3WEBA

Crystal structure of a niemann-pick type c2 protein from japanese carpenter ant in complex with oleic acid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
FVFEDCGSEVGKFSDIIISSCDPSEEKCSIIRESEIHVSMKFTPSVDVKNVEAKAFGVLLDVPVPFPLKKPEICKDPDSGVKCPLKKDVEIEYKVTFFVEKATPALSLEIMWEFRNEKDEKITCVKFPAKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Niemann-Pick type C2 protein
publication title Niemann-Pick type C2 protein mediating chemical communication in the worker ant
pubmed doi rcsb
source organism Camponotus japonicus
molecule tags Lipid binding protein
total genus 26
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3webA00
1NEPA 5IJBC 5IJCC 3RG1C 1WRFA 3VQ1C 1A9VA 2F08A 3B2DC 3MTXA 2Z64C 3M7OA 1AHMA 5IJDC 1XWVA 3MU3A 3WEAA 2HKAA 1KTJA 3T6QC 1AHKA 3WEBA 4G8AC 2E56A 2Z65C 3VQ2C 3FXIC 5KWYC 3ULAB 2E59A
chains in the Genus database with same CATH superfamily
4Z0BH 5EWIL 2N0MA 3RIFF 4XVSH 3V6FB 1KJ2H 2PWGA 4P2RB 5GGVH 4XNMA 1MREH 3A6CH 1BZQK 5E1AA 2VXVH 4JHBA 5IB4A 4IBWA 1IAKB 1UENA 1ZVSB 3OKEB 4FTVE 1QLFA 1IGML 5K1VA 4AQEA 4DAGH 3ZE2E 1DLFH 5E5RB 1UWEH 1HHJB 4KRLB 5I30L 2WB1A 5HHXH 2P4AB 4GQRA 2UX6A 1LILA 3CFKB 4XR8C 4JFPB 4F7PA 5HI5D 5JLZA 4PJ8B 5E1HB 2O1AA 4YHLL 4NNYB 2CRYA 3HMXH 2EDWA 1SY6A 3CVBA 3QPXL 3L6FB 4NT6A 4XGZB 5HHNA 4FC3E 4XVJL 5DVMA 2A9NL 2F7IA 4NQSA 2D03L 3NIFE 5D1QD 4A6YH 4KI5E 2DZEA 3FB6A 4JFYA 4M1CC 2MCMA 2QVIA 5T1KA 2Y69B 1Q0EA 1A0QH 3WJJA 1JNLH 2PYFB 4I3SL 1R24B 2YWYA 2PTTA 2AZAA 1QLRB 2K4WA 3LKRA 4RETB 5DK2A 1D3CA 3SE6A 1IBDA 4TSAL 2DB8A 1A3ZA 2H2PC 4K94H 2V33A 3QZWG 3H7BB 1OF2A 5IFHH 1I1FA 1OGAB 3MROB 4P07A 5DJYB 3RKDD 1GGTA 3HN5A 3P3SA 2H3NA 3G6DL 3NRFA 2NNFA 4K4KA 5F1IB 3WHE0 2XX0A 3DX4A 2CMRH 5I0YA 2Q20A 3ARBB 3MACH 2EIMB 2CHWA 2IFFL 1RJYB 3LN4B 4JHWH 5DQ9A 1NFDB 5FWQA 1QO3B 4NHUB 2BHYA 4KQ3L 3GSXB 4PJAF 3UTSE 1WE5A 1KEGH 4NGHL 3E0GA 4UTBH 2VR3A 4XAWL 2EXYD 3ZGHA 2ZG2A 5I6NA 5KOMC 4OF6A 4DP1X 1DBBL 1UVQB 3BKCL 2EDMA 2BNUA 3VXMD 5KYYA 1PQZA 2ED9A 4WI5A 3FU9A 3HAEB 1UQSA 4FNQA 3T0EB 4G5AA 4RFNB 4PLJC 2CHZA 1NCHA 2CKBB 3RL1B 5KS9B 4Y2LA 1O0VA 1FCGA 4W9KC 2PXYD 3CLFH 1MXDA 1UZGA 3EFFA 3JQOB 1ZLVH 4GXVL 4P23D 3BP5B 1CGWA 2H26B 3SYQA 1KWGA 4H1LG 3B6SA 2EYSB 5CCHE 1LP9A 4JDEA 4JVPA 1J9QA 3NBNA 1OT2A 1QVOB 3WEBA 2V9QA 4JPWL 2VJ8A 1DHKA 3BVTA 4AVJA 2KS0A 3VXUB 1JUFA 5J13B 3C8KB 1R3HA 2B15A 3VXOA 4BH8B 4MVBD 4OF0A 5T1DH 2XA8H 5E6ZA 4M7ZC 3V9FA 5IREA 1JVKA 2WINA 4H20L 3W11C 5IW1B 5JPNB 4JLRA 4GXUN 3HG1B 1C08B 3DROB 5IB3A 2AHIA 4F5CA 3H42L 2Q5BA 3AQZA 1G94A 3D39D 2DJUA 1EHKB 1QFUH 2M26A 3PJSB 4GB9A 2ZUYA 4Y4FC 1OV8A 3QYNA 2QSQA 1NBZB 1VZGA 3RWDB 4NPJA 5CSZA 3GMQA 3SYPA 2WZAA 3DJZA 1NL0L 1NFIA 5GSVA 4DO5A 5T3XE 3HLAA 2ZD0A 2CIIA 4JFXB 2BINA 2DMHA 1JVOA 1T7WA 1TSHA 3D85B 3B83A 2BNQA 2OI9C 3CVIL 1MG3C 4YE4H 2AQRA 3MGAA 4X6BB 3WFDH 1A1OA 5FCUL 1R5IB 3BO8B 5EO9A 3CZGA 5B7FA 3EYFB 1SHXA 5IW6A 2CK0H 4GFXA 4Y4KC 2NQDA 4F24A 5H4ZA 1PZ3A 2EIKB 3PAUA 1SDAB 2VYRE 3ES6A 1K4DB 3MV7A 2VDPH 3AB0B 3W57A 4UU9A 1D5BB 5DZAA 2F5AL 2CPUA 3MNDA 4AEHH 4GBXB 4XPTL 1WV7T 2EXWC 4HWNA 4ZO8A 4E5XB 4Y2DC 1BXVA 4DGVL 3UPAA 2WIIA 3TBYB 4PJIA 1UGKA 2YPKB 3QEHB 4DKAA 3MBEA 1XZWA 4QTFA 4LBEA 5ESAA 4JM4H 5JYLA 1DBMH 1TJGH 4DN4L 1WS8A 3SDYH 1HILA 3PG2A 3TEYA 2KLRA 3IKCB 1P5VA 1KIRA 4MCYA 4HUUA 2FAUA 1Z66A 4MD0B 1BJ8A 1XR9B 4G6AC 3SY0A 3LB6D 1VHPA 2APSA 4NQVB 3VFTB 1KBBA 2NLJA 3QGVA 4UDUA 5EPMA 2CALA 4MHHG 5HGHB 1RMFL 4WJ5A 5ICYA 1EXHA 1Z9SB 4KKLC 3AFLA 2EEBA 5CILL 4NCDA 2WXMA 4EAEA 1BQLL 1KGUA 4ZOEA 3U4AA 1QLFB 1RH8A 3U1PA 5HYIA 5KBNC 3OV6A 4MA7H 5SWZB 1AE6H 2DYSB 2XWXA 3MKKA 3H85A 1V3KA 3DVGA 2EVJA 1PGRB 3QEQE 2C3VA 3G08A 3BGAA 5L0QC 1J0YA 1E0OB 1T0OA 3BW9A 3MNMA 1OLZA 5F1OB 3VGHA 3O8XD 4PJXA 1M6UA 1RL1A 1DSFL 1RZQA 1CO1A 4YGVB 4YR6A 1E7UA 3H9ZA 2IADA 4UT9A 5ISZE 2DYPA 5HHNB 1J8HA 2R69A 4NT6B 3V6ZA 1RZPA 4P46A 5FFGA 1ORQA 1FIGL 1ADQL 3NSYA 3FB6B 4JFYB 4OGXH 1JF1A 5T1KB 4WI2A 2I5YH 3NEEA 3MUY1 1BIHA 1OW0C 4QXTA 2D0FA 4W6XB 3GS4A 2RFXB 1KGIA 5LN8A 4LCUA 1BQRA 4FI7A 1IC0A 4NX0A 5E2UL 3O4OB 5C0AD 4PWKA 4ZMPA 2HT2C 2UXTA 1YSOA 2VZ1A 4AQOA 2NNRA 1RY7B 5HGBA 2FRGP 4AKOA 4AE1A 2EXTA 1N18A 1YECL 3AAZB 2NRDA 2AQ2A 1WS7A 1Q9WB 3BAEL 5T3ZD 4DESA 1XGTA 3W0WE 3NQIA 5AVQB 4F2MA 2BWDA 2AEPL 2BP5M 4G59C 3WAKA 4EZJA 2YPLD 3BEWB 3X1EA 5AW8B 4WU7A 4F92B 1BFOA 2W0LA 1CR9H 2O72A 3OXRA 3P2DA 1VFMA 5D7IF 5D70L 1KCSH 2NXYD 4AIOA 5AVWB 5I2IA 1PQZB 1DBJL 1T3FA 1UQSB 1MOEA 1MUJA 4K5MA 4GG6F 1QSZA 2VNCA 3NRQA 2VLMD 1HS6A 2PPCA 1MDAA 1NEZA 3TO4A 3EFFB 5EB9A 1AQDB 3R0NA 5EULV 1G7PA 4AZ8B 1CG9A 3DXAA 2ORBL 3EFOA 2JKRM 3B6SB 4CNIA 3JWNC 5HVHB 3MLTA 1L7TL 1V7NH 3FT3A 4JDEB 4N20A 4OF8A 1D5XA 4ORGB 5DQJA 3KPSE 3L3HB 4P3CH 1II4E 2QMKA 3N91A 1ETZB 1R3HB 1BJMA 3VXOB 4X6FB 4F27A 5JYMA 4YSTA 5BZZA 3SPJA 3JYBA 2GAZB 5IHBA 1I7RA 4FQQA 2WINB 2IBGA 1HYSC 3HPJB 3P4MA 4ODWA 5IBTL 4PJ5D 1EFXB 2XBTA 1CLYL 3UROR 3QIBC 2XKSA 5CO1A 4KUZL 3HE7C 5DMIL 1GY1A 1WWCA 2FD6H 2P5WB 3LNHA 4U6XA 3CXFA 1JNNH 1SUHA 1VFBA 3HLAB 3M46A 1P7KA 3GXMA 5CZVH 2HH0H 5F6HI 1BF8A 1IVTA 1FV1A 4XP4H 4G7SB 2NZ9C 1CLOH 4FNPA 2IGFH 3CVHA 5BOZG 3KBEA 2Q8AL 3TV3H 1TU2B 1C12A 3MR9A 1TQTA 1T80A 1LQSR 5CKAA 4TPRL 3KVPA 1JN6A 1KTKE 3OBAA 4G5ZL 3S98A 1L6PA 3Q05A 2A4ZA 2ZX5A 3STZB 3S37L 1PZ5A 1ZS8B 2W8CA 1CDYA 3BQUA 3S4SG 4XRCB 5IROA 5TDPA 5FM8A 4FFYA 1C7SA 1BX2A 3IT8D 5K9JH 1F4YL 2EKSB 2OYMA 3V4PA 4LEOB 3RHWK 2ADIA 3FN9A 1ZT4A 3ULVF 4K8RH 5B3SB 1CF1A 1E7VA 4ZXBD 3VD4A 5JIQA 5D1ZC 2CLVA 5IQ9A 5ADPL 5HYJE 4XPBL 1ZV9A 1INDL 3MCKB 4PJIB 2H1PH 3NJVA 4NQDE 4XO3A 4D0CA 4DGYH 4S0HA 3TWCH 5ESAB 1QBLL 2ESVB 1WAAA 3IS0X 4HIHB 4Q6KA 4CJ1A 1HCFX 4LL9A 2VQTA 2E27L 1P5VB 4KK5D 4RWYL 4MCYB 4HUUB 4OIBA 4KK6D 4E9QA 1A7NL 2B39A 3H3PL 5BS0A 1P5UB 4HMEA 4MA8L 3SY0B 1DQVA 1I3VA 4AEFA 2DTSA 4UDUB 1F13A 1SYVB 1G1YA 3DO7A 3QNYB 4JAMA 2GB2A 4LHUA 1SLVA 2KLSA 4HZLB 2FQFA 5AVUB 4CVWA 1NBYA 4K3EH 2CRMA 4WW2A 4PB0H 4H4NA 4FQXA 3LPWA 1HKLL 3WNPA 4RMUA 1DE4B 3MOAH 3OJDA 5T3ZH 4NFBA 1L6XA 5DC2A 2VMCA 3W38A 4Y88A 3BD4A 3VWKC 4QEGA 4CMHB 1JJUA 2VO8A 1U8HA 4O58H 3DVGB 2GIMA 4LLQA 3G08B 2VSDA 2OAAA 4DCQA 1WO2A 1QI4A 4PJXB 4AYEC 5JHLL 1P6AB 5KVDH 4JY6A 1M6OA 4YR6B 4AUUA 2H0FA 2NTFA 4EI0A 1J8HB 5EU6E 3V6ZB 4CVUA 2PETA 1U8OA 1HC1A 5C0GA 2PP9A 2ROYA 1JF1B 3QDJB 2VSMB 2VLKE 4L4TA 4Z7WE 4QXTB 2XZCH 5DJCA 3OLIA 3OJ2C 4D94A 3A4EA 3WEXB 1CLCA 1XMWA 3B2DC 3MLSL 2AGJL 1OM3L 4KZEL 1KTDB 2FWOA 2F1BA 3WI9A 4EEEA 4LLAA 1S7XA 1UOKA 2N7BA 3DX8B 3L4ZA 1ACZA 5HGBB 3WTSA 2OL3L 3DV4B 4TUKL 4WO4A 4PUBL 4OZHE 1TJIL 4R4NC 1KBPA 5CSBA 2CWRA 2X4UA 5B38B 1D6VH 4POZC 5EOQH 2DLFH 3LS5H 5F97E 5AYUH 2ICWI 2WYZA 2MKLC 5ALCL 3WXWL 1F45A 3ZSTA 4DZ8B 4WU7B 2F0CA 2F5BL 1JRHI 3F7PC 2VDNB 3VQLA 1DSWA 3QHZL 2DBLL 3IETA 2EUZA 1SOXA 5A1AA 5I2IB 2WVTA 2QGCA 2XUWA 1XH0A 2B59B 1AO7B 5AWNL 1XGYL 1AJ7H 3JZYA 4K3DH 2P80D 5LXGL 2G60H 3S7GA 4OFPA 1TTBA 1YJDL 4M29A 3MRLA 3DA0A 3TO4B 1OGSA 4WFFD 3X3FL 1U3YA 2FDBP 3AS1A 2K45A 4NDMA 3ZUNC 2A7BA 4OKVA 4QRSA 3DXAB 2LU7A 1QD0A 3HFMH 1DZ0A 4CNIB 4NAMA 1P7QD 3MLTB 3GSQA 5HD8C 3BSZH 2XTLA 3F7VA 4J4PC 4UM8A 5LN4A 3FU7A 4WFED 4OFDA 2A5UA 2KH2B 2MHAA 5CWSA 5DD3H 5DUBA 4F37F 4LPWA 2XN2A 2YEVB 3H55A 4UQ9A 3S5LG 3CFUA 1J9TA 4MASA 3SBQA 1RZ8A 2GSMB 4KTEL 1W16A 2JB5H 1I7RB 2IDUA 1ETJA 1LXMA 2YXMA 4NKIL 1BWWA 4Y5YA 4BFKA 3P4MB 1B3IA 2YZ8A 1OLLA 4FQ2L 5FYKH 4IOFD 1LDPL 4M6OL 4N26A 1WT5A 5A2IH 1E27A 3GXUB 3KNBA 5IHHA 3CLEL 2BSCA 1FAKT 3NIDB 3AG1B 3UG3A 3WE6A 2AFNA 1VFBB 5EV7A 5L6YL 4TVPE 1OAZL 5FF6B 4ZTEA 2FQEA 4MNQE 5CF3A 1FV1B 4UI2A 2D2OA 4ICWA 5LCVH 3IMBA 4TOYL 3CVHB 2JXMA 5FGBA 2Q86A 1UWFA 1C12B 2D31A 3MR9B 4JM2C 4TRPL 4LKCA 1UA3A 3MODH 4M6MH 3TASA 4U1HA 2LFEA 1EPFA 5ESVA 1JN6B 1WGVA 4J3OD 3HI6L 4OCLC 3QZMA 4FL4B 3OSKA 3VRIA 3VQMA 1XH3A 2VLJA 3CN4A 4HJJL 5GS0H 1PZ5B 3L8QA 4JFDD 1LEIB 2KERA 2QPEB 2J88L 1J1XH 3E9TA 4NM8L 5DD0L 4DQAA 1SXSA 4NZRL 3V4PB 4BH7A 4PWJA 1QOKA 5I0DA 4FNRA 2WGNB 4JPKH 1ML0A 1T0MB 5IOPB 4A2DA 2DICA 5SX4I 3C9NA 2BNRA 2EC9U 4LGRB 1N7MH 1BD2B 1KN4L 3T3MF 1ZDSA 4QWWD 4YGAB 3O3BA 3FSZA 5IIEA 1YEJL 2VZUA 2BFVL 1Q8MA 5BS0B 1OTUC 2J2ZA 1L0PA 1FFPA 4FHJA 5E2VH 4R7NB 3OB0K 3MV8E 4HKZA 1RIVH 3CVDA 1G7LA 2JCCF 3MRFA 3DO7B 2BY2A 4JAMB 1UUNA 4YBHA 3T0XA 2WAQA 2XQBL 3ZE1B 4FQXB 4GG8B 2LV4A 3KYNB 4Z76A 1LD9A 3NGBB 3ORJA 5F3FA 3OJDB 5EEWA 5J12B 5LNEA 5G2NA 2O61A 3S5ZA 4W9CC 1FHGA 1R5VB 2IH1A 4R2GD 3HJEA 3RBGA 1GYCA 1QWUA 1U8HB 3E8UL 5DI8B 1TTGA 4Z78A 3CN3A 2NXZC 4IEFB 5A40E 2AQNA 1IC4L 5CBAB 4JY6B 2A6KA 1JF6A 1Y6MR 4M5SA 4PJ8C 4RVBA 3UO8B 5DEFB 4FQJL 4PTUA 2CJTA 1JDAA 3FTZA 3G5XB 4AQ8C 3QAQA 2CPCA 3X14A 1YQVH 5C0IB 4Z7OB 3CH8A 1M05A 2D3VA 3N44F 5ES4B 5LBSL 5F6IB 1AAJA 3U0PB 1KCLA 5B4MC 5HDQL 5GJSH 5B8CB 5GRVK 4S0TD 4BELD 4PGDA 4RDQF 1WHPA 4CAGA 2FWOB 5FV2A 5B3JF 1CDBA 5F7EL 1HHIA 3ZTJG 4GQ9H 3LX9A 3L5IA 3N41B 1XB6A 2X38A 1IAII 6FABL 3MOBL 5IJKC 4WO4B 5J0BA 5MHSE 4MXVE 4YLQT 2XTJB 2NW3A 4FQHA 1AS8A 3TA3A 2X4UB 1B88A 1FE8H 2XVKA 3IE4A 2QGBA 3ARBC 5BMFL 4CN6A 4MJID 4MB4A 3OMNB 4P2QE 3B1UA 2VAJA 3KCPA 2DJMA 4FKEA 2Y72A 5ELIA 1YHPA 5KSUA 5DS1A 2PWHA 4L29A 3CHRA 4ZNCD 4R0LA 4ZFOL 2YKLL 1SVCP 3T0EC 3FFOA 3REVA 4RFNC 5BZDA 2G4GA 2M1KA 2UXGA 4GUPA 1D7BA 4PJAA 3GTTA 4CDHA 2ZUTA 1HESA 4OI7A 1N4XL 2NY3D 2B9BA 4N2FA 4NDMB 4QRSB 4HIIA 4NJ9L 1A6VL 4BZ2A 2YSSB 3AITA 4ODBD 4UM8B 7FABH 2MHAB 5DUBB 5F8RC 4XO8A 1FYTB 1M71A 2FHBA 5ANME 4FULA 5J13C 5F8QC 3EO9L 1U8CB 5F7DA 5CEYB 1A6WH 3SGJA 1ZMYA 4Y5YB 2VL5B 2CJSA 4WO0A 3P11H 4YQXL 5JPNC 3S2AA 3LXBA 4J3OG 4LRIA 4W9IC 1E27B 5AVRB 4AIEA 3I50L 3T4YA 2VXTH 4ECNA 3QUZD 1J86A 3ESPA 4NQCE 3VI3E 5KYNA 4NP9A 4JX0A 3JVFC 1HIMH 2DH3A 5DVLA 4RSYA 2MOVA 3SDCD 1Q0XL 1ZA6B 3IDYB 4QXVA 5DWPA 3R1GH 2JQMA 3GNMH 1NCWH 5DEJA 3NCJH 2Q86B 1Q1PA 1ONQB 2V17H 4YJZL 2GJ6D 4AGNA 4ERSH 1EEUA 3CX5K 1R1CA 3IXTA 4XNUL 1PEWA 3CFQA 1BZ9A 1YMMA 4OLYH 1DSYA 5DTFA 3BMWA 1DQIA 1R3IH 5T33L 1VERA 3RIKA 3VRIB 3MGTA 3KWWA 5B1KA 1XH3B 4A55A 5GRUH 5B39A 1VCBC 2H45A 1UM5H 5EZIH 3AB0C 4Z7QB 1IGTA 5F6HJ 5HVWA 4RCAA 4NHCH 1QTPA 4NZ8A 2A1WL 3C9NB 5DA4A 5J8OA 2BVQA 1PG7L 4HKXA 1KMGA 2I85A 2ZKYA 1RK0A 1EAJA 2DJSA 3A6BH 5DUMH 5GS1A 1L9PA 3NJLA 5I8CA 2BS9A 4JFED 1DN2A 3PF2A 4LSDA 1BQ5A 3QS2A 1WHOA 4AQAB 5E4AA 2J2ZB 3CFJB 1KCWA 3BZEA 2J1WA 4HPYL 3Q01A 4DK6A 4EN3B 1TEFA 1IGYB 1OB1A 3HBGA 4HKZB 3TIDA 1ZY9A 1MIML 4L2YA 4QHLA 1G7LB 3ISRA 3B3IA 4RZCA 2P8MB 3HNSH 4V2BA 3K6IA 3GMLA 1L7IH 3P02A 4RAVA 1AR1C 5DD1L 3LHAA 2VDLB 5DGRA 3K80A 4GT0A 3IXAA 1OK8A 1I1AD 4C4BA 5K39A 1LD9B 2O61B 1XQ4A 3APFA 2QKIA 3NTCL 3GJEA 4HSAC 5BV7L 1ZGLA 2I7OA 3C2AL 1SQ2N 4Z8FH 4IDJH 4JFFA 4Z7WF 4W9FC 2K78A 2ZCHL 2EYTA 4Z78B 4LEXL 4LEEA 1Q1JH 3FU6A 2W59A 3MV9B 4BXSV 5IQ7H 2WKLA 4K3HA 1JAEA 5I8OL 3NSCA 2A6KB 1URLA 3TGXA 2HG5A 4LDEB 1WFTA 3QWNA 5LWYH 1I7TA 5LBVA 2DV6A 1KB5H 3FRPA 4E9SA 2QGDA 4HDIB 5F1NB 4ZMNA 4G3YH 4HMDA 3HHMA 3B9KB 4PGDB 3G6JE 3RZCB 5KANI 1RZKH 1BEYH 2AXHA 3FH7A 4XOBA 1A1MA 3FUFA 5GJTH 1R75A 3X17A 3V0JA 1AGCA 1IGFL 3MRDA 5IP4A 2VQ4A 3RX7A 4GW5A 1HSBB 2NW3B 1H8OA 2FO4A 3TA3B 1DVQA 3N5AA 1ETA1 1FFRA 1LMKA 1VKXA 1GAFL 1A66A 4UYPA 4MDJB 4OLXL 4FAAB 1LEGA 4DIXA 4V2CB 1XGPB 3PWNA 4NCC1 3AREB 3LEVH 5LBGA 5K5YA 3KCPB 1G9EA 1NGQL 5KSUB 4I2XE 5CUSL 2IANE 1RZJC 4OD2A 2X09A 1U33A 2WQSA 4L29B 4JQIH 4PJEB 4ZW6A 1QI3A 3QCVL 2F54D 4GUPB 1GOGA 4PP2A 1NDTA 3QJHA 3FU5A 5DFWH 5MP6H 1ADQA 2C9SA 5KVFH 2ICWJ 5D7IA 5BRPA 1FAIL 3H0TA 3OGCA 4HP5A 1HCVA 1SXAA 3ME0A 2PYEA 4TTDD 4Y1SA 1A7OL 2NSMA 5IUCA 1T5WA 1UKTA 4GG6A 4R8WL 5HVHC 5GGQH 3UBHA 4EO5A 3TP4A 1FLRL 1IKNC 1M71B 4XHJD 1NUDA 3T4AB 2QSVA 4CSTA 4U6TA 1BYOA 2CSPA 4Z7NB 4OCSL 1NWPA 3QXAA 5F7UA 2OJEA 4F1SA 5JORA 1N64L 2OMTA 3VXQA 3WFEH 2YAEA 3C87A 4NENA 1N59A 3ARDD 3Q7JA 3JTTA 1EMTH 3T3PF 2WXPA 4L4VE 3W1ZA 3DYPA 4UMGA 2IC2A 3SKNB 2CZNA 4BDVA 4AIZA 1Z3GH 3V0HA 5KJ7E 4WI0B 3DI2B 4WUUD 1BYPA 2OMNA 4GS7B 4QCIA 1QACA 3VB9A 2DQDL 1D6EA 2E7CA 3UERA 2KZ1B 4FFVD 1UYWH 3MRBA 2NQ3A 3NABH 1CJYA 4JG0H 3W2DL 3RNQA 4ZTOL 3QRLA 2JIXB 1Q38A 1HZHH 1FNAA 2WWMC 4YSSA 3IXTB 5KVEL 1YMMB 1NAKL 2OZ4H 2DTMH 1H3PH 3G04B 3MBXH 4EVNA 5DTFB 1IAIH 3N3EA 1ZVHA 2ATKA 4WIQA 1QSFA 4FABH 4QXUL 4X6CF 3KWWB 2H4EA 2CE6A 5B39B 1QNZL 2G2RA 5C0CA 4HUXB 3EOBA 4XP5H 1JK9A 3OLDA 4XWGH 1KFAH 3TZVD 1PEZA 4HEME 2F8OA 1B0GB 5I1GH 3SDAD 1LO2L 5BOPA 2H0PA 2W94A 4KHXL 3LZPA 2DLHA 4HKXB 3GMPB 4QRRE 2XA3A 1RK0B 2R1XB 5C6TL 1KIPB 1HL9A 3UTOA 4PWHA 2I9LA 3ZYZA 5HI4C 1S3KH 1TJHH 3EIFA 4HMCA 2QPFA 3NN8B 2AJUL 1MCSA 1P5UC 5C1MB 4QHLB 4CJ0A 4ISVA 4LT7A 4RZCB 3X3GH 4TNFA 3GMLB 3STBA 4J8RB 2Y2TA 1N3NB 3U9WA 4M1DL 1O75A 3CSYB 5K39B 5JOPD 1JPGA 4FG2A 3ARFB 5IMKB 3G5ZB 2D7MA 3DOSA 4AYSA 2ADYA 1XCQA 3GJEB 3T77A 2QPDB 3V5DA 3DTUB 4PGCB 2V9RA 4CMHC 4W4OC 2EYTB 3MCLL 4G8IA 1B2WH 4KJWC 2I24N 1J5OH 2PR4H 5TE4L 4BCXA 1QQDA 2YGQA 3QYMA 4FLSA 4M93B 3SDDB 4GAGL 2UZYA 1S3RA 3PWPB 4GIOA 3NYKA 3NZHH 5EHFA 4E42B 1IJNA 3BT2L 3QYCA 4FMFA 1I7TB 4ELKB 3IDIB 4NBXB 3SCMB 2G0LA 4JRXB 4MAYA 3TBBA 3FRPB 4M6AA 4KOBA 2FJFA 1Q94B 4MNGA 2IBBA 1KBWA 1PDKA 2PCYA 1U8KA 2OULB 4FRWA 4QIRA 1E28A 3W37A 4ODTH 4OCWL 4TMPA 5D1XD 1UM6L 4X50A 5CJQH 1S9YB 1TETL 1A6ZA 3HA0A 3VJ6A 5JNYA 3U9UB 1AGCB 4M4RB 3MRDB 4K9EL 4F33A 5LQBH 4GW5B 1MDTA 5I71B 3OR7B 3A3YB 3K1DA 1V7ML 1WITA 2HWZL 4D9RD 3I84A 1VKXB 2HVBA 3B56A 2FATH 4FFWD 4P5TB 4MDRA 3RJOA 2ODHA 3MLUH 1BLIA 3OKKA 1ZA3A 2OW6A 3APCA 2AV7A 2JMRA 3PWNB 2H3XC 3KPOA 4OF3A 1PZAA 4MD5A 1S7UB 2EDHA 2Z92A 4RGND 1DVFD 1MF2L 5DD6A 1JFQH 1MWAH 2GUOA 2OJZL 1F18A 3SD2A 5L4FA 1Y18B 2V3DA 4GRLD 2HP4A 4OD2B 1P2CA 4S1SL 5K93A 2HRPH 2NY6B 5CLYA 4G9DA 4JRYB 4LPXA 1V3MA 4LPCA 5HXMA 2H0EA 1J9RA 4PRHD 1Y0LA 4DN3L 3LPOA 4PP2B 4ES9A 4IOSA 4BZ1L 1QBBA 2CO2A 1V54B 4BFIA 4A7VA 3TO4C 5D7IB 2TSBA 4YDKL 5F96L 5FKPA 4RGOL 5MERB 4IRZH 3OQ3B 4KI1A 5ABDE 1MZYA 1BM3L 3D0LB 1LJMA 1HH6B 3MRPB 4GG6B 2LAAA 4JQVA 1BVLA 1U3ZA 2OYPA 1AS7A 4QR7A 4ADIA 2AK1L 3T71A 1GZHA 2Y6SD 2YD3A 4I48B 5C0NC 1OTSC 2NW2A 2QELA 2XWBA 3ZL4L 3FZUC 5AG8A 1ZV2A 5AW6B 1QG3A 1AQMA 3J07A 2O5ZL 4RZKA 3IMRA 3CN1A 3QXAB 1NCNA 2W9LA 3LIUA 5E1QA 4YHZL 5IV2A 3EF4A 3KPTA 5JORB 2ODIA 4J3BA 5FUZL 3L1OH 3DX3A 1OAXH 1PAZA 3EOAB 3ZQ9A 1A7BA 3GMOA 3QNXA 5KJRL 1GKOA 5FK9A 2ZXBA 3L5XH 3RUGF 3BWZA 1PVHA 3HNVL 2ZTBA 2JJSA 3CBKB 1MY7A 4QCIB 4Y0GA 5SV4A 3O2VL 4NQQA 3PYCA 5FHBH 2P8PA 1Z9PA 2XG5A 1E4XH 1VZIA 2CHXA 3Q06A 1IC1A 3P3TA 4BINA 3NP4A 4DNLA 4KJQC 4MKMA 3ETBJ 5C7XH 2CLRA 4WSGA 4G7YL 3TYFB 3WIAA 4EVNB 4KTYA 4H26B 4RIRA 1GC1C 3SD5A 1PZBA 2ATKB 3BH9A 3ZL1A 4AMXA 3BVDB 3BCDA 1O6VA 4PJGB 3PQYE 4FL4C 4GINA 1MJ8H 2J5WA 3KYOA 4C4UA 2OSLA 3W3BA 1B0RA 4QY8A 5C0CB 3RE0A 4WI4A 3PUUA 3U4KA 3HI5L 4L8DA 4JL1A 4RA3A 4JUTA 3KLLA 4PJ9A 5IROC 3FDWA 3I9GL 3SGEH 2YXFA 3VTAA 5C08D 5F93C 4HAGA 4G9FA 1A6PA 5KANG 3GI9L 3MSPA 3HC4H 2YRBA 3KGSA 3VFNB 4WWKD 4G1MB 2GI0A 1J5HA 2MPAH 3T6ZA 4YHOL 4JDVB 2QVKA 5IHUH 4UMSA 1ZJBA 2B20A 3MA7A 1DN0B 1DQKA 1O7VA 5T1LB 5HDWA 3U1QA 5E1IA 3VFMB 4ZO6A 2EUVA 1YPZB 4N6QA 3WJLA 4ISVB 3D06A 1KIUA 1EHAA 1F6LL 3B7SA 1MCIA 3JZ7A 25C8H 3DTXB 3HR5B 3W9EB 4BRJA 3Q2CA 1ZLEA 2P48B 2EDKA 2OMWA 3WJMB 4ZO9A 3U0WH 3M8OL 2DQTH 3TCTA 1BZEA 1CFNA 1IBHA 4R90H 4WW2C 1NANH 1JPGB 3PRZA 4FQXC 3DOSB 3NGBC 3T77B 4ODSH 3V5DB 3ZE2B 1TZIA 4H2AA 5J12C 2VC2B 4B96A 1PMYA 5ESQB 1YG9A 2X4NB 4U49A 1RIHH 5DRXA 2JCCA 5HHOA 1LWHA 1T66D 4G8IB 1OD7A 1PJ9A 3QEQA 3VE0A 5JA8B 1QQDB 2WM0A 3D7PA 5KTEH 4IRJA 3L3GA 3UX9B 1U8LB 4IKLA 4PP1D 3JWOC 5ISZA 3X13A 3FTVA 4X5WA 3HZYB 4Z3HA 2ENSA 2TRHA 3NZUA 3NIFB 3RI5F 3SQRA 4MAYB 3TVMD 4QGTA 3OZKA 4M7JL 4MNGB 2G9KA 5FUCC 1DO6A 1OAYL 1JYNA 1PDKB 5IBLD 1UWGH 4FTDA 3ZYIA 9PCYA 4OV5B 2DDQL 4I1NB 1U21A 1U95A 4K7PY 3KJ4B 2Q1EA 3WO4C 5F6IC 4LVEA 4LMQI 3V6OA 1X5AA 3L7EB 3OKYA 4OLZH 5B8CC 4ZT1A 3VJ6B 1A6ZB 3DI3B 4P3DA 4X7FC 5JNYB 2A6DB 5CS7A 1PLGL 4F33B 1IV8A 2YD5A 1MW2A 2R1WA 5F9DC 1Y7VA 2NY4C 1N6QH 5FA4A 1UB5A 3HN8A 3O0RH 4PJHF 1U2CA 3P9LA 4WO4C 5IVXE 5ABZA 2XWTB 1CGSL 2XTJC 4KX9A 1L9OA 5I24A 1A7PH 2R9HD 3RLSA 3UTSB 1OALA 4YHYB 3KPOB 3RTQD 4F7TB 5DD6B 2GUOB 4FDWA 3G6AA 4B6ZA 1E9QB 1M53A 1MVFA 1HT6A 3LKNB 4F37K 1P2CB 5D4JA 8FABB 5MEND 3IU4H 1ZHNA 5IWLA 1A7RL 3QFDB 5C07E 4QUOA 1Y0LB 1XF3A 2HLFC 1WISA 4R83A 3KPRD 3QNFA 4QHKI 4W9ZA 4F2FA 3NDZE 3FN0L 3O6FA 4BE6A 3ULUF 2XG4A 3EH3B 2D3LA 1MCLA 1INQB 4LHQB 4OFYD 1BVOA 4B9GA 5LBSA 1HK6A 1MFAL 1G0XA 4EDWL 2VB5A 1LE9A 3QJRB 5K9OA 5EIIG 1IO4C 3W9DB 1BVLB 1MFBL 5IJDC 4LLDB 1HXYA 4NUPA 2AAAA 3TNMA 2GKIA 4IGBA 2Q8BH 3RVTC 5I17B 1F4HA 2QLYA 3EJYD 1TZGH 4KRPB 2XWBB 2NW2B 4P2OD 3ZOAA 1C1EH 1MCCA 4IQHA 5EBLA 1M42A 4I4WA 6TAAA 5CEZL 3V7AG 4U6YA 2WB7A 4JG9A 2XWJB 3QUYD 4Y5YC 1MCKA 4KMTL 1W8EA 4LQFH 4LSTL 4NQEE 4JFWA 1QMUA 5MEPA 5GGSY 5GHWH 3GMOB 3B5GA 4LCYA 1P4UA 3VDCA 2B4CC 3UZVB 1NINA 3FC8A 3VFSA 1MREL 2Z91A 4KMLB 5BRQA 1EEYA 3FQRB 4AXWA 4XOAA 5AW3B 4KVCH 3IFNL 2BY0A 3ROLA 1IC7H 1DLFL 3LZRA 3SPCA 1E30A 4OBRA 3RVUD 2A73B 2AK4D 5ANHA 2JQZA 4RDBA 5EZPA 5HHXL 4ZFOA 2O4EA 4FQIL 5DYOA 5FGBC 2M2DA 3X2QB 3NEXA 5IT2L 1VSCA 4K3JH 5CNHA 3VFUB 3CQFA 3HMXL 4F8PA 2B0SH 5DRWB 4LCVA 5FUCE 4OUUA 4E9XA 3SOTA 3DUSB 4DEWA 3IJSA 4HU2A 2NYKA 3KBHE 2VRKA 2C9XA 3KYOB 4FP8L 3DO4A 2XIIA 2OSLB 4QY8B 3ZKXB 2E9WA 1QSEE 2YMTA 1WD8A 4L8DB 4Q52A 5D2LE 5L88L 2C9VA 4PJ9B 1XIWD 4FCAA 4H0LC 1YY9C 4G9FB 4YSPA 1G4MA 3THML 5C09E 5TK4A 3AY4A 1BQHG 1EGJL 3FT1A 4MMZB 1SVZA 4O2FA 5IVZB 1ZSDA 3TBVB 5J7CC 5JPMA 4ZYKA 4FA7B 1ZCRA 3CXHK 1T1XB 1A2YA 3MJ9L 4L3CA 3NCYP 3BH8B 2MSPA 5CCKL 3EDJA 4H8UA 3ILQD 3FTYA 1J0KA 3MUGA 1DR9A 3T0DA 4GKSA 3LVEA 4EN3C 1PIGA 4FXKA 5IF0A 2YIHA 3KE0A 1NGYB 3JWDC 2VLLB 3JYCA 5E7FA 4LSUH 1CFNB 1YEIH 3U7WL 4FADA 1C9SA 3DO3A 2R69H 4NWTH 5F88A 2IMMA 2LTQB 1KGWA 2VDMH 2X3BA 1MPAH 3OLGA 4YX2L 4X4ME 4MYPA 4EI5A 3V6BR 1WEJL 2JCCB 5DRXB 5IQLA 2VLME 1NZRA 3QEQB 3VE0B 4LOUC 2E8YA 2Q7NA 1A25A 2EP6A 2QQNH 4IRJB 3WXVH 3LHPH 2C1PA 4JO4L 4X6DE 2WNXA 3ZYJA 5IHZA 4HCRL 4F91B 5ISZB 2GTZA 2WCGA 1EO8H 5L9DH 1KXTA 1A5FL 4WGKA 5E9DE 1L4IA 2Q76A 3KLKA 4HJEA 4EOWL 5I6PA 5JA9A 4OQ1A 2NT1A 2XA8L 3MC0A 4LPUA 4XBPB 1KCKA 4Z7WA 3CFDA 3S3PA 2Z34A 2W0KA 4HD5A 1JZ2A 2CDEB 4PV1C 4XPFL 1SZNA 1IRAY 1TTFA 3BIKA 1JZFA 1P53A 2BERA 5AOJA 5IJBC 3FUMA 2XXGA 4HV8A 2JQAA 5BRZA 4JFQA 3RZCC 2MWCA 3SKOA 3GJFK 2FGZA 2I26N 2VSKB 3JV6A 4MD4B 1UB5B 1HJBC 1N2RA 1NLBH 3DMMB 4IU2A 1AC0A 5HYSG 2OMBA 1FG2B 3N44B 1O9ZA 3V4UL 2R83A 3TA3C 3W0WB 2WCSA 4JANB 1CC3A 1QASA 3S48A 2E6JA 1R9FA 3BKJH 3R4RA 3MGOA 5DLML 2G9HB 1FL3A 3NA4A 3K6FA 4G6JL 4YBLC 2GQHA 5DK0A 5D9SA 3AREC 3BXNA 5AZEH 3UAJA 2CM6A 4W1TA 1WIPA 4XTRD 4UT7L 4AL8C 4I0KA 2X0UA 4Z5RB 1J5CA 3TEXA 4JG1H 2VDPL 3C5ZA 2CQVA 1A6TA 3H4HA 1NMBH 1XF3B 3QUMA 4M5ZL 4TSCL 2JJUA 4XMVA 5TF1L 3E6HB 1PIFA 3SQOH 3DWTA 3V4VL 2NOYA 2VR7A 4W9JC 3VX0A 1U41A 3T1FA 4R4FH 4QRUA 2K6WA 5D96B 2KQNA 1C5DB 5IJVB 5D5ME 5K9OB 3FFCA 3KPSB 1ZXKA 1HXYB 5CSGA 2DMKA 5FYKE 4P9ML 1A9BA 4Y4HB 1MFDL 4AWJC 4FEMA 4O51A 4PJBE 4HBCH 2X4TA 1KGYE 1DQDH 2W88A 3T4AC 2AMGA 3WUZA 2AF2A 1RUKH 1ZHLA 3FB7A 2PCPA 1JNHA 1WZMA 3DX1A 4FNLH 3CZKA 2JF1A 2DEXX 1SM3H 5D6CA 3RA7L 4C58B 2WVSA 1HL5A 4M02A 5JQHC 5MEPB 3OB8A 3DGDA 3OKLB 4A68A 5HHPA 3T6XA 4LCYB 2QADD 5I76A 3VFSB 3WOVA 3C09B 1EEYB 4AXWB 1KGCE 1AGBA 4HIXH 2B14A 4J3VA 3ROLB 5IUSA 4HPOL 1CDHA 3BLPX 4X9GA 2V7NA 1SEQH 4GS7C 3UC0L 4FFYH 1ND0A 3GRWL 5TPWH 1GPOL 5KZCD 1TIUA 2NPLX 1OSZA 2GBTA 2G75A 4HS3A 4RX4D 4Z9KB 2ZOTA 3KYAA 4QPEA 2HLAA 3GSRA 3D2UD 3HC3H 5B7MA 2P24B 2O93L 3HFFA 3QIUA 4WW1A 5FHAL 3B7TA 5FCSH 4ONFH 3LQAL 3MLZH 3DIDA 3N1FC 4OGXL 3QORA 2LW3A 2HUEA 1M7IB 1TO5A 4YXKL 3II1A 1OT4A 2VCOA 5D6DA 3DHUA 4ZSOE 3C5SA 3D08A 3DDGA 3BUPA 3B5TA 3DJSA 1YNKH 1S7RA 4F9LC 3LZFL 5IFAH 4ZQKA 3WYRA 3QUHA 5HYJB 2VIRA 3E7JA 2C7UA 4ANUA 3Q8CA 4BV1A 5JPMB 1MAMH 3C8HA 4X6CA 2W9EL 1A2YB 3P0GB 2W9DH 2CBMA 4AX3A 1SOKA 1T1ZA 1A7QL 2GW5A 4LVHB 1IM3D 1G7QA 1YMHA 2B1OA 2BVPB 4NZTH 2ADFL 2DI7A 3W11D 3NIGF 4AGPA 4GW4B 4HK3N 4IKJA 5F3HB 3KDMA 4KY1L 3U48A 3BAKA 3MUGB 5IQMA 3VXRE 3DTDA 4HWUA 2X3AA 5B1BB 3SO3B 5IF0B 4ADJA 3D3VD 4P9HL 4X8CA 5BOJA 1GL4B 4HKJB 4MCZA 3UTQB 4YO0A 4HIQA 4LSRL 5AAMA 2LLNA 1HSAB 3FAXA 3ARFC 2QKIC 3N42B 1QPPA 5LUMA 3LEXB 1QFWI 3GIVA 3GZPA 2ROXA 4IU3B 2LLGA 4KGJA 1E50A 3OB0H 5T1JA 3FCTA 1CFBA 2B08A 3B9DA 4QKTA 5DZVA 1A3LH 2UZXA 3AS2A 2WZ0A 4TQEL 4Y4KD 3OF6D 5IHZB 2I9TA 1V7NL 3VSTA 2GTZB 5EU6B 4M93C 3SDDC 2WBJA 2OFQA 3ZQWA 4LASH 4K5PA 1X5JA 4H8PA 1JZEA 2B3RA 5F44A 4N0CC 1TQCB 4KXDA 2BIQA 2VLKB 4HAKA 4Z7WB 2DWYA 2BH0A 4KRMB 4LSPH 4P5RA 2EXWD 1MI5A 1XTLA 4YWGL 3BSHA 3IMUA 4U1IA 4N4YB 3EUDA 5D55A 4Y2DD 4L1SA 2R23A 1T1YA 4MSWA 4NAJA 2VDOH 1ASOA 3BZFA 4HV8B 2XICA 2X6VA 2F53E 4JFQB 3SKOB 2IEPA 2BOCB 1NBCA 4ZTPH 1AXSB 2NY0B 2F1AA 3IVKA 5DRZA 2CGRH 2BZDA 3OM3B 3DETC 3AROA 4GRMA 4X7SH 4BSVB 5AVXB 3CSBA 3EZ8A 5I71C 3OX8A 3PXJA 1LDSA 2YD8A 1UA6H 4LPTA 1GVIA 1UZ8A 5AOZA 3I74A 3GS0A 4P5TC 4QOKE 4HT1H 5FYLD 1IM9B 1C5BH 3U4EA 1FL3B 1USZA 2IPTL 4W81A 4P2QA 3OHMB 4JRFA 2P5EA 4DGUA 3CFCH 4PRPD 1GSKA 3BXNB 3HHSB 4GFTB 3NCMA 4M8QB 1E65A 1NGPH 3TN0B 2WK2A 3WN6A 4I1RA 1WUZA 4HLZH 1JGUH 3WY3A 3RX5A 1KPUB 4J3SA 1DQJA 3S36H 1SMAA 2NY6C 3QQ3B 3HLKA 4R7LA 2Y07H 1A6TB 3LH9A 3QUMB 2W0PA 3RPIA 4JN2A 4XP9L 4JFDE 1WSST 1L3NA 1KXVC 4HWBL 2F7QA 4J1UA 1SBSL 1FGNH 3T1FB 4ZUUA 1WIUA 4I13B 4ZUTA 3LXAA 1G1OA 1M1XB 4Y5VB 1D2PA 4LNVA 3LRSA 4YSDA 1EAQA 1CICA 1XB3A 1IKOP 4UZGA 4S10A 5F9JA 1U3JA 2YLKA 2CCWA 1RUAH 2X4TB 4M7KL 2IDTA 3QDME 4N3TA 4WFGE 1DVZA 2FJUB 1JHLH 3BE1L 3FB7B 1QKZL 3CZFB 3P4NA 2PCPB 4O9HL 2MRYA 1AI1L 2JI2A 1FNSL 1FG9C 1IC5H 4N8UA 4NRZA 4QHKJ 5D6CB 3EBAA 5L2KA 5T3XL 1PFCA 4U1LB 3GGWA 2J8UE 1SXCA 3KLHC 3V79C 2H41A 4JDZA 1HQ4B 1IEBA 2HT2D 1GTNA 4GPVA 1UCTA 4HUCA 5HHPB 3L3KB 4XPGL 3MYJB 1BVNP 3HMWL 2YAMA 3HR6A 3TJEH 1IILE 3MOAL 1DBAH 4L3FA 4JREB 4MNQB 3K91A 1IQWH 1T6BX 1R3LA 1U4EA 2RD0A 5I1DA 4WY7H 1OSZB 2I69A 3BDXA 1RSFA 2YD0A 2IH3B 3QRGL 4X4XA 3BP6B 3QIUB 4DKTA 3WD5L 4RMWA 3RUGA 3BPNB 5INDA 5LGKA 1AP2A 1LWJA 1ROWA 5JDSB 2Q6WA 4AM0A 3INOA 3NCCB 3QORB 4FLRA 4V1DE 4OJCA 1B3JA 1PZ2A 2IAMA 3C5SB 2IVFC 1BF2A 1T83A 1HQRA 3HI1B 2HPOA 4UV7H 5A43C 4L8CA 2MTPA 4ZQKB 3BUIA 4OZGF 3LYRA 4N2IA 4NP4H 1H3XA 4ELME 1AZUA 3D25B 5C0BE 1FZJA 2VIRB 2Z35A 1NCAL 2NDGA 1AXTH 1RXLA 4NRXB 4X6CB 4XH2A 1SYSA 3OKNA 3VXSE 3D34A 1T1ZB 4A63A 3IRZA 3K5RA 1G7QB 1K8IB 1R0AH 2FECI 2HTKC 3NJHA 3BYTA 3KDMB 1MW1A 1SQMA 3MV8B 4TQPA 1HYSD 3ULVC 5TH2B 3CU1A 1WBXA 4WHTA 1HZKA 4PRIE 3QIBD 4EDXB 2DQJL 4HIJA 1RD6A 4P57B 3HE7D 3PV6B 4UUJA 3P0VH 3MRKA 1WFUA 3IJ8A 2WUCH 1I75A 2YEZA 4OLVH 1E8XA 1YEKL 3TWYA 1AQHA 1VIWA 2W91A 2G60L 4JHVA 1PSKH 4OD1H 4WI9A 2XQYG 3IFOA 4M7LH 3SPVA 3S35X 1BREA 4C56D 4GUOA 3FCTB 1X5FA 3N85H 5FW8A 1QYGH 1KGJA 5DHMC 1JHKL 5AVTB 3BSZL 1G9MH 2EE2A 3N1GC 4XVTL 1BAGA 3Q8FA 3L3JB 2WBJB 2P44B 2PWFA 4PJ7E 4MX7A 5EWIH 4KDTA 1ULVA 2KZBA 3WMSA 2WP3T 4KI5C 4MAYC 2MMXA 5ICXA 1MI5B 1N67A 5ETUA 5INCA 1CN4A 3FYIB 1CXKA 2VISA 3EJPA 3G6JA 3KJ4C 1T1YB 3BZFB 1IGMH 4FJYA 4O02A 5IZ7A 1KXQA 3LKPA 4K15A 5I30H 3IVKB 1OP5K 4JHAL 1PCSA 1ZT7A 1NJ9A 4ZJ9A 4XO5A 3OX8B 3ARWA 4N1EA 4YHLH 1IGIL 4Q9RL 4PG2A 3ECBA 2ZXGA 1UCBL 4FFZL 1MG2C 1RUML 5BO0D 3QPXH 4XVJH 3U4EB 2A9NH 3F83A 4L4JA 2D03H 4P2QB 3SN6N 4NM4L 4YHYC 3QNZA 3UJJL 2XY1A 2IOOA 3RWHB 3QFJA 4WEUD 5GRWA 1SNRA 3FQNA 4I3SH 5ITFB 1VADA 3FU8A 1E5BA 1U8JB 3PWLA 4PJHA 1DVXA 4Y9EA 2BRRH 5D7LA 2VZSA 3CVCA 4IIQB 4NKMA 3K71A 1DQJB 2Y3AA 2BLFA 3QJOA 1WCBA 2SEBA 3RGBA 1G87A 4JCWA 3ESNA 4TSAH 1X5IA 3EO0B 4Y19A 3U25A 5C9JB 4G8GD 1S9KC 3ZHFA 4ENZA 5ACZA 3QISA 3BYYA 5ID0A 4X5PA 4FYRA 1OD9A 2IMNA 2J8OA 5CZRA 2E8ZA 2YN3A 4XC3L 3UTTD 5JR1L 3N40F 1ZTXL 4ZUUB 3VH8A 1TUPA 2OTUA 2IFFH 1MFNA 4ZUTB 4KQ3H 4LCWE 2K8QA 4G6KL 1PYWB 3LRSB 1HX0A 4JQVC 4NGHH 1I8IB 1X4ZA 2UVFA 4FG6C 4LCCA 4XE5B 3CQPA 3DX7A 4XAWH 1NC2A 5ANMB 1NSNH 4GP4B 5F9JB 4E9WA 1DBBH 1S5IL 2P1YA 3BKCH 4JFEE 4KRPC 3P4NB 1TMQA 4I1PA 3L3DA 2E59A 4NRZB 1E6JL 2C9QA 3DIFB 3LKOA 3GGWB 1T21A 3H6AA 1CI5A 1YEFL 3ZO0A 1TVBB 4PAZA 1QWNA 3ZT7A 3NP3A 1BMGA 4XXWC 4NQCB 5CJOL 4PYGA 3V2AR 2P28B 2BIPA 4GXVH 4R4ND 4KKZA 1OK0A 3DURB 5J1AA 3V0VA 5CD5C 2X0WA 2ZAHA 3CH1B 3BAJA 1DL7L 3N1PC 1P4LA 4OZIE 1CFVL 4YNYA 1R3LB 2FR4B 1TZHA 2JJSC 2Y7LA 5I16A 4JPWH 1AMYA 1A6AB 1FC1A 2YQGA 4YSQA 2VDRB 3LXUX 1YYLH 5AAWC 4KH9A 3JWNG 1M2OA 4NRYA 1KT2A 2PP7A 1R34A 4H20H 3SPGA 1AP2B 3C2SA 3E9UA 3FF8A 3IF1A 3TX4A 3EYVA 1QRNE 3PAZA 5DT1L 4N2KA 1GCFA 2AERT 5FECA 3B9EA 4FQLL 2FJGA 4MKTA 3ZKXC 2VLRA 5E8OB 2WXQA 3IGUA 4NUJA 4U1NA 3VYPA 2FSEA 3V0GA 1G4RA 3HS0B 4L8CB 4PJ9C 1NL0H 4XNBA 1JGVH 3FPYA 4P2AA 5E6ID 5J6GA 4AH2A 3IU3B 4FF9A 5DVKA 1RZIA 4J4PD 3ZKMC 3CVIH 1SYSB 2G2NA 1P6FA 4MMZC 2IBZY 4I0PA 5DDHB 5FCUH 3O4LA 4Y1AD 1NOLA 5DJDB 1G0YR 1JWSA 1KJ2A 4WWPA 1EJFA 3PIQA 5DFTA 1WWAX 2L7JA 1S7TA 4MCMA 4ZD3L 3L1FA 4NNPL 1FBIL 1CDGA 4B9CA 4WHTB 3WJLC 4ANVA 1AKJA 1BECA 1P6WA 4P5SA 1FFOB 1XBRA 4JY4A 1XGUB 4UUJB 1X4YA 3MRKB 3HNTL 2F5AH 3BPCB 3RI5K 5HP5A 2YEZB 4XPTH 5C3LD 4YHIA 4JUSA 4KX7A 2Y24A 3QZWA 3HMXA 4DGVH 2LTQC 5FLUA 4PH8A 1U8IA 1VEPA 3SPVB 2BVOA 3PCYA 3LN5B 1AXIB 4DN4H 3QZNA 1RIUH 4C57C 5IG7A 4H5SB 2XWDA 4GIAA 4YZFF 4ANWA 2XIBA 3ROOA 1JDDA 4IRJC 1NFDE 2Q3ZA 2DWSA 4N2OA 3TA4D 2QV2A 2JVUA 3Q8EA 1G7JB 1RMFH 2E6QA 4RH4A 1I8MA 4LLVA 5FOBA 5CILH 5ADOL 3B7UX 3G6JB 1NC4B 4YE0A 1HYRC 1BQLH 3TH4T 4NZUL 1OANA 1S78D 2XN9E 3LIZL 3V6OC 4PU2A 4O02B 3LNFA 3MRHB 1P7BA 3NJFA 1D9KD 5D2NA 3LKPB 4ZK8A 5A6MA 5C3IA 4UQBA 1ZT7B 3EAKA 1GGUA 4W9DC 4UTBA 2J73A 1WZ1L 4H1LA 4PTTB 1HIML 1I7ZB 1OTUD 3VNZA 1VAHA 3DMMC 4J3OF 4PMEA 4RRPM 1BFVL 1DSFH 3KVDD 4Q14A 5K9QI 1QRKA 4XN9A 1S9VA 3S2CA 3VXUE 4P4KB 3CTTA 5GISL 1FIGH 1ADQH 3LH2L 2WN3A 5EUKA 2JLPA 3O3DA 2RCSL 2KDYA 4I2XB 4KDWA 2OK0H 2A83A 2EDFA 2IANB 3BJ91 5FYJD 1XF5A 1R3IL 4G8FA 4P2RD 5GSRB 1MCFA 5FDWB 3ZL2A 4UILL 3HG1E 4NKMB 2YUVA 4PSPA 3K71B 3DGGB 1QHQA 1WCBB 2SEBB 2NY5L 3HE6A 5IWLC 4LSSL 5E2UH 2G5UA 3ILPA 4HCRA 3OXSA 4TF4A 4Z7AA 1XDTT 5ACZB 1Z9NA 5ID0B 4RISH 4O2CB 3O0LA 4YFDB 3S3SA 4BA0A 4M9OA 4O5LL 4MMYB 2GT9A 1YECH 4NHCL 2ZKWA 1JRHL 1AC6A 1LK2B 5CZKA 3BAEH 3GMRB 2J8UF 2OTUB 1NGWB 4PJ8D 4DP7X 5ACLA 4X6EB 5GZND 4N2AA 1H6EA 2YS4A 2AEPH 1JZ7A 1CFMA 5D96C 3ZK0A 4A37A 1T04B 3IDUA 3LRGA 4YPJA 1FF5A 2FUQA 2YAHA 1DJWA 3RVVD 1JTTA 1RZ7L 3TEUA 5D70H 4CU8A 4MA1B 2OMZA 2BPBA 4G2AA 5JHDA 1DBJH 3BGMA 1ZE3C 1AZZC 1TQSA 3QAZB 1OHZA 1BQKA 2YR3A 3AU1B 2GHZA 1J8SA 2OMVA 4UTCA 1ET7A 1F3DH 2H6PB 3ARGA 3F58L 4LK4A 3NH7H 4ODVL 4XI5D 3HG3A 4DGIL 4L4VB 1OGAD 2V5SA 1H6TA 2EDXA 2N01B 1NPJA 5LNDA 3OWRA 3RX9A 1KLUB 5TQ2L 2ORBH 5AW4B 3C09C 3V0VB 2O5YL 5JOPE 1P4LB 2D7QA 2H0JA 3PLYA 1L7TH 1BF5A 2CJUL 4YNYB 4POUB 3WIFA 1TZHB 4ZNEE 2NX5D 3EO1B 3NCYS 1FO0B 3TF4A 4Z8FL 2JE8A 3IMSA 4WUKL 1EWHA 1Q1JL 2FBRA 1U6AL 3QZLA 1GZQA 2EDQA 3GSNL 5H35A 2OR8A 3V4VA 2TAAA 1NIDA 4QMEA 1FNEA 1R5WB 3BESR 1JGEB 3IF1B 3T0ED 5IBTH 1E9PA 4CMMA 5LWYL 4J2XA 1CLYH 1T22A 5FECB 3L16A 1Z5LB 4KUZH 5I23A 3ZPDA 5D1QA 5DMIH 1IFRA 4IKNA 4J2QA 4NUJB 3BEVA 5J06A 2OSWA 2FSEB 5DHYB 4EIUA 4XP1L 2O6DA 1RP9A 1VFAA 3IM1A 4KJPC 4Q8BA 4OGAC 4OZFG 4AH2B 3MRIB 1KJ3L 3AY4C 3MXWH 4PGZA 3S34L 1YUKB 2PP8A 4QRRB 3FB5B 3R4DA 1JZ8A 1D5MB 5JPMC 4DEPB 3TPUB 1X5ZA 1FZKA 2AJVL 3RKPA 1KJ2B 4KKQA 4LVHC 4TPRH 3SDXF 4UIKL 3IAGC 2NDFA 2YZ1A 1S7TB 1U93A 1P0SE 2ED6A 5JW5B 4G5ZH 2AABL 4TNGA 2YOAA 1NFKA 1H15A 1AKJB 1XF2A 4RMBA 1DVTA 3QH3B 3KBFA 3S37H 4HC1L 2UWEF 3L81A 1ZLWK 3SO3C 4YEFA 1XZ0A 3RWFA 5FA3A 3WNOA 1F4YH 2H8PA 3D0VA 4HSQA 2J72A 4ZMVA 3QT2A 4YHIB 5FPIA 3VXMA 5H4YA 3V0WL 4N86A 5ADPH 2DL2A 3F12B 2WWOA 4XPBH 1INDH 2XN1A 2PW1B 3MRJB 3V0AC 4A2EA 3D85D 5EN2B 1F56A 1U8IB 2A6IB 1QBLH 3DUUA 4AYMC 4A6YB 2BVOB 5ITBL 5GGSB 5JHAA 2EXSA 3IJ9A 4AYGA 5KVFL 2PXYA 2C4FU 5IG7B 2E27H 4WKZA 1SMOA 4RWYH 3ROOB 1A7NH 4P23A 3H3PH 1PD1A 3V0EA 2LOEA 4MA8H 3MNWB 1FZOB 4S1DC 3RU8L 1F00I 1NEUA 4BEIA 4HS6A 2FIRT 5KYXB 3GSUA 4XCCH 4IMKA 1TQCC 3RPKA 5FOBB 2O5NA 4TL4A 5F7WC 1HKLH 4ZMQA 4GBXD 3EYOB 3KYKL 1NDMB 3NRPA 3U79A 3D18B 3UCQA 3SIKA 2EVGA 4FE9A 1F3JB 4FX5A 1DANU 1V55B 4WI3A 4PBXA 2E7HA 1EMTL 3D39A 3SY6A 3N2JA 4XX1E 4N90D 4EI6B 2EDDA 2NY0C 4WAFA 1NDGB 2LU3A 4OSUL 1IEHA 3OPZL 3ISWA 5JHLH 4JJ5A 2HJKB 5KVGL 1LP9E 2A9ML 3TBTB 4AYFA 1QR1A 1EHNA 4LRNL 4NCC2 1S9VB 2APFA 5JW3L 5EUKB 5C0EA 5JZ7D 1HNGA 5BV7C 2DJ4A 4P2YA 3LMJL 2X4QB 3UAJC 4Z0XA 3VW3L 4B9FA 3TN0C 2AKRA 3RVXD 5KSVA 4X7EC 3MLSH 4U1MA 2AGJH 5E4EB 2WZPD 2AXGB 4R26L 1ZGLP 4KZEH 4Y8AA 3HE6B 2RH0A 1OSPL 1UKSA 3ILPB 3OXSB 4WGWB 5SWZD 4B9JA 1GJWA 2OL3H 4XWGL 3ML9A 1ODAA 4TUKH 2Y06H 1MHPL 1YO4A 2GT9B 4PUBH 1TJIH 2IWFA 5I1GL 2FSDA 1KCRL 3FCBA 4RQQA 5C0DA 1F2QA 2QSTA 3ESUF 4HK0A 2BNQE 4RA0C 4J23A 2K70A 2P7TB 4WTWA 4Y1TA 1S7WA 5ALCH 3WXWH 3FTSA 4Y5VC 5DXWA 2F5BH 4QRTB 2CKBH 2EDOA 3LRKA 3QHZH 4QXWA 5C6WH 2HUHA 2DBLH 5JMOC 4DEUA 2MQ0A 4OJAA 1HOEA 3BGMB 3K4ZA 2ICES 2FYYA 5F7BA 1SFHA 3NFPB 3MV7E 3S4SA 4E36A 5AWNH 5CIPA 1XGYH 5LXGH 5ALBL 1YJDH 4NO2A 2AQSA 4HCFA 1UZ6E 3X3FH 4D2NA 3GMNB 1J88A 4GIPD 2XV0A 4G80A 1TZ8A 5I6MA 3WS6A 4N1CA 2PTUA 2BOBB 4JREC 3WIFB 5F21B 4PD4J 1D5IL 1KACB 1J87A 4K2UL 5CEXA 2FIKA 4H0IA 2JTDA 5EZLA 1J5OL 2JNZA 2AP2A 1AGFA 4GQPH 4NYLA 1GZQB 4KTEH 5H35B 3H9SD 1ZV5A 1OAUL 3V0IA 1MQKL 4NKIH 4WV1B 4NWUH 5IVOA 3PNWB 3PGDB 3O8XA 3QIUC 4FXGB 4MWFB 1K72A 3TH3T 2IOIA 3PQYB 4R5VA 1HDMB 3BPNC 5FV1L 1LDPH 4M6OH 2B3IA 4L23A 4JPIB 3LPPA 3QORC 3CLEH 2DKSA 3DOHA 4TLSA 1KIQA 5D6DC 1ZEAL 3F62A 4QF1A 5FC9A 5C09A 1W72L 1RQ5A 1FVDB 2YQBA 3ZE0F 2Z31B 1OAZH 2ZNXA 2APTA 2UVEA 4IMLA 3TT1L 4N5UA 1I1RA 1I3RB 1H8NA 4BQ8A 4TOYH 5I1JL 5C0AA 4WFHD 4DVRH 3OGOE 3ETBF 4TRPH 4JM0A 5K9QG 5TF0A 3FQTA 3CZEA 3CC1A 4GMSL 2ZXCA 1K2DA 2OMYA 3HI6H 2WTRA 4MQ7A 4FMVA 4OZGA 1J8HE 3F05A 2G5BA 1BZ7A 1H15B 4YSUA 1XF2B 5I6XB 2OR9L 5DSCA 2RIKA 1EFXD 2ADGA 2ARWA 3DSNB 2RBLA 4HJJH 4NC1C 2YPLA 1OP3K 2J88H 4M62L 5IEKB 4NM8H 5FA3B 5DD0H 5I1KL 3QQ4A 1YEHL 4NZRH 2ITDA 4HJ0C 3RBSA 5KYUB 2GY5A 2P5WD 1MFMA 2J4WL 4QAWA 3L95A 1CIUA 3VXMB 4TUOA 4ZX3A 4OU3A 3T2QA 2J56A 5AAMC 2VSCA 4X9YA 5ENWB 1KN4H 4WHYH 5HJGA 3V5KA 1UWXK 4ZPVB 2WWMD 4E5XG 2PXYB 3AXIA 1YEJH 3QEUB 3U6RB 4GMTL 1IBFA 2AQQA 2BFVH 3KL3A 4IS6A 4WKZB 5LAXA 2V5TA 4P23B 1OPGH 4JFHD 4F2ME 4LARH 3QIWB 4R5TA 1DDHB 2J20A 3L08A 3F85A 5DR5L 2WBJC 5EH1A 3GSUB 4JVUA 3KPMB 4QJ5B 4M43L 4CC1A 2DQFB 1QZNA 2OJ1A 2XQBH 3SBPA 2AJXH 5BO1L 2C26A 1L0QA 3I3DA 3BC9A 2D73A 3L1OL 4IM8A 1OAXL 3NZSA 4D9QD 3UBGA 4Z7VF 4PJ5A 3E8UH 3DX9A 2HAZA 3PHOA 4I5BA 3ARYA 1U3HB 4ACTA 1GRWA 4Y5XA 2ESVD 4UV4L 3PL6B 4HCGA 3WHXB 5J1SC 5HI4D 1EAPA 3GTVA 4J5VA 3DXAE 1IC4H 4M7LT 4GUCA 2WXRA 3QQDA 3MREB 1M7DA 3IDMA 3S5LA 2CGYA 1RV6X 3UJIL 2ISDA 4JFOA 2LQRA 1KTRL 5F89A 5C0EB 3OWEA 1HH9B 5CZXD 2OX5B 3P4LA 3VU2A 3K8LA 1L9MA 1XL6A 5LBSH 2XYCA 4GI6A 3TJHC 5HDQH 3GJFH 2AKRB 3MN8A 3WV0A 4H8WL 4U1MB 4X5QA 5FR3A 2GEEA 5IHLB 5C07B 4JEGB 3BSZA 5F7EH 3WSQL 2V2TA 5EOTA 1E4WL 6FABH 1Z2KA 3MOBH 1FIEA 1MNUL 5K9KB 4RQQB 4OF5A 2H47C 1LO5A 2AXWA 4ZXBA 2ZUQB 5BMFH 2EZ0C 1MH5A 1S7WB 2E86A 4UIMA 2YA2A 1S7VA 2XNAA 2UX7A 1SOSA 2KT6A 4IJ3B 4E41D 5HDBF 1SJVA 4XAKE 4KV5E 3QDJD 3RGVB 4M9PA 3MRQA 3RZWA 4JPQA 2HFEB 2KZWA 3WS3B 3TTYA 2HT4C 2Y2YA 2FYYB 2YKLH 5D7JD 3S4SB 2NY1D 4B9IA 1SJHA 1T20A 2PR9A 2HKHL 5KUMA 1EEQA 4KO7A 3HS8A 1M56B 3R06B 2AVFA 3BFOA 4YEEA 1N4XH 1JXDA 3FT2A 4R90L 2WNGA 2NNCA 1A6VH 1AGDA 3PU7A 3KG5A 1OTTC 4MS8C 4F8TA 3SODB 4HJSA 1CDJA 3N50A 4FZ8L 4XX1G 1WAAE 5E4OA 3D4YA 4W6WB 1K5NB 4FYQA 1JBJA 3KD4A 3P77B 4XE0A 4LCIL 5KTEL 2MNJB 5BS0E 3EO9H 1CLZL 3EOTL 5DJXA 4F9PA 1CZ8L 3O8XB 3BD5A 3NQKA 4M8UA 4DQOL 1OZUA 4EKJA 4YQXH 1RHFA 5I0VA 4J28A 1QSEB 4L8SA 1AO7D 3I50H 1NGXB 5D2LB 4ZAKD 1V8HA 1HINL 1TKWA 2E76C 3EDEA 3ZE1E 2IAMC 2GK0A 4AMWA 3UZEA 4QF1B 5EUOF 3NFNB 5C09B 3L4TA 3P73A 3FW6A 5IBUG 4G1EB 3HS0C 3A4DA 4MYWB 3L3IB 1Q0XH 4BWUA 1JSYA 3CAFA 1K5WA 3SE4A 3T2NH 4M61A 4E9YA 5CR8A 5A2LH 2QDWA 2X2YA 4Q2ZA 5DVNA 1YAIA 4XNUH 2E6PA 2BSTA 3D0AA 1OTSD 3EYUL 3V8CA 5CKGA 3GT6A 1JVLA 1A7PL 5T33H 1CD8A 2G5BB 4WRLA 4LF3A 1JGLL 4AV0A 1BZ7B 4F1ZA 2EINB 2YD2A 2ZXEB 2EO7A 3KL0A 4TNVF 4S1QL 2ADGB 3T04D 4I18A 2QTVA 2YPLB 2X6BA 1MFVA 3TNNA 4L4TE 3UBFA 4PRNA 5BVPL 2VZ3A 4TUOB 4ZMOA 3DBSA 4JKNA 2VDKB 1IAOA 2XFXA 3FU0A 5F7KC 1AQKL 1E90A 3ZKND 2A1WH 2AZUA 1L9NA 4L37A 1IT9L 4ZFFA 3JTSA 1PG7H 3Q2VA 2DAVA 3V5KB 1DJXA 2P5PA 2YBGA 2P80A 4MJ2A 4C55A 2K0RA 3KPLA 1S5HA 2X9ZA 4KJQD 1A3QA 3LKQA 3IBOA 4IS6B 2JJWA 5LAXB 1CTMA 4K5OA 2X9YA 2V9TA 4X6DB 5E94B 5GPRA 3OAUL 4WK0B 1MCNA 2HFFA 1MIMH 3BIBX 5C2BL 4I88A 1P7QA 5E9NA 1MHHA 1YYCA 2GTQA 1YN6B 2WOYA 3QWRD 5E9DB 4HHWA 1I4FA 4GH7B 4KDTC 4ACPA 5DD1H 4HOXA 2ZUSA 3FCUB 2QSCL 2UY6A 5G5DA 2IV9A 4KVNL 4B9KC 1XXFC 4ABWA 3B4NA 4LQFL 3NTCH 4JDTL 2W1NA 1ZHBB 1ZDQA 1WBZA 2X4OA 3LS4L 1BD2D 3DX9B 4I5BB 1KFGA 2ZCHH 4NC2B 4HISA 4MBRA 1CU4L 4LEXH 1TEGA 1NIBA 2BCMA 3OHXA 2IGLA 3RG1C 1EJ6A 3R19A 5I8OH 1U30A 3ZKQD 2NMSA 1INEL 2Z7ZA 2R29L 4F8NA 1M7DB 3IDMB 4PG2C 4BHUI 2PPAA 1BA9A 5DMGC 1LGVA 5BZXA 3T6QC 5F89B 4D7BA 4P4KC 3O11A 4PQXA 3SB3A 4RESB 2W65B 3L4UA 3MRRA 1MLCA 4XWOC 4HUWA 2WGXA 4Y4FB 2BZCA 2GG1A 1T7ZA 3CHSA 5B3NA 2FBJL 2R0ZL 2V2TB 5EOTB 4P05A 3H2PA 4F7CA 4JFDA 4KXZH 1GYAA 1MCOL 5EBWB 4HG4J 5I28A 3REWA 1N8OE 4Z23A 4EIGB 1U8PB 1Q0YL 1WC7B 3LSOB 4L1DA 1GAFH 4NC0B 1S8DB 4KWUA 1WA2X 4WKXA 3BH4A 5D5MB 1WDAA 4OFIA 5D7SL 3EXJA 1C8QA 1G9NL 1H0DB 2BX5A 1S7VB 2XNAB 4I0CC 1MIEL 1UZ6F 4ZUVA 4Q9CA 3ASWA 2K9FB 2GCYB 1ED3A 2G3NA 5B38G 4G42A 1NGQH 4XHQA 1I7UB 1JGIA 5CN3A 5CUSH 3MRQB 3TOPA 4B97A 3AVEA 4MA1C 4R3SA 3VGAB 4OCMC 1ASPA 4BWWA 1URIA 5IEHA 3ULUC 1QW9A 1S6NA 2J8UA 2VLJE 3MTXA 3KWVA 1SJHB 3CFTA 3QAZC 3QCVH 4D8PB 1OE3A 3X1GA 3U2JA 3GUTB 1ODUA 1R3JA 2UV3A 1JZIA 4WWID 1LEKA 3WHE1 5DZOA 1LLAA 1HZLA 4WO4D 3ZMEA 2HX8A 2WNWA 3C5JB 2XTJD 4U0RB 1FAIH 5KBMA 1AGDB 3JXAA 3K6OA 2BNRE 1A7OH 1EJOH 2CNZA 4H13C 4ORZC 3TTSA 2EJ1A 1HL8A 5LGJB 3VYOA 2BIHA 1E4KA 2VXUL 4EQ3A 1FLRH 2QFRA 1PLCA 4IHOA 3BLBA 3JT0A 2ZG1A 3WDJA 2VMFA 2UYLA 3C60B 3RURA 2BVYA 2CUAA 2GEQA 1I8KB 2VOTA 3ZX1A 2ZXAA 2WKOF 1N8ZA 2BS8A 5DJ8B 4M5TA 5HHQB 3BRFA 1N64H 3RHWF 2HLFD 3BOVA 3O45B 5D71L 1RZGB 3D09A 4L8BA 4LSVL 3TFBA 1JCKA 3FO9A 1NM9A 5ERWA 1H8LA 5BPPA 1T2JA 5CAYB 1YZZA 2EDNA 4AV4A 4ALAC 3P73B 3WTWA 5EEXA 1EXGA 4HGWA 3FCSB 5JXED 3ZMRA 4QRQB 2ZOLA 2UZIL 3BVXA 5SV3A 3I6SA 4J39A 2DQDH 4FZEL 3SEPA 3W2DH 4PV9B 5J3HD 4OM0L 2A99A 4X7CC 4ZTOH 5IB2B 4KTGA 2GSGA 4I0PC 4Q2ZB 4AEEA 3AU0A 2BSTB 1FYTD 2ZP0T 4DEPC 5GZOD 5KVEH 4NKOA 1NAKH 3COOA 2OMXA 2NTSP 4GQZA 2YJQA 1MJJA 4JE0A 2QEJA 1F3RB 4I18B 1QNZH 1CDUA 3TNNB 1R17A 1U8NA 4MJIA 2BP3A 4PRNB 4YDIL 3IAPA 1DFBL 3H6JA 2YOCA 1EZSA 4AGQA 1IAOB 5SWQA 5AKVA 1D7CA 3SDXA 4ZFFB 1E3ZA 2ALAA 2IXQA 4IBQA 4EBQL 2CIKA 1ICTA 1HJCA 1F4AA 4G8EA 3KPLB 1S5HB 1KB5A 5ECJE 3EHBB 2UWEA 3MX0A 4J3UA 3WY4A 3L9EA 1PBYA 2EE0A 2AJUH 3KM2A 5JTWA 3VD7A 1TO4A 1X5KA 2GYSA 2HMID 4TUJB 3NDYE 1P7QB 4ZW7A 1MHHB 2HJFA 1FNGA 1I4FB 3BCFA 4BFRA 2YD4A 2EYRA 3OKOB 4K94C 5KVMC 5E99L 3SYCA 2H3KA 3DBXA 3Q6GL 2ZYSA 1MNNA 4M1DH 2XIDA 3FQXA 3KDPB 2F53B 1NCJA 1WBZB 2WSKA 4YDZA 4PJAE 4QT5B 3P3YA 1BIIA 3MCLH 4B9ZA 3SQBB 1EX0A 1LO3L 3LXCA 2GK2A 3OHXB 2GJRA 1BM7A 2AJSL 3FB8A 4HC1A 4P5MA 4HIXL 5TE4H 3GHPA 3I9AA 1CBJA 2OV0A 4GAGH 4QOKB 4PG9A 4HFWA 4HKBB 1TYJA 1AY1L 4EN3D 3BT2H 3SDCA 3P2BA 2VQ1B 3RFZB 5E24E 1FCCA 3O11B 3TJPA 2EEAA 2GJ6A 4YL4A 2YGNA 3UTPE 5L8KB 3MRRB 1AZCA 1MLCB 2BSED 4P06A 3U9PL 1M3IA 4DPRA 1A4JB 1SDDA 4HUWB 4OCWH 1UACL 2AXJA 1UM6H 4UOJA 1OP5H 4DK5A 1F58L 2G2PA 5E4EC 1TETH 1UT9A 3HE6C 4LLMB 2DWTA 4K9EH 3SZKC 4KNQA 1P1VA 4JFDB 1KLGA 1MSPA 3C6SA 3IDJB 4IBSA 4KKCD 4JPVL 2Q0ZX 1UT1A 5E6UB 1V5JA 1V7MH 2HWZH 1JE6A 3MV9D 3OC8A 1QUNA 1TITA 1CMOA 4Y2OA 2HN7A 1WTLA 2A2QT 1F90L 4ZUVB 3N43F 1EHLL 1ED3B 1MF2H 4AG4L 1YMME 2OJZH 4XNQB 1PKOA 3QDMB 1VZHA 4XCFH 4JFEA 1CD9B 2J6EL 3NJIA 1MFCL 3B9KD 1E2VA 2J8UB 1KCVL 5I6LA 1G7MA 3RZCD 1TSRA 4N8VB 4DN3H 1TR7A 3WFHA 4XNXL 4WZ9A 4ZX6A 3LPFA 1R3JB 4BZ1H 2DQCH 1LEKB 1UWYA 3BP4A 4OLUL 4ODHL 3NFSH 4YDKH 2IDSA 4R4BA 5F96H 2CA3A 1TYEB 4RGOH 2OZ4A 1I1AA 1S46A 1KJVB 4N6RA 1BM3H 3M1BA 1ZK9A 2XOTA 5E6YA 4O2EB 2QLVB 3IAQA 2EILB 4X4ZA 3H8NA 2R0LL 3I6KA 3AQYA 2AK1H 3ARED 1RLBA 5FYJU 1CXFA 1XGRB 4DWHA 4G82A 2UYLB 3ZL4H 2H9GA 2P8LA 1JPSH 4I3GA 1A1NA 1V3LA 1YNTF 4WV1C 4YHZH 3RL2A 4FXGC 4C59B 1AKPA 5FUZH 4N3UA 3L3OB 4L8BB 5C9KA 3CUPB 5KJRH 4IK7A 4NNXB 5ERWB 1BLNA 3B8SA 4ELMB 2MCPH 4HGWB 4XN7A 5C0BB 2W81C 4HEPA 2RB8A 4UAHA 3O2VH 2Z31C 2L4OA 2NZIA 4CADA 4JFFE 4AEIL 1NTDA 5EG6C 2GSGB 2XBDA 2QQKL 3CSPA 2VN4A 4X7SL 5G4NA 4Z3JA 5I6KA 2AI0L 3BP7B 4NKOB 3ZT6A 1ET8A 2VT0A 4G7YH 1U2HA 3CHQA 5I5IA 3EJQA 3P4OA 3CC5B 1WA1X 2AJZB 2OP4L 3IE9A 4X5XA 3DECA 3O9WA 4PRIB 3SE9L 5M95B 1I31A 1WAEA 3MJ7B 4TNWK 1FL6A 4N2BA 3D4CA 2PWDA 5I6XC 1NAML 3HI5H 2QVFB 2V2WA 3I9GH 4N1HB 4B5ZA 1KC5L 3GI9H 4JZJA 5CEZD 1ZAGA 4JL2A 5SWQB 3SDXB 3HUJF 2CU9A 1COBA 2CIKB 2Y07L 4Z7UF 4GUQA 2VKXA 1J0IA 3AZUA 2VW7A 4G8EB 4YHOH 3S35L 3S88L 4ABUA 1H8SA 2F54A 5D4IA 1KB5B 1ET5A 1X5GA 3MX0B 2JIXD 2A74A 3LEYH 4RFOL 5EZOL 1I53A 2PXYC 2E7MA 3F7QA 1WVZA 4X5RA 4AKPA 1TCRA 3IPBA 3Q2WA 3WUWG 3PWJA 4HD9A 4P23C 4PJ7B 3MRGA 3QIWC 4M8VA 4XMUA 4Q56A 1FNGB 4ZMYA 2O6EA 5DS8B 3IJEB 3KYMA 4YDJA 3DBXB 3BISA 1LO0L 4GEIA 3M8OH 1KB3A 5E2JA 4MVBC 3VDBA 5AFAA 5IESL 2XN9A 3ARXA 2JLLA 2J12B 4QTIH 1ROCA 2QZQA 2XVLA 4OAWA 4KQ4L 3KBPA 1BIIB 3UIZA 4Q97A 3CFNA 1JF5A 3ARDA 4K23L 4KGLA 3FB8B 3QSKB 1U3HC 1MWAA 4R96A 5D7IE 3C8DA 3PL6C 2PYEE 4DH2A 2CO6B 5ILTL 4LEBA 4GG6E 4WY7L 4WUUA 4PJFF 3SDCB 1OQXA 3WTTA 4URKA 3K6SA 2X9XA 4Z7VA 1OAYH 2GJ6B 2DDQH 3AG3B 4AW4A 2JKSA 4PLKC 5DEGA 1OE1A 4JBSA 1SDDB 3SPHA 1RI8A 1UH3A 1X5MA 2QV4A 3ARFD 4MXQD 2JK5A 3T6WA 5KUKA 2YA1A 5H94A 5DC4B 4JKWA 1PLGH 1KLGB 2VKWA 2F58L 4H8VA 3OMAB 3GBEA 5GGRA 4AQ1B 4NP4L 1CGSH 2BVUA 3GHEH 4MJ6B 3TZVA 4BK8A 3SDDD 3EG9B 2Z4QA 4LCWB 2GTWB 1JWMA 3BKYL 4RNRA 3PWPD 3SDAA 4S11A 2ZUQC 3UADA 4MJJA 3SCMD 1VB9A 2P9RA 4JRXD 2W60A 1TVHA 5BZWA 4IJ3C 1KZYA 1OCRB 4JFEB 4OT1L 2VO5A 1QSFE 3RGVC 5IMOB 1L3WA 4BQ9A 3UMTA 3RWEB 1A7RH 1KPRA 5C0JA 4YDNA 5C0CE 4APQA 3KXFD 3WFHB 3HZVA 4OFVA 3TLRA 3P0VL 3FN3A 1R33A 3BP4B 3FN0H 4HA1A 4NO5A 4B3EA 2WUCL 1PD0A 4OLVL 1SLWA 2Z8SA 4LSQL 3AXLB 1HE7A 1CTOA 1CUOA 1I1AB 4MAUL 3Q6FA 4Y8DC 1H6FA 4OZIB 3GKWL 1MFAH 3HPLB 4P5TD 5E6RB 5FYLL 4EDWH 3KLAA 1Y07A 4MQXD 1MFBH 3QG6A 5CD3A 3E3QC 3FFDA 1L6ZA 3KLDA 2CDGB 5CBEB 1W80A 2IOMA 4N9GB 4WWOA 5DJZA 4K71B 4GI9A 1G9ML 3ULVE 2YD7A 3ZHKA 1WZAA 4TLUA 3QPQC 5CEZH 3RL2B 2KMWA 1T6WA 3NJMA 1QRNB 4K8RC 1X5LA 1F4XL 2NY6D 3O8XC 4KMTH 4N0FB 2L04A 4LSTH 4HUVA 2VN7A 4JRYD 4JZOA 4J3WA 4Q9BA 5J89A 1EQWA 1KTLA 4XB7A 5KG9B 4NPYA 1C16A 1IARB 3LZLA 3UO1L 5HDRA 2VUOA 5IFJB 1BLNB 4BXVA 3UBXB 3IFNH 5FW7A 2F61A 4WU5A 3RX8A 3BKML 4UOZA 1G9HA 2I07B 2XPZA 2NXZB 3IFPA 4QHMB 4CADB 4DFIA 3DVFA 3DYMA 1NPNA 1ID2A 2JB6B 2DYRB 4FQIH 4PW9A 3T65B 2WWKO 5IT2H 1SXBA 3FSOA 2V4LA 5CM1A 3G5YA 2XJLA 1N6VA 1ZVNA 2DWDB 3LZOA 5EUOA 1EO5A 1BG9A 3MO1B 3BAIA 4X5XB 2Y7OA 3QJXA 5ICZA 3KLHD 3O9WB 4FP8H 5DO2D 3I6LD 4F2EA 1CXHA 5HJDA 4MNGE 4M8RA 4X9FA 1KTJA 5L88H 2V2WB 3A47A 2BRRL 3THMH 4R7DA 5B39G 1UOVA 4GRLA 4N2EA 2XXFA 1EGJH 1KYUA 1PD6A 3ECVA 3MJ9H 1CGUA 3ULAB 3UYPA 3N55A 4Y7MA 5F7MC 3ZR6A 1F8TL 2X41A 1E5UI 2GIYA 4L0PB 2FTAA 3CCHA 5CCKH 4AQZA 3MI6A 4UQAA 3TO2A 4NOBA 2NYZA 2EDJA 1ZLWH 4KKAD 1G6RL 3L2LA 1SPDA 3MRGB 5JIKA 1SHWA 2GI7A 1ZHKA 5EU3A 1M7XA 3WN5B 4BA8A 4NSKB 4H1LH 1AG6A 1NSNL 3KYMB 1NWOA 4NO0B 4XPAL 4YDJB 3TIEB 2WXFA 3FTGA 3BZ4B 5EBMA 3NZ8A 1QFWL 2IPUK 1EBPA 3FUHA 2VABA 3M7FB 5F1SA 2PCXA 3U7WH 3JSSA 3HRZB 5FIEA 1VEMA 2DEWX 1CLVA 3A23A 3ZTCC 2XN9B 2KYIA 4ZW3A 2FBOJ 1FVEA 2XU9A 2R2BA 4YX2H 3DOIA 5BVJB 3RWJA 1QATA 1T0NB 2YLHA 1KPVA 1WEJH 3L13A 2ICEA 4OB5L 4PWEA 2VQUA 4R96B 4GSDL 1MWAB 1UA7A 2HTKD 4Y5XC 1E2WA 3GEWB 4AENA 5DO8A 3FOLA 3K2UL 4JO4H 5EIIA 4HCRH 5T1LD 2Y5QA 2Z93B 5I26A 3B3BA 4A66A 4GYBA 4WUUB 2EICA 1NH6A 1A5FH 1YYLL 5JO5B 1UXWA 3K6SB 1PFOA 2NX5E 2XPYA 2KQMA 2YGOA 2WZ5A 3BWAA 3H9HA 4Z7VB 4NUGH 4EOWH 2OSXA 2Y7QB 4DP6X 3F64A 3P2TA 3U2SB 3D33A 1KF9B 1QLEL 4GKZB 1W8NA 4XPFH 5MI0C 4B3VA 1CXIA 2WO2B 3MMEA 1PS3A 3KPQA 1IEAB 4GOSA 1QEWB 3F5WA 4FTVD 2Q7YA 2YXVA 4HJIA 2NYYC 3QI9A 4QO1A 5E5UB 1KTBA 3NK4A 1MFEL 2FEDD 5FEBA 4FLHA 4OD3L 4HIPA 1JGVL 1F1GA 2NY2B 3QXDA 3ZDZF 5CCJA 3V4UH 2CR6A 1Z5HA 4PI2A 4L9LA 5C08A 1I1CA 1IE5A 1JWMB 1B4LA 4KKPA 5DLMH 1W8OA 2QHLA 4WWKA 1DQQA 1FHNA 4RFEB 5D7KD 4G6JH 1QHPA 2XJKA 3GBLA 1TVHB 4KI5D 1F11B 2UXVA 4PB9L 1ZT1A 5BZWB 3W5NA 2ZSVA 2K9UA 1FGVL 4Z6AT 4F7MB 1VJSA 4UANA 4UT7H 4PW3A 3D8MA 4XN1A 3ZZQA 3VGAC 1DJHA 3Q8BA 3RFRA 1KPRB 1HXKA 4KK6C 4YHKL 4Q0XH 4APQB 3HZVB 4TSCH 2WJ7A 4M5ZH 5TF1H 1QPXA 1WFOA 2HVJA 2J8HA 3TFKD 3I3BA 1RJLB 3MRNB 5TQ0H 3V4VH 1BQHA 5D8JL 5HDBB 2UY7B 4G9FE 2J7LA 4F7EB 4F93B 5CJXC 3Q6FB 3K4DA 3FT0A 1BVKA 5IB5A 2XDHA 4U0RC 2OTWA 1QFPA 3DNKA 4LDLB 4DTGL 4F3FA 3HZ3A 4HX1B 3QG6B 2FJSA 2LU4A 4TM9A 4EZLA 3CFBB 1Z9LA 2X9WA 4P9MH 3UTSD 1RIUL 1RFDH 3QQXA 1MFDH 2AEIT 3HCVA 5E8EA 4ODXA 4PM1A 1BBDL 1EAOA 3VXPB 5GS0C 4DUXA 1DEDA 3MJWA 4BCYA 4K7FA 2P49B 1L0XA 3VSQA 4ONHB 2WLJA 3DC0A 4AVIA 1Z5YD 2XKNA 3C60C 3PFUA 4UYQA 1KCUH 3VI4E 2LAGB 3RA7H 3HVNA 4HUVB 3MNVA 1AR1B 4JZOB 4DPCX 2HVKA 4HIEA 4TNEA 3T3ME 5KSBF 3PWVA 3WKML 1KB9J 2KLTA 3TVMA 4B53A 1J8KA 4TNVK 4XNMB 1P84J 3C6LD 5E1AB 4QRFA 4UQ2A