3WDPP

Structural analysis of a beta-glucosidase mutant derived from a hyperthermophilic tetrameric structure
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
472
structure length
472
Chain Sequence
AKFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDAAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLASGFPPGFLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVFREIATQKEIPEELAHLADLKFVTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of beta-glucosidase mutants derived from a hyperthermophilic tetrameric structure
doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Beta-glucosidase
total genus 189
structure length 472
sequence length 472
chains with identical sequence Q, R, S
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wdpP00
3ZT6A 3AXIA 4AZ6A 2XM1A 1V6VA 1ZB5A 2GJPA 4HP5A 1HKJA 1UKPA 1HKIA 1W1TA 2J7DA 1EDQA 2G41A 3B8SA 1VRXA 3WDHA 1WZLA 1KCLA 3UG4A 3FN9A 3MO4A 3AROA 3L2LA 3SUTA 2BS9A 4X9YA 1B3ZA 2TAAA 4CCCA 1AMYA 1OGSA 4A3YA 2VRJA 2YA2A 4FLSA 1W9BM 4J3WA 3RCNA 1BYAA 3MKKA 3RM8A 4JIEA 1H1NA 5I77A 4W86A 5JIPA 1E6QM 1C8XA 2VT0A 1KQZA 2X0HA 5ABEA 4D1IA 3A6OA 4AZCB 4PMQA 1HJVA 1OCQA 1JXJA 2WANA 1H2JA 5A69A 1C8YA 3PHAA 4GXPA 5M3WA 4MADA 5GNYA 4UTFA 1LQ0A 2VCAA 3SCWA 2NT1A 2HISA 3EDEA 4U3AA 3AIQA 2XYLA 1W1YA 2NT0A 2XFRA 1QHOA 5EMYA 3RMEA 1H11A 1ZBWA 4Z2JA 1AQHA 1UKOA 1HJQA 2BVDA 3TP4A 1VFFA 1LL4A 3VGEA 2ZUWA 3O6AA 2CKSA 3W24A 3GNRA 2A3AA 3T2PA 3CIVA 1UUQA 1W91A 1M03A 1K9DA 3WENA 3SCVA 1J0HA 3EBVA 5BROA 3AJ7A 4B3LA 3W29A 4MDPA 3ZJ8A 2EPLX 1DWIM 2XTKA 3VIPA 1CXHA 1J12A 5GQBA 1R86A 3VM7A 1XYZA 4UZUA 1XD1A 5AYIA 4W7UA 4EANA 1FA2A 1HP5A 2CBUA 1DEDA 3AS0A 4HA4A 3POHA 3OLIA 3AXXA 7TAAA 6CGTA 4HPGA 3W4RA 4KH2A 2BHYA 4V27A 2XG9A 5CPQA 1CXIA 3U5YA 3PZQA 3BXWA 2ZX8A 5AC4A 2EQDA 3PN8A 5FL1A 2VZVA 8A3HA 4H2CA 3THDA 3BAJA 2ZXBA 4MAVA 2VC9A 5TD4A 1CNVA 2EPNA 3AIRA 1TVNA 3JUGA 4GO8A 1QHPA 1XSKA 2ZIDA 4D71A 3ARWA 1TG7A 3WSUA 4FMVA 1E70M 3OZPA 1CGUA 1H41A 2BVYA 4JCLA 2JIWA 3HJEA 5BYWA 1TA3B 2ZXDA 1HKKA 2DGAA 4U5IA 1DWJM 3AIBA 4W88A 5A6MA 4AIOA 3GBEA 1PJ9A 3VO0A 3U57A 1ITCA 4PUEA 3MMWA 3NYDA 3N18A 4ATLA 2CHNA 4C7DA 1GOOA 3NDZA 3OBAA 3WD3A 4XUYA 1GNXA 2Y8KA 4TXEA 1ITXA 1H49A 5CSUA 3SEPA 1U33A 4CKQA 4J7RA 1E56A 3AS2A 4CD6A 3MU7A 1E71M 2CITA 3L4YA 3VD5A 1GJWA 4E4PA 5HNNA 4HTYA 8CGTA 1XV8A 2PWEA 3WDRA 1S46A 2WBGA 1U30A 2FHCA 2X0YA 2XHYA 5HPOA 1BGAA 4U3CA 3RM9A 5IFTA 4UFLA 5A8QA 3GM8A 3VINA 1WKYA 2ZUMA 2PWGA 3ARRA 2JALA 1Z32X 2DT2A 3CHCA 1GW1A 2DIJA 3MUY1 1PIFA 3ARQA 5FKYA 5A6SA 4UFHA 2BVTA 4AYSA 4L4OA 1XYFA 5BXRA 3SCOA 3VDCA 4QLJA 3SCSA 4XB3A 4UQDA 3ZSSA 2D24A 1Q6CA 4B16A 4HZ6A 2ESCA 3N11A 2WHKA 3ARXA 2PB1A 5DEZA 3SCPA 3VMPA 1OM0A 1OWQA 4J3VA 4KGJA 3GTNA 3EDKA 3K8MA 5A6KA 1JYXA 2VX5A 1NQ6A 4A3HA 4PUDA 3GXIA 3U7VA 3TTSA 1WDQA 2ZE0A 3CHDA 2VUYA 4R5EA 4PSPA 2ZUSA 1SMDA 2UWFA 3EMCA 4JHOA 4N0RA 1CPUA 4W93A 4D6CA 5BXSA 1W9VA 4U31A 1R7OA 3ZR6A 2J47A 1WNOA 2B31A 5CQ1A 1KCKA 2JE8A 1RP8A 1EQPA 3W6LA 3KL3A 4UOQA 4P7QA 1UHVA 2DSKA 2E0PA 4M82A 3W82A 1EO7A 5I23A 2WPGA 2XVKA 1C7TA 3GZAA 1UD4A 2YL8A 4B9YA 1HJXA 5CJ5A 1CXLA 2O9OA 4JFUA 3VIGA 4W87A 2J79A 2WMKA 2DSVA 3DECA 4JFWA 1VBRA 1E73M 2QPSA 1KGWA 4UFIA 1ZL1A 2YBUA 1VFMA 1JYNA 2FDMA 2FHBA 4F9DA 3VMOA 3O2LA 1NM9A 1V0MA 1GOMA 4HZ7A 3A4AA 3T2OA 3I3BA 2GJXA 3WUBA 3GH5A 3WNPA 4Q7NA 4AD4A 2VCCA 1JD9A 2XVPA 4OZOA 5E6ZA 4CN4A 5JBEA 4JAWA 5ABFB 3G6LA 2JIEA 5BXTA 1CXEA 4Z2IA 4AZGA 3VKKA 1UOKA 2V3FA 3AHTA 4P8VA 2GDVA 3RDKA 1IV8A 1NH6A 1E3XA 4ACZA 5A6AA 4KGLA 2YL6A 4PMVA 2DDXA 3AI0A 4P7LA 4AZ7A 1AQ0A 1QBAA 4LQ1A 1JFHA 1E6RA 3RPMA 4WF7A 4XV0A 5CLTA 1US2A 2PBOA 3SCNA 1D2KA 3HN3A 1QW8A 4QAWA 1F4AA 2DSWA 5FIPA 2IXUA 1C8QA 1PX4A 1J10A 4ZE4A 4PMRA 9CGTA 1V6UA 4B15A 3W25A 1WAWA 2J7FA 2X2YA 1TMQA 2O9TA 3CLWA 1PBGA 4CCEA 3DYOA 1EOMA 3PZVA 1MW2A 4PCTA 3PZ9A 3UG5A 1UWRA 1JAKA 4J3SA 3GBDA 3BCFA 4AZCA 1UD8A 2V3GA 5EFFA 2WVVA 2YOCA 3RM4A 5JBFA 2V3DA 3VD3A 1J9YA 1VJZA 2ZICA 1ZS2A 1KFWA 4CD7A 4PCSA 3OB8A 1J18A 4OBSA 3FNDA 5IHSA 3ZMRA 4GQRA 4GI9A 1B3WA 1K9TA 2GJXB 4L4PA 4PTMA 3PTKA 3WFZA 2V5DA 3MV01 1MQQA 1L0PA 1QNOA 1WZKA 3QOMA 5CLWA 1WO2A 3FAXA 4HPHA 1KWGA 2ZWYA 3KE0A 1E5NA 1UH4A 4GZJA 2GVYA 5D8WA 4W5UA 3BMWA 3AHYA 2ZX7A 3UCQA 4NZCA 3BAWA 1E3ZA 4D6IA 3WEOA 2CYGA 2J7GA 3ARZA 2DQXA 4HOXA 3WMSA 3ZJ6A 1G0CA 2W5FA 1WPCA 1V0LA 2E3ZA 2GUYA 4NF7A 4DUWA 3UR8A 4IUGA 1OINA 4W8BA 3AIWA 1V0NA 1UR2A 1JZ5A 2WMHA 3CBWA 4WKFA 5A2BA 3CGTA 5D9PA 2VR4A 2D3LA 1W3JA 1G5AA 1BPLB 1BG9A 2X1IA 3KL0A 3NDYA 4AWEA 4YHEA 1ESWA 2XWEA 1EDGA 2WVSA 3KL5A 4EAMA 1R8LA 3VD7A 4UZSA 4WLCA 3UG3A 2WLZA 5D4YA 3OA5A 2AMGA 2W62A 2WHJA 1GOKA 4PMYA 3ARYA 5DF0A 3W0KA 1FHLA 3GH7A 4DWSD 4CD5A 5BXPA 1VFUA 2F8QA 3ARUA 2UY5A 4XZBA 3K8KA 4GKLA 4AD2A 2VCBA 2BHUA 3S6TA 3RILA 2J62A 2CBIA 2PI6A 1UQZA 1J01A 1UG6A 1DTUA 1KXVA 4LYQA 1KXQA 1NOWA 1EH9A 3TA9A 3VMNA 3AHZA 1MQPA 4UQCA 1N82A 5E70A 2VTFA 1V3IA 1UWIA 5A6BD 4HMEA 4LPCA 2XVGA 3T08A 4D6GA 3VIIA 2XIIA 3F5KA 3GNPA 1E40A 2WZHA 4D6FA 4CVWA 3ARSA 1M53A 1JL8A 5HXMA 1GZJA 3CUIA 4QFUA 4CCDA 3DYMA 4MNLA 3MV11 3M46A 1EOKA 1MFVA 2VX4A 4UCFA 1V08A 4ZXOA 2O9PA 4CUCA 1ECEA 2CNCA 3SIMA 3UEQA 3L4VA 5AY7A 2D0FA 2W4XA 3CH9A 2WYSA 4YN5A 1VEMA 4GI8A 4NRSA 1E0WA 1WDRA 4DWSB 4H8UA 4J27A 2VX6A 3TTOA 4QCFA 1V3KA 1VB9A 4HU8A 1LL6A 3TTYA 1Y7VA 1E6ZA 1OB0A 1J0YA 2ZUNA 2EBNA 3WH8A 5A2CA 1OGBA 4JL1A 4PTXA 2FGLA 3WQ5A 3WEMA 3SUSA 1LLOA 1KGXA 2G8ZA 3GXDA 1WDPA 1MW3A 2OWXA 4AXNA 3IK2A 1HJUA 3MMUA 2WMIA 1ZBKA 4RE3A 1GPFA 1QBBA 2UY4A 5IDIA 2ZXQA 5BWFA 2HVMA 1C90A 2BY0A 3U5UA 2VOTA 4URIA 4FLQA 2RGMA 1VIWA 4UFJA 2XGBA 1BSIA 2J78A 3IAQA 2WKGA 3SUUA 1I1XA 2UY3A 2OSWA 3BSGA 2QMJA 5CPTA 4DWSA 2EPMX 2WK2A 3UERA 3WQVA 3WUEA 3K4DA 4BCEA 2XM2A 4ATWA 1JYWA 1J0IA 2BHZA 5D9MA 4W7WA 1CIUA 3BAYA 2WC4A 4FK9A 1GVYA 5A8MA 1WE5A 2A3EA 1R87A 3AZTA 1Q6EA 4JKLA 5HBFA 2NSXA 3OGSA 1UWQA 2CXGA 1MQRA 1J0JA 2J7HA 2BFGA 3GDBA 4WKAA 3SCRA 1RPKA 1JI1A 4J3TA 1IT0A 4Y7EA 1WB0A 3GH4A 3W81A 3M07A 5E09A 1E4NA 4UQEA 1W9XA 2BY2A 1DHKA 1TE1A 5GPRA 1E43A 4RE2A 2X05A 4CGTA 3CMGA 3CUFA 2YDRA 4PBGA 1BQCA 1ZBCA 4MB5A 5M17A 4M8UA 2YA0A 3APGA 5LA1A 1QPKA 2EJ1A 3AMGA 1ZBVA 4IPLA 3ZO9A 1HT6A 2WCSA 2W92A 1JI2A 3WD1A 2OYKA 1VFOA 1KXTA 2ZWZA 3FHAA 1G01A 2WW5A 1UZ1A 3W26A 4AISA 2DSZA 2VVNA 3RIKA 1B3VA 1L8NA 2OWWA 2J4GA 3WL1A 1JYVA 1EA9C 1NOUA 1UA3A 3PZTA 5A8OA 3QHMA 5JUVA 4IPNB 1OT1A 1WZMA 4ML4A 6A3HA 3CUHA 4PSRA 4M81A 1UH3A 3GXFA 3LPGA 2NW0A 1OIMA 2J7EA 1JZ6A 3BCDA 2XFYA 3NUKA 3WNLA 3BMVA 3F5LA 2QF8A 1W1PA 1GQLA 3II1A 4WK9A 4QLKA 2PWDA 1F4HA 2W91A 3AIEA 2C0HA 2XSBA 3IJ8A 4MTVA 4DWSC 2OSYA 4WSKA 4ACZB 4LX4A 3WUGA 4U2ZA 4OOZA 2E9MA 3IAPA 5DMYA 4B9ZA 3CUJA 5M03A 3OG2A 1C93A 1V3MA 3OLDA 3AIVA 3AHXA 7CGTA 4W89A 5A8PA 4GQQA 3AISA 2UY2A 5AYBA 5ABFA 3WQ8A 5A94A 1CLVA 3ARVA 1Q6DA 3PBGA 3WDIA 1HL8A 3CMJA 4PMXA 1K9EA 4MNJA 2OYMA 3N13A 3CPUA 3WDPP 1U2YA 5C8BB 1EXPA 1JDDA 4M56A 1E0XA 3VX1A 2VQTA 2DT1A 4DUVA 4AZIA 3VD4A 2PWHA 3W27A 3FHQA 3N15A 1DWGM 5I3DA 1LWHA 2BNJA 5HDRA 1K9FA 1V6XA 1FFQA 5I2UA 4MJ2A 4FF5A 4AC1X 1PX3A 3CZLA 1TR1A 2G3NA 2VMFA 1V02A 3IANA 1O7AA 3ZR5A 4GZIA 1VBUA 1H0IA 4DM1A 3ZQ9A 1KQYA 4IISA 1MWOA 1ODUA 1M01A 3MANA 5IHRA 3BAXA 1XRVA 2D3NA 4LYPA 2VJXA 3J7HA 3WF4A 5A2AA 1JZ7A 1B90A 1TVPA 3A4XA 4LGXA 1E6XM 1BAGA 1CGTA 4PN2A 2Z1KA 1EHNA 2FH6A 3M7SA 1VAHA 2CERA 1UD2A 3VGBA 3QHOA 1DWHM 4PYSA 5AC5A 3ALGA 1H4PA 1Q6GA 4W8AA 1GCYA 1V6YA 1HX0A 3B9AA 4YPJA 1PPIA 3SUVA 1VEPA 3VM5A 1X6NA 4QCEA 4JFTA 2YLAA 3T0DA 1KR0A 3L2MA 4XX6A 1B1YA 1B30A 3WQ6A 1O6IA 3PZMA 3IJ9A 4AD1A 1UZ4A 4DM2A 4M29A 1KBBA 3PZUA 1B3XA 3MSGA 5CPSA 5KZ6A 5A3HA 1E72M 5CZKA 4P8XA 4QP0A 5LA2A 1UKTA 2Y5EA 1LWJA 2YKKA 2J75A 3ARTA 4JL2A 3EDJA 2E4TA 3AMCA 1TA3A 3OGRA 1C91A 1UR9A 1ODZA 5HOSA 1OT2A 3VGFA 3WF3A 2J7BA 1CGVA 4BQ5A 4AW7A 2O9RA 1CGXA 1JNDA 2J25A 1C92A 1VENA 4M80A 1E0VA 5D8ZA 5D9OA 1US3A 2WWDA 1DWFM 3WH7A 5M5DA 1MXGA 1UR4A 3T09A 2CPUA 2WMFA 5JIWA 4Z2HA 4EKJA 1JG9A 2YJQA 4PRWA 3WFLA 3VIHA 1P6WA 1E5JA 2DPEA 1ISXA 1CWYA 2JFEX 5KEZA 1CECA 4RL3A 1E6PA 2WC7A 3FY1A 4F79A 3W6MA 4PMZA 2D1ZA 1V3JA 3FW6A 5CG0A 2VVSA 4KRTA 3SCUA 3N12A 2WHMA 3PZOA 1JZ4A 4D1JA 3W28A 4OUEA 2VZUA 1GJUA 4PTVA 1KWKA 3WL0A 3WEZA 3VU2A 1YHTA 1JZ3A 3SURA 4U5KA 4MB4A 3K46A 1GQIA 2CBJA 2X8RA 2CHOA 3G6MA 2XIBA 1GHRA 5FOOA 1CXKA 2VX7A 4TX8A 1QHZA 5FD0A 3PZNA 1CZ1A 1W9UA 2CBVA 3WH9A 1NP0A 3DHPA 3WKZA 3VIKA 3D3AA 1W9DM 4HOZA 4BQ4A 1V03A 2VO5A 1R85A 1GQKA 1UKQA 3RO8A 3POCA 4AY1A 1DWAM 2PF0A 3MMDA 4X0NA 2BY3A 1BVNP 2CCRA 1V6WA 1BFNA 3VGHA 3W38A 3ARPA 4DUXA 3WDJA 3CZJA 4HOWA 3NSNA 2DT0A 2G3MA 4EK7A 3DC0A 1LF1A 2A3CA 1QI4A 1UQYA 1EQCA 2ZOXA 3F4VA 1J0KA 3MS8A 3WIJA 1MXDA 7A3HA 1H09A 4M24A 3VOCA 4ATDA 3AS3A 3WNKA 2E40A 2XJ7A 1PEZA 1J0ZA 4MB3A 4CVUA 4TOQA 5BCAA 1CTNA 2E8YA 3CHFA 1UA7A 4RE4A 1G94A 2ZXAA 4A4AA 4P8WA 1OD0A 3NSXA 4WIWA 2EPKX 1JDCA 4HA1A 5IXEA 1PZ3A 5DO8A 4AZBA 3VGGA 2VRQA 1MYRA 1BG4A 4C7FA 3B9EA 2WLYA 1A3HA 3WQWA 1SYTA 1CBGA 3QR3A 1FH8A 2DH3A 4Z2KA 4F9JA 3GXMA 4J28A 3RJXA 3ZM8A 4JHZA 4AEEA 1R7AA 4D6HA 2YIHA 3EYPA 4W5ZA 4OKDA 2WMGA 2DH2A 2WMIB 1W1VA 2DSUA 4HU0A 4WJXA 3KZSA 1MVYA 3ZSTA 2ZX5A 3BLPX 1M7XA 2V5CA 1IZKA 4FLOA 3DYPA 3D5HA 1UR1A 1E1EA 1HF6A 4R27A 1NARA 1GONA 4E8CA 3AMLA 2PWFA 4BS0A 4GPNA 1PAMA 1C3FA 1E1FA 1AVAA 1IZJA 4W7VA 1QNSA 1FP9A 5BRQA 3AQUA 2Y24A 3SCTA 1UWTA 3N1AA 3CHEA 3CO4A 3CZEA 4J3XA 4WKHA 1EIBA 2AAAA 5A95A 2EEXA 3A3HA 1GORA 1CGWA 2EO7A 2BXZA 3UESA 2CKRA 5I5RA 1MW0A 2YBTA 2VR5A 1E4LA 3EDFA 1H5VA 2XPKA 2XVLA 4PMOA 4TTUA 3AMDA 3BAIA 3TTQA 3L4UA 5FL0A 3A4WA 3I3DA 1UD3A 2D20A 5A6LA 3SCQA 2OWCA 1JD7A 2VI0A 4IM4A 4X0VA 4TVDA 1B3YA 3OLGA 4U2YA 3VIOA 1V3HA 1UWUA 4D6EA 1H3GA 4UNIA 1TUXA 5ABGA 2VQUA 4UOZA 3VDHA 2WSPA 3K1DA 1UR8A 2ZUVA 5DT5A 4CN1A 3AYSA 3GYCA 1V0KA 1QI0A 4BF7A 1AQMA 4UFMA 5CSYA 1LJYA 2WBKA 4JFVA 2RGLA 2BV9A 3WNNA 1G1YA 2FHFA 4F66A 1B9ZA 3VNZA 2D0HA 4GO9A 1I75A 1CLXA 2W67A 1OGGA 1BYBA 3SUWA 3K4AA 2D23A 3TONA 1UR0A 4D6JA 2DEPA 1CXFA 1W9PA 1Q6FA 2FH8A 3LMYA 3WF2A 4S3KA 1OSEA 4OBRA 1W32A 4KRUA 2WCGA 4AEFA 2CIPA 5C71A 1FOBA 5DFAA 1W2PA 2QPUA 3AFBA 2WC3A 2BY1A 5I78A 4GZEA 3AOFA 2ZX9A 3MUIA 1LG1A 3QHNA 1WP6A 2XSAA 3FAWA 2VZTA 2WWCA 1QNRA 3KWXA 4NRRA 5EBAA 1WZAA 5A6BA 3N17A 3WMBA 3NSMA 4BZYA 5C70A 4D72A 3KEHA 3IJ7A 1FP8A 2OSXA 1JIBA 4H8VA 5I6SA 1UWSA 2PBGA 1WDSA 2Q8XA 4E2OA 3OGVA 1BGGA 1W3HA 4MJ4A 3O9NA 1HKMA 1V02E 5D9NA 4UQAA 3WNMA 4PMNA 2JEPA 3OLEA 4QLLA 4OOUA 3ZJKA 4CD8A 1RD6A 2DT3A 1HNYA 4CN6A 1JFXA 1GOIA 1KR1A 1B0IA 2OYLA 4NSBA 4AZ5A 4ZFMA 3WD4A 3AMKA 3T0BA 3VIMA 1JXKA 1M04A 3AZRA 4TTGA 2YA1A 3W53A 1E4IA 2JEQA 3MUAA 3W37A 2D2OA 2WSKA 1YQ2A 3L4XA 3L4TA 3GNOA 4F8XA 3MUZ1 3EMZA 1UD5A 1JF6A 1HJWA 1ISVA 2DIEA 3WBEA 3OIHA 2WAGA 4B3KA 2JF7A 5CXPA 1QOXA 3AS1A 3ECQA 4HA3A 4AMCA 1GUVA 4S3JA 4EE9A 2V3EA 1JDAA 4JKKA 1B31A 1JGIA 1BLIA 1CEOA 2J8GA 2ZUUA 3CZ8A 3AZSA 2E9BA 4CU6A 2YL5A 2G3JA 2W61A 2V38A 1I1WA 3BAKA 4H7VA 4HMCA 3HMCA 4M1RA 1TCMA 1OD8A 2QMKA 5I0DA 4C7GA 4W85A 2VURA 1HVQA 3TOPA 4PEEA 2D22A 3VDBA 4GIAA 4Z2LA 2EXOA 2J7CA 1KGUA 3AICA 1GOQA 2BXYA 3NIYA 2WMJA 2WVVB 5CGTA 1GHSA 2IUZA 3MSDA 1QW9A 3U7BA 1JF5A 2WCAA 4MAZA 2GJRA 4CU8A 5DT7A 2J8FA 4BQ3A 4LYRA 1J11A 1XC6A 3VVGA 4AD0A 4ZEPA 2E8ZA 2YLLA 4CD4A 4AD5A 5E6YA 1UYQA 2VRKA 1OBAA 3UETA 3VPLA 3BGAA 1Q4NX 3VUPA 3VIFA 2XWDA 5F7UA 3NJ3A 1SMAA 2YDQA 3VNYA 2ZX6A 4FLRA 2Y8VA 1MFUA 1QNPA 1VF8A 3S2CA 4LXFA 4TX6A 1CGYA 3WH6A 3K8LA 3QGVA 2F61A 1E6SM 5BRPA 1WCGA 4MNMA 4OJYA 2OLHA 5LYRA 1W3LA 2CETA 3VIJA 1XH0A 1UD6A 2WKLA 2WXDM 1QNQA 3VGDA 5JBDA 3VD9A 4NI3A 1CDGA 4JFSA 3WDQA 3PTQA 5EFDA 3WY1A 1E55A 1HXJA 4YHGA 3FXYA 5GNZA 1E6NA 2QLYA 2VNCA 3WF1A 2Y4SA 5A1AA 5CGMA 2W63A 2XFFA 4P7NA 1XD0A 2J77A 1SFSA 4GI6A 4OIFA 1XHGA 3ZT5A 3CUGA 1RP9A 3CZGA 4GINA 3LPOA 2YDSA 5ECUA 1H0GA 1BTCA 5IFPA 1NWSA 1BF2A 2IXVA 5E9AA 3ZIZA 1D3CA 5A8NA 3M6DA 2AOSA 4ACYA 4MPKA 1HVXA 1HL9A 4H41A 4ZXLA 2VZOA 1W3KA 1EDTA 4UQBA 2J74A 1KXHA 2GFTA 4MB1A 1GVIA 4KWUA 5E0FA 2MANA 1FH9A 1MW1A 3T2QA 1BYDA 1LG2A 1X6LA 5LA0A 2W66A 2WHLA 1NP2A 1B2YA 1PX8A 4AIUA 1BHGA 1JZ2A 2Z1SA 3DHUA 5FCZA 2PC8A 3WD0A 4J3UA 1QI2A 4H04A 4PMUA 2X09A 4W84A 2WM0A 3ZT7A 3I3EA 1QVBA 4Q22A 2G4FA 3L4WA 4HZ8A 4H8HA 1KB3A 4ZENA 1KBKA 1NWRA 4N42A 1RH9A 4P8UA 4MNKA 1V3LA 1GOWA 1PZ2A 1LL7A 2WB5A 4PTWA 2GK1A 1HIZA 5ABHA 4U33A 1TFVA 2C8NA 2A3HA 4JZ5A 1W2VA 3VX0A 1X1NA 3AYRA 3VILA 2E9LA 4E8DA 3BH4A 1A47A 3HU7A 2GSJA 5E0CA 4W8LA 3WNOA 1NWUA 1UH2A 1ZU8A 2XVNA 4HMDA 4QDMA 1ISYA 2FGZA 5HPCA 4D6DA 1E4MM 1JNEA 1PIGA 3N04A 3THCA 1JAEA 2JF6A 3WUFA 1NOFA 1XGZA 2WVTA 3UR7A 1DP0A 4UQ9A 4UFKA 2CESA 3RJYA 1TZ7A 1HN1A 1CENA 4PMDA 1FH7A 4TVUA 3VTRA 5I79A 1D7FA 3WN6A 2Y2WA 3WF0A 1XH1A 2VL4A 3CTTA 1E9LA 2CEQA 2G3IA 4TUFA 4V2XA 5GNXA 3AIUA 3ZOAA 1XCWA 4K68A 4MDOA 1EGZA 1CYGA 1ZJBA 1OIFA 3AHVA 1UKSA 5I24A 4AZHA 3EDDA 2A3BA 2WZEA 4P7OA 1XSJA 1EHAA 1ZJAA 4UOJA 4V28A 1EO5A 3WD2A 1JZ8A 1G9HA 3WELA 1BYCA 2ZUTA 1BVZA 3VDAA 1HP4A 3ALFA 3T0AA 1QI3A 1K6AA 1NWTA 2WNWA 1ISZA 3E1F1 4P7RA 2WVUA 1FHDA 1VEOA 2EPOA 3B9DA 1E15A 5EB8A 4UR9A 3NCOA 4WSJA 3EMQA 3L4ZA 4ZE5A 3WMCA 1ISWA 3ZJ7A 4BQ2A 2WZIA 2D0GA 1XH2A 1FFRA 1QI5A 2XUCA 4AD3A 3PZGA 4AIEA 3QOKA 4TVCA 1SR0A 2F2HA 2XGIA 2O92A 4XZWA 2QHAA 2GDUA 3N9KA 1VJSA 5A6JA 3WBAA 1XSIA 3LPFA 2C7FA 3AXHA 2GK1B 3PZIA 3WQ4A 4CU7A 1XCXA 3A47A 6TAAA 3F5JA 2VZSA 3CZKA 4Z2GA 4KMQA 4JKMA 2QV4A 4JCMA 1C7SA 1HJSA 4BA0A 3WH5A 2YL9A 3BSHA 3BC9A 3LPPA 3PTMA 1GQJA 3BLKA 3OZOA
chains in the Genus database with same CATH superfamily
4JYEA 3ZT6A 1YTDA 3I7SA 3AXIA 1GK8A 1ZB5A 2GJPA 1UKPA 4EIVA 2J7DA 1SUXA 3PUEA 1LCOA 2HCVA 4HU4A 3L2LA 2C19A 3RR4A 3NZQA 4POCA 5CJMA 1I8JA 2QDHA 2SFPA 3MW7A 1YEYA 2VRJA 2YA2A 1S1PA 3RCNA 2NVCA 4LAKA 4UTMA 1BYAA 1YNYA 3F4WA 3MQTA 4HIBA 3RM8A 4JIEA 1H1NA 4A29A 4W86A 2X0HA 1E9ZB 3T42A 3BJSA 5ABEA 3K30A 1TRIA 2IPWA 3AU2A 4XBJA 2TYSA 1OCQA 1SW0A 2AQVA 3PHAA 4IL2A 7REQB 2PE4A 5KITA 1IEVA 4AEOA 3P14A 1LQ0A 3ATYA 4MF4A 3NPVA 3LMZA 3AIQA 1W1YA 5EMYA 1DIDA 1UKOA 2JK2A 4QROA 2BVDA 1HKVA 3LBOA 1M7OA 4X9SA 5DCBA 1B4KA 1OZQA 2Q3OA 1ZNNA 3FEMA 3CIVA 1M03A 3QKEA 3SCVA 3EBVA 3TSMA 2GWNA 3LTPA 3W1AA 3VIPA 1CXHA 1KM0A 3VM7A 1ADSA 4IGHA 4UZUA 1GKRA 4EANA 1DEDA 3AS0A 3W83A 3LXBA 2PA6A 4ROQA 3POHA 3LX9A 4GC3A 6ALDA 3S1VA 7TAAA 3AXXA 3HPFA 4IJRA 4X3ZA 2A21A 3L68A 1S5MA 3W4RA 1OVDA 4V27A 4DY1A 3VOJA 1OCJA 2ZX8A 1OEPA 4DJDC 2EQDA 5DX7A 1UOZA 3LYEA 3BAJA 4ILSA 1MNSA 3KS5A 2VGBA 3DN5A 3MB9A 4K1WA 4B5VA 3RPTA 1SJBA 1WAUA 2YSWA 2AKMA 1QHPA 3TR2A 4B5TA 4QE4A 3WSUA 4WGHA 5DMMA 4DPPA 3OZPA 1AJZA 1S5VA 2GDQA 3QGAC 3CB3A 2CZEA 1F05A 2JIWA 2OVLA 3NPXA 1OK6A 1LRQA 1A5BA 5AFDA 3AIBA 4X22A 4B5NA 3VO0A 3EAUA 1YXYA 3VZYA 3N18A 2PP1A 1W37A 2G37A 3GX9A 3WD3A 2AGKA 1FWFC 1GNXA 4LJ3A 1F3TA 1US0A 3JZEA 1E71M 1GJWA 3FA3A 5HNNA 4C1LA 2WBGA 3SSZA 2FHCA 2P8BA 3E0LA 2X0YA 3H53A 4CEXC 3FJNA 4PC8A 1R3RA 5CPNA 1VYRA 2PGWA 3UJRA 3EXSA 1RLDA 3W2UA 2JALA 1Z32X 3CHCA 3BWWA 3CMFA 1WYIA 3MUY1 1Q85A 3W1XA 4AYSA 5LIKX 4QLJA 1IR2A 1U1HA 3DG7A 3GWQA 4M7SA 1XYCA 2QCCA 2PB1A 3VMPA 3GFZA 3GTNA 1JYXA 1XQKA 1H62A 4Q32A 4PUDA 4UTHA 3U7VA 4GVIA 1NTHA 4JS3A 3CEPA 3C0SA 1SMDA 4JHOA 5BXSA 4MKVA 1R7OA 2UV8G 3ZR6A 3UWZA 2PZ0A 3KL3A 1YXCA 2DSKA 4M82A 3W2JA 3W82A 5KINA 1OG6A 4IQLA 1EXBA 5XIAA 2VFHA 2HE8A 4TMBA 5CJ5A 1OQFA 1CXLA 3KRBA 4HGXA 4L6HA 2J79A 3E3HA 3TDFA 1S1RA 2DSVA 1PKMA 1XG4A 1E73M 3G1YA 2QPSA 2E1WA 3TZFA 4LVFA 2YBUA 3N4FA 3SGGA 5K4ZA 3TW7A 4GYJA 1TJPA 1NM9A 4IG2B 4HZ7A 2QNEA 1WKDA 4P5UA 4KESA 4Q7NA 1JD9A 4OZOA 2VFGA 5JBEA 5BMXA 4JAWA 4HNOA 2ZDSA 1H51A 3OHMB 1HO4A 3A4JA 4E3VA 3SFWA 2C3ZA 4Z0JA 3R8GA 2GQ8A 3A3XA 1D7KA 1U22A 1SFTA 4KWSA 3KOZA 4KGLA 4DO4A 2YL6A 1F3WA 1XWYA 4P7LA 4YXGA 1M7JA 4AZ7A 4B5SA 3W7GA 1E6RA 3F2BA 2VM8A 1Q6QA 3OOQA 4PBFA 3PAJA 4XWUA 1J8VA 5LGXA 2OKOA 5FIPA 3KBMA 4HJWA 1Y8BA 5DY3A 4WSHA 1KCXA 5D37A 3W74A 5GJPA 9CGTA 5AHMA 4B15A 4IGMA 5KSWA 2O9TA 3NZRA 1PBGA 2GVLA 1MXSA 3TW6A 4CCEA 3HG5A 4QJ5B 3QPZA 1TO3A 3N14A 3BK0A 3JZUA 1RPXA 3E2VA 4K36A 4C6PA 1KM2A 1FY6A 3URAA 1UWRA 4GMEA 2KX9A 1OF6A 4CNNA 5EA9A 1EUNA 4NT0A 3MPGA 3S8HA 1UD8A 3M0JA 1F73A 1PL9A 2WVVA 5JBFA 5M2FX 3R2GA 1ZS2A 1KFWA 4CD7A 1J18A 4H01A 1RBLA 3ZMRA 4AX6A 4GQ0A 1B3WA 1D8CA 5DMNA 4F0MA 4PTMA 2HNEA 1MQQA 3QOMA 3C3UA 4Q4OA 1UH4A 5G2WA 3U2ZA 3GNNA 5D8WA 4M5PA 2ZX7A 3AUOA 1ZP3A 3BAWA 1E3ZA 1W5NA 4LVBA 2J7GA 4Y2WA 3A64A 3MSYA 1G0CA 4JQ3A 1TJ2A 2V5LA 1V0LA 4MM1A 2E3ZA 4NAFA 3W7PA 2HV5A 1SJAA 2QUNA 3UR8A 4DUWA 1XIMA 1OINA 3CPGA 1CLKA 3CASA 3CGTA 5D9PA 5DMLA 3R0UA 3KCJA 1FWAC 4L9ZA 5F2MA 1EDGA 2FMNA 3G1RA 4G1KA 3VD7A 1IIGA 2CLMA 3QM3A 1A5CA 2NX1A 4WY0B 1H1YA 3OA5A 2HXUA 3U48A 1PSCA 1A50A 4B90A 2FVLA 4BF5A 3NQ2A 1FHLA 3GH7A 3DUGA 3TN4A 4DWSD 2YPIA 5BXPA 3LV6A 4HCDA 3V5FA 2B7NA 1O94A 2GOKA 4R85A 1ML1A 2HRWA 1TWDA 2X1SA 2VCBA 5FJIA 1SQ7A 3CUZA 1Y5XA 2CBIA 3S1WA 4XZHA 1FKXA 2CLLA 1PZ1A 5T8GA 1KBIA 1UG6A 5KTLA 1GQNA 3FV9A 1NOWA 1P1MA 2ZC1A 4C6BA 1OY0A 1ZP4A 1MQPA 2GGEA 5EMUA 3UXIA 4Q6JA 1WDDA 4HMEA 4QG6A 4GGHA 4D6GA 2XIIA 3GNPA 1E40A 3S0CA 4NU7A 5G4WA 2EJAA 4NYYA 5EMKA 2H8XA 3O6CA 5C0QA 1GZJA 5HXMA 4O1EA 1EWEA 3LCXA 4QFUA 4CCDA 5B80A 4R9OA 4JTIA 3GW3A 5EMJA 1EJXC 3ANYA 3MYPA 2ABBA 2HEJA 3UBPC 1O12A 3H2FA 2O9PA 3FYYA 4CUCA 5MHBA 1EF3A 2CNCA 2DZSA 4DZ5A 1LBFA 4Z08A 3LXCA 3UEQA 4ADUA 1U5HA 1QT1A 1TPC1 1RXOB 1K03A 1VEMA 4NRSA 1E0WA 1XINA 3GU1A 2X16A 3ME3A 1H61A 3SB0A 3JR2A 3P0WA 3O6DA 1V3KA 1VB9A 2V2CA 2XN1A 2WJZA 3SRKA 1OB0A 1AA1B 3ATZA 3JU2A 4FOJA 3IIPA 2PD9A 3WQGA 1V5XA 1OGBA 3BJFA 4PTXA 1GOXA 1LLOA 1KGXA 4ZTXA 2VEFA 1W54A 3H2AA 3HGJA 5MF5A 2OWXA 2PC4A 3MMUA 4RE3A 4H00A 1QBBA 2G50A 3UU0A 1UROA 2IQ0A 3EA2A 2R6OA 1EJ7L 5H2ZA 2XGZA 3ZWTA 4M6VA 4K8EA 1R0MA 1SSGA 3IAQA 2NXGA 3W7IA 5G1TA 4G2DA 3TMLA 4XQ6A 1F6YA 4YL2A 2ISFA 1ZFJA 3WUEA 2ACUA 3LEPA 4FIRA 1J0IA 1CIUA 2QCLA 1O5XA 2W27A 2WC4A 1HGYA 2A3EA 5BMWA 3IV3A 4NX5A 5HBFA 2CXGA 1OYCA 1XBXA 1MQRA 4WRHA 3QH2A 1I45A 1WB0A 3A9BA 5KZDA 1I0BA 3SGZA 4GGBA 1DHKA 3BLDA 4MUPA 4RE2A 4ZB0A 4CGTA 3CMGA 4LAOA 1I4NA 2YDRA 4PBGA 3DU0A 3DFOA 3SIZA 1IXNA 4PTDA 3M4HA 3MDUA 4X61A 5AC6A 4NZ4A 1T99A 3TUUA 3ZO9A 5FEWA 3DIPA 5K2ZA 1IE7C 4AHPA 2Y70A 3V36A 2ZWZA 1G01A 2WW5A 1UZ1A 5K3VA 3M47A 4A21A 1B3VA 3GY1A 3B3DA 3QEZA 1AD1A 3WK2A 3ONBA 4PUKA 3NZ1A 2HWGA 1ADOA 1S2TA 2PURA 4IPNB 3GFYA 2GSHA 1W1IE 3CUHA 1UH3A 4GY7A 2XN2A 3QN3A 3GG7A 5IOBA 4CCZA 1NJJA 3K2GA 1JZ6A 1FWTA 2XFYA 3NUKA 3BMVA 1X8CA 2WM1A 3TJ4A 1W1PA 4JTAA 4S38A 1F4HA 2W91A 4FNRA 5HULA 1W56A 2XSBA 3BG5A 3PB2A 4KIEA 4ZQMA 1QR7A 1O60A 2YCJA 4NY2A 5M03A 4ERGA 3P8JA 1V3MA 3COTA 4YU1A 4LUTA 3OP2A 2XIOA 1UCWA 4IGSA 1ZQ5A 2FZ9A 3JVAA 2UY2A 2Y62A 3DAQA 1VCFA 3CMJA 2QJJA 1QWKA 4LUIA 3N13A 4M56A 3W84A 2XINA 1K4HA 4JQAA 3FHQA 4S2BA 2BNJA 5HDRA 1K9FA 4TU1A 4DJEA 1RCQA 2PAJA 1FWDC 4H19A 4MJ2A 4MVAA 5HNUA 4RUBA 2QUMA 1V02A 5E0KA 3ZR5A 5LIYX 1VHCA 2IQTA 4S3CA 3DX5A 3RCMA 1XIGA 1XBZA 5F2GA 1ODUA 4K7VA 1DPMA 3GVWA 5IHRA 1A5OC 1AL7A 2E28A 3M16A 3RNDA 2VEPA 2VJXA 4QJ1A 3DHFA 3WLTA 3A4XA 4RNJA 1E6XM 1CGTA 3PR2A 5DBTA 3M7SA 4Q4KA 2CERA 1T7LA 4IGNA 4Q7BA 3ANVA 3YPIA 2TODA 5AC5A 3D47A 3T1GA 2OFJA 4O8AA 2WQDA 3B9AA 1A0CA 3W7QA 3T0DA 4XD3A 4FXJA 3L2MA 1R9ZA 1B1YA 5FAJA 2YW3A 3A24A 1AG1O 5EY5A 1A0DA 5I3HA 4DM2A 1B3XA 3KHJA 1TB3A 3PFMA 1J93A 2BWGA 3WK1A 3H4WA 1E72M 4IX0A 1UKTA 2Y5EA 4M1BA 2J75A 4FXSA 3TU9A 3AMCA 3OGRA 4I7VA 1P43A 1UR9A 3M64A 4C90A 3T4CA 1OT2A 5H8UA 1CGVA 4BQ5A 1CGXA 2V81A 2J25A 1EP2A 2V2DA 3Q58A 5D8ZA 1D9EA 3LCWA 4YYCA 3G77A 2WWDA 1MXGA 2CPUA 5LGZA 4KBXA 1P6WA 1ISXA 2VDHA 1CWYA 2ZCGA 1S2UA 4RL3A 2WC7A 3FY1A 3W6MA 3FW6A 2QAFA 3R94A 1R2RA 4HKPA 3W23A 4WXYA 6ENLA 2VZUA 1IEIA 5H1WA 4PTVA 3WL0A 2FKPA 4LUYA 3I6RA 2J24A 4MB4A 3H4XA 2QZRA 2PDKA 1B9BA 3NL3A 2CHOA 4WEVX 3AO0A 3GKFA 1RA0A 4Y90A 3IGSA 3VE9A 1K4GA 1GHRA 1CXKA 5FD0A 2Q02A 1W9UA 2YB4A 3WKZA 3NXFA 3VIKA 3ITYA 3D3AA 2A7PA 4O1BA 3IARA 4A8NA 2A5HA 2VO5A 1R85A 2ZA1A 1UKQA 1TVLA 3RO8A 4ZB5A 2V63A 3POCA 2PF0A 2F6UA 3MMDA 5G4HC 3CQJA 1BVNP 4RDWA 5AVHA 4GX8A 2ZZ1A 3APYA 2QJNA 3GSMA 3B97A 2QPXA 4EK7A 1Z44A 4RW5A 1FHUA 1UQYA 5HINA 2QCFA 4HNVA 3S1UA 3HQPA 3F4VA 2A1YA 1AODA 4JY8A 1MXDA 1JPHA 4XISA 2PS2A 3VOCA 5AHFA 4WDXA 1Y5VA 3C3NA 3WNKA 2E40A 3LD5A 1TZ9A 3R43A 4ZO6A 1C8VA 1EKOA 5BCAA 1CTNA 1SJCA 1TPEA 1IYXA 3PG8A 4XAYA 2ZXAA 2WZMA 3GE7A 1DIEA 1IEWA 2VD9A 1K3UA 1JDCA 3H26A 4E2VA 3GK0A 3NM1A 2EG6A 4AZBA 1O1ZA 3VGGA 3IGHX 4IIFA 2R1LA 5HR7A 3NYZA 4CNUA 3BQ5A 4KWVA 4GLEA 4ZFCA 3WQWA 3OQEA 3QR3A 4E5TA 1FH8A 2DH3A 2C13A 1WXJA 2YCLA 4LRSA 3ZM8A 4QG8A 4FB7A 3LS9A 4NJHA 4NZ3A 3W01A 3UZZA 3P60A 2DH2A 2DSUA 2ZRYA 3KZSA 1MVYA 1Q66A 2HMCA 4US6A 3BLPX 1R30A 1ZUAX 3D5HA 2J8TA 1E1EA 2X1UA 3NVTA 2XDFA 1M1BA 1KFBA 3I10A 3AMLA 3BANA 1TPH1 2C79A 1PV8A 1QNSA 1FP9A 3R5EA 1UR3M 5BRQA 3B0VC 3SCTA 1N7KA 2ZRUA 1SFLA 1YYAA 4ZVJA 4XKMA 2GQ3A 2CKRA 1H7OA 1MW0A 1VR6A 3QVQA 4PMOA 4TTUA 5FL0A 3WMLA 3PNUA 1UD3A 1RVKA 4ASTA 2ZBTA 3SCQA 2OWCA 2VI0A 3REQA 4IM4A 4X0VA 3OLGA 4UMBA 4CNOA 3SRFA 2DVUA 2C16A 3R6IA 1UWUA 4D6EA 1ZLPA 3WLLA 5ABGA 1W5PA 4UOZA 5GJMA 3A22A 3IVSA 4CN1A 2AQOA 3GYCA 2C0AA 1AQMA 3BOXA 4Q33A 1TTPA 3UJFA 4ZBCA 4O10A 2PU1A 1B9ZA 5IBXA 2WNZA 1EEPA 3DDMA 3B0YA 1PTDA 4JX4A 1XRSA 4FR1A 4QQUA 2W67A 4BEUA 2ALRA 1UR0A 1YKWA 2GYIA 2DEPA 4D6JA 3DG3A 1REQB 1W9PA 3LMYA 3WF2A 4S3KA 4Z1YA 3E74A 4OBRA 4KRUA 4AEFA 2CIPA 5EKYA 4DELA 2A4AA 1FOBA 3PJWA 2QPUA 2WC3A 3QPEA 2BY1A 2ACSA 5I78A 5BU9A 3MUIA 1LG1A 4LVDA 4F3HA 5EBAA 4AC7C 5A6BA 3N17A 1DQXA 4DXKA 1RAKA 3FFSA 4FNPA 1UWSA 4E2OA 3OGVA 3UY8A 4L6OA 1I60A 2X1TA 4N7QA 4PMNA 4GQGA 4QLLA 4AVOA 4N9CA 2IS7A 1RD6A 1DXEA 3MI6A 1KTNA 1D3HA 1KKRA 3CIWA 1XM3A 4JQ1A 3IIXA 2OYLA 1YTKA 4AZ5A 2YGYA 3WD4A 3T0BA 2PF8A 1A80A 2HSAA 2EHHA 5D32A 2JEQA 3MUAA 3W37A 5DRCA 2D2OA 3L4XA 1OYAA 4IZGA 4F8XA 3EPOA 4Q4PA 2VELA 2WAGA 3T78A 1LDCA 1UBSA 3AS1A 4HA3A 1UASA 4AMCA 2FYMA 1PUDA 4S3JA 2XN0A 1TV2A 2X30A 2VEKA 2FTWA 3W2KA 3MP4A 3G3MA 3EX6A 2DUXA 2ZUUA 3EOOA 3BG9A 4JD4A 4F0HA 3TC3A 2DZUA 3GS6A 2YL5A 2G3JA 3Q94A 4IMDA 3BAKA 2A7NA 4MJZA 5REQA 3B8TA 4H7VA 3I4EA 3EA1A 5I0DA 3HIJA 3W7OA 5DLCA 3MJMA 2VURA 2F84A 3U9IA 4PEEA 4ZCWA 2QGYA 3MHFA 2J6XA 4GIAA 2QCMA 2EXOA 3NQFA 1KGUA 1X1OA 2BXYA 2WMJA 2WVVB 2IUZA 5CC7A 3U0HA 4MAZA 1XR2A 4BQ3A 1DQUA 1IGWA 1J11A 5EL1A 2E8ZA 2YLLA 2REQB 4CD4A 2OGJA 3A5VA 1OBAA 5I3GA 3UETA 3BGAA 4DN1A 1Q4NX 3OZMA 1SGJA 2QCGA 3V1PA 3VIFA 4DJED 3VNYA 4K8GA 4O57A 2Y8VA 3WH6A 2OO6A 4IXHA 3XINA 5BRPA 4OJYA 4GZ7A 1QMLA 5HANA 3WJXA 1TQXA 1XH0A 1QNQA 3VD9A 2D73A 2OQHA 1CDGA 4H2HA 4JFSA 2P5NA 3KBVA 1XYAA 4CNTA 4F4RA 2OX4A 1M5WA 1E6NA 2QLYA 5A1AA 3TKFA 3P5YA 3Q2DA 1XD0A 1SFSA 4Q8UA 4OIFA 4D8ZA 1XHGA 1TMHA 4LCRA 3QQ1A 1QASA 3DENA 3CZGA 1XDLA 4BHYA 2J9ZA 3PPCA 3P7YA 1BTCA 3QPYA 3ZIZA 1D3CA 4AHOA 3M6DA 4FNUA 3TMQA 3FJ6A 5FJPA 4Y9OA 3UVIA 3AC0A 1HL9A 1TV4A 2CW6A 4YVXA 2VZOA 1EC8A 5I02A 5BNKA 3E5BA 4E2DA 4MB1A 5C7VA 1Z3NA 1YBQB 1K77A 3PPFA 3UXDA 5E0FA 3MZNA 1MW1A 3H2EA 3T2QA 2W66A 1V8EA 3UWWA 2A85A 1PX8A 1WXYA 3W87A 2PC8A 1GG0A 3H70A 3WD0A 1Q45A 4NXSA 1TRDA 4H04A 2X09A 4I9JA 3ZT7A 1DYSA 1QVBA 4Q22A 3L4WA 4HZ8A 1TV3A 2ZQ0A 2OELA 1GPWA 3FK4A 1MO0A 5C9ZA 2J66A 2VEIA 3LRLA 4IFRA 3QR1A 1V3LA 1GVOA 1PZ2A 1LL7A 2GK1A 1DHPA 4C6KA 2GJNA 1TFVA 4M6QA 2C8NA 2A3HA 3VX0A 5XINA 3NURA 2BVWA 4MWAB 1U5JA 1G4TA 5DY2A 3E38A 3JS3A 3NFUA 1NWUA 2PZNA 1UH2A 1B57A 1ZU8A 3L0GA 4QDMA 2FGZA 5HPCA 4GX9A 3F1QA 3BCJA 4HHMA 1IWPA 2XIQA 1F8IA 1XXXA 3UR7A 2I56A 1B54A 4UQ9A 4IFOA 1OX4B 1P6BA 1G4PA 4UFKA 2J9YA 2DQWA 1TZ7A 4PMJA 3VTRA 1RZMA 3PBVA 4JX6A 3UW6A 2VL4A 3CTTA 1E9LA 3NO1A 5D2YA 2FLIA 3H22A 3ZVHB 3S9IA 4V2XA 3JW7A 3AIUA 3VDGA 1LROA 1CYGA 1UKSA 2WSRA 3IRDA 4P7OA 3QGKC 1EHAA 4UOJA 3H23A 4V28A 1FWWA 4ONVA 5FJUA 1JZ8A 4ZOAA 2NQZA 4ZTYA 2WSYA 1KRBC 1BYCA 1XDJA 3VDAA 4LY8A 3GKAA 1Y5WA 3TFCA 3WLKX 5CZJA 3GR8A 1X98A 3VCCA 1FHDA 1EPXA 1E15A 3KHDA 5EB8A 3GUGA 2CWXA 3EMQA 1K70A 1UC5A 4H3DA 3WMCA 4LS1A 2D0GA 1FFRA 4AIEA 1L6SA 3TJXA 2EGZA 1SR0A 4E38A 2QHAA 1TWSA 4LC6A 3ZVIA 1E1CA 5FI8A 4GVGA 3LPFA 5FSEC 2FFCA 4O0KA 1XCXA 3F5JA 2ZC8A 4H9MA 3CZKA 3RN6A 4Z2GA 3UG8A 1YPIA 3PTDA 1C7SA 4JHMA 3STGA 2QW5A 3UCDA 4GYPA 2P50A 4CLMA 3OZOA 3M5VA 1HZYA 4AZ6A 4JBRA 3UQNA 3TN6A 4IQJA 3BW4A 3TAOA 1W1TA 1EDQA 2G41A 3LDVA 3B8SA 4GUHA 3WDHA 1WZLA 4JTFA 3VC5A 1XUUA 1QTWA 3AROA 4Q8VA 3A3WA 5D05A 2BS9A 4X9YA 4OE7A 4Y96A 4ALDA 1OGSA 1UP3A 5AB3A 3KVJA 1L2QA 4OU1A 4O8RA 2Z1XA 1E6QM 1XYMA 1C8XA 2VT0A 4N6EA 4EWND 1L2UA 5BOEA 1EEXA 4AZCB 2WANA 1H2JA 5HWMA 4UNKA 3BG3A 5GNYA 3S9YA 3TWBA 2BODX 3P6LA 4UTFA 5C2GA 1L9WA 4JTRA 2VCAA 3ABQA 2NT1A 1E51A 2HISA 3EDEA 3KOXA 2XYLA 2NT0A 3RMEA 3UWUA 2BGSA 1HJQA 3TP4A 5HATA 2F38A 4LEFA 3VABA 1HO1A 3G1XA 4XIMA 4M6UA 1W91A 1K9DA 5LNWA 3AJ7A 1IEQA 1DWIM 2XTKA 4F2UA 3HG2A 3PJTA 5GQBA 3VFCA 4DAFA 1Q13A 1XYZA 3FSUA 4L56A 4ZQRA 4DNHA 1ZENA 2BOGX 1HP5A 3CQIA 5HJLA 4V1YA 3AUJA 3QTPA 3C2FA 6CGTA 2PP3A 2ZZ5A 2BTMA 1UZDA 2I9UA 1KFCA 3ITLA 2XG9A 4S3GA 6XIMA 3RHGA 2PDMA 5AC4A 2VZVA 1FCBA 4MAVA 1K7EA 1IF2A 3MTWA 2OX1A 4S3BA 2EPNA 3CWNA 1M41A 3VZXA 3N2OA 4AG0A 2B7QA 2ZIDA 4D71A 4XZNX 3LG3A 3ARWA 4DLFA 4C6OA 4AB4A 1QPQA 5CJNA 4H9XA 1H41A 3RPDA 4JCLA 1FWBC 5HUOA 4HA0A 4LRTA 4RCXA 1ZPTA 3HJEA 1TA3B 3FVMA 4LEQA 3S5OA 1AQFA 1XYBA 4U5IA 1DWJM 4AIOA 1QAPA 1PJ9A 2BLEA 3CU2A 4PUEA 3FA5A 1M65A 4A8RA 4C7DA 4CQ9A 3RG6A 2EPHA 2CLPA 4RR4A 4GJIA 5CZTA 4L5ZA 4B2DD 4FA3A 2Y8KA 4AWSA 2DY3A 4IF2A 5LKYA 5CSUA 4CKQA 1QATA 5HK4A 4CD6A 2CITA 1PDZA 4E4PA 1VKFA 1TJRA 1XV8A 3WDRA 1S46A 4HPJA 3LQLA 5HWNA 2W0UA 5G2IA 1EX5A 4XTIA 2NX3A 3GVVA 1SM9A 1Q3NA 2O55A 5IFTA 5HMSA 3WLOA 5A8QA 4JY9A 3SGUA 3B8IA 3VINA 3V4BA 1WKYA 3TA6A 5BOFA 2DT2A 2HROA 3N2BA 3UPWA 3MP3A 3E49A 4CQBA 2BVTA 4LUSA 2OODA 2W6RA 4GG9A 1CCWB 1XYFA 5BXRA 3VDCA 1Q6CA 4B16A 4HZ6A 1EL3A 2ESCA 4O54A 3ARXA 1OWQA 4KGJA 5LZLA 3NTYA 3K8MA 4QR6A 1QK2A 3AWOA 1MEHA 2ZRZA 2Y1HA 1SJDA 3Q45A 3TTSA 2VUYA 4R5EA 2ZUSA 4JNMA 3M44A 1CPUA 4W93A 2PSNA 1W9VA 3IJDA 4U31A 3GHTA 3LK6A 4G7EA 1DBTA 1F07A 3DGRA 2JE8A 1NAL1 1EQPA 3W6LA 1YW1A 4P7QA 1UHVA 2J6VA 4DZAA 2CLKA 5I23A 3L5MA 2WPGA 4I8YA 1O4UA 1HJXA 3V5CA 1VCGA 3UPBA 4PA8A 1VZWA 5CAHA 3NDOA 3LA4A 2O9OA 3UXAA 3VIGA 4W87A 3DI1A 1EGVA 2WMKA 4FNQA 2HZGA 1VBRA 3S3GA 1N8FA 3U6WA 3VOIA 1ITQA 3A21A 4WGXA 1JYNA 2FDMA 3HPZA 3WK0A 1IZCA 3H8AA 5HWJA 2VC6A 2ZA2A 3XIMA 4JGDA 3TXZA 3DFHA 3URQA 2E67A 3PF3A 3I3BA 3WQEA 2GJXA 2DW7A 3GH5A 4AD4A 4YS1A 1ZCCA 2I5IA 3MBDA 5E6ZA 3RGTA 5BXTA 1NFGA 3B0UX 1UOKA 4HZMA 3QQ0A 3TIMA 3RDKA 4PB5A 2FB3A 1E3XA 3KRZA 1QCWA 1GZGA 1XLIA 3ZXWA 5A6AA 3NQGA 1M6JA 4XZMX 2PLKA 5C5YA 1J6OA 3S47A 3KM8A 1KRAC 3RFAA 4O1CA 4WF7A 5CLTA 3BOFA 1TPDA 3SCNA 1P0NA 3URBA 3IVTA 1F4AA 4OWGA 3TOYA 2NSOA 3KP1A 3STPA 3THAA 1WAWA 2V9DA 3CLWA 1RA5A 3IUDA 2Y5SA 4JEQA 5AZ1A 1EOMA 3PZVA 4INFA 1MW2A 2HQAA 3PZ9A 1JAKA 3GBDA 2YZRA 3BCFA 4C5ZA 3GD6A 4YVPA 3GR4A 3RM4A 2YOCA 3HO8A 2V3DA 2QYGA 1J9YA 4S3FA 2ZICA 3CPRA 5H6HA 3QV8A 3PPHA 4GQRA 2ZRVA 4Z0SA 1K9TA 4R33A 7ENLA 2GGJA 4DJFC 3WFZA 4JTQA 3MV01 1A5KC 4ERAA 1L0PA 1QNOA 1WZKA 3IS4A 5CLWA 5C6MA 3W07A 1ME7A 2ZWYA 4TX9A 3CNYA 3GFXA 1H7RA 3OJGA 2GGIA 2PGRA 2AAMA 1ZZMA 3OODA 1DXFA 1NSJA 2X41A 1T5AA 3WEOA 2CYGA 3ARZA 1V51A 2DQXA 4Z1AA 4J40A 3R58A 2G97A 3MUXA 2W5FA 3IRSA 2INEA 2GUYA 1GGOA 3H24A 4A8LA 4NF7A 4FXFA 4W8BA 2E1DA 1W5QA 3E0IA 3GTFA 2FIQA 3PM6A 4WKFA 5A2BA 3NQ8A 1YDYA 2VR4A 2D3LA 1RJPA 1G5AA 3NR0A 2X1IA 1BRLB 3UWQA 2EAWA 3LHVA 3AU6A 3I7RA 1ESWA 4AXKA 1Y0EA 2E68A 3KL5A 1Q65A 4EAMA 3UA4A 4HNLA 1PS9A 3W85A 3NPUA 3RX2A 3CXOA 1XPYA 4OFCA 2PLMA 4PMYA 1Q8JA 3FS2A 3W0KA 3BOLA 3KBWA 4I7UA 2QAPA 3TVAA 1VFUA 1L8PA 4IICA 2OZ8A 1PKNA 2UY5A 2RH9A 4MUZA 4RPPA 4MMWA 4I6KA 1SZGA 5FA5A 2H90A 1KBJA 3QZEA 2BHUA 3S6TA 1G69A 3RILA 2DZWA 1DJHA 2H9AB 2J62A 1PKYA 2PI6A 1W8SA 4Z1BA 1DJQA 1UQZA 3H54A 1DTUA 4EPEC 5D04C 3GIPA 4AWUA 3TA9A 3VMNA 3I6EA 1UC4A 4AQLA 2JKAA 4TMCA 2HS8A 3O05A 3VCRA 4S3AA 2Z29A 4L61A 2CXEA 1K8XA 1UWIA 2H9AA 2ISWA 3DZ1A 3M5XA 3PNZA 2XVGA 3L5LA 3VIIA 3F5KA 4QRNA 1M53A 4JN7A 1W17A 3HTWA 3L2IA 3CUIA 1G6CA 3VKAA 3MV11 3VFLA 1MFVA 3CO8A 4UCFA 5AHEA 3RR1A 3QQWA 1DXIA 2QCHA 5AY7A 4PFMA 4DWSB 1SW7A 4J27A 2DORA 3FEQA 1UZHA 1Y7VA 5LXXA 3GXNA 3SRHA 1ME8A 5XIMA 4RNFA 1GVRA 2X42A 2FGLA 3DKJA 3C0QA 4AXNA 3HQ1A 3IK2A 2HNHA 1HJUA 4KT2A 3PAOA 2FVMA 3M0YA 3THUA 2QDEA 2DVTA 5BWFA 3C2OA 2HVMA 3HV9A 1Z9AA 1AJ0A 2AL1A 2JGQA 3F7JA 3U5UA 4WY0F 4FLQA 2Z2BA 3NM3A 4UFJA 4YNGA 2XGBA 5DELA 1A5SA 1AK5A 1F5ZA 3SUUA 3UGVA 4ES4A 3LTYA 5CPTA 3T81A 2EPMX 2J27A 5JQ9A 5FF7A 5I00A 3R8RA 2YCEA 3VA8A 4JN6A 5D9MA 4X2PA 4W7WA 3EWUA 2DV0A 3VNLA 1GVYA 4WOZA 2YYTA 4BWLA 2NSXA 4QJ4B 4K8HA 3GDBA 1RR2A 4PGLA 3SCRA 3OTRA 3WG6A 4F0LA 4G9PA 4J3TA 3MCMA 3GRIA 5E09A 1TE1A 2OB3A 5D2WA 4E3TA 2J9XA 4ZODA 2R1KA 3EOSA 3QMSA 3SO7A 3CUFA 5M17A 3P84A 2OTDA 4M8UA 1JCXA 3APGA 1DJWA 4DYJA 2PDJA 3KP0A 5D2XA 3QY8A 2W92A 2OYKA 5CBIA 3I68A 4UTIA 2Q8ZA 4HHLA 1JYVA 3AAMA 1NOUA 3PZTA 3BZJA 4KFNA 3PUGA 5K9DA 1YPFA 2R94A 3TV8A 1JRCA 4ML4A 4IMCA 1H7WA 2DZAA 6A3HA 4PSRA 1A53A 3GC2A 5AKQA 5LSMA 3LU2A 4JICA 3F5LA 3HB9A 2QGHA 2QF8A 1W1B1 2V5JA 2ISSA 2BX7A 3WQDA 1GQLA 4I3GA 4WK9A 4QLKA 4XAPA 4NZ5A 4XZ9A 4KEUA 3IJ8A 4MTVA 3W1MA 3E0WA 3IV8A 4WSKA 4E4UA 4LX4A 1FXPA 4NILA 4A3UA 4OOZA 2E9MA 3SADA 3K5XA 4B9ZA 2P3ZA 3BLOA 4RDVA 2P8CA 3UY7A 3AHXA 2E5BA 7CGTA 4W89A 4GQBA 2HVOA 4J3ZA 5ABFA 1BWVA 3WQ8A 3KTXA 3ARVA 4K39A 1Z6KA 3WDIA 1HL8A 1FKWA 2VHLA 4MNJA 2OYMA 4LNYA 3CPUA 1U2YA 1SZNA 5C8BB 2WNQA 4RDZA 1EXPA 1AD4A 3VX1A 4AZIA 5TIMA 3UNDA 2PWHA 3D6NA 3N15A 4PCFA 3W6YA 1LWHA 4EAYA 1EJTC 1FFQA 4NAEA 2V69A 4AC1X 1PX3A 2FQIA 3WFAA 1TR1A 2G3NA 3IANA 3LERA 3H12A 5CPOA 1H0IA 4Q8OA 3CAQA 4DM1A 3QW3A 4IISA 4B5XA 1MWOA 3ZFHA 3LLXA 3J7HA 2NLIA 4YMZA 4WCJA 1BAGA 4PN2A 3QRHA 4GI4A 1V93A 1DWHM 4O4VA 1H4PA 1GT8A 5HMFA 4M51A 1ADDA 1V6YA 3BDKA 4V33A 4Q4MA 1Z8AA 4KW2A 1PPIA 1YE6A 4K1GA 4HCHA 1VEPA 5FESA 4L64A 1OABA 3LV5A 3GO2A 4XBKA 4LTSA 3UXLA 3N3TA 3WQ6A 5B7ZA 2ON3A 2BB0A 3BQ6A 4M29A 1KBBA 3PZUA 3C61A 2OJPA 2OXNA 3MSGA 4NJKA 5A3HA 5CZSA 5CZKA 4QP0A 1UIOA 2FVKA 1LWJA 3EDJA 1TA3A 3M6YA 1XG3A 1C91A 4KF1A 3R89A 4UR7A 2QUVA 1P7TA 3KLKA 1LRTA 1JNDA 1S5WA 1VENA 2GVJA 4OT7A 3TC7A 2B81A 2DIKA 3EWBX 5M5DA 1P0BA 5HMDA 1CI1A 4LT9A 4EKJA 3VIHA 3HV8A 4QGCA 1XJBA 4R9XA 5H8MA 1YDOA 2O4QA 3BTNA 4F79A 3EPNA 4PMZA 3VXGA 4HK6A 1XRFA 1V6TA 2ZZ4A 4KRTA 2INZA 3KVKA 1JZ4A 5D03A 1GJUA 1KWKA 4OBTA 5EMLA 1JZ3A 1JCJA 2VD8A 2FPVA 3SURA 3KUMA 2XSXA 4R53A 3K46A 4WJEA 2E6DA 5FF4A 1HFBA 4JTUA 3UGRA 3L23A 3WQPA 3PJXA 3HGOA 3O0KA 3W00A 3NQ6A 2V5BA 3L0NA 3RLGA 1JPDX 2VX7A 1QHZA 2TPSA 2CBVA 3W1QA 1NP0A 3DHPA 1I0DA 1W9DM 5DXYA 4ERIA 2FZMA 3QF0A 3WLQA 3H7VA 1CW2A 2OOFA 2POZA 4KWOA 1DWAM 2HTMA 2BY3A 1V6WA 4X60A 5D38A 4DJDD 4L6DA 5CBBA 3ARPA 3IUIA 4DUOA 3CZJA 1IIHA 3C8NA 2DT0A 4PR4A 1GYNA 3ZYZA 4YTUA 1LF1A 4PUMA 5L6UA 4QDPA 3EZ4A 4ECLA 4QNEA 4DPQA 4HSNA 3IJQA 4EF9A 2XJ7A 1PEZA 4MKNA 4CVUA 1W1A1 2EKGA 3CHFA 3KRUA 2DZVA 2IKHA 2PTDA 3GHRA 3NSXA 4GUGA 1O5RA 1ZTVA 3BICA 5IXEA 1FWGC 3MMTA 2PDQA 2C15A 4GH1A 2VRQA 4C6EA 1MDLA 1MYRA 1VLWA 4REQB 4IP7A 1R3YA 5TAOA 4C7FA 3B06A 5TF0A 2WLYA 4PRRA 1X39A 3LHTA 4O14A 1NY1A 3GTIA 3W71A 3GXMA 2QQ6A 3HGRA 1GVQA 1RBAA 2PU0A 3KDOA 4D6HA 1V7YA 3CQ0A 1I2NA 4ZQPA 4AUBA 1XP3A 3HFTA 3HURA 4W5ZA 4OKDA 2HPMA 3OVGA 2ACRA 1TELA 3ZSTA 3T05A 2ZX5A 4FLOA 3C0LA 4Q8MA 4NAEB 3VKBA 1HF6A 1C29A 1TTQA 3T55A 4L4LA 1GONA 3GXPA 4KPLA 3H7RA 4A3QA 2PWFA 3TX9A 5K7JA 4GPNA 3PBWA 1C3FA 3GLCA 1E1FA 3GZ3A 1LBMA 1ZGDA 4DI9A 4XD6A 1FCVA 3OYXA 3A12A 3CO4A 1XYLA 1YIXA 8TIMA 4GJ1A 5AC7A 2EEXA 3A3HA 2BXZA 1UPPA 1LZOA 1R5YA 5H8PA 3VYLA 2VR5A 1VH7A 1H5VA 2XPKA 3EDFA 2RDUA 3SQLA 4MLRA 3AMDA 3BAIA 3VKDA 3M0MA 3A4WA 3B9OA 3DESA 3A13A 4F0SA 3UYCA 4TVDA 1B3YA 5T26A 3VIOA 3RAOA 1H3GA 1TUXA 2VYOA 3QY6A 3EKLA 3R1ZA 3LLFA 3VDHA 3G18A 1T8XA 5M1TA 1Q5MA 3AYSA 2PDPA 1Q4WA 4U10A 4C1KA 4UFMA 1LJYA 3GG0A 2BV9A 2VXNA 1Y65A 1LP6A 1G1YA 2FHFA 3VNZA 3V7PA 2PD5A 4GO9A 3L66A 1PWMA 5C55A 3LCHA 4K2SA 3L67A 3VE7A 4MPQA 2QEZA 3NQ7A 2F2KA 4IFKB 1BYBA 3SUWA 2AQWA 2D23A 5J5DA 2GWGA 2FH8A 6TIMA 2I5GA 2WCGA 3STFA 3EXRA 4FF7A 1J2BA 1W1ZA 3AOFA 4FIQA 3FDKA 3QHNA 2QT3A 4NG3A 2XSAA 2REQA 3KWXA 7ODCA 3WMBA 3V5OA 3NSMA 4BZYA 4DF2A 3IJ7A 2CFFA 3TQPA 1YX1A 2ZZ3A 4IH3A 5AC8A 5I6SA 1GVEA 1WDSA 2GVGA 1BGGA 1DJIA 2DZPA 4GUIA 1V02E 3WNMA 4DJFD 3LCFA 4OOUA 4H6QA 1OG0A 3LBMA 3G0UA 1VFHA 4DF1A 4NSBA 4ZFMA 4ORMA 1RBOB 2OZTA 4B2DA 1Z42A 3AYTA 1M04A 3CAVA 1E4IA 5JVLA 3DI0A 1YQ2A 5GVJA 2GQAA 4QTGA 4UUIA 2E6AA 3PBMA 4PE8A 1XLDA 3EMZA 5T9CE 1UD5A 1HJWA 3WQOA 4N9EA 1EYWA 3WO8A 4H6KA 1JCLA 4EPKA 1PTAA 4B3KA 4ZO9A 3MCNA 4XUGA 3WLJA 2VC5A 1XDMA 3EKZA 5FACA 5CXPA 1OFDA 3ECQA 4ZSTA 3QV6A 2ZTJA 4LCSA 2V3EA 3SJ3A 1AJ2A 1OC7A 2J88A 4FXRA 3N9RA 3TWAA 1B31A 3CYJA 1JCYA 1E9IA 3KBJA 1PIIA 3MYOA 1BLIA 4UXDA 3EXTA 4M6PA 1HL2A 1RK6A 4E8GA 3NZGA 3G1SA 4RJEA 4Q8TA 3QSTA 1DKWA 4WDWA 1TWZA 2V38A 2PLJA 1EJUC 1TPWA 3HMCA 1TX0A 3FCPA 5LIUX 2Y61A 3DEQA 4EACA 4R34A 3R7MA 4W85A 5FAGA 3KW3A 2VKZG 3TOPA 1A3WA 2BOEX 4GK8A 2D22A 3VDBA 1A0EA 2QDGA 2J7CA 2YXXA 3AICA 3TQVA 1A5AA 5CGTA 3MSDA 4A6GA 3UYIA 1JF5A 3P93A 4CU8A 1FVPA 1YLVA 5DT7A 2J8FA 4I5RA 3MJYA 3VVGA 4AD0A 3TYZA 4ZEPA 4AD5A 1NDYA 2ZYFA 3VK5A 4C6QA 3D3FA 3NEHA 5I3IA 3GYEA 1C9WA 1LBLA 4JTJA 3NQEA 1IR1A 3DOPA 4Y9NA 2YDQA 1NFPA 4GH3A 4CNSA 1MFUA 1KA9F 3S2CA 4TX6A 4JDYA 2OR2A 4PZVA 1IXQA 2B0MA 3B0PA 3GHSA 3A9IA 1DQWA 2NUWA 4MNMA 2P0IA 4ENLA 1W3LA 2CETA 1UD6A 2WKLA 3STEA 3VGDA 5JBDA 4LU0A 3ITVA 3PTQA 1YDVA 5EFDA 4H1ZA 4FALA 5G1YA 1RALA 2W63A 3N6HA 2ZVIA 4WZHA 3ZT5A 3M7WA 1OYBA 3U2CA 2YDSA 1SW3A 5IBXC 5CAKA 4E0CA 4XZLX 4LC8A 1H0GA 4HBKA 5IFPA 1NWSA 5E9AA 2AOSA 3UWVA 2G5WA 1D8WA 4EX4A 3FJLA 4QJ3B 2WZTA 1JDEA 4X2RA 3C52A 3HG4A 5C9XA 4UQBA 1H5YA 1K6WA 1KXHA 2GFTA 3EX2A 1GVIA 3SN1A 6REQA 3QTGA 2MANA 1FH9A 4C60A 4DO5A 1SVDA 2Z27A 1F2JA 4FX7A 2VWSA 3ITCA 4GRSA 1AH0A 3GW0A 1BHGA 1DE5A 1K7FA 5HR6A 5JH1A 2VGIA 1KBLA 5EU9A 4C65A 1W5OA 5K9XA 4JYFA 1EFZA 4W84A 4O1AA 1W31A 4O53A 3HQNA 5IRPA 1KBKA 1NWRA 4N42A 4J35A 3O15A 5A5WA 1WX0A 4PTWA 3R4IA 1E1CB 1ZSXA 4TIMA 2IMRA 2FZNA 1XIBA 4Q8NA 1Q63A 3VILA 2E9LA 3LTSA 3BH4A 1A47A 2PRHA 2Y8UA 5HJYA 1TQJA 3W1RA 2GSJA 1M9HA 4W8LA 3EEZA 2OEMA 3EEGA 5HMEA 4HMDA 1O68A 2XVNA 1ISYA 3V0SA 1YDNA 1KRMA 1E4MM 1VFTA 4K37A 3M0XA 1ECQA 1JNEA 1JAEA 1W5MA 2JF6A 2HBXA 1NOFA 4ZO7A 1P1XA 1XGZA 2OEKA 5GJNA 1LM1A 2WVTA 1GTHA 2C18A 2CESA 4GOAA 4D9PA 3RJYA 4IIGA 1FH7A 2EG7A 5I79A 5AHNA 4MYXA 4JDBA 3W02A 1XH1A 3C2YA 4XO7A 2PDCA 3DFNA 4L1WA 4FZIA 3KAOA 3O8AA 1FX6A 3G1AA 2DP3A 2TSYA 1EIXA 2IPJA 4L4MA 3CL6A 5I24A 3VKJA 2A3BA 2WZEA 1ZJAA 1VCVA 4EVZA 3GR7A 1LT7A 1G7UA 4JQ2A 3WD2A 4IMAA 2ISVA 1BVZA 4RXFA 3CV1A 1EGMA 3BL3A 5LNUA 4MFEA 1F8MA 1QI3A 1K6AA 1NWTA 1F74A 1ISZA 4IQDA 3GB6A 2PTYA 3L21A 2Y7EA 4UR9A 1RY0A 2ZZ2A 4PEKA 1QRQA 1XCFA 5PTDA 4ZE5A 1MMFA 4JTSA 4ZOCA 2DUAA 4UTJA 1QI5A 3PZGA 2H8ZA 4GYFA 4QAIA 1T0OA 3V1HA 3QOKA 4UTUA 5EMMA 4O0QA 1KRCC 4I9AA 5G4EA 3N9SA 4KFPA 4WXZA 4LV4A 1KV5A 4IX2A 4IIEA 4BWLC 2C7FA 3F4NA 1LLWA 2GK1B 3PZIA 1FWHC 4Q4QA 1H7XA 4LBUA 1J4EA 3UZYA 2VZSA 3UWYA 3IIVA 5AOUA 4JCMA 4MOZA 3IGXA 4BA0A 1I6NA 4TO8A 3HA1A 3QZ6A 2YL9A 3BSHA 3BC9A 3PTMA 1W8GA 1GQJA 1NELA 3N73A 1L6WA 1UP2A 2R1PA 1QK0A 3E0FA 4P61A 1D7FA 1KFJA 5MKGA 4BF9A 2XM1A 1V6VA 4HP5A 3VNMA 1LORA 1HKIA 2RDWA 4OQVA 1VRXA 5F4XA 1KCLA 1TIWA 2YB1A 3MO4A 4WDUA 1SFJA 3KCOA 1OX4A 2G96A 3SUTA 3MUCA 4W4QA 3W86A 4IMEA 1YBQA 3ABXA 2H3DA 4Q4SA 2ZFAA 3RXZA 1W9BM 2WJDA 1Z69A 4IIBA 3LENA 3MKKA 3QR0A 3A5FA 5I77A 5JIPA 2Y89A 1KQZA 4IMGA 3EWXA 3D0CA 3EWCA 2I7GA 3A6OA 1HJVA 1JGMA 2IKJA 4H8NA 1C8YA 1BEUA 4GXPA 1MI3A 1RLCL 3LHZA 2C14A 3WJSA 5AZ0A 2VP8A 3SCWA 2OG9A 4PCPA 2Z1WA 4Q8QA 2WV8A 1H11A 1ZBWA 4Z2JA 4DWDA 3PWIA 3W7HA 3NPWA 3KFTA 3VGEA 2ZUWA 4E2BA 3W24A 3VC6A 3GNRA 4JTGA 3KWSA 2CHRA 3TYUA 1YPXA 4EXQA 1J0HA 5BROA 4B3LA 3ITOA 3ZJ8A 1LUCA 2EPLX 1MRQA 5D09A 1R46A 1ICPA 2YDAA 4W7UA 3QV9A 2V5KA 4Q7IA 1FA2A 4QNWA 1P0DA 5LIXX 1TMLA 4HA4A 1UIPA 1RQBA 3IEBA 4KH2A 1VBGA 2BHYA 2E5CA 4F2TA 4N2YA 4ZR8A 5CGQA 3PN8A 8A3HA 3THDA 4YIWA 1F3XA 2ZXBA 2VC9A 5TD4A 1CNVA 4MHBA 3AIRA 3DERA 3G5EA 1TVNA 3JUGA 2PDIA 4I90A 1KD0A 4GO8A 4UB9A 4IT1A 1XSKA 3T0CA 4NIRA 1N2VA 4LBSA 4OV9A 4UCGA 4FMVA 4J2PA 1JCMP 1CGUA 4H83A 1AW2A 3CLMA 5HQMA 3MHGA 1P0EA 2PGEA 1R3TA 4Z1CA 4JTCA 3FDGA 1R9YA 1XICA 4B4FA 5DCDA 3DH7A 2DGAA 5A6MA 4J5NA 4S39A 1KFLA 3U57A 5FF0A 2AMXA 1IGSA 3MMWA 3NYDA 3RF9A 4QIUA 4G7EB 4N4QA 2CHNA 2NXHA 1GOOA 2R9RA 1TV5A 1V4YA 2PCEA 2E6FA 3TN5A 2YW4A 2NV2A 3LGGA 3MDWA 3SEPA 3AS2A 4PH6A 2NV1A 3MU7A 1AZ2A 3L4YA 3NO3A 4BI7A 5CSRA 3N3MA 4L65A 5ECVA 4DBDA 4HTYA 8CGTA 2PWEA 1RQEA 2A6NA 3O63A 4M0XA 4C6LA 4BY3A 2VDGA 4IP5A 4IJBA 1SZEA 3MHUA 2PRMA 3H2MA 3SR7A 3V0UA 3CB8A 4UFLA 4LVGA 5CZ0A 3GM8A 1DORA 2QCEA 4CQCA 4UBPC 1TTJA 2PWGA 4A05A 4AF0B 1GW1A 4TQTA 2DIJA 3PVFA 1LYXA 1PIFA 4I8DA 5A6SA 1J79A 5C2XA 3SCOA 3SCSA 1BF6A 4KERA 3ZSSA 2FMOA 4MY8A 1I2PA 1POKA 3N11A 5CCZA 2WHKA 3W70A 5DEZA 1OM0A 4J3VA 3EDKA 2WJFA 4MZYA 4E6MA 2PTXA 5A6KA 2OOGA 1RJQA 1ME9A 2X7VA 2VX5A 1NQ6A 4A3HA 2PDWA 2FFIA 2ATMA 4AVFA 3OPSA 3EWYA 3CHDA 4PL1A 4N0RA 2J47A 1WNOA 2B31A 5CQ1A 5TBOA 4MWAE 1HQTA 1P6CA 4GFIA 4Y6GA 3HPSA 3M5ZA 3BW2A 3GZAA 1UD4A 2YL8A 2OQLA 2VFFA 1F7BA 4QHRA 3PS7A 1IT8A 3FX4A 4ADTA 2DJLA 3MO7A 1S38A 4LWWA 5J04A 1KFKA 4DJEC 3ISIX 1KGWA 1DJZA 4FX8A 1XI3A 3DG6A 1VFMA 2JKPA 1ZALA 4UR8A 3O2LA 3H4GA 1V0MA 4WVXA 4KFOA 4LOCA 3WNPA 1VPQA 2VCCA 1WUEA 1KLYA 5U4NA 2QUTA 3PULA 2BGQA 3T44A 2E7FA 2JIEA 4Z2IA 4AZGA 3EWDA 1QJWA 1UMYA 2V3FA 1DIOA 2GDVA 3N2MA 2NQ5A 4PL2A 2PUZA 1NH6A 5FSDC 4NZ1A 2MUCA 3HGSA 3N4EA 1MUMA 4ACZA 5AYXA 4ICMA 3FJ4A 1UJQA 2DDXA 3AI0A 4I5UA 2Y7FA 5KMYA 3NGJA 1JFHA 2EF9A 4AY7A 4FHAA 1YTEA 9XIAA 4XV0A 3M0ZA 2PBOA 4DEFA 2YCKX 2MNRA 1QW8A 1UP0A 1XLKA 3P5ZA 2DSWA 2IXUA 2FTYA 1C8QA 3ZZ1A 1PX4A 3VKCA 4ZE4A 2CLEA 3LGDA 1R2SA 4C1NA 4DO7A 2J7FA 5EPDA 2X2YA 1EX1A 3DYOA 3NGFA 3NWRA 3BGJA 4KETA 1TREA 4NNBA 4PCTA 3UG5A 2QUUA 4J3SA 4J9JA 4AZCA 2V3GA 3B04A 5EFFA 1UMLA 3VD3A 1ONEA 1U1JA 4PCSA 4OBSA 1X7IA 3CHVA 3FNDA 3WX7A 3TCSA 4DAIA 3C0JA 8XIMA 3ELFA 1HUVA 1DJYA 2P76A 2BBFA 1WO2A 3FAXA 4HPHA 1KWGA 4O12A 3VOFA 3RLVA 1Z89A 3KE0A 1E5NA 1GVSA 4GZJA 4NYUA 4W5UA 3BMWA 3DHDA 3R13A 3UCQA 4NZJA 2YXOA 3ES8A 4NZCA 3FKRA 1Q7ZA 3QV7A 2WQPA 2FGBA 1WPCA 4XBSA 3TSBA 2GL5A 3UVAA 5CKSA 3V16A 5FJJA 4IUGA 4O16A 3IWPA 1V0NA 2V68A 1JZ5A 2WMHA 5HQLA 1CB7B 4Y9AA 1DV7A 1GYLA 1W3JA 5C2CA 1BG9A 4M3PA 3KL0A 3NDYA 1X8FA 4ZOEA 1DTNA 3B8UA 1WBJA 4OHQA 4XK2A 4AWEA 3GHUA 4YHEA 4MWAC 1A4LA 3G1DA 4C91A 3B05A 1XKJA 4WLCA 4JOMA 4AFYA 2WLZA 4FOKA 1R6WA 2WJEA 4F2BA 3BURA 3E2QA 4HT3A 2W62A 2WHJA 1GOKA 1UWAA 2O7SA 3ARYA 4GHRA 4NQ1A 2HXTA 2ZRXA 3ARUA 3SFKA 3E6EA 4KKXA 3K8KA 4DI8A 1EYEA 3EOUA 2PWUA 4NVTA 4OUIA 1KTCA 1S2VA 4LV9A 3QYQA 4BK9A 4MY9A 4EF8A 5U7SA 1KLZA 4GABA 3C2VA 1J01A 4LYQA 1VFLA 1KXQA 1EH9A 4UMAA 4F0KA 4JIHA 4JTLA 1RCXB 4NNCA 1N82A 3EA3A 4JN8A 5E70A 2GOUA 3TAKA 2XH4A 4Y8EA 7PTDA 1EJRC 3T08A 2Y5JA 1BVWA 3PBYA 3RO6A 1OC6A 4CVWA 3R0KA 4ORIA 1J5TA 1LRNA 1PZ0A 3IJLA 4NX0A 3DYMA 1JDFA 2VOMA 1X7FA 4MNLA 2JQXA 1EOKA 1P4CA 3PJUA 4ZL1A 4R7OA 4PFHA 5J5RA 1IT7A 4ZXOA 1ECEA 2ZDRA 3UR2A 3DFPA 3CH9A 2JBMA 4YN5A 2YZ5A 4K6AA 2OCZA 4H8UA 3TTOA 4QCFA 5CH9A 4HU8A 1LL6A 2VENA 1IQ8A 3KOWA 5BZAA 2CC0A 3B8VA 1J0YA 2ZUNA 2BXVA 2EBNA 3SN0A 3WH8A 2PDUA 5A2CA 1XIDA 3WEMA 1MUWA 4EP8C 3SUSA 3GXDA 1WDPA 3NQMA 2WMIA 1U1UA 1ZBKA 1GPFA 2VGFA 2QULA 4XTDA 2UY4A 5IDIA 4HMNA 4G6CA 1C90A 2CLHA 2BY0A 2IKGA 4QS5A 4HTBA 2VOTA 4IHCA 2Y7DA 4URIA 3TQ0A 2CZ5A 3SY8A 4UC5A 4R7WA 1BSIA 2WKGA 4JIPA 1VC4A 1I1XA 2UY3A 1XFBA 3W7MA 2OSWA 2QMJA 5JMUA 1XGDA 4IIDA 2V2HA 3UERA 4DXVA 3LSCA 3W7NA 3EGJA 5BU6A 3CV7A 3K4DA 4BCEA 2XM2A 4ATWA 1JYWA 2BHZA 3L12A 1PKLA 9XIMA 4F0RA 3CH0A 4FK9A 1MRAA 1WE5A 2Z0IA 4ICCX 3AZTA 1Q6EA 1ALDA 1OFRA 4HN8A 1UWQA 1JCNA 1J0JA 1FWEC 2BFGA 1QPOA 3BLLA 3BVJA 4LUSB 1RPKA 1TUFA 1IT0A 1UB3A 1TJ1A 2ZKMX 3P74A 3W81A 2BY2A 5T9BG 5GPRA 8XIAA 4LSBA 3S5YA 1QO5A 4B4HA 3WLRA 1BQCA 1KM5A 3W1PA 3P82A 4MB5A 3OEXA 3CUXA 3UCCA 1IXPA 2YA0A 2EJ1A 1ZBVA 4QDWA 3M41A 5CEWA 5J8LA 1HT6A 2WCSA 3NQAA 4UMCA 1EWDA 1WA3A 3WD1A 1VFOA 1KXTA 3W26A 2DSZA 2VVNA 3Q37A 1F61A 2VEGA 4HYVA 3GG8A 4S23A 3RIKA 2KZHA 3L9CA 2J4GA 3WL1A 1FCUA 1UA3A 1EJWC 3DBPA 3QHMA 1JUBA 5JUVA 3H2NA 4XAZA 4C1NB 3TYAA 3O1NA 5I09A 1NF0A 3TN3A 4AIBA 3LPGA 2NW0A 1OIMA 3SW6A 4OTKA 3BCDA 5AVNA 1WQ5A 1SU5A 3WNLA 3MT1A 4BI5A 3II1A 3BJTA 1DVJA 4O15A 4WQ6A 3W2NA 2C0HA 2YX0A 2E5DA 2Z1VA 4DWSC 2OSYA 4ACZB 3C8FA 4U2ZA 3IAPA 3REQB 1MEWA 3B4UA 5EGRA 2ZZ7A 7XIMA 1F3EA 3OG2A 3ORWA 4HK7A 4BKNA 1C93A 3OLDA 2QJHA 4KIRA 1OC5A 3NAVA 3OBEA 4PTNA 3M0IA 1ITUA 2A3LA 1CLVA 4QXIA 5JXQA 1UUOA 3BMXA 4PMXA 1FUYA 1ENUA 3TTEA 3WDPP 2NWRA 1Z48A 4ZA0A 4A3RA 1E0XA 3GDMA 2DJXA 2VQTA 2DT1A 4U4MA 3SRDA 4DUVA 3GDKA 3WLPA 3W27A 2NV9A 4IPIA 5I3DA 1V6XA 5BOOA 5I2UA 3NQCA 4JTHA 5T91A 3W73A 3CZLA 2X1RA 4R7JA 1I2RA 3U4AA 2Y6ZA 2HS6A 1KCZA 1TWWA 3GC5A 5TNVA 4LYPA 1XGEA 4UTKA 3NZPA 2VWTA 3K13A 4ZMGA 1MNZA 1NDVA 2Z1KA 2FH6A 1PE1A 1VAHA 3VGBA 8RUCA 2FB2A 3ALGA 3M43A 1WDWA 1S5NA 1GCYA 1QNVA 1JQXA 3SUVA 7REQA 3G8EA 3FSTA 3NOEA 1X6NA 4QCEA 4JFTA 2YLAA 4CQAA 3TW9A 4XX6A 1OFAA 1B30A 3KZPA 4FAMA 3VNDA 1BSLA 4RV8A 1O6IA 3IJ9A 3I65A 1NQKA 2W79A 4S3EA 1UZ4A 2PDXA 1OCBA 5CPSA 3EOLA