3WDPP

Structural analysis of a beta-glucosidase mutant derived from a hyperthermophilic tetrameric structure
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
472
structure length
472
Chain Sequence
AKFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDAAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLASGFPPGFLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVFREIATQKEIPEELAHLADLKFVTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
publication title Structural analysis of beta-glucosidase mutants derived from a hyperthermophilic tetrameric structure
doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 189
structure length 472
sequence length 472
chains with identical sequence Q, R, S
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wdpP00
3AMCA 1GHSA 4P7QA 3OGSA 2X8RA 3ARYA 1HP5A 4MJ4A 1BYCA 4AW7A 4OZOA 5A94A 3CZGA 3N12A 4MPKA 4PUEA 3T2QA 1QW9A 3WENA 4PN2A 2G8ZA 2V5DA 1XH2A 2QHAA 2YL5A 4R5EA 2BFGA 1TCMA 2BVDA 1DWGM 1UH3A 3ZJ7A 1W9PA 3NIYA 1HX0A 5M03A 4ZXLA 2D1ZA 3VM5A 1WDPA 1E5NA 5BXRA 4GO9A 2MANA 1MQPA 1E0VA 4ML4A 2O9RA 2C7FA 2PBGA 4H8VA 1QI2A 3GTNA 3WMSA 4TVDA 1UH4A 5GNZA 3VIFA 3KEHA 2ZUTA 2IXVA 1FFRA 3MO4A 1GQJA 1ZBVA 4F9DA 2ZX8A 3GXIA 4WK9A 3WF3A 2Z1KA 2BY3A 5CQ1A 4ACYA 5FD0A 4NF7A 2WVUA 5A6BD 3UG4A 3MUIA 3DHPA 4LYRA 2XG9A 4WKHA 1ITXA 1UR8A 2V3EA 1K9DA 3PZUA 5HBFA 2GFTA 3AXIA 3BCDA 1J18A 1XH0A 2VNCA 2WSKA 2XSAA 4UR9A 2G3NA 3PTKA 5JUVA 4DWSB 4D72A 1RD6A 4HU0A 2J62A 5I79A 1B2YA 3GH4A 1G0CA 3VIMA 4MNKA 2JEPA 1I1WA 3PTQA 1E4NA 3GXFA 2UY5A 1D3CA 3M7SA 3CUJA 2WVTA 3NSNA 4PMYA 1IV8A 3VNZA 4PMXA 1GORA 1LG2A 4YN5A 1N82A 1KBKA 2OYMA 1B3VA 3BH4A 4UOJA 5DT7A 4AISA 4ATLA 5M3WA 4CCDA 4TX6A 2X1IA 4PMDA 2VCCA 4GQRA 3G6LA 4PCTA 3IJ9A 3WN6A 2W92A 1CENA 4J3XA 1I75A 2C0HA 4AZ5A 2IUZA 3BAYA 2D3LA 5IXEA 4J3WA 1GNXA 5DEZA 3AQUA 1J12A 1JFHA 3WEZA 5LA1A 1YQ2A 3WQ8A 1E0XA 3CZKA 1E72M 1NH6A 4M1RA 2EEXA 1XSKA 1V0NA 2WCAA 5A6KA 1E15A 4M82A 3VVGA 1IT0A 4Z2IA 3PZQA 1ODZA 2CYGA 2WMIA 4ACZA 3BAJA 5I78A 3VKKA 4D6CA 4CVWA 4LXFA 3KL5A 2VZSA 1HKIA 4M8UA 3T2PA 1JZ3A 3AYRA 1C90A 2WC7A 1JGIA 4H7VA 3TTYA 3BSGA 2W4XA 2YA2A 4B3KA 1E6XM 1ODUA 1SYTA 2A3BA 5A6SA 2VRKA 3A3HA 4D1IA 4W88A 4BQ5A 4W85A 2C8NA 2O9OA 4E2OA 5KEZA 3RM9A 1BYDA 3W26A 5CPTA 3WEOA 1PIFA 5IFPA 1J0JA 2CKSA 2XPKA 1JYVA 4IUGA 2NSXA 4J3VA 4JKMA 3BMWA 2DSUA 4HOZA 1NWSA 1V6UA 4UQDA 5I3DA 3PZGA 5A1AA 3WH6A 1B90A 3EMQA 5EFDA 1KXQA 4ACZB 3BAIA 3N13A 1UZ1A 4M24A 3DECA 3SIMA 1W91A 1K9FA 2X09A 2D2OA 3WIJA 3CZLA 4Z2GA 1W1YA 4NZCA 1UR1A 1DWIM 3BXWA 3SCSA 1NWUA 5A6AA 1HKMA 3OLGA 3NDZA 2W62A 1EQCA 3WNOA 3VD3A 2DPEA 3W38A 1DWAM 4NRRA 3CIVA 1J0KA 6A3HA 3EMCA 2NT1A 3OLDA 5CZKA 3T2OA 3EMZA 1U2YA 5EFFA 1KR1A 3WD1A 2QV4A 1KXTA 1VB9A 5FIPA 4CD4A 3CHCA 3QOKA 5E70A 2ZOXA 4HOWA 1BSIA 1E6QM 3W29A 4J3TA 2DIJA 4U3AA 1LQ0A 2XGIA 3OZPA 1HJVA 1B1YA 1H3GA 3GBEA 1DEDA 3SCVA 1BYBA 1WPCA 3RILA 5BWFA 4N0RA 1VAHA 4OUEA 1CWYA 4W84A 3AIRA 3VINA 1G5AA 1LL7A 4W86A 4U33A 2NW0A 4ZE4A 3W25A 2VRJA 4UCFA 1KWKA 1UQYA 1O6IA 1TG7A 5E0CA 2WMKA 3KL3A 1QPKA 3AHTA 1R86A 2ZUWA 1JIBA 3MMWA 4AYSA 2VJXA 4D6JA 1LLOA 1FA2A 1K9TA 2J75A 2XYLA 2CIPA 2CBVA 4PMOA 2X05A 3I3DA 2EPKX 2QPSA 2YA0A 1C91A 2YBTA 1GHRA 1JFXA 4V2XA 4CCEA 3AOFA 1CGTA 1E73M 4CD7A 1UKPA 1HN1A 2WC4A 4H8UA 3WDPP 1H41A 1W9XA 4X9YA 1R7AA 1QNRA 1V3HA 1WZAA 4AIUA 1TUXA 2BY2A 3W0KA 4PTVA 3AMKA 2WAGA 5CSUA 5E09A 3ZJ6A 3MS8A 4AEEA 3WNNA 3QHOA 2FGLA 4P7OA 2X2YA 4AD4A 3MANA 3HN3A 2QF8A 3IJ7A 1KFWA 1GOKA 3AROA 4PMNA 1B30A 1GJUA 2CHNA 1CPUA 2XWEA 3AIBA 3N04A 1I1XA 2XTKA 7CGTA 4KGLA 2XFFA 1V3IA 4C7FA 1WZLA 3WNPA 5DMYA 4CUCA 1W3HA 3W82A 5CXPA 3SCOA 3QOMA 1JNEA 1QOXA 4J7RA 3PZVA 3E1F1 2PF0A 2WLYA 3WBAA 3MMDA 1GVIA 1PAMA 2WKGA 5FOOA 2D22A 4XUYA 3WL1A 2HISA 1V0LA 2PWFA 4MNMA 3LMYA 1B3XA 1J9YA 4JCMA 2WMHA 4QDMA 3F5KA 2WBGA 2GJPA 4AZIA 3AMGA 1TE1A 1XGZA 2A3CA 2WZEA 1TZ7A 3WH9A 2DSWA 4ATDA 4IM4A 2V38A 1B3WA 4OBRA 1X6NA 3WD2A 1JZ7A 4YPJA 4GI9A 1WDSA 1NOUA 1CZ1A 1UR0A 3FNDA 4AZCA 4P7RA 2Y24A 1EO5A 3BAWA 4DWSC 1SFSA 2YDRA 4GI8A 4EAMA 2EJ1A 1ISXA 4JL2A 1JYWA 1W32A 1E1FA 1S46A 3AJ7A 1JI2A 3WH8A 4JFSA 4MNLA 1V02E 5AYBA 2D0FA 2Y8KA 5CG0A 1L0PA 4V28A 4QAWA 1UWUA 4CCCA 3T09A 2YLAA 3LPOA 2X0HA 2WCSA 1WKYA 3MSDA 2Y8VA 1ZU8A 1V6YA 2GK1A 2VZUA 2Y2WA 3ARWA 2VX4A 2VR4A 1M01A 4AD2A 2CBJA 1Q6GA 1RP9A 3F5LA 1E0WA 3VPLA 1V3LA 1ZBKA 2WK2A 3CGTA 2PWDA 1CIUA 2YL6A 2UY4A 3F4VA 1HIZA 1HL8A 2WBKA 4BA0A 3VIIA 4UQAA 4P7NA 3KZSA 2WNWA 4KWUA 3L4YA 2BXZA 2XHYA 3AS1A 1ECEA 5C8BB 1Q6DA 4NSBA 1ISYA 3SCQA 4M80A 4J3UA 3OLIA 1EO7A 3I3BA 1HL9A 3AYSA 3T08A 1EOKA 3VDBA 3B8SA 1H11A 2YA1A 4CU6A 2VR5A 4P8WA 4OKDA 2OSYA 3RJYA 2CESA 1ZL1A 1KR0A 1W2VA 1Z32X 2WVSA 4FLOA 3PZTA 3N17A 2YBUA 3FN9A 5A2AA 1B0IA 1XCXA 3PZMA 3L4ZA 3WELA 1E3XA 2WMJA 1C8YA 2GDUA 2GK1B 4MTVA 5IHRA 1VFUA 4CD6A 5D9PA 4UZUA 5ABFA 1PPIA 2WSPA 4LYPA 1DTUA 2DIEA 4W5ZA 4WJXA 1EDQA 1CGVA 2WB5A 1EA9C 1SR0A 3CH9A 3WEMA 1BPLB 3UCQA 4UQ9A 1DP0A 4KGJA 3D5HA 3ZJ8A 4CN4A 2Y4SA 2JF6A 1K6AA 1JDCA 4PTWA 2YKKA 4IISA 1GQLA 1E4IA 3VD9A 3WQVA 1V03A 5BRQA 5JBDA 3IAQA 3SUTA 4ZFMA 4Z2HA 4HA3A 2BV9A 3MUAA 1KWGA 3NUKA 2WCGA 4H2CA 2G3JA 2OYLA 4AZ7A 2XJ7A 3M46A 2EO7A 3AZTA 2GJXB 3N11A 2AMGA 1FFQA 5E0FA 3VO0A 3UR7A 1CGYA 5I2UA 1WZKA 1QI0A 3VIPA 1UZ4A 2WHMA 1QBAA 1XD0A 1H0IA 3VGDA 3CPUA 4W7VA 2CBUA 1EIBA 3GH5A 3K1DA 1WDRA 1W9UA 1BHGA 1MYRA 2Q8XA 4NI3A 4GZIA 3WUEA 2VOTA 2VURA 2DGAA 4HZ6A 4S3JA 4AZBA 4NRSA 1DWFM 1GOIA 1C8XA 1MXDA 1H49A 2WMGA 4R27A 4JHOA 1MW3A 3D3AA 3PHAA 1V6WA 1P6WA 1MW0A 1CGXA 4H41A 1JZ6A 3ZT5A 4FLRA 5KZ6A 3L2MA 3VMOA 1GOOA 4DUWA 4JFVA 2ZIDA 3L4VA 3S6TA 5IHSA 5A3HA 1JD9A 1LF1A 2XM1A 3K4AA 1EHNA 1UWQA 2FHBA 4V27A 2JIWA 3PZNA 2J7DA 3DYMA 5AYIA 1CXKA 4MB5A 5D9OA 4W89A 2WC3A 4DWSD 3WBEA 4OOUA 1FP8A 4UOQA 1UD5A 5A8OA 2WZIA 1US3A 1JXKA 4HMCA 2OSXA 3FHQA 3VDHA 3TTOA 3RDKA 4Z2JA 4XX6A 4Q7NA 4RE3A 4S3KA 3OZOA 1V6VA 3WDQA 2D3NA 4PTMA 4WLCA 1VEOA 1XD1A 1PX3A 8CGTA 4TTUA 1E71M 2XFYA 1VFOA 3EDEA 1J10A 1WP6A 3VTRA 1JZ4A 2O9PA 2BHUA 4J3SA 2BVYA 2OWCA 2VVNA 3I3EA 2YIHA 1BLIA 4LGXA 3CUHA 1FH8A 1CEOA 3M6DA 3OB8A 5TD4A 1R8LA 1D7FA 1UWRA 1OINA 3MV11 3ZR6A 3OA5A 3OG2A 2ZX6A 4KMQA 2V3DA 3UESA 2UWFA 2F8QA 1W3KA 1PZ3A 4OOZA 1W1PA 3UETA 3RMEA 1QNQA 3SUWA 3M07A 2BXYA 2EXOA 3AHZA 1G94A 4CU7A 4PMQA 1G01A 1XYZA 2E9BA 2PWHA 2DT0A 5BXPA 1ZBCA 3B9EA 4RE2A 3RM8A 4PEEA 1JDDA 1OCQA 3U7VA 2W91A 1D2KA 4CGTA 4YHEA 1ISWA 2ZX7A 2AAAA 4D6GA 1F4AA 3W81A 4CVUA 3NSXA 4P7LA 3FXYA 4AEFA 4AMCA 2ZXAA 3VD5A 3WY1A 2UY2A 1EDTA 3CHDA 2VO5A 3PN8A 2GVYA 1IZKA 3W4RA 1JNDA 3WQ5A 3RO8A 4AZGA 2DDXA 1Q6FA 3HJEA 2JF7A 1V02A 1E4MM 1OIFA 3OLEA 3A4XA 2WMIB 1V0MA 2BHYA 1A3HA 1UKOA 3PZOA 4F66A 5BXSA 1GJWA 3SEPA 5CJ5A 1XHGA 2VX5A 2YL9A 1B31A 2ZUVA 4DM1A 2WVVA 2OSWA 1Q6CA 1UKSA 5FL1A 3IK2A 3WFZA 1HVQA 4L4OA 2JFEX 3K46A 2ZICA 1AQHA 1E6NA 4OJYA 3F5JA 4D6DA 4UZSA 3WUBA 2WW5A 3T0BA 4AWEA 1FHDA 4W7UA 4WSJA 4TOQA 1UKQA 1VBUA 5I6SA 3O9NA 1JXJA 1VENA 5EMYA 3VMNA 3FAWA 3ARUA 1J0YA 5DO8A 2ZX5A 2F2HA 2EPOA 4BQ2A 1NP2A 1OD8A 4WKAA 4HA4A 1M7XA 2XFRA 4LX4A 1JI1A 3EDKA 3VGFA 2OLHA 1BG4A 1R7OA 4UOZA 1HJXA 2J7CA 1B3ZA 1OSEA 1K9EA 2WXDM 3WNKA 5HPCA 4AZ6A 2J7GA 3GZAA 4GPNA 3KWXA 1HNYA 2A3HA 1BQCA 4TX8A 3WL0A 4TUFA 2FDMA 2EPMX 1ESWA 1LWJA 4GQQA 1UKTA 4AXNA 3CZ8A 3DC0A 1VBRA 1TVPA 1BVNP 1CXIA 4XZWA 3CHFA 3VIJA 3VD4A 5CSYA 1E6SM 5LA2A 3AIVA 1FH7A 4M29A 2AOSA 4W7WA 2YLLA 1A47A 2E3ZA 3ARQA 3AXHA 1PZ2A 3RM4A 1V3KA 4AY1A 1J11A 3CZEA 5D8WA 3QHNA 5JBFA 5AY7A 1QBBA 4BQ4A 2QLYA 2WPGA 1RPKA 5EB8A 3L2LA 5ECUA 1OT1A 3TP4A 4ZE5A 2VRQA 3VUPA 3NYDA 2G4FA 4MAZA 1OM0A 4JFTA 3MUY1 1OIMA 4B9YA 1Y7VA 3WUGA 3TA9A 1XYFA 2D24A 1C8QA 3VDCA 2CPUA 3GH7A 3ARXA 3VGGA 2A3EA 3VGHA 2BY1A 1KCLA 4W93A 4B15A 2J8FA 2E8ZA 3O2LA 1KGWA 3BAKA 4JZ5A 3A4AA 5GNXA 2XM2A 3N1AA 2XWDA 4N42A 2EBNA 1VRXA 1XSIA 3HMCA 1EHAA 1KGUA 3WF4A 1CXHA 2YDSA 4AIOA 1BGAA 1CLXA 1C92A 2BVTA 5HPOA 1E70M 2CETA 2GJRA 4M56A 4AZHA 3AHVA 5BRPA 2VL4A 3RPMA 3CMGA 1FH9A 5AC5A 4W8LA 3WQWA 2FGZA 1MWOA 3KE0A 1GPFA 4UFJA 1E9LA 1OD0A 2ZXBA 3AXXA 1TVNA 3MMUA 1CLVA 1JD7A 3AIQA 3U5YA 1QHZA 3AS0A 1JZ5A 3ALGA 2FH6A 5BXTA 1KBBA 3WD3A 2VCAA 1V08A 2CXGA 1QI5A 5BROA 5LA0A 3VOCA 1JF5A 1AQ0A 4J27A 4MAVA 5CPQA 1HJUA 4MDOA 3U5UA 2XVLA 1BFNA 3A4WA 2VT0A 4C7DA 3GYCA 1OT2A 3ZJKA 4MB1A 1RP8A 3OGVA 4UFKA 5FCZA 3MKKA 1ZJAA 1E1EA 9CGTA 1NWRA 3WH7A 1CNVA 4FLQA 4KRTA 4HPHA 1UWIA 2GUYA 2ZE0A 2DSKA 2XVGA 1C93A 1C7SA 2BNJA 4WIWA 2VI0A 4QCEA 1BTCA 5I5RA 3ARVA 1QI4A 4MDPA 3J7HA 4EKJA 2A3AA 4RE4A 5DFAA 1W2PA 3PZ9A 1C7TA 4XB3A 1SMDA 4AIEA 4QFUA 2BHZA 2DT3A 3QGVA 3VMPA 1OGBA 4P8VA 4AZCB 1CGWA 4H8HA 3L4TA 4P8UA 3AHYA 3W53A 3IANA 3VIKA 5I24A 1NQ6A 4D1JA 3AMDA 5HOSA 4LYQA 1Q6EA 2OYKA 1LG1A 4UQEA 3UG3A 1CXFA 3LPFA 3A6OA 4AC1X 2ZXQA 2J7HA 1KXHA 3CBWA 3VM7A 2IXUA 1XC6A 3SCTA 3FAXA 4ZEPA 3OBAA 4DUXA 5HDRA 1UQZA 1C3FA 1UWSA 1H0GA 4B9ZA 1JZ2A 3SUVA 2W67A 2RGLA 1OB0A 4Z2LA 3CHEA 2TAAA 1US2A 3W6LA 1UD3A 4W8BA 3WSUA 3K8KA 4JAWA 2UY3A 1JL8A 2XVKA 2Y5EA 1J0IA 3AMLA 1VJZA 3L4WA 4PBGA 4YHGA 3L4UA 1NWTA 1WZMA 1JG9A 3N18A 1FOBA 4AD1A 3CUGA 1UD6A 1NARA 2WHJA 4F8XA 3FY1A 3PBGA 1W3JA 1W9DM 4PUDA 4GI6A 4UQCA 3II1A 2WHKA 4A3YA 3ARZA 2G3IA 3AISA 4D6HA 5I77A 1H4PA 4E8DA 1IZJA 1UUQA 1R85A 5BCAA 1HKKA 1UR2A 4OBSA 3BSHA 1TA3A 3AHXA 4BS0A 3RJXA 5CLTA 1KXVA 2DT2A 4X0NA 3GNOA 1HXJA 3K4DA 3QR3A 4CU8A 1TR1A 1X1NA 1UHVA 3VX1A 1PIGA 1GZJA 3A47A 1TMQA 3AIUA 5A8PA 2VZTA 3APGA 1W9BM 2PI6A 3VILA 2WANA 3W24A 2CCRA 1CYGA 1E3ZA 2V5CA 1UR4A 3WKZA 1UD8A 3ALFA 4K68A 4U5KA 1HJSA 3PZIA 1WCGA 5IDIA 1KCKA 3FHAA 4AD0A 4DWSA 3IAPA 2WLZA 5A6LA 3GM8A 3AZSA 2J77A 1ZBWA 2Z1SA 5ABFB 4JIEA 3WH5A 2GSJA 1W1VA 3BMVA 3NDYA 4AD5A 6TAAA 1QW8A 1NOWA 3VX0A 1UWTA 1UH2A 1ZJBA 5I23A 1MQQA 1E6ZA 2FH8A 3QHMA 3GBDA 3UG5A 3WF0A 2J8GA 5GPRA 3WNLA 5JIPA 4EANA 4ATWA 1O7AA 4BZYA 1TA3B 5D8ZA 2CKRA 4Z2KA 1HT6A 3TOPA 5C71A 4L4PA 1ISVA 1PJ9A 1BG9A 1MQRA 1E55A 1UR9A 2NT0A 3NJ3A 1TFVA 1VJSA 3K8MA 4CKQA 1VFMA 2VUYA 1E4LA 2PBOA 2XIIA 4D71A 4JL1A 1UG6A 2DSZA 2GDVA 4KH2A 1H2JA 1OGGA 2YDQA 4TTGA 3CLWA 4C7GA 4W8AA 1ZS2A 2CITA 3ZR5A 3L4XA 1HF6A 3TTQA 1PX8A 3MV01 1WAWA 2EQDA 4UQBA 3EDJA 3G6MA 1UYQA 1OBAA 4HU8A 4XZBA 2D0HA 3AIWA 2W63A 3UR8A 4U5IA 1CXLA 1JDAA 1AVAA 2ZUUA 2CNCA 4FMVA 4IPLA 4FLSA 3S2CA 3GDBA 2DSVA 3DYPA 3AZRA 1DWJM 3WMBA 2ZUSA 5ABGA 3WDJA 4DUVA 3AIEA 2CHOA 4D6EA 5D9MA 1UD2A 1VEMA 3WDRA 4HOXA 5EBAA 5AC4A 2J7EA 3DHUA 1QI3A 3CTTA 1GW1A 2WWDA 8A3HA 2E4TA 1U33A 2W66A 2VVSA 1HP4A 1NM9A 2G41A 4PCSA 5A8QA 2XUCA 2HVMA 4TXEA 1LL4A 1CGUA 3CZJA 3ZM8A 1ITCA 2VQUA 1WE5A 3WMCA 2V3FA 1BVZA 1QNSA 3SCWA 2J74A 4AD3A 7TAAA 2DT1A 2J25A 3LPGA 1JAKA 1HJQA 1LWHA 1AQMA 5DF0A 3UERA 1WB0A 1W1TA 1B3YA 2DH3A 3THDA 1KB3A 4TVCA 5A6JA 1H5VA 3WF2A 1EQPA 3EDFA 2CBIA 2VZVA 4PRWA 4CD5A 5JIWA 2JEQA 4PMRA 4UFMA 1LJYA 5M5DA 1J0ZA 3O6AA 3W28A 3CUIA 3WD4A 4FF5A 1RH9A 3DYOA 4LPCA 7A3HA 1ZB5A 6CGTA 5DT5A 1E56A 4BCEA 2E9LA 3ZT6A 2VCBA 3ECQA 3GNRA 4UFIA 2WM0A 5E6YA 1PX4A 4WSKA 1JF6A 1E40A 2E0PA 3U7BA 3FW6A 1KQZA 3MU7A 3ZO9A 1F4HA 3SCUA 1BAGA 2CEQA 4KRUA 3NCOA 1L8NA 2BS9A 2D20A 1W9VA 5A2CA 2ZUMA 4GIAA 1GOWA 2RGMA 3PTMA 3AS2A 2OWXA 3K8LA 4JFUA 3SUSA 4P8XA 5CLWA 3AI0A 2VZOA 5BYWA 3VU2A 2ZWYA 1CXEA 3VNYA 1MFUA 2O9TA 4JFWA 2B31A 3BAXA 2J78A 4HMDA 1M04A 4WKFA 5E9AA 3CO4A 1CECA 2J4GA 3ARTA 4JCLA 4MJ2A 2VTFA 3ARPA 1QVBA 5A8NA 2PWGA 2E8YA 2E40A 2W61A 3N9KA 3HU7A 1VF8A 2XVNA 4W87A 1KGXA 1EDGA 1X6LA 5GQBA 5D4YA 2WKLA 3IJ8A 2WZHA 4X0VA 3W37A 1XV8A 4QCFA 3EDDA 1GQKA 5GNYA 2WHLA 3WQ4A 1AMYA 3WFLA 2WVVB 3LPPA 3SUUA 1R87A 5CGTA 1LL6A 4JHZA 4W5UA 1QHOA 3SCPA 2DQXA 4UNIA 3WF1A 1GVYA 1SMAA 2VX6A 1NP0A 4BQ3A 2V3GA 2XIBA 1GQIA 4CN6A 1VIWA 3B9DA 4F79A 4FK9A 3EBVA 2J7BA 1UOKA 5ABHA 5HXMA 4Y7EA 2WYSA 2JIEA 2YOCA 1E6PA 2DH2A 3ZQ9A 3B9AA 1KQYA 3GXMA 2F61A 5A8MA 5A2BA 5ABEA 2PC8A 3MSGA 3AICA 5FKYA 4GXPA 2VX7A 2VMFA 3POHA 1FP9A 3BCFA 3WUFA 5I0DA 5A6MA 2ZUNA 1OGSA 3AS3A 5A95A 1PBGA 2QPUA 2J79A 4HTYA 2W5FA 2FHFA 3GNPA 5D9NA 4HA1A 3WQ6A 3VIHA 4DM2A 3VGBA 1BYAA 1YHTA 2D23A 4PTXA 4MADA 2E9MA 2JALA 1QNPA 2VC9A 1BGGA 4MNJA 5M17A 3ZT7A 4MB3A 1JYXA 3POCA 2J47A 4GZEA 2OWWA 5F7UA 1MXGA 1WDQA 4PMVA 2QMKA 2ZXDA 2YJQA 1E43A 4D6FA 4PSPA 5LYRA 1XRVA 4UFLA 1EGZA 3EYPA 1UD4A 4UFHA 1CDGA 4LQ1A 5CGMA 4B3LA 3VD7A 1JAEA 3ZSTA 4E8CA 2J7FA 4PSRA 1EOMA 1HKJA 4QLKA 2WMFA 4CD8A 1DWHM 4U2ZA 1OWQA 3TTSA 3W27A 3CUFA 3ZOAA 1ISZA 4PYSA 5FL0A 1XCWA 1CTNA 1V3MA 1W3LA 1XH1A 1H09A 4HPGA 4HMEA 4U31A 4CN1A 2ZWZA 4JKKA 2G3MA 4WF7A 1B9ZA 4GINA 2ESCA 1V3JA 4A4AA 1G1YA 4M81A 4U2YA 1GONA 1EH9A 2XGBA 4IPNB 5IFTA 4JKLA 3WD0A 1CBGA 5HNNA 4ZXOA 3VDAA 2FHCA 1MFVA 1MW1A 4D6IA 2DEPA 3JUGA 5C70A 1M03A 4HP5A 2PWEA 3BGAA 2QMJA 2XVPA 2EPLX 4BF7A 1GOMA 1WNOA 3U57A 4A3HA 1E5JA 1G9HA 5CPSA 3W6MA 3BC9A 1E6RA 4EK7A 3KL0A 3T0DA 2X0YA 2XSBA 3VIGA 3OGRA 3RCNA 1FHLA 3CMJA 1WO2A 2YL8A 4UTFA 3SCNA 4PMZA 3BLPX 1EXPA 3ARSA 3RIKA 3VGEA 2JE8A 2VQTA 2D0GA 2WWCA 4PMUA 1H1NA 4EE9A 3WDHA 3SURA 3UEQA 5A69A 4GZJA 3GXDA 3VIOA 1GOQA 1QNOA 4QP0A 2PB1A 1MW2A 4TVUA 4J28A 1V6XA 4QLLA 4U3CA 1J01A 4MB4A 3ZIZA 1JZ8A 1MVYA 3WDIA 1PEZA 3OIHA 1J0HA 2BY0A 3N15A 4B16A 3MUZ1 3AFBA 1JYNA 2CERA 4F9JA 3TONA 1M53A 2O92A 4ZENA 3THCA 1XSJA 4E4PA 4RL3A 5E6ZA 4OIFA 2EPNA 1GCYA 4GKLA 1HVXA 4HZ8A 3WNMA 3ARRA 1U30A 1DHKA 4H04A 3T0AA 1UA7A 1VFFA 4QLJA 1BF2A 3BLKA 3ZMRA 1UA3A 2ZX9A 3ZSSA 3NSMA 1Q4NX 2GJXA 1QHPA 4Q22A 1VEPA 4URIA 4XV0A 4HZ7A 1V0KA 3SCRA 5JBEA 1GUVA 1HJWA 5A6BA 4GO8A 1NOFA
chains in the Genus database with same CATH superfamily
3P7YA 4ZOEA 1FDJA 2X8RA 1NDVA 3N34A 4MJ4A 1VJIA 4MKNA 3N12A 1QWGA 3AO0A 2OOFA 2G8ZA 2PLMA 2YL5A 3W74A 1LTDA 3MKCA 1TCMA 1DWGM 1UH3A 3ZJ7A 5M03A 3NQ2A 1HW6A 4Y9OA 4ORIA 3E5PA 5BOEA 1WDPA 3MHUA 4GO9A 4LU0A 2MANA 7ODCA 4LF2A 3EPNA 3UT0A 4C6IA 1YPXA 3WMSA 1UH4A 2ZUTA 2IXVA 1FFRA 3KW3A 2H9AA 4F9DA 2FZ8A 2ZX8A 3WF3A 2PS2A 2Z1KA 4ACYA 5FD0A 3C61A 3AYVA 4NF7A 1PTDA 3CAKA 4IL2A 3DHPA 2DZAA 3RN6A 4Y9PA 4BI6A 5HBFA 2GFTA 4AHOA 3N6QA 3M6YA 5F2MA 4C6NA 1J18A 4ZO7A 1Z8AA 2G3NA 4NZ5A 3M41A 1OZMA 5HQLA 3VIMA 2QV5A 4WY0F 4MNKA 1TTPA 3APYA 2JEPA 4YTQA 3QW4B 3P8IA 4A21A 3GWQA 3B8WA 4HT3A 2C6QA 3DFYA 4H9YA 1ADOA 1FWJC 4K3ZA 1LG2A 4WXZA 5G4WA 4M6PA 3BH4A 4AISA 2XGZA 1FWDC 3RU8X 3ITCA 5FF3A 4PCTA 3IJ9A 4LVFA 4N02A 4J3XA 1VBHA 3N2CA 2P0IA 1K7EA 2D3LA 2E09A 1XI3A 2BXVA 5IXEA 3LK6A 3TXVA 3OPSA 1YDNA 3AQUA 3Q94A 2PURA 4MWAE 5LA1A 1YQ2A 3WQ8A 1E72M 1NH6A 3VKJA 3EWCA 1V0NA 2PSNA 2YCEA 1GGOA 1IT0A 3EZ4A 1ZCOA 1XBZA 2OT0A 3BG5A 4D6CA 4CVWA 4CNNA 3DERA 3CL7A 4M8UA 2QIIA 3T2PA 4WGXA 4RX0A 1JZ3A 3AYRA 4N9CA 3T9PA 3U0HA 1VFLA 1N8IA 2YR1A 4O11A 4P5UA 4B3KA 3EPMA 3QLDA 1SYTA 2A3BA 5A6SA 2VRKA 5LGXA 3A3HA 4W88A 2C8NA 1XM3A 3CH0A 2PDIA 4QDWA 5L6UA 2WNQA 1PIFA 2V81A 4MYAA 5IFPA 1ME7A 3R25A 4Q8OA 3KX6A 3W1RA 4LH8A 1JYVA 1S2TA 5AHLA 3BMWA 3BZGA 4HOZA 3BV7A 1XGDA 4M7TA 1V6UA 4UQDA 3BW3A 1O12A 3EMQA 4QXIA 2QPXA 1GKQA 3O8AA 1WOBA 3DECA 4XBKA 1HQTA 1W91A 2X09A 3UY8A 2HROA 2GJLA 3BOXA 1G6CA 2AL2B 2ZYFA 3SCSA 4PFHA 5A6AA 1A5SA 3Q37A 3NO3A 3EMCA 3QRHA 3OLDA 4HD5A 3KAOA 3RAOA 4LEFA 5EFFA 4O28A 1KXTA 1XDMA 3CHCA 2ZOXA 5HK4A 4S23A 2PTZA 3RRAA 1SW3A 2RAGA 4J3TA 3U4AA 5E5CA 4U3AA 1LQ0A 1KM2A 3OZPA 3WLOA 4LVAA 4GWEA 4Q8UA 4DZHA 5BWFA 5D2TA 4N0RA 1OK4A 3MPGA 4GYPA 4W84A 1J5SA 1LL7A 4W86A 4U33A 4DXVA 4ZE4A 1W8SA 5HAOA 3G22A 1UQYA 1TG7A 3VCRA 1QPKA 2ZZ3A 3V1HA 2GQ8A 4D6JA 1K9TA 2HEJA 3GC2A 1XLAA 4PMOA 4RZ6A 3P82A 2X05A 5HWJA 4JTDA 2QPSA 1XLEA 1UR3M 5AB3A 2VWSA 2YA0A 2X16A 3RRXA 1JFXA 1Q7ZA 4O8RA 1GEQA 4D8ZA 3R89A 1CGTA 2TSYA 4PULA 1BQGA 3MQTA 1UKPA 2WC4A 1H41A 3M0IA 1MI3A 3GKAA 1WXJA 3LCXA 2DFAA 5J04A 1WZAA 1TUXA 2BY2A 3H4XA 2PDPA 3TXZA 3W1AA 1L6WA 3MS8A 4AEEA 3UXLA 3KVLA 2X2YA 3MCNA 1EB3A 2QDHA 1KFWA 2CZEA 5C2CA 3UWQA 4PMNA 1B30A 1SZEA 1MDRA 4EIVA 3H4WA 3CASA 3FEMA 1BSLA 3QYQA 2JKAA 1CPUA 3C52A 1WKDA 2XTKA 3PJXA 4KGLA 3LD5A 1XLLA 1QOXA 4RNIA 2PTYA 2PF0A 2WLYA 3FFSA 3WBAA 3M0XA 3MMDA 4JY9A 3G77A 5EMJA 2D22A 1XUUA 4JEJA 3SAZA 1UP3A 2NVAA 5A6TC 2WMHA 5B7ZA 3G1AA 3DBNA 3GVRA 1EC7A 1TE1A 2A3CA 3GR8A 3RX4A 2J9ZA 5DQPA 4JTAA 4FXFA 1CZ1A 4LB3A 1C29A 3SRDA 3OHMB 3B0VC 4JN6A 2XH7A 3RHGA 5IOBA 4IUOA 3MVTA 5D09A 3GLCA 4DBWA 3OQ8A 1SFLA 4EAMA 3UWUA 2EJ1A 1E1FA 3HMJG 1JCJA 2CLOA 2X7VA 8XIAA 4TU1A 2OB3A 3NQCA 4RKAA 2QXWA 3ABOA 3XINA 4F48A 3S5SA 1LROA 3LXBA 5CG0A 1XQKA 1L0PA 4QAWA 3B06A 2G96A 3NTYA 4QRNA 2YLAA 2R91A 2YFNA 2WCSA 4GIYA 4IJRA 2WKJA 2Y8VA 1J6OA 2HK0A 2O0TA 4B5NA 4AG0A 2Y2WA 2VX4A 2VR4A 3SRHA 2XISA 3JS3A 5HMSA 3A5VA 1E0WA 2RDXA 2RKXA 3NQ8A 2WK2A 1CIUA 3L21A 4LUTA 3WMLA 4WUIA 2UY4A 2E1DA 3IVTA 2PAJA 1AH3A 2P3ZA 1TMHA 1K4HA 2WNWA 4KWUA 5EGRA 4O54A 5ECVA 4XAFA 5C8BB 3TWAA 4RE0A 4LALA 1KTNA 3I3BA 3AYSA 1EOKA 3DENA 3VDBA 3S3GA 3K2GA 1H11A 2HNEA 2EG8A 3DH7A 4QEEA 3PUEA 2WJDA 2CESA 2YXGA 4FLOA 2ZZ6A 4GYJA 3NQ6A 2HS6A 3PZMA 3L4ZA 3WELA 3H12A 2VEIA 3GVVA 2A4AA 4CD6A 3H6OA 1A5BA 2WSPA 5AHNA 4WJXA 1XIJA 4MKVA 1EDQA 1WBJA 2WB5A 3U8GA 4IH3A 1SR0A 3K5XA 3WEMA 4CN4A 1QASA 4C91A 1M9HA 5DMLA 1ELSA 2BGSA 1QXLA 1JJKA 2X1TA 4PH6A 2B7NA 4PTWA 2VFIA 1GQLA 3T0TA 3LV6A 1KFLA 3PJWA 5BRQA 5JBDA 1RY8A 1XDLA 4HA3A 1BF6A 3GR7A 3QY8A 3PB2A 4GVGA 1EZWA 1G7UA 1HL2A 3AZTA 3N11A 4A3RA 4OGZA 1OCBA 4H01A 3IRSA 3VO0A 2ZVIA 1RJPA 3CC1A 2E67A 3DFHA 1WZKA 1QI0A 1NDWA 2PGRA 1QBAA 5LIUX 3NGJA 3O63A 1YPIA 1W5NA 2H3BA 1C8VA 2CBUA 1QTWA 3EWBX 1T6MA 1BHGA 2W3ZA 5DRIA 3M4HA 1RBAA 2F2KA 3A21A 4M0XA 3ME3A 3UXIA 2VUNA 3TX9A 4R27A 1MW3A 2J6XA 1A5KC 1V6WA 1P6WA 3IK4A 3VOJA 4FLRA 2QJJA 5CBJA 1GOOA 4DUWA 2C18A 1SW0A 4JFVA 3S6TA 2OXNA 4JIIX 4GC4A 2BODX 3K4AA 1LOQA 1UWQA 4NX0A 5FJRA 3I10A 3KDOA 2WC3A 3WBEA 1FP8A 3ZLHA 4HCLA 2QIWA 4GYFA 3T4WA 2QJHA 3REQB 3FHQA 3RDKA 5HJXA 3Q58A 3WDQA 3C3UA 4PTMA 4UUIA 4WLCA 4PRRA 1CI1A 4QDPA 4TQTA 1SJCA 4EF9A 1QO2A 1E71M 3VTRA 2O4QA 1WP6A 2OWCA 2VVNA 1CEOA 1QPQA 3EXSA 3S0CA 1H1ZA 4KMQA 1DOSA 4JTRA 1FUYA 3UESA 1R3SA 1ZNNA 4O4VA 3W7QA 4FEZA 2FTYA 2F8QA 1H51A 1MUWA 2VEFA 2EXOA 3MP3A 4KETA 1VR6A 1G94A 1UP2A 2PWHA 1JPHA 1REQA 4YHEA 2Z1XA 3KBVA 2ZX7A 3LV5A 2GGHA 2HSAA 3NSXA 3FXYA 4AEFA 3DAQA 5LXEA 1VLIA 2VO5A 3PN8A 4D2JA 2FGBA 1JNDA 5DLCA 4AZGA 4I9AA 2JF7A 1E4MM 1YXYA 4XVEA 3E02A 4H7CA 3PZOA 3R5EA 4F66A 4Q8NA 4DPQA 4INFA 3NZGA 3EKLA 5LNUA 2ZUVA 1I2OA 1TB3A 4I8YA 1UKSA 2Y0FA 2ZZ5A 3IK2A 3WFZA 2HQAA 1XP3A 2PGFA 3T44A 4OJYA 3UBPC 3F5JA 4D6DA 2FVKA 3KCOA 2RDTA 4L9XA 4H19A 4EAYA 5I3HA 3T0BA 3G1HA 4W7UA 1UKQA 1EJRC 3LNMA 4HSHA 3O9NA 4YVPA 3WZ0E 3FKKA 1ML1A 3TDFA 4BQ2A 1NP2A 1KM6A 4Q8WA 3WQOA 4HA4A 5REQA 4PRTA 2E1WA 3QMSA 1W3IA 3V5OA 4UOZA 3EEZA 1HJXA 3O0KA 1OSEA 3B0PA 1XYLA 3MBFA 4U4MA 1AZ2A 2A3HA 1BQCA 3WL0A 5CC6A 2WO5A 3ENLA 5JQ9A 1BXCA 1ESWA 3NQMA 1LWJA 3G1VA 1TPUA 3SADA 3CZ8A 4LUYA 1PHWA 1CXIA 1MEWA 4L6OA 1H60A 3ABXA 1FH7A 4IMDA 1X1OA 2YLLA 1LCOA 5JH2A 2E3ZA 3XIMA 1ZAJA 1HO1A 4UB9A 4M7SA 5G1TA 4H00A 5AY7A 3AUOA 2QLYA 5EB8A 5ECUA 3S6OA 1UASA 1SR9A 4I3GA 4GK8A 3P74A 4JFTA 1RQHA 3BGGA 1ZJIA 3MUY1 1Y7VA 4HU3A 5JU6A 1C8QA 5I03A 4RXGA 4PCFA 2GWGA 3GH7A 2R14A 1IIHA 3V1PA 5LIXX 4IZGA 5ABTA 4W93A 4C90A 2QCEA 2J8FA 2E8ZA 3M64A 3O2LA 5C2GA 3BAKA 1EJWC 3A4AA 2D73A 3LM7A 4C1NA 3C5QA 2EBNA 1XWYA 3DESA 1VRXA 4MUZA 3PFRA 1KGUA 3G8RA 3MBDA 3F4DA 3STPA 4AWSA 1LM1A 2YSWA 3R7MA 3S9ZA 1FCVA 5BRPA 3RPMA 4Z17A 1FH9A 3WQWA 2HBVA 4ZGYA 1MWOA 2GGEA 1KKRA 4N7QA 2ZXBA 4XAZA 3AXXA 3AC0A 4PC8A 3I6EA 3D47A 3AS0A 2IMRA 3L7RA 3M0VA 3ALGA 2V0TA 4FPSA 3IV8A 5I00A 5LA0A 3RO6A 1K6WA 3G1RA 4MAVA 3C2EA 4MDOA 4LY8A 3U5UA 1BFNA 3FXGA 1XRSA 2I14A 4RLIA 3O06A 3VNJA 6XIAA 3CPRA 4QGCA 4GKTA 3CYJA 3XISA 2GOKA 2OEMA 1YNYA 2GQ3A 4OFCA 1NWRA 2QDEA 4HPHA 1UIPA 3S1UA 1RVGA 2GUYA 3UZWA 4H7ZA 1C93A 5CBBA 4IQEA 2QCLA 2YCIX 1F5ZA 1HKVA 3ITYA 4M6UA 2NVDA 4EPEC 4M3PA 3TLLA 3B05A 4KIRA 3J7HA 4EKJA 2R1KA 5D32A 1W2PA 3QGKC 2DT3A 1NF0A 4GCAA 4AZCB 3UXAA 3TR9A 3L4TA 3EOLA 1EJVC 4UWMA 4V1YA 3M43A 5I24A 2J66A 3SSJA 4LYQA 3PPHA 2OYKA 1ITQA 3UG3A 3A6OA 1YADA 1E1CA 2SFPA 3QYSA 2NLIA 4GNJA 4LT9A 2J7HA 4JQ4A 4TIMA 3WLHA 4OV9A 1OF6A 1ZENA 1MNZA 5AZ0A 5H8MA 1XC6A 1UQZA 2DJLA 3ES8A 1H0GA 4DZ5A 2HZGA 1DBTA 3LMZA 1HO4A 1P1MA 4LAOA 2AMXA 5FEZA 1OB0A 4N4QA 4MWAB 2G4JA 4XAPA 3JVAA 1US2A 3W6LA 2ISWA 3K8KA 3P67A 4JAWA 1JQVA 2EPHA 1JL8A 3L4WA 3LGDA 4PBGA 2H8XA 3CIWA 1S39A 2IQ0A 4B4FA 3CUGA 4F2UA 1YBQA 2ZFAA 4C1LA 2WHJA 4F8XA 3FY1A 3HG4A 4PUDA 1XXXA 1P4CA 2INEA 2VKZG 2WHKA 4A3YA 4I90A 4A8NA 3MUCA 1H4PA 4E8DA 3WJZA 1UUQA 3BSHA 1FDZA 1KXVA 4IP4A 3W1UA 3K4DA 3RR1A 4CU8A 3KBWA 3VX1A 1UHVA 3VNDA 4RNFA 1TMQA 3APGA 3HIJA 3VILA 3O15A 6XIMA 2XIMA 4G2DA 1IXOA 4B2DA 1UD8A 2FZNA 4IFKB 2FPYA 1ZPTA 2QAPA 2GPTA 3IAPA 3GM8A 1FQ0A 2Z1SA 1P43A 2GSJA 1W1VA 1NOWA 1EJSC 3U2CA 2C1HA 4ZVJA 1MQQA 1P7TA 4HHMA 4GACA 4XO6A 4RDYA 3GBDA 3UG5A 3PBWA 3E12A 3WF0A 3WNLA 1GVQA 3UWZA 5G1YA 3LCGA 1HT6A 4L4PA 1PJ9A 4M5PA 2OTDA 1KRCC 1BG9A 4X2RA 3VAVA 1VJSA 3K8MA 4WDUA 1E4LA 1JQXA 1SO5A 2QEZA 2XIIA 2XIQA 4K36A 3GQYA 1UIOA 1UG6A 4TTGA 3CLWA 4C7GA 1ZS2A 4AQLA 3ZR5A 3CM4A 3L4XA 2PP0A 3LZ3A 3T05A 3M5XA 2A0NA 4UQBA 2J9XA 2PU1A 1UYQA 3C0LA 1S5MA 1KLYA 4XZBA 2D0HA 4GI4A 2W63A 1EX5A 1OY0A 4NNAA 1L6GA 1FWIC 1JDAA 2ZUUA 1Z6KA 3B8TA 1NJJA 3GDBA 2DSVA 4GX8A 1RPXA 7PTDA 2ZUSA 5ABGA 1IWBA 2CHOA 1QATA 2BOEX 1F6PA 4YIWA 4D6EA 4E0CA 4DYKA 4B5XA 4H9TA 4ES4A 3EX1A 6ENLA 3LSCA 2J7EA 3Q67A 1W56A 2PDFA 3UG8A 1TV3A 4ZA0A 1U33A 1PIIA 2W66A 4GBUA 1NM9A 1K8ZA 4NAEA 1Z89A 3W01A 4NAFA 1HGWA 1P6CA 2Q8LA 1EP2A 4WRHA 1G4TA 1CW2A 2VQUA 3FGCB 3URNA 3IGHX 2V5JA 3ABQA 3U2OA 3W7GA 4AD3A 2BVWA 3KBJA 1W1IE 4F0RA 4YCPA 2DT1A 2J25A 2DV0A 1JAKA 5DF0A 1J2WA 4DO4A 1NELA 1W1TA 3GY1A 4JTKA 5H91A 2Z27A 1TPVA 3TV8A 1TJRA 2WQDA 4LYKA 2DH3A 3THDA 2V2HA 1W3TA 4HGXA 4ZMGA 4WR3A 1V4YA 1EQPA 2VZVA 2JEQA 4PMRA 3W9ZA 2XZ9A 1BRLB 3W28A 1Q66A 2BGQA 3WD4A 2R1LA 4FF5A 3CXOA 4LPCA 3BG3A 1ZB5A 5I3IA 4M6VA 3C2YA 4AAJA 1E56A 4FX8A 4GNVA 4UFIA 2WM0A 5BU9A 5E6YA 1PX4A 2DP3A 1QU4A 4UNKA 1JF6A 4WSKA 1PDYA 3W75A 1E40A 1T0OA 3GS6A 2QCDA 4Q4OA 2O56A 4JPGA 3ZWTA 2Y85A 3SCUA 4KRUA 4GVIA 2Z6IA 2AQOA 2RGMA 3PTMA 1WDWA 1K4GA 3K8LA 2PGWA 4FAMA 5GJMA 3NR0A 1A0DA 5CLWA 1DQUA 2UV8G 5D2VA 4PTNA 2PWVA 4JNZA 5BYWA 1ZCCA 2P50A 1Y0EA 1OFEA 4NZFA 5I3JA 3NYZA 3VNYA 3GW3A 1L6FA 2O9TA 2HXTA 3T8QA 4E2DA 2REQB 3BAXA 3CO4A 1R9ZA 3EWYA 2J4GA 3M44A 4JOMA 5A8NA 3JU2A 2E8YA 1AH0A 3N9KA 4DWDA 3AXMA 3IJLA 4FX6M 4S3DA 5MF5A 3W37A 1YE4A 1RV8A 4QCFA 1C9DA 1DIKA 3EDDA 2AKMA 5LXXA 1RXOB 1US0A 1HGYA 3LPPA 4OECA 4A3UA 1R87A 4Q8VA 2XH0A 1Z42A 1R3WA 1TPH1 2J27A 1GJPA 4G1KA 5KMYA 2Y7EA 4B5TA 2I5QA 1GVYA 3ZVIA 3P14A 1IT8A 1YMYA 2VX6A 3NVDA 3GC5A 4XSLA 5D05A 3BG9A 4CN6A 2ODOA 1VIWA 3B9DA 4FK9A 3TAOA 4K1WA 4UTWC 2JQXA 3IIZA 5HXMA 4K1GA 4H6RA 1EPVA 1M68A 2I57A 3W6YA 3BV4A 5A2BA 4F0KA 5CBIA 4I7WA 3TC3A 3AICA 5FKYA 4DQWA 3QQWA 1E0TA 3POHA 4NXSA 4ALDA 2ZUNA 1PBGA 5BZAA 1WV2A 3IIVA 5D9NA 5C5YA 5C9ZA 3VIHA 2F6XA 2HWGA 3DKJA 2PDGA 4PTXA 4MADA 2FFCA 3ATZA 4MB3A 4PB4A 1JYXA 4US5D 3POCA 4CQCA 4DLMA 4IQDA 1IWAA 1ADSA 1SSGA 4PZVA 4JS3A 2YJQA 1E43A 3TAKA 5HNTA 3ZS4A 5CPMA 5LYRA 4S3EA 2IPGA 4HSOA 4C6EA 1KW1A 4UFLA 4UFHA 2QCCA 5CGMA 2QW5A 3M0MA 4IPJA 5H8UA 3USBA 3L9CA 3GYEA 2VD9A 1HKJA 4DI8A 1OEPA 3D3FA 2OMAA 1DWHM 3TTSA 3W27A 3CUFA 2EGZA 4WJ8A 4GGBA 1UC4A 4CN1A 1W3LA 4U31A 1H09A 3E5BA 1LYXA 3E74A 3LQGA 4C6LA 3B8UA 3LHUA 2Z1BA 3G1FA 4WF7A 1B9ZA 2CZVA 4E3VA 3OTRA 1KTCA 1QMLA 2VGIA 1X8FA 4NL1A 4M81A 1S3HA 1QUMA 3C4UA 2NZLA 5A5WA 4EACA 4FXSA 3OVGA 1YTEA 3GXPA 5L9FA 1M6JA 3B4YA 5HNNA 4YMZA 2V82A 4IMAA 4ZO8A 4FB7A 4I8DA 3H7UA 4AHQA 2EPLX 5LNSA 1JRCA 1IEXA 4L64A 4PBFA 2YBVA 4WY0A 3MI3A 1ZY9A 3IVSA 3ZYZA 4XAGA 1S5NA 1V7AA 5HWMA 3N73A 3BLPX 3ARSA 3QW3A 2VQTA 4OU1A 3DC8A 2ZTJA 3WDHA 4DVOA 1H62A 3UEQA 3CK5A 3C2FA 2HTMA 2IKHA 1U1HA 1GOQA 3ITTA 2OGYA 4QP0A 2PDQA 1RALA 1V6XA 1FX6A 3DI1A 2FJKA 1JZ8A 3K1GA 1MVYA 4H4IA 3LHTA 4FA3A 1MEIA 3DOPA 3CAQA 2QUMA 1PCWA 4CQ8A 2CERA 3TONA 1B5TA 1EF3A 3LCWA 4O19A 3THCA 5C9WA 1XSJA 2P53A 4RL3A 4OIFA 4BK9A 1GCYA 2D2HA 3C8NA 2CZDA 4HZ8A 1JCTA 2GL5A 4KFNA 3ARRA 1U30A 4H04A 1JPIA 4LRTA 3BLKA 3ZMRA 2YCKX 4HCDA 4PTDA 4QJ4B 3W72A 1V79A 2GJXA 1YKWA 1VEPA 4DB7A 2C16A 3SCRA 3ERPA 1HJWA 4LBUA 1JULA 5A6BA 2B7QA 3KWSA 1AJZA 4HNNA 4J2PA 3V3WA 1PYFA 3TSBA 1FWFC 3I7QA 1HP5A 5E1QA 1BYCA 4AW7A 4HNUA 4WHBA 4S38A 4RDZA 1XLMA 3VZYA 1W6TA 2Y70A 1QW9A 4Y2WA 2E7FA 2J6VA 1A5NC 3VDGA 2HS8A 2BVDA 1A3WA 3GDMA 3NIYA 3TYBA 2D1ZA 4A29A 1Y5XA 3VM5A 1E0UA 4D8LA 1YX1A 5JMUA 3NZ1A 3N2XA 1E0VA 2HE5A 3GTXA 3F1QA 4H8VA 1WQ5A 3GTNA 2FB3A 2VDHA 2DZXA 1FWAC 4RR4A 3MO4A 4UNLA 3W7DA 3VCCA 4ZOCA 4DO5A 4HHPA 4DHGA 2O7QA 5EBUA 3S2NA 4LYRA 4RPQA 1UR8A 3I7RA 3UJ2A 4XK2A 2VNCA 1XBXA 2XSAA 3A13A 3PTKA 4DWSB 2R1MA 2IQTA 5CPLA 4PMJA 3RR4A 2J62A 3H70A 3GH4A 4F0HA 2YX0A 3R8HA 4AVFA 1XC4A 4KWOA 2UY5A 3PC0A 3U48A 1PB0A 1EC9A 1TPWA 3B4UA 3PTDA 3URAA 3PAOA 3KZPA 4PMYA 3QEZA 4PMXA 1GORA 3WLLA 5MKGB 3WJYA 1N82A 4PCNA 1D9EA 2FZMA 1B3VA 4UOJA 1J6PA 1YNPA 2RDWA 4CCDA 4TX6A 1AODA 3G6LA 3WN6A 1CENA 3HFYA 3N4AA 4Y9MA 2C0HA 3KS5A 3BAYA 4ZSTA 5DEZA 3USZA 3ONCA 3CZKA 4M1RA 2QJMA 5A6KA 4XISA 4TMBA 3VE9A 4JIRA 5H2ZA 3VVGA 3L2IA 1V77A 4Z2IA 3PZQA 3BOFA 3T8LA 2WMIA 4ZO9A 3WQDA 3KL5A 2VZSA 1FDYA 3MCOA 3LZ5A 1EKOA 1JGIA 2WC7A 3W1NA 2OELA 4AHPA 4YYCA 4WQ6A 1E6XM 1ODUA 2VFGA 3SFKA 4BQ5A 4W85A 1ZAIA 3W1PA 1V8EA 5KEZA 4O13A 3RM9A 3W26A 2RUSA 3TC6A 1VRDA 1I0BA 3UWEA 2PLKA 4OHQA 2ZRXA 4OTKA 2NSXA 1W5MA 4KRZA 2O4MA 2DSUA 4ILSA 5D30A 1WXYA 1NWSA 1WUFA 3VFLA 5I3DA 3PZGA 2DJXA 3P0XA 5D03A 3WH6A 4FOJA 3HPSA 1KXQA 2WV8A 4ACZB 3BAIA 1UZ1A 4M24A 2H3DA 3WIJA 4Z2GA 1DWIM 4UR8A 1BXNA 1HKMA 3NDZA 5I09A 1EQCA 1JVNA 2PDUA 5BOFA 2DUXA 3IV3A 3W38A 4W4QA 6A3HA 5IDZA 4R34A 4DJFD 3GW0A 5CZKA 3T2OA 4DEFA 1U2YA 3W7JA 3NXFA 1KR1A 3N6HA 1QR7A 1VB9A 4QS5A 5FIPA 4CD4A 4QHRA 5T8GA 4HOWA 2X41A 2Z29A 1XLDA 2CLFA 3P6LA 1VP5A 3H8AA 3RYSA 3DIPA 3B04A 1F9CA 4ASTA 2BMBA 1X6UA 3GBEA 4XBSA 2V8ZA 3SCVA 3HV8A 2FMOA 5AYXA 4A3QA 1VAHA 1U5HA 4ZOAA 1TPB1 3AIRA 4JQ1A 2VEPA 1DPMA 5CCZA 3S1GA 3NPWA 1R86A 1A0EA 3KUMA 1LLOA 3TJIA 1A53A 2XYLA 2CIPA 5HQMA 1DV7A 2WSRA 4OE7A 4N6EA 2FTPA 3E96A 3TU9A 1C91A 2G50A 2VC5A 2PP3A 3LHZA 5C6MA 1L9WA 4V2XA 4YTRA 2I5GA 3QPYA 4Y96A 4CCEA 3WG6A 2L5HA 4CD7A 1KV8A 3GG8A 4HA0A 2QQ6A 3RITA 1R7AA 3PVFA 4AIUA 3EGJA 2E6FA 3W0KA 4PTVA 1X7FA 4OUIA 4Y9NA 1OCNA 4MY9A 1Q6RA 4P7OA 3MANA 1THFD 3HN3A 3IJ7A 4FNTA 1VHCA 3FA4A 1A5LC 2P5NA 3AROA 3OZMA 1WAUA 3Q45A 1TWDA 2CHNA 3FA3A 3GXNA 3BZJA 3OODA 7CGTA 2NQ9A 2XFFA 1LZOA 3MVIA 4IQJA 3WQCA 2VGGA 4LCQA 3W82A 3ZFHA 4MF4A 1JNEA 3VE7A 4J7RA 1UP0A 3E1F1 3IACA 5M2FX 4FNPA 2ZADA 1H5YA 1AK5A 3MJMA 1PAMA 5FOOA 2ONEA 3WL1A 3BURA 1OC6A 2PWFA 5GJPA 5AHFA 5I3GA 4JCMA 4QDMA 1EP3A 1R30A 3F5KA 3QTPA 2C0AA 3OZYA 1RBLA 2WBGA 3EWUA 1XGZA 3CV6A 4XTIA 4DUOA 2WZEA 4ATDA 3WH9A 2DSWA 3CV1A 4OBRA 4TMCA 3WD2A 1JZ7A 4GI9A 1NOUA 1Y5WA 2B0MA 3OYXA 2VXNA 2Z24A 5HANA 1S2VA 3E0IA 6PTDA 1SFSA 3CO8A 3QPZA 2HPMA 7XIMA 4LV9A 1TX0A 5CGQA 1W5OA 1S46A 3AJ7A 1JI2A 4AYGA 3WH8A 4JFSA 2A1YA 2ZC8A 2G95A 1IXNA 3SQLA 2JBMA 1FKXA 4UTWA 5HMFA 3QTGA 4V15A 2NV2A 2V67A 3EX2A 2WZTA 1UWUA 3TN4A 2PDLA 3UJRA 1FVPA 3O7UA 1UOZA 4Y8EA 1WKYA 4GC3A 1J79A 3MSDA 4R9XA 3SN0A 3S2JA 3ARWA 1MRQA 5FJJA 2FMNA 4AD2A 3H4GA 4R7WA 1RP9A 1W1A1 1QOPA 3CGTA 2NWRA 4F2BA 3S1VA 5HWNA 4GD0A 3F4VA 2WBKA 4AWUA 3SDOA 4LEQA 2ZVRA 1OFBA 1TR9A 4HNVA 1BD0A 2F9RA 4WDWA 2XHYA 1Q6DA 3SCQA 1ISYA 5HJYA 3G0XA 1JPMA 3T08A 2YA1A 2VR5A 2DUZA 4DAIA 5AHIA 2OSYA 3RJYA 3JZUA 3LTYA 1KR0A 2NQLA 1Z32X 5AYZA 3CIXA 3N17A 1TJPA 1XIBA 3LENA 2E28A 1E3XA 4LAUA 1C8YA 2GK1B 2VFFA 3FLUA 3WQPA 2Y7GA 1PPIA 2W6RA 3ZXWA 2DIEA 3AAMA 4G6CA 1TKKA 1CGVA 2PDXA 1GVRA 4KGJA 2POTA 2JF6A 1JDCA 3W00A 2I56A 2GVGA 3VD9A 2VHLA 4IP5A 3B9NA 1ITUA 1EJUC 3KCLA 3KOYA 3ITOA 3E2VA 3SUTA 2CLIA 4ZFMA 4QNWA 3SN4A 2G3JA 2OYLA 1UMLA 1YTKA 2D2GA 2A7NA 1H7RA 3A3XA 4GFIA 5LZLA 4LVBA 5E0FA 3QJAA 1NY1A 1CGYA 1I4NA 1MMFA 2PDKA 5I2UA 3UR2A 3CPUA 2OCZA 3EEGA 3LSBA 1WDRA 1W9UA 3QFWA 2Q6ZA 4GZIA 3NDOA 3ZWSA 1S1RA 4NHVA 4L9ZA 2QUTA 4S3JA 4AZBA 4NRSA 3ID7A 5FF0A 1C8XA 1H49A 2WMGA 3H21A 4DJDD 2XFWA 1JPKA 4H41A 1JZ6A 5KZ6A 1A4LA 3FJNA 3L2MA 2ZC1A 5ENLA 1A80A 2H9AB 5IHSA 3Q65A 5A3HA 5JVLA 3TFCA 1QK2A 3DYMA 4GE8A 3R79A 4P2VA 4W89A 2ACSA 2QAFA 1UD5A 4C1KA 2ABBA 3CMFA 4Q6XA 4UC5A 4XX6A 4Q7NA 4RE3A 3UWWA 4S3KA 4A6GA 3LI1A 3M5VA 3VNKA 1R3VA 1PX3A 4O57A 2BOFX 1YPFA 1VFOA 1JZ4A 2WNZA 3TJ4A 2BHUA 3E2SA 3GTHA 2BVYA 4KKXA 2OJPA 4KWVA 1UC5A 3OB8A 4GYPC 1EPXA 1GYNA 1OINA 3ZR6A 3OG2A 3LCIA 3DXIA 3UZZA 4JYEA 4Q4QA 3LQLA 1PZ3A 4QE4A 5HNRA 1W1PA 3UETA 3RMEA 1QNQA 3SUWA 3RU6A 1XYAA 3N25A 2BXYA 5EYWA 3AHZA 3VNMA 4R88A 4QX4A 4Q32A 4IXXA 1GKPA 4NYYA 4CU7A 2Y61A 3B9EA 4RE2A 1KBJA 4NUWA 3KHDA 3U7VA 1FBAA 2W91A 1D2KA 4LUSA 3IUHA 1ISWA 2AAAA 4D6GA 1F4AA 4CVUA 3KDNA 4AMCA 1OABA 3QLLA 2FPVA 1UBSA 3CHDA 1GVOA 4NIRA 3QXBA 3I65A 1WKFA 3WQ5A 3BOLA 3HJEA 1Q6FA 1TWZA 3C0SA 4RJEA 3G3MA 4DLFA 1A3HA 1F61A 4RZBA 5AKQA 3BVJA 3SEPA 4JHMA 1XHGA 3LRMA 3DEQA 3STEA 1B31A 4C60A 4DM1A 2WVVA 4O1FA 3N9SA 4B5UA 3RLUA 3KS6A 1Q6CA 4GXMA 1Q3NA 2GVJA 3OU8A 5FL1A 3W2UA 3IIPA 2JFEX 2PDBA 1AQHA 2YCJA 1UJPA 2NXHA 4U10A 2WW5A 1KM5A 1P6BA 3S47A 3TFXA 4AWEA 1PUDA 7REQA 1EFZA 4EWND 1VENA 3VKCA 1PYMA 3WCZA 4DY1A 3N2MA 3DFPA 4DO7A 1J0YA 2ON3A 4E38A 3IGSA 4Y9AA 4WKAA 5G2WA 2KAUC 5C9RA 4IT1A 1B3ZA 4AZ6A 2Z26A 3CL8A 3EAUA 4I6VA 1POKA 4GPNA 2QCMA 4PBEA 4E4FA 2E6DA 3H24A 4GQQA 5DMNA 3FJ4A 4RK8A 5BOOA 3DC0A 1VBRA 4G1NA 3GK0A 3CHFA 2X40A 1YDVA 5CSYA 3VD4A 5LA2A 2AOSA 3SGZA 3TN6A 4ERGA 4I9MA 1A47A 3S9YA 3L23A 4RDVA 3GE7A 2ZA3A 3AXHA 4AXKA 1V3KA 1MRAA 4AY1A 2RH9A 1Z69A 2EKGA 5LHEA 3CZEA 4IMEA 3QHNA 5JBFA 2CW6A 3MJYA 1MDLA 2OR2A 3VUPA 4QQ3A 1M5WA 2DZVA 4MVAA 3KLKA 5C7HA 3W1QA 4KERA 3GU2A 3AU2A 4HMNA 1XYFA 2D24A 3W87A 1XLCA 3GDRA 3L5AA 3D6NA 2CPUA 5DBTA 4K8EA 2A3EA 3CL6A 3VGHA 4HSNA 1RCXB 3CNYA 1AMKA 4Q4SA 4FXRA 3M0LA 2B81A 1UB3A 3S1WA 4EXQA 3BWWA 4MGGA 3H53A 2XM2A 4PL1A 2XWDA 4N42A 1RK6A 1XSIA 3HMCA 1CXHA 1QK0A 1YEYA 4I7UA 3TROA 1T5AA 3QSTA 2PE4A 2YDSA 5XIMA 2DQWA 1BGAA 3WLQA 4XSMA 3M47A 3KTXA 2CETA 2A6LA 2GJRA 4AZHA 1DJXA 3AHVA 2VL4A 5HUOA 2FGZA 2VEKA 3KE0A 3KM8A 4UFJA 1FY6A 4ZB5A 1LT8A 3T1GA 1RY0A 2P0OA 4Z1DA 4MFDA 1TVNA 4GISA 4DZIA 1CLVA 1JD7A 1JUBA 1QHZA 3W2JA 4F0MA 1R2RA 4LS1A 1JZ5A 2FH6A 3U6WA 1KBBA 3WD3A 3IIXA 3WJWA 1V08A 2Z7KA 1QI5A 4A8IA 4PGLA 3M1ZA 1Z48A 1JF5A 1RLDA 5CPQA 1Q45A 4DYEA 3F2CA 2XVLA 2CLPA 4GZ7A 1XPYA 4IL0A 1OT2A 3ZJKA 4C7DA 4E4UA 3OGVA 3IARA 4JX5A 1P0EA 1XISA 5FCZA 9CGTA 2POZA 4BHYA 4C6JA 2PODA 4KPLA 4O10A 3GG7A 2VENA 2ZE0A 4YYFA 1M7PA 2ATSA 3V0TA 5B7YA 4JTUA 1N7KA 4QAIA 1EEXA 3ARVA 3VOIA 3QZEA 2A3AA 1F05A 5DFAA 4FI4A 1A5OC 1XG4A 1Q63A 4QNEA 1OFQA 3QGVA 1OGBA 3DHFA 1XIMA 4GH3A 4N9EA 4H8HA 1ICQA 4AVNA 3WLIA 3CJPA 1FWEC 1I2RA 1FRBA 3MYPA 4D1JA 3AMDA 1XINA 4I5RA 4GY7A 4UQEA 3FX4A 4AC1X 4E2BA 3QBUA 3EWDA 2ZXQA 3W1LA 4ZQOA 5I07A 2DZUA 4JTIA 1IEVA 3CBWA 3SCTA 4FO4A 4DUXA 1UWSA 1P5BA 4B9ZA 2PD5A 2PC4A 3SUVA 1TV5A 2RGLA 1YIXA 3QVQA 1IQ8A 4G9PA 1UD3A 3BO9A 4TX9A 3CB3A 1J0IA 1W1B1 1VJZA 1XR2A 4YHGA 1OYBA 3P80A 1ZTVA 4AB4A 2INFA 1JG9A 4AD1A 4NVTA 3PBGA 9XIAA 4LUTB 3PJTA 3WLTA 4PUJA 1TJ1A 3PR2A 3ARZA 2G3IA 3GZ3A 3NL2A 4NYUA 4D6HA 5I77A 5CH9A 1IZJA 1R85A 5BCAA 1HKKA 1UR2A 2AAMA 3AHXA 2PTDA 4NZ1A 1CCWB 4PUWA 1R9YA 3CAVA 3PG9A 3GNOA 1HXJA 4O1EA 3QR3A 1PIGA 4J35A 4R33A 5A8PA 3WK1A 2X0SA 3WQGA 3CAWA 3RCYA 1YDYA 1E3ZA 4S3FA 1Q6OA 1JR1A 3R12A 4K68A 4U5KA 1HJSA 5CZ0A 4AD0A 1HTIA 1ZAHA 4QITA 1RD5A 4XD3A 2J77A 1ZBWA 2VGFA 3UW6A 6TAAA 4AD5A 1ZALA 3QY6A 5D2WA 3SBFA 1UH2A 3TK7A 5I23A 2C1GA 3KOFA 1XKJA 4HB7A 4AEOA 4FALA 5JIPA 3FEQA 4EANA 4UIOA 4NJHA 4BZYA 1TA3B 3NGFA 3TOPA 3W23A 4DNMA 1ISVA 1DHPA 2FVMA 3R0DA 3ELFA 1P48A 1YDOA 2NT0A 2ABAA 4HK5A 1QO5A 4CKQA 2VUYA 1P0DA 1XRFA 3WLPA 4D71A 4JL1A 4W8AA 4AF0B 4E2VA 1BXBA 2QULA 1FCBA 1PX8A 3MV01 4DPPA 4IXHA 3HPXA 5FF2A 5FJUA 2Z2UA 3G6MA 5DY3A 4CEUC 2DZPA 4HU8A 2IKGA 4WX2A 1SO4A 3MWAA 2DW7A 2I17A 5C0QA 1A4MA 3VZZA 3TSMA 4KIEA 2ACRA 3TQVA 3DYPA 3B0XA 3UNDA 1MUMA 1DWJM 1GZGA 8TIMA 4DUVA 1UD2A 3LGEA 1VEMA 3IUIA 1BRLA 3WDRA 4QE5A 5AC4A 2W79A 3DHUA 4LOCA 3FCPA 3D0CA 2WWDA 2BBFA 2E4TA 1FXQA 2VVSA 2NV1A 3ZZ1A 1HP4A 2V6AA 4PUUA 2XUCA 3MSRA 2HBXA 2GUUA 4TXEA 2E5BA 3THUA 2Z4GA 2WJZA 1ITCA 1WE5A 3QMRA 3SCWA 4C6FA 2J74A 3HURA 2BTMA 3KBNA 2HDJA 5FEWA 4TR9A 3ITLA 1S5TA 1HJQA 3TE9A 2RDUA 3UERA 1KA9F 1KTBA 1B3YA 3GIQA 1AUSL 2CBIA 3T78A 2Y1HA 3PBYA 4CD5A 1KD0A 3O6DA 4YVXA 1LJYA 5M5DA 4CNSA 2RHGA 4XZ9A 4ROPA 1KFKA 3P62A 3DGBA 1PTAA 5F1VA 1OG6A 4BCEA 1K8YA 4MJZA 2Z7GA 2VCBA 5DCEA 1TO3A 3GNRA 4NQ1A 4H6EA 1NF7A 1AW5A 1IE7C 3F4WA 1A49A 3FSUA 1OYAA 1T40A 1MEHA 2C13A 3SJ3A 4IIFA 1KQZA 3MU7A 4F2TA 9XIMA 3DCPA 1L8NA 3GAKA 3Q2DA 1K02A 3P61A 1PZ0A 1RCQA 1UZHA 3QV6A 2ZRUA 2XH4A 4UTHA 2OWXA 3BK0A 1XKYA 3SUSA 5CJMA 2PA6A 2I9EA 4AVOA 5EU9A 3VU2A 3AUJA 4LUJA 3ITXA 1REQB 4IQLA 4JFWA 4AIBA 2PDJA 1DJQA 4WKFA 1LT7A 2XH2A 1CECA 4L5ZA 3PSVA 3ARTA 2YPIA 4S3AA 1EJXC 3UNTA 5DCDA 4C6CA 2W61A 3TSDA 4O52A 4W87A 2XVNA 1KGXA 1EDGA 1R3YA 3FDGA 1GVFA 4O0QA 5GQBA 5D4YA 3IJ8A 2WZHA 1A5MC 1L2QA 1XV8A 1DYSA 5DXXA 3EOEA 5GNYA 4Z1CA 2WHLA 1AMYA 4XKYA 4NY2A 1LOSA 1OFDA 3TYDA 1IXQA 2AGKA 3V16A 4MLJA 3CT2A 4EWJA 3H54A 3M0YA 4REQA 4CEXC 4S2CA 4H9VA 2V3GA 2IPWA 4WJEA 3BGJA 3CU2A 4F79A 1F8MA 3EBVA 2J7BA 1UOKA 3WBWA 5ABHA 4JR5A 4IX0A 2WYSA 2JIEA 2YOCA 4TV6A 4Y90A 3QKZA 4GUJA 2DH2A 1S2CA 3ZQ9A 5I3FA 4PE8A 2VR2A 3GXMA 5A8MA 1IT7A 2IPJA 5ABEA 5REQB 1PCKA 2PC8A 3BICA 1UUOA 3KOZA 4L1WA 3UY7A 5A8GA 2VX7A 1KLZA 2A3LA 2PGEA 4AY7A 3ISIX 2NVCA 5I0DA 3ATYA 3AS3A 4HTYA 2PU0A 3OA3A 3ONBA 1JCMP 4DM2A 3QMTA 2J88A 1BYAA 1VIZA 1YHTA 4O50A 3W22A 2E9MA 2PZ0A 2JALA 5M17A 4AMAA 4H9XA 4IIBA 3ZT7A 3G1YA 2ZZ1A 1K70A 2OWWA 4PMVA 3LYEA 2IKJA 3PULA 5AVHA 3F7JA 2YZ5A 1EGZA 3EYPA 1UD4A 3CQ0A 1CDGA 2XN2A 4LQ1A 3N19B 3ZSTA 5TQLA 4ZOBA 3TYEA 1X97A 3O1NA 1EOMA 3OO2A 5E9XA 4HYWA 1ONXA 1TIWA 4QLKA 4U2ZA 4JTQA 3RUBL 3ZOAA 4EF8A 2WJEA 4OQVA 1ISZA 1JPDX 1AL8A 1Q5MA 4Q4RA 1K3UA 3ANUA 3O05A 4GA8A 4AH7A 1KM4A 1FKWA 2G3MA 1YLVA 2Q01A 3TJLA 3PY2A 2GSEA 4C1NB 2ALRA 3E0VA 3Q4DA 4DYJA 1OFRA 2XU2A 1V51A 4IPNB 5IFTA 3GC4A 4JKLA 3HG3A 3RX3A 3WD0A 5CAHA 3W7RA 1CBGA 3VDAA 2FHCA 4QJ3B 1O5RA 3JUGA 1KNWA 4HP5A 1ZQ5A 4F40A 2ATMA 3BGAA 2XVPA 5H6HA 1GOMA 4MMWA 4A3HA 1KC7A 5CPSA 5AFDA 1RBOB 3PS7A 3KL0A 3GFYA 2X0YA 4KCVA 2CU0A 3CMJA 1WO2A 4UTFA 4GY1A 1EXPA 3VGEA 3VZXA 5EMKA 2WWCA 1TV8A 5CSRA 4DBUA 1PTGA 1OFOA 1OFPA 3T0CA 4O0KA 4GZJA 1MW2A 4JNMA 2Y88A 2WZMA 2NV9A 1H63A 4PUNA 1Z41A 1MXSA 1EJ7L 3MDUA 2BY0A 1IXPA 4RNHA 1M53A 3CS2A 3S6DA 2O92A 3TVAA 3OVRA 4ZENA 3LY0A 2QUVA 4HHHA 3KHJA 3W1MA 4GY0A 2WM1A 1HG3A 1DHKA 2Y63A 3T0AA 1VFFA 1BF2A 1P0KA 1UA3A 4Q8PA 3I6RA 3W1XA 3ZSSA 3ITVA 4G7EA 4IIEA 4XZLX 1SVDA 2GZXA 3L65A 3WBXA 1QHPA 4NJGA 3CWOX 4MZ8A 4Q22A 3EKGA 4XV0A 4HZ7A 1V0KA 1LWIA 1RZMA 4LF1A 1GOXA 3UA3A 4MWAD 1E1CB 1GHSA 2PD9A 4FOUA 3VKBA 4OZOA 3WYZA 1WYIA 2Y7FA 1NTHA 3T2QA 2PFHA 1OJXA 3R2GA 3UCDA 3VOHA 3WENA 4R5EA 4LV4A 3UGVA 2BFGA 2X30A 3HF3A 3TN5A 1JCLA 3F03K 4DJFC 4ZXLA 2V63A 2OX4A 3A12A 4LVDA 1ME8A 2EF9A 6TIMA 4YLWA 5BXRA 1YBQB 3I6TA 1MQPA 1SQ7A 1SO3A 2C7FA 2QR6A 2PBGA 3STGA 5GNZA 1XUZA 3KEHA 4H9MA 1GQJA 1ZBVA 1VQTA 3GXIA 4GVFA 1XLKA 5CQ1A 4B5VA 3MDWA 4H1ZA 5FI8A 1IGSA 4GHRA 5A6BD 3MUIA 1B4KA 2XG9A 4WKHA 5I02A 1ITXA 3CLMA 2QYGA 2V3EA 1K9DA 3PZUA 3TTEA 2ISSA 1GTHA 3QV9A 2WSKA 4YNGA 4UR9A 1QJWA 5JUVA 1FWTA 1VKFA 4JIQA 1PKYA 1B2YA 3HJZA 4GUHA 1G0CA 4F0SA 4L6DA 3V7PA 1P7TB 4PCPA 1H7OA 1F3XA 3E0WA 2WOQA 2YYUA 3PTQA 1E4NA 1D3CA 4MIMA 3EOOA 3M7SA 3WK2A 4ZB2A 3S5ZA 3H7RA 3IJ6A 3S46A 1TTIA 1I6NA 4RZ4A 4IFOA 2QUUA 3CUJA 2W9MA 2IQDA 3EA3A 1KBKA 2ZDRA 5CZJA 3TCEA 2V30A 3SB0A 2PMQA 4GQ0A 5M3WA 4LAZA 1QT1A 4GQRA 2W92A 3DBPA 3QZAA 4BI5A 3THAA 3SGUA 4LUIA 3WEZA 5HULA 2VFHA 3KVKA 4K38A 3MMTA 2EEXA 1XSKA 3B40A 2Q09A 1YW1A 4GJIA 4ACZA 3BAJA 5I78A 4LXFA 1W54A 3G1XA 2ZE3A 1SM9A 3OVQA 4H7VA 3BSGA 5CPNA 4YL2A 2YA2A 1Q13A 3SRKA 4D1IA 3G0UA 5LNVA 4Q33A 3UPMA 4IG2A 1FWGC 3HOJA 3MTWA 3M0ZA 3GTFA 3IS4A 4JTGA 1FHUA 5CPTA 5EPDA 4NAEB 1DIOA 3SIZA 3LBCA 4NAFB 1J0JA 3OQEA 4DX3A 2X7WA 3R13A 3UJSA 4JQAA 3GFXA 4JKMA 3C0QA 1N55A 5HATA 1YYAA 3A23A 3SQMA 1PKMA 4QM1A 1P1XA 3ANVA 5IM51 2FKPA 1XLJA 5A1AA 4I5XA 3K30A 3NQBA 3C0JA 1B90A 3PUGA 5EFDA 5AECA 2GQ9A 4QBXA 3TMLA 2CZFA 2C15A 1OQFA 1K9FA 3GNXA 1RLCL 2D2OA 3CZLA 4Y8FA 1W1YA 4NZCA 3B0YA 4DBEA 3BXWA 3HFTA 3OLGA 3O3RA 2DPEA 4GVHA 1DWAM 2ZKMX 4ICCX 3RPDA 3WJXA 1J0KA 1TX2A 3H2OA 1R3QA 4QE1A 1EBGA 4Z1AA 1TRDA 2C71A 3E2RA 4FIRA 3GIPA 5LIYX 1J96A 5GVJA 2PCQA 2QV4A 2FYMA 2R9RA 4LS0A 2QCDB 2BSLA 3HGRA 3QOKA 1BSIA 1E6QM 5EMMA 3KFTA 2ZBTA 4M51A 3NG3A 3VYLA 2PRMA 5FEPA 5E0KA 4GRSA 2XGIA 1W5PA 3MSYA 1HJVA 1D8WA 1B1YA 1DEDA 3NVTA 4US5A 3RILA 4HJFA 1G4PA 4OUEA 1TRIA 3VINA 1YTDA 5G4HC 3U2ZA 4GABA 3W25A 4FHAA 1O6IA 3NWRA 3KOXA 2WMKA 3KL3A 3AHTA 3QM3A 3UFYA 3MMWA 4AYSA 2VJXA 2CBVA 3A24A 3T07A 5B80A 3STFA 2EPKX 3KLLA 1KM1A 4QG9A 1HZYA 3H22A 1BTMA 3LHWA 3AOFA 1FWBC 1O1ZA 1N2VA 4H8UA 3WDPP 2Y8UA 5CG7A 1LORA 4X9YA 4UMCA 1QNRA 2XSXA 4NT0A 2WAGA 5CSUA 5E09A 5K4XA 3ZJ6A 1EJTC 3LERA 4MM1A 4Z0JA 4DJED 4AD4A 2QF8A 3MO7A 4OBTA 4E6MA 5T9BG 2NLYA 4IGHA 3IJQA 1Q4WA 3BMXA 1ZP3A 4AY8A 3N04A 1V3IA 4C7FA 3A3WA 1WZLA 5DMYA 1PE1A 1W3HA 3WK3A 4UTKA 1E9ZB 3SCOA 4HKPA 3MP5A 2V68A 3PZVA 3W7IA 2PDNA 1WXZA 3NPUA 4XZHA 1POJA 4XUYA 4Q7BA 3WLSA 2HISA 1V0LA 3BLFA 4YWIA 3LMYA 5I7GA 3A4JA 5HMEA 3GG0A 1B3XA 1F76A 4WXYA 3LEPA 1DIEA 3IJDA 5BW6A 4E3TA 4Q7IA 3AMGA 4B5WA 2V5BA 2CWXA 4HYRA 1R46A 1B3WA 4ZR8A 5FACA 4YPJA 1WDSA 4JQ2A 3FNDA 3E2QA 2VFDA 1J2BA 4P7RA 3LS9A 2YDRA 1VGAA 1D7KA 1ISXA 1SUXA 4LW7A 4O8AA 2A6NA 4JL2A 1JYWA 1SO6A 3N3MA 1DQWA 4FNUA 4EVZA 3OYZA 4ZQCA 2VGBA 4MNLA 4RV8A 1TREA 3W7HA 4FP1A 2D0FA 2Y8KA 3BSMA 4GMEA 3TH6A 4HK6A 4V28A 4OT7A 4GGHA 2GSHA 1WA3A 3LPOA 3VXGA 3G2GA 4R9OA 3GFZA 1ZU8A 1V6YA 2GK1A 4HNTA 1VFTA 2F84A 1NFPA 5D37A 2ACQA 2ZRWA 3F5LA 3VPLA 1V3LA 3LLFA 4KFPA 1HIZA 1BWLA 1O5KA 3GB6A 3GTIA 2JK2A 4GYKA 4UQAA 5BWAA 4P7NA 3I68A 4MG4A 2BXZA 1ECEA 3G0SA 3OJGA 4M80A 1NFGA 4J3UA 3OLIA 4WY0B 3SY8A 1EO7A 3QY7A 4RW3A 2CXEA 5LHFA 4FR6A 4CU6A 1I2PA 4HNLA 4PB5A 1UPMB 1E9IA 3P5ZA 4Z1BA 2E6YA 2WVSA 4UXDA 1EX1A 1JCNA 3LX9A 1ZSXA 3FN9A 4RPPA 1RA5A 1XCXA 2WMJA 2GDUA 3PPGA 4XD6A 2ZA2A 3TW7A 1VFUA 2D69A 4X9SA 4EPBC 2ZCGA 5D9PA 4UZUA 5ABFA 4LYPA 2PPGA 1DTUA 4W5ZA 3W83A 2JKPA 1D8CA 4FZIA 5C2XA 3W73A 1F8IA 3LHVA 1BPLB 4UQ9A 3EWZA 1DP0A 3ZJ8A 3OOQA 2Y4SA 2QJGA 1AFSA 3AJXA 1KO0A 4YU1A 1K6AA 1VYRA 5HQEA 4BWLA 3NL3A 2FQIA 2YKKA 4IISA 3LNPA 4J40A 1TV4A 3WQVA 3IAQA 2PDWA 4LCRA 3DN5A 4NJKA 3G24A 1I9CB 2P76A 4YVVA 2QS8A 2BV9A 3MUAA 1W3NA 4H2CA 3NUKA 2WCGA 4AZ7A 1NU5A 4YTUA 2GJXB 4LB4A 2QNEA 4N9DA 1ENUA 3W71A 4ECLA 5BU6A 1UZ4A 1H0IA 2OG9A 3W2LA 2JGQA 3INPA 4W7VA 4YWSA 1EIBA 5TNVA 3K1DA 1AJ2A 4NI3A 5FSEC 2Q02A 2VURA 1DTNA 4HZ6A 1DWFM 5DCBA 4IOTA 1MXDA 2A85A 1E51A 6REQB 3PHAA 1CGXA 4L9YA 4GCXA 1W1ZA 1A0CA 3EA1A 3VMOA 4UMBA 1OC7A 1VZWA 4ORMA 5PTDA 1A5CA 2ZIDA 1AW2A 4KWWA 3M9YA 3TOYA 1EGMA 4JTCA 2PTXA 4WOQA 1H50A 1NVMA 1PWLA 4QIUA 2FHBA 2JIWA 4L61A 3PZNA 2J7DA 3TQKA 2AGTA 1OX4A 4MB5A 2OU4A 4NXKA 1I8JA 1S2AA 1O4UA 4DWSD 4OOUA 4UOQA 2A7RA 3MHFA 1R0MA 2WZIA 3UR5A 2HMCA 2B7OA 3SGGA 4KW2A 3G5EA 4YJ5A 1JXKA 4HMCA 2OSXA 4Z2JA 4C6BA 3KRZA 3NXLA 3OZOA 4QTGA 1V6VA 2D3NA 3GVWA 3QC0A 5KITA 1BWVA 3BDKA 4TTUA 3T55A 2C91A 4Q8TA 2O9PA 3GX9A 3PBUA 2R94A 1WDDA 3I3EA 3GDTA 2BOGX 3LN3A 3JW7A 4ZSUA 1XICA 4LGXA 1FH8A 1OYCA 2F38A 1PHQA 1R8LA 5BRBA 3MV11 3OA5A 3PBMA 1IR2A 2OZ3A 2ZX6A 3P81A 4FR1A 4XIMA 1EGVA 1W3KA 4R85A 4XZNX 3OP2A 4DJFA 1XIDA 3DX5A 2HCVA 1J5TA 4HBKA 1F6YA 2E5DA 1VFHA 4PMQA 1G01A 1XYZA 5BXPA 2DT0A 1ZBCA 3KOWA 4DNHA 4PEEA 1EWEA 1XLIA 4CGTA 3FK4A 4KT2A 3TN3A 3W81A 4CQBA 3WY1A 3N29A 4EP8C 1H7PA 2EG6A 1XYCA 4O14A 2GVYA 3W4RA 2WPBA 3LBOA 2ACUA 1DKWA 3CHVA 1V02A 2OLAA 3OLEA 1G67A 2WMIB 2BHYA 1KRBC 1Z44A 5BXSA 1JGMA 2Z6JA 2VC6A 2AQVA 2VX5A 4JTFA 2OSWA 1S3TC 1JDEA 3TNOA 3K46A 2Z28A 1E6NA 3I4EA 5EL1A 4KWSA 1EZ2A 1IGWA 2W0UA 2DVUA 4LAMA 2YCLB 1FHDA 1Z3NA 4WSJA 4TOQA 2A5HA 5I6SA 4BKNA 1JXJA 5EMYA 1OF8A 4IPIA 3DFTA 1L2UA 5DO8A 2ZX5A 1O68A 1M7XA 2XFRA 3KVJA 4NILA 1M7OA 1XF0A 2OLHA 2WXDM 1K9EA 4HCHA 3WNKA 3CB8A 2J7GA 3GZAA 4ONVA 3GIYA 3TC7A 3KWXA 1HNYA 3KRBA 3UZXA 3W2MA 1C9WA 1PXGA 4TUFA 1W0MA 3N3TA 3W7PA 2EPMX 7TIMA 1PL9A 4J5NA 1TV7A 2QF7A 1VC4A 2QZRA 3NURA 1BVNP 4XZWA 4O0ZA 1JUKA 4LANA 4W7WA 3URBA 3RM4A 2RJGA 1LUCA 1SZNA 1J11A 2OO0A 5HJLA 3H55A 3BARA 4JEQA 4L6HA 1QBBA 4BQ4A 3G18A 5DRCA 3W70A 3TP4A 4ZE5A 2VRQA 3MB9A 1VCGA 1VYPX 2FZBA 1OIMA 2OPJA 1QRQA 4B9YA 1LQAA 3B8IA 3FYPA 3TA9A 3SZ8A 3EPOA 4QR6A 3WLMA 3VDCA 1RAKA 3CWHA 3MHGA 4RUBA 1KCLA 3PM6A 3PNZA 4JGDA 1TTJA 3MP4A 3P5YA 1KGWA 1AA1B 4K8GA 1NEYA 3O6CA 3VUSA 4JZ5A 1NQKA 5H1WA 4BY3A 4IHCA 1EHAA 5D38A 3CEPA 2NQZA 1H7XA 1R38A 2NX1A 4AIOA 3AU6A 1CLXA 1C92A 4C6QA 1E70M 3CMGA 4KCWA 4AX6A 1GPFA 3L5MA 2OT1A 4XD4A 4BR1A 1OD0A 3T7VA 5CSSA 3TW9A 2GVEA 4HJWA 5LGZA 1TZ9A 2PF8A 3AIQA 4LC6A 3LDVA 5G5IA 3EXTA 1PVNA 4NASA 3PF3A 1LLZA 4HNCA 1VHNA 3MCMA 3TQPA 1V93A 3CV7A 2F6KA 1HJUA 1QCWA 3A9BA 4B5SA 2VT0A 3GYCA 1PO9A 4MB1A 5K9CA 3KRSA 2PWUA 1ICSA 3L68A 3MYOA 1ZJAA 1E1EA 4UTTC 3H2AA 3WH7A 1R47A 5FF7A 2VFEA 1UWIA 3GDKA 3W7MA 4LS2A 4KFOA 4PR4A 3VOFA 5KTLA 3A9IA 1C7SA 4WIWA