3WEBA

Crystal structure of a niemann-pick type c2 protein from japanese carpenter ant in complex with oleic acid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
FVFEDCGSEVGKFSDIIISSCDPSEEKCSIIRESEIHVSMKFTPSVDVKNVEAKAFGVLLDVPVPFPLKKPEICKDPDSGVKCPLKKDVEIEYKVTFFVEKATPALSLEIMWEFRNEKDEKITCVKFPAKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Niemann-Pick type C2 protein mediating chemical communication in the worker ant
pubmed doi rcsb
source organism Camponotus japonicus
molecule tags Lipid binding protein
molecule keywords Niemann-Pick type C2 protein
total genus 26
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3webA00
5IJDC 1WRFA 5KWYC 1AHKA 1AHMA 2Z65C 1A9VA 3RG1C 3WEAA 3T6QC 3FXIC 3MU3A 4G8AC 3MTXA 1KTJA 3ULAB 3B2DC 5IJBC 2E59A 3M7OA 1XWVA 2Z64C 2F08A 3VQ1C 1NEPA 3VQ2C 2E56A 3WEBA 5IJCC 2HKAA
chains in the Genus database with same CATH superfamily
3WSQH 1IC5H 2Q0ZX 2YMTA 4G11A 1I8KA 1ZANH 1AFVL 2UZXB 3QVAA 3NJKA 2NXYC 4JG0L 3WJJC 2X1OA 5IFJB 1ET5A 1ZWIA 2OJEA 5B39G 5ERWB 1MDAA 1Q94A 2NY4B 3MTRA 5DUMH 1TEFA 5GPRA 3HI5H 4B6ZA 5B3SB 1IQWL 1GJIA 1MCPH 2BRQA 3KEDA 1NCAH 4MCNA 1LO2L 2AQPA 3H9SB 1Q9LB 4CMMA 3U7WH 2NNAA 4N8UA 1HDMA 4ZBJA 4P4KA 4Q74A 2Q5BA 4PQXA 5IJCC 1M6UA 2Q8BL 3N1MC 3SBWA 2GYSA 2A1WL 5IMLA 4E0RA 1YN7A 4OJAA 3QDMD 4I1PA 1S7WA 4YDIH 2WANA 1ET8A 1AXTL 4L8CB 1ZEAH 4RGNE 4GXUN 3NCYS 3N85L 5AVXB 3QQ9D 2JQZA 1MW1A 5GJTH 3GSQB 12E8H 3DMMA 5CP7B 1PMYA 2A6JA 5IR1B 2EQDA 1SNRA 1PSKL 2A2QT 4NAMA 5FM5O 4MZIA 2IGTA 4MFHA 1KGCE 3UJIL 4JZOA 4P2YA 2K3HA 3G6DL 5FV2A 3U9UB 3NIFE 1NPNA 2KZKA 4HG4K 3F7RA 1IL1B 4JBSA 3CFDA 4UIMA 2AJYL 5BO0D 5AVYB 3SE8L 1W6LA 4ELMA 3MBED 1A1NA 4V2CB 2AQ1A 2VAAB 2ZSWA 5EV7A 1B2WL 5IVZA 4K9JA 1OHZA 4NP9A 3TCXA 5IKCA 1HQ4B 5DMIH 4S1DD 2WVSA 3EUUA 1I82A 3ATFA 4KZCA 1OANA 2Y7NA 2XVLA 5EO9B 3MHZA 4XAKE 1GC1H 2XTLA 3ZT5A 2X4PB 2UZXA 4JRWA 1KV3A 4HH8A 4ZUSA 2NY3D 3UPRA 3E8UL 4DN4H 5F93C 4U1LA 4AT6B 4B9KC 1QKZH 4HP5A 1NFIA 2HLFD 4MHHI 4KY2A 1OPGL 3X1GA 1JD9A 1F1AA 3KMDA 3GLZA 1ZGLB 4GSRA 4MXQD 4FQIL 1HKLL 2EIZB 5GGSB 5HD8C 1QHOA 2JKTM 4ZT1A 1PZDA 2AXFB 4IJTA 1XXDC 3QCUL 3QNXA 3MYJA 4H13C 4N2KA 1HL4A 2F5AH 4XNZB 4WCYH 4ZTEA 3WJLA 5IB2B 2EC9T 2FWSA 4AMKL 4FQCL 4KITB 1LNUB 5CXPA 4KI1A 3QWRD 1ADQL 4JFUA 2VMFA 2W92A 3IN0A 4HWEH 4K3HA 4DSYA 2HMIC 2YOAA 4MJ2A 2HRPH 3GSRB 2GIYA 5I30L 2Q3AA 2HZHA 3QQDA 5AW0B 1GS6X 2X5PA 1ILUA 1NGQH 1M4KA 1YMMB 1WA2X 2IAMD 4YHZH 5DUPH 3MLRH 4PJBB 1ACYH 3CFDB 4K0OA 1KN4H 2JKXA 2JKSA 2YZ8A 1PPIA 2D3LA 3CXDL 4OIFA 3TO4D 1J9SA 2PP9A 1IE5A 2FQFA 4IOIA 3VQ1C 4GW4A 2Q7NA 4UDTB 4NS0A 4QKXB 1CXLA 3KD4A 4XBPB 3VWKC 5HYEA 2J5WA 3ARFA 2V7HB 3L4UA 3IGAA 4FS0A 5DEFB 3O6LL 2F54B 3UO1L 4LE8A 3D25B 3MOAL 1PCXA 5PAZA 3QDJB 1C12B 2CRIA 3ORJA 5F6HJ 5GIRA 1CFSA 1PNCA 3ETSA 4MD0B 5GGVY 4AZUA 4GRWB 4E9XA 2VB5A 1ZT4B 1UWYA 1E30A 3A4EA 2XA8L 3K4AA 2Y6SC 3LVEA 4JFEA 4K4KA 5JIPA 3SGKC 1DEDA 3EHBD 1MQ8A 4RMUA 1CICA 2GBVA 4NAQA 1NC4D 3QIWA 4I77L 1AXSA 4R2GB 1WUNT 2FRGP 2F74B 1FZKA 3VGDA 1KGXA 1KB3A 1OW0A 4POYA 1T5WA 4OQ1A 3LKPA 1MCRA 2IBBA 2DI7A 1OCZB 2Y1VA 5CHNA 3JQOB 4N20A 5EDSA 5GGRB 1H3GA 5IQOA 1PDKB 4YHYC 3BP6B 1DR9A 2CCWA 1WJ3A 1B6UA 3PWUB 1UM5L 1WG3A 4HETA 4OSUL 4AQAB 5KYXA 1SBBA 3C8KA 3CXFA 2HJKA 3NJHA 2PWFA 4KO7A 1PLGH 1NKRA 3GSRA 3DX2A 1CGTA 1MFEL 2IG2L 2OMVB 3U6RA 3WIAA 1OP3H 1Q4NX 5HI4C 2V5SA 2ZUSA 5LBSA 1TITA 1MFAH 5SX4H 2P80A 5JQ6L 2A6DB 3V0WH 2GTWA 4JFXA 2L04A 5IB3B 2DQDH 2PO6A 5CJXC 1ITCA 4A7UA 1G0XA 3TEUA 1MWAB 4S2SB 4C4BA 1U4EA 2NOYA 5GRJH 4F2MA 2F15A 3L4ZA 4WUKL 4BZ1L 3OKNA 2WLYA 3TBVA 2ATAA 4GBXD 3CFEB 4KK6C 4R97B 2F61A 3PS6A 4U6VL 2I9TB 4GMSL 4YR6A 3HC4H 1X9QA 3D0VA 1F90L 1I8IA 4F58L 3SJVD 2EIEA 2Y6TE 3BFQG 1EAJA 2V17H 2GJZB 1KEGL 5EORH 1BAGA 1VGEL 2X4UB 4HGKC 1MW3A 2WBWB 1HNFA 2VR3A 5BRZD 2O6DA 1YECH 2JNZA 3QJXA 1S78D 3FO1B 3DVGB 3WIHA 3D3VA 3BDBA 3FB6A 3ULUH 3FBKA 4HPOH 2R56H 3DUHA 3S36L 1BM3L 5ID1A 2OMTB 4L3EE 1NC2D 5KJ4A 2C34A 4O4YH 2E3VA 5FA3A 3QJFB 2EEXA 1E4KA 1JFHA 2E4TA 4BGLA 5DJ0B 3TV3L 1LO3H 4U1HA 1KBBA 4EI0A 2DMGA 2OLDA 4ILDA 5SX4I 2YA1A 2OYKA 1O0VA 5KS9F 1S7UB 3FUEA 1MJ7L 1GAFL 2ZCHL 4GS7B 1NMCB 4FFZH 3SQRA 3GMPB 1F8TH 1YEKH 2H2PC 4KVCL 1RD6A 4R9HA 5L6YH 2WNWA 5FA4B 4MZRA 1B9ZA 2F54D 1ZE3C 1DQIA 4X6DA 1IBBA 2H6PB 3AREA 3I84A 4NO5A 4TKWA 4D3CL 1EEYA 1FPTH 3T8MA 2IQ9L 4TVUA 1A9BB 5ACMA 3RB7A 2GC7C 3OV6A 4Q6IA 1CLOH 3WKPA 5IB4B 1X9RA 4OZFA 1MAML 3KPNA 4GO9A 2XV3A 1ZS8A 4ZI8A 2NY4C 4FQ1H 4IU3A 2V5MA 3BT2L 4GUPB 2R0WH 5JA9A 4U1KA 4DCQA 1IU1A 4BWWA 2FBJH 3PUCA 3SKMA 3SZ6A 2MTAA 5K9JL 3PL6A 4JY4A 3TA3D 5L2JB 3FO9B 3B9KB 1RZJH 2OS7A 2VM9A 4PLKD 3WGVB 4FC3E 2JI2A 3MV8B 1I8MB 3WXVH 3MACH 2R8SH 1XGTB 2AJUL 5EZLA 3DXAB 1GW0A 1A6WH 3UFIA 4IDJL 4FQQB 1XH1A 5ETUA 5C8JB 5E2TL 1Z32X 5TDNA 5ICUA 3KCPB 3L6FB 1T0NA 2EIBA 4GJTB 1K85A 1WS7A 4M6AA 1G9MH 2WXGA 3S37H 4XP6L 3UL4A 5DD3L 1E6JH 4U1HB 4KKRA 2Z93A 3HG1A 4G8IA 4RNRA 2MHAB 3MDJA 4U6XA 4BCZA 4QIRA 2ZUQC 3RNKB 1MCIA 2WSDA 2JLPA 1K72A 4JO2L 4TUUA 1HH9A 3X12A 3ARUA 5EOCH 5IMMA 4N8CL 1H3WM 5C9JB 1U8JA 1JIBA 4KRLB 1CIDA 3DURB 2NTSP 2QL1A 1AZCA 4NSKB 4XAKD 3FRPA 5CLZA 3WLBB 5FO8B 2FSEB 3VSUA 2AKRB 2PW1B 3F6IA 4XBGB 1T5XA 2YPVL 3ZIYA 1CJYA 2HG0A 4NIYE 4PJEE 4W9JC 3KW8A 5BV7H 1CK0H 2WBJA 3OB0H 1CFBA 5CKAA 2HVJA 3QP3A 1KXVC 1D5XA 3W11D 5F1KC 4MX7A 1I1AD 4OCYH 4IGBD 1L3WA 3FT3B 1VFBB 4PLOB 3VTTA 5IHUH 2F19H 3CG8A 4K8RD 4Y4KD 4YK4B 3GNML 5AZEH 4A39A 5I1KH 4XXWA 5LCVA 3CHOA 1QLRB 1PJ9A 1W0WB 5FB8B 3P3UA 4ERSH 3ASWA 3WXWH 2DBLL 5DJCB 1ZT7A 5MENE 1JHTA 3IJ8A 3NSYA 4WO4C 5F1NB 3UGEA 3B3BA 1GGCH 5C8JA 3S3JA 1DJHA 1G6RB 3M88A 1YN7B 1J86A 2I9TA 1WFMA 1UT9A 3WMQA 1HNYA 1IGIH 1PQZA 3NFSL 4FQ2H 5E0FA 2EEDA 1RURH 2FO4A 3CZKA 3ME0A 3QG7L 1OK0A 4ZXBA 4UWQB 2HJFA 1MQKH 5F7HA 4A37A 5C86A 5I71B 5KJ7E 1ROWA 2CIIA 2W0PA 3R06A 4ISVA 1TKWB 1MG3C 1HC1A 4L8SC 4QRTB 2GITA 4HJUA 5JOFB 3B1TA 5AWNH 4N9GB 1MCLA 1I3GH 3IMRA 3DMMC 4M4PA 2BSEA 3KPLB 1AR1C 4BKSC 1S9XA 3G5ZA 1KCBA 1RJZA 3O9WD 4NQDD 1KEMH 3CZFA 1WAPA 2ITCA 3OWRA 5FX3A 2WBJB 4G7QB 5DJ2B 4KQ4H 4R7LA 3V10A 1BLIA 1YSOA 1KCVL 3O6ML 2BVPB 3DXAD 4TVPE 1T0PB 3A6BH 2C1OB 1AQDA 4QHKI 4YFLI 3VD3A 3TT1H 3MRCA 1DJXA 5FGBA 1RZFH 2RB8A 1YC8A 3QFJE 3X13A 4J3OG 2AHIA 3KDMB 4PS3A 3WDIA 3PE9A 5JORB 2EACA 5D1ZI 1EZLA 2DD8L 5GZOD 1NFIB 1FL5A 1QP1A 2FGWH 4JFVA 3S9DB 1IGCL 4WW2B 1QLRA 1HXMB 2P80D 1WCQA 4TYUA 1KIQB 3L08A 1W8EA 1HEJC 2LT9A 2H9GB 4ZUTA 3EXLA 1D6EA 4YNYA 3CFIC 2Y36L 1DBJH 3RPIA 3RY4A 1QRND 4JVUA 5ALCH 1MAJA 2VC2L 1ECYA 4OFYD 5MENB 3JZYA 1R4XA 5EN3A 4HUKB 1I9IL 3H42L 3IDNA 3V9CA 3PHQA 3CDGB 3JV0A 4BZ2A 2Y7OA 3UZEC 3IKKA 2EDOA 2ZOKB 5DHVA 1JHLH 3VB8A 2DQGL 5ADOH 4OJEH 1HI6B 3BSGA 5CZXC 4G6AD 1JGUL 5D1ZC 3OF6D 4JM4H 3D39A 5D1XA 5HGDB 3TBWB 3OG4B 2E46A 2WTRA 3HJ0A 4OM0H 3GSNL 3MRHA 4HUUA 4ZUWA 3OKMB 3UJTH 3POHA 5FR3A 4HKBB 1NWOA 2B2XH 3IAQA 5K9KA 2AQ2A 3A3YB 1UZ8B 3KNBB 5DVNA 4ONHB 3ZTNL 2J21A 5FYKL 1NGZB 5JIDA 3G5ZB 4Q9CA 2XFXA 2QKIA 3CWGA 3EH5B 4GW4B 4XBPA 1UATA 1IAOB 3NFPB 3O4LD 4GP5B 1W8NA 3BWUF 1WZAA 2ZKYA 2WC7A 3CVHB 2VUKA 4DGIL 3SQBB 1FJ1B 2Z7WA 4HK0A 3ECQA 3UZVA 4BH8B 2RCSH 1F4WH 2ENYA 1USQA 1MZYA 4HSCX 2ZYHA 4PJCB 1CXIA 5LN4A 4NSKA 2F58H 3NP4A 4FXGB 2NXZB 4RGNC 1TJGL 4HC1A 3T2PA 3VXUB 5BS0E 3LIZA 4P9HC 2OJEB 2YWYA 3S36X 1DQLL 1BXVA 2GT9A 5DC2A 4F57H 1VACB 5BUAA 3IJSA 3PWJA 1R3JA 4RWYH 3U7AA 1I85A 4G42A 3O45B 2FSDA 3GIVA 4N1HB 43CAB 3HOGA 5HI3D 3L3GA 4I18A 4BH7B 4JHWL 2YD2A 3JBG7 2YR3A 3EDDA 4HAKA 3ZT7A 3L3KB 3MJ8A 2ZSVB 4X0NA 2BP8A 1NQBA 1OGAD 4WWKA 1DE4B 5J13B 1L0PA 4J5VA 3H9YA 4P8QA 3EYFA 3RX9A 2RGSA 4BGDA 1GJUA 1CFVH 1EFQA 4HMEA 4WI5A 8CGTA 4E5XB 5HYSA 3JVGA 2BFVH 3FAXA 3SJVE 3ZMRA 1ZDQA 2F0CA 1BD2B 4JDVB 2B4CH 3AZUA 4DEWA 4Z7VA 1KCLA 1S3KL 3WJMA 4A6YB 4BQ9A 3PWLB 3L3OB 5CFAA 1ZLVH 3T6XA 4AJWA 4B9FA 5KAQF 4QAWA 3CZUB 3ARDA 3A21A 5KSVB 3QAZB 4N87A 2ZSWB 5E1IA 1C9SA 3SOBH 4YK4C 5K39A 4GAYA 5K33A 2ZCZA 4NC1E 5HDLA 3ZL4H 3QARA 2NTFB 1FA4A 2BSBA 2N1KA 2ZKHL 2BS71 3V4LA 4KKZA 5EU4A 1TKWA 4YDJB 4YHNB 3KBHE 3BAWA 4XMPH 4UILH 1LP9E 2QSCL 4WJKB 3FRUA 3ISWA 4KNSA 4P2OD 4BINA 1E9PB 1K9TA 4PJCE 1CR9H 3R1GL 5HVFB 4XX1G 3S34H 3WIFA 4KO9A 2OSLA 3LS4L 1QPPA 2Z4QA 1BAFH 5F7KC 3VRLF 1L3NA 4PJFA 3MKKA 4QT5A 5I1IH 3O45A 1H15A 1CDYA 2YAPA 3KHOA 4KKLD 3PUUA 3JWDC 5BZDB 3UBXA 3LYRA 3PGDA 3HIZA 5D7IA 5IIEA 3SPHA 4R7DA 4NKMB 4ZMWA 5FV1L 3WNLA 4NO0A 5KVDH 2MIZA 2BP8B 1QFWH 4M6OH 1W9XA 3P4MB 4UM9A 3NA9L 2CXGA 1E4XH 2YO3A 3DX9A 3NQKA 4X6BB 5AW8B 4YSTA 3BRGC 32C2B 3TH4T 1QNIA 1LO0H 2F18A 3CN4A 3DMMD 2CM6A 1JTOA 1IMHC 4HIJB 4Y2DC 1G1CA 5I1EL 3BUTA 1VADB 1BD2A 4X9YA 1YEEH 2X0WA 5DZJA 5F7EH 4B41A 2H2SC 2CHDA 2OM5A 3UTTE 4X7CC 4XWOC 4L0YA 2ATPB 4OZIA 3ET9F 1MHHB 5E56A 2OL3A 4DP6X 1G7LA 5B1AB 5KVEH 1B4JL 2FZ3A 3B8SA 3WY1A 4AEHL 1B0WA 1GSKA 3N9GH 4KZDH 2GABA 4EN3D 3GIZH 5HGDA 3O8XB 1CYXA 1EDYA 3SSGA 4QHNA 4KX8A 4XMZA 1XB8A 2ZYIA 5C6TH 3UDWC 5L2JA 3Q2CA 2GTQA 6PCYA 1IQDA 5KS9B 4KK5D 2GI7A 2NY1B 2D7NA 4OW6A 5B4MD 1N64H 2XWJA 3GK8H 3KXFD 4LT7A 1WIPA 3DHPA 1I1FB 7CGTA 3G08A 1FCCA 4LVNC 5K9QI 3EJJX 1B3IA 4NQDA 2P5EE 2VRQA 1EAPA 5HYQB 2ZOTA 1TIUA 2D8KA 3L17A 3LNHA 1P69B 5AB1A 2A0LD 2B08A 3AM8A 3KCPA 2HLEB 2ICEB 1I4FA 3O6KL 4FNRA 1ZHKB 1WIOA 4JO5A 4WEBH 3NVQA 1LVEA 4NIKB 5E7BA 5AYQA 2HFFA 2FYVA 4NM8H 3L9YA 4P9HH 4M3HA 4NT6A 3L5WB 3T3PE 3VFGL 4MZ2A 1IBGL 4NCC2 4Y9GA 3Q8EA 3KPQB 4ZFGH 3DGDA 3IVKB 4QOKB 2JCWA 4KKCD 3TCTA 4H8QA 2C9XA 3F7PC 4U6HA 2XG5A 4C59B 3KJ6L 2Z91A 2LGNA 3TIEB 2Z1KA 2GIXA 2X1WL 3M6DA 4WTQA 4M62H 4AG4L 5KVMC 3DKHA 5FDWA 3IFPA 5AKRA 1IRAY 4Z3HA 5T33L 2A6DA 1KLUA 4GIOA 1BZ9B 2F8OA 1HIML 4PRIE 1IBHA 4NENA 1PAMA 2HWZL 4ODSH 4OLXH 2VLJA 5MP6H 4NO2A 4FLHA 3G04A 3VXQA 2WNGA 2YD8A 4MMZC 4NPJA 3SKNA 3FO2B 4FLOA 5D1XD 3ARQA 1ZSDA 1UD2A 4KNUA 3KWUA 5JW4R 1DQJA 1BOGA 2G0KA 1XF5A 4LPTA 2WLIA 4ZW5A 3ZDXB 1QSFD 4UCFA 5HHMD 3QE5A 4MDJA 4X9HA 5IQ7L 4MB1A 1ZPUA 4RFOL 5KYYB 4WHYG 3H53A 1AO7D 1N6UA 4P06A 3S98A 4WHTB 4PWKA 3C60D 4HDIA 3UACA 3AGWA 3G5VB 4S1DC 4IS6B 3KL5A 5KS9E 5GGUB 3BIBX 1SBSH 3H4HA 1AHKA 3GI9H 2JKWA 1VFMA 4XB3A 4F7PA 2FD6H 3NZHH 2V9RA 4LCIL 1T7WA 3NJJA 5H37A 2N7BA 2WOYA 3CDYA 4P2CG 4ZMZA 1GYUA 1CFQB 1NEZB 4P5RA 3OPZH 3PAUA 4HCRL 3QZWA 4LHUD 4YX2H 5CF3A 2WLZA 1HZHL 3SDCC 1T3FA 4N2HA 5ACLA 4JG1L 4GQZA 1VEMA 3B9KD 2ZUVA 2KLRA 4NBYB 5KSUA 4POUB 5I1JL 5F7BA 4PU2A 3OZ9H 4CAGA 5GS1B 2EO1A 4LVOC 1DJZA 4S11A 1KIRA 2NY7L 2G9HA 5ICXB 4CVUA 3P2TA 1P6FA 3QPXH 2IV8A 4BSVA 3JT2A 3H3PH 1K3IA 1NAML 3LXUX 4LLYB 4JCLA 1SQMA 1S5HB 4Y2DA 3APCA 1KFAH 3CXHK 1JE6A 1RJLB 2RH0A 4HCIA 2XRAH 4NPYB 5EZOH 3AQYA 5D7LD 2EH7L 5EDXA 4EUPH 4MRCA 1MLCB 1NMBH 3AXIA 3A6OA 5A2JH 1OAQH 1TLMA 1KTCA 2HJKB 2EDFA 1J8HB 5D7IE 1D3CA 1FH2A 5D2NB 5IBLD 5EA0L 4HHAB 4J3OD 4LHJB 3BQUC 4WI3A 2BX5A 5A40E 5IF0A 4HD9A 1BD2E 1E28A 5HHOD 2OSXA 1UEYA 2OI9B 3FB7B 3AACA 4JRYA 3VYOA 3OBAA 1Y7VA 3WL9B 5C08B 1EVTC 3CVBA 3TYGL 4AK2A 4DKEH 1BGXL 1F4AA 2APSA 3V7AE 2QSVA 3EJQA 3F5WB 1WS8A 4S1QH 5B7MA 2GCYA 3WO4C 2PETA 4ZAKB 3BN3B 3O3BA 1YZZA 3WEXB 2XKNB 5JHLL 4U6XB 4OZHA 4OAWB 5DRWB 5ESQA 2J12B 2PYEE 2VL5B 1KELH 4QRSB 2WWMD 2D3NA 3AB0C 4L5FL 4F91B 3MBWB 3ZUCA 3FONB 1OOAA 4MDIA 2G9HB 5ICXA 5E23A 1XF3A 3X14A 3C09B 2FSEA 2FJSA 5AKTA 2BLFA 2EIZA 3IBEA 3U30B 1N68A 4O02H 3HPJB 4QEGA 1YUKB 1KPRB 1SOXA 3ARGB 5IESL 4S1SH 1RV6X 5AD0A 4YPGB 2A83B 2DLEA 3D69A 5C6PB 2CDFA 3MV9E 5EC2B 1NCAL 4KFMA 2CA4A 5EF3A 5C0CE 2KPNA 4BUQA 4OF0A 1F02I 4OCWH 4PV8B 4JFHE 4RGOL 3VWKA 3PPSA 4HMDA 3CTTA 5DJYA 4NOBA 5EU7E 1JZ4A 1YEHH 4M1CC 5T1MA 2A1WH 4ZD3H 2EZ0D 3OG6B 3RZCC 3STBA 3SYPA 5FHAL 5AG9A 5FF6A 2KI6A 3N85H 4ONGL 4FP8L 4Z7AA 3GSVA 1KTLA 3FFDA 4N3TA 1AHWA 2WW8A 2VLJB 3H0TB 2DYRB 2FE0A 2D03H 1MW2A 3LD8C 5FUOH 4YXLL 4JW3A 3BUDA 4QMEA 2E9BA 5CO1A 3RWDB 3FQ4A 4HWZA 4JL2A 3IPEA 2FJHA 1E6OH 4XVUD 4LLWA 5E0QA 4AKPA 2CUHA 3D25A 9PCYA 3GRGA 2VLLA 1I85C 4RFEA 1ESOA 5DHYB 3SE8H 3BUYB 3EOAA 2NY6D 4IBVA 3RU8L 1OLLA 4TNVF 1RY7B 1F6AA 5DMIL 4FXKC 5I1HH 1CICB 4JCMA 5DFVD 5CINL 4RAVB 5T3ZD 5T3XE 3GO1H 4XODA 4OU3A 2J5LB 3QWOA 3QHFL 5D2LE 3K2IA 1CUOA 1FG2B 2H2PD 3QFJA 4IKJA 1TQCC 4D9RD 3QUMH 3EUDA 1OPGH 2DLFL 2VERN 4GI9A 3CDZA 4LVNB 3V79C 5CMAB 4HIHA 1HKLH 5TK2A 3S35X 4RDQG 2ENJA 3EH1A 4KDVA 5EG6C 4E36A 4FNLH 3FQUB 3EJUA 2VXSH 4S0TD 4N2LA 3RL1A 5IQNA 1TLKA 2TRYA 1I9RL 4ZSOA 5I26A 2X2UA 3V0IA 1OGPA 2BVQA 2K7QA 2P1YA 2ESVB 5AVVB 5F88B 3MCG1 5EWIH 2YAOA 4BFEA 2F8XC 1L9OA 4KXBA 3H9SD 3W9DA 3LNIA 1INDL 1AHWB 2XZAL 3BP5B 5JZ7D 2H1PH 3CSFA 3V0DA 3ARRA 3PRZA 3QQ4A 1DN0B 1MEXL 2YAHA 1LEKB 2DLIA 4OGZA 3KW7A 4KMTL 3RVVD 1NDGA 4Z76A 1INQB 1ACYL 1G43A 1H8OA 3QJUB 3ZQWA 3VFUA 5DC0A 1ZLUK 1HHHB 1T7VA 3P4OB 3LS5L 4TNVK 3GBNH 1OWWA 3PG2A 4OCRL 4HUUB 1JAEA 2V8MA 1UXWB 2DI9A 3NJMA 2XY2A 3OD3A 5LCVH 3WFBL 5IJKC 1BZ7B 2CGRL 2LLGA 2WXOA 4HXAL 4LOUC 3F3HA 1OGSA 3UO1H 1PVHA 2QSQA 2NQCA 4G2AA 4OJCA 2IOIA 1AZUA 1O6TA 1OHQA 2Z7UA 4M7LL 5FO7B 3MGAA 2BSTB 1V5JA 2OSYA 2EH8H 3MBEB 2QBWA 4FYTA 3MLUH 2WNXA 5I8OL 5D2NC 3GTNA 4MNQE 3PWPA 4ZUVA 3V4VH 2DEWX 2JCCF 1TMQA 5BRQA 3Q7JA 3BEWB 3HVDA 4PUBH 1SXZA 2H3NA 2ZZUT 2AV1A 3FYIB 4I1RA 2ODIA 2APFA 2D3VA 1DANT 4C47A 1DJIA 2OJ1A 2WGXA 5GZNC 2BIMA 2N01B 1IAII 2C7UB 3K91A 3UAJD 3RY5A 4IOSA 1X5FA 4AUYA 1ZTXE 4DP0X 2BP5M 5LO7A 2NY6B 2ZICA 1J1OH 4F3FB 1VPOH 4C56B 5E94B 4MQ7A 2AQTA 2MWCA 1P7KB 1AQDB 2E27L 1UB6A 1QYGL 1ZLWK 2VDPH 5DJZB 5G55A 2VRKA 4BH7A 1A6ZA 5LXVA 1AR1D 4LU5H 2DN7A 3EYSH 3DVIA 4IKNA 5E5RB 3VNYA 3VU1A 2PXYB 1MFAL 1ZCRA 5I1DA 2MQGA 4P2OB 5AZ2H 3FTVA 4RQQA 2W1NA 3T0XA 4C83A 4FFWC 4G6KL 1LK3H 1JF5A 3CV5A 2ZF9A 4M3KB 5D71L 1VFAA 3FT0A 1KBGL 4UZGA 1GYVA 1CU4L 4QRRD 5E8NA 3VFPA 4QRUB 1JGDB 3FU3A 3KJ4C 2C7FA 4PJ8C 3ENEA 2B1HH 1T2JA 1L9SA 4R4FH 5ANME 3OX8A 3LNEA 4OM1H 4TUOB 2V17L 2BHYA 3GZKA 4B9CA 3RFZA 4XP9L 1HL5A 2YK1H 1FAIL 1KLFB 1U3YA 4YQXH 4J6RL 3GBML 1KULA 3S5LG 3QDGA 5KJRL 4NQCA 3QZBA 1X5ZA 3RB5A 2XWTB 1RZ7H 2VLRB 4LLVA 5DEFA 1PIFA 3O4LA 4PJGE 1E4WH 4GRWH 3OJMB 3O9WC 5I24A 4MDJB 3TWCH 4J3XA 1I9JH 3DJ9A 4K23L 2ARJA 4M8VA 4N28A 3QIWD 2FHFA 4GSDL 3BKYL 5HJ3A 1BEYL 3RILA 3FRUB 2VZ3A 3DV6A 3M1BB 1S7SB 1XH2A 4FZEH 4N5UA 1LO3L 2VDNB 3NT0A 1V55B 1BFVL 2MCPH 3DX8A 4XP5H 2VYRE 3N2JA 3K46A 2D7OA 2YC1A 1YYML 1E2WA 35C8H 4WFFE 3WO4B 2WQSA 5LXGH 1CLZH 3PWPD 4PJAE 1SMAA 4MQ7B 4P59H 5DUBB 3TNNA 5BW7A 2B59A 3LHAA 2R1XA 1UOVA 5L6YL 4PPTA 3G5XA 4JY5L 4XHQA 1CFNB 2VW4A 3HB3B 3TFBA 3QQ9C 5I0VA 2NCEA 1BVNP 1SFHA 1H3PH 2O5ZH 3QH3B 2IMNA 1F0LA 3GXUB 5FECA 3OQ3B 3HE6A 4OZGA 2GY5A 5FGRA 3HKFA 1MHEB 1JI2A 3UMTA 1CLOL 3KPSD 1NH6A 5I16A 5D5MF 1GOHA 1RZGA 2JCCB 3FQNA 4HUXA 4DN3L 3PL6C 4XNXL 5JQIB 3L5XL 1K3ZA 1C5CL 1FIGL 1TQCB 5BOJA 1HE8A 4NM4L 1NAKH 3IE4A 4FXKA 2IPTL 3WFEL 1BYNA 4L8SA 4PJEB 3VFWB 5BJTA 1F86A 4ODXA 1RUQH 2WAQA 4IRJD 4UV7L 1UB5A 1MREL 1R24B 2VR9A 4JDTL 2OL3B 4JB9L 5BVPH 4HLZG 1X9LA 4M1GH 1OD9A 4URTB 2A6IB 2Z0UA 1QWUA 2NXYD 2GKIA 4GKNA 2ESVE 5KVFH 1WFJA 3AAZB 5DCCA 3NYKA 1KB5A 1MUJA 2WXJA 4K8RH 4GQQA 1HWWA 3VXRA 5L9DH 1REIA 4ZO7A 3Q6FB 3GS0A 3HG4A 3LKQB 2XT1B 3C5ZB 4HJJL 1CDIA 1FZJB 2AQRA 4JCWA 5TJWK 2J6WA 2DDQH 4QRTA 3SGKA 3V0VA 2AEQL 4GAGL 1KYDA 2WLJA 3KLQA 3BCFA 3PXHA 3T3PF 4XP6H 2AJZB 2O72A 2VW6A 1UA7A 4KK9C 4IEFA 3N1GC 1S7QA 2NNXA 3M45A 4PV9A 3UEQA 4TNWK 3WD5L 1BMZA 4QYAA 3ZRFC 4EN3A 4BIKA 5MEOB 1AD0B 5IG7A 3WUWG 3F5WA 1HYSC 4KXCA 5CGMA 4F33A 5I8CA 2OZ4L 2EDBA 1GGBL 2J55A 3MX0B 4NOFA 3BT0A 1R19A 5AKVA 1DLHB 3EG9B 2H3NB 3O2VH 1A3RL 1FYTB 2YN5A 1R5IA 4YO0B 1C08A 3DO3A 5AAWC 1SJMA 2W95A 5C09D 1WAAF 2VDQL 1HOCB 1NIAA 1KJ2H 4NKIH 1T7YA 1N9PA 2J4WH 1UACH 5FM8A 3EADA 2HTLC 1AXSB 3QXVA 1A7QH 2EXTA 5BUGA 4NO5B 1P7KA 2VDKL 4AGQA 5AZEL 5BZDA 5I1KL 4OLUH 4L3CB 4YS4A 3Q06A 3TIDB 2QVFB 5KSAB 3BH8B 1MFVA 3PHAA 1JZHA 1MFBH 4PH8A 3KAAA 4CGUB 2CCVA 4IRSC 4DZBB 2WTPA 4UT6H 3RA7L 3L1OL 1I1AA 3II2A 1QO3A 2NY3C 2XWDA 5EOQH 4ZNEA 1CBVH 1KB5B 1MUJB 2VZ1A 3IF1B 3SDAA 2W59A 4P4KD 1V7MH 3LKOB 2R29H 1P5UA 3QRFM 1AZRA 1F3DH 1QRKA 3CH8A 3QR1A 4ICWA 3S3DB 3U36A 1QR1A 4B97A 1XD0A 4CNIA 1ND0B 3NFSH 4JFTA 3RVXC 2RA1A 3GHEL 1NCJA 2J8UF 5E00A 5LVEA 4UT6A 43C9B 1WZMA 3OC8A 2ZUYA 3KPSB 5FOBA 4YHIB 3EOTL 4K94H 4XHJD 1TFHA 4ANVA 2NW3A 1N2RA 3J7HA 3K71B 3CN1A 5IHBA 1QSFA 2YPLD 1J10A 3IKCB 1J8HD 1UD6A 3OGCA 2AJVH 2VC2B 3GKWL 4TN9A 3G9VA 4L8DA 2X4PA 4X8JA 1RPUA 2Z6FA 2VSKB 1XCTB 3EOAB 4RX4D 4LEOA 2KLTA 4B9PA 3VI4F 2W9LA 5I5JA 1S9VA 3OLIA 2XCMC 4L3AA 4U1MA 5INCA 3DXAE 3VACA 1KCVH 2BY0A 4WI4A 3N42F 2NZ9D 2Y2WA 1IB5A 3DJRA 4XCFH 1SEQL 1IC0A 1ZAGA 4PTTA 4RAVA 5HVHC 1XB3A 3H9HA 1NC4A 1A4AA 3M17A 2JB5L 3KPRB 3ZMEA 2X42A 2VLMD 3C6EA 3K6FA 4XOCA 3M07A 4Y1TA 1JWMA 3IDXL 3FJTA 5D2LF 5EMYA 4NO3B 2OP4H 2OR9L 5E08L 3H1ZA 3BP7A 4AGNA 1NANI 2YXMA 4X4YB 1MRFH 2DW5A 1HHIB 1Z5LA 3QAZC 2I7OA 1I1AB 2KLSA 5EIIA 1P7BA 4NNPL 3AMKA 3C6SA 3ULVE 3MNZA 3B56A 4RGMC 1FE8H 1RIVH 1J1PH 4P2RE 1KENL 4OD1H 3NAAL 4WUUE 4KHTH 3QQDB 4MVBD 3DC0A 4NRZA 4XI5D 4GIAA 4UNTA 1UKQA 4QUOA 2WINA 1MFMA 1VCBC 1MLBB 3M1CA 3UC0L 4JFYB 4J27A 1JHLL 4TUJB 2CHZA 4H8VA 3WNOA 1ADQA 2YSSA 1HEHC 1G1OA 2BHFA 1JZ8A 3MO1A 3BH9B 3H54A 3UTZA 5G4OA 1G7JA 3RX8A 4AE1A 3DOSA 4GKNB 2XPZA 2BDNH 1EWHA 1PS3A 2B2XL 5DK3A 3K71A 4MJ4A 1DO6A 2H8PB 4PJHF 2CNZA 3PV6B 4ZTPL 2OSWA 4Z5RB 2AGJH 4FLQA 5E8OB 1EZVY 4ACPA 5F0LB 4N1CA 1W72A 4M61B 4LSVH 1KC5H 4G1EB 1T0MB 2OTWB 4M8UA 2OMYB 2MQ3A 5CEZD 1NMCC 4M7JH 1OB0A 5JO5B 1N5YH 4X6CF 2CO4A 1CYGA 2IDTA 3P73A 2EE3A 5INCB 3PV7A 2FVNA 3D3VD 25C8H 1S8DA 4DGIH 1FDLH 4JG9A 3DDGA 1H8LA 4UINH 4BFIB 1CD0A 5HGAA 1SLVA 4PWGA 3T0VA 1IKFL 4A7VA 4IRJC 5GRYA 3BD5A 4OCSH 3O4LE 4KKCC 2F58L 4HQQL 4PJGA 1A14H 3EDJA 5BS0D 4YLBA 3O9WB 5HJGA 4QO1A 2ITDB 2ZAHA 1ZT1A 2WJ5A 4IBSA 4GRLD 4W4OA 2X4QA 1GKOA 4P23C 2X40A 4PJHE 4TSAH 5KUKA 2Z92B 3QYNA 3VAEA 5EZJB 3VCLB 3RNQA 3WE6B 4LSQH 3GI8L 3AC0A 2GUOB 32C2A 5KZCD 2I60H 1KJVB 2A9ML 4AI7A 4M8RA 4HCRA 3LRKA 2E74C 1NJ9A 4HCGA 1WTGT 1I1RA 1NBVH 1FNHA 4NRZB 1U3HB 4ZQKB 3T8XB 4AXWA 4F3FA 1AR2A 1TVHA 3OJVC 3P77B 1NWPA 5HI4D 4U3HA 4KTYA 2X88A 1WC7B 3BKMH 1AZVA 1VJSA 1CDJA 1G9NC 2ATPA 1CFVL 4OZIB 5B4MC 1KMGA 2E7LC 4BD4A 3BCDA 1EXHA 3I6KA 3FO0L 4YFLF 4DW2H 3WN5C 4PY8I 2VMEA 5I8KL 3EF7A 1C5BL 2D7MA 2DKSA 3Q5TA 4LQFH 1MH5A 4JVPA 3O6FA 1BEXA 5EU3A 2J1KA 1XF4B 3DPBB 3KS0H 4LLQA 5D1XE 3RWHA 4A2LA 4DP4X 4NHCH 3CD4A 2Y5TB 4M00A 1K4DA 3TO4B 4X6CA 4AIZA 4QAMB 2OMYA 2CBPA 4RSVA 1QR4A 2B9AA 5F0MB 2K8MA 5I28A 1M1XB 3P9WB 1HSAA 4HIEA 2CUIA 4RISH 3PLYA 2E75C 3HE6C 1U8LB 4H20L 4IRSB 1XSKA 4UQ2A 3X3GL 2IXQB 4XMPL 3MODL 5EO1B 4RMSA 4LPWA 3HHMA 3CFBB 2OJZL 1COBA 3CHXA 4K7PH 3T71A 4J2XA 1W80A 3T0ED 5C09A 2MEJB 2BCMA 2Z3FA 5BV7C 2ZXEB 4GKOA 3O4LB 4FG2A 4L1DA 4IBZA 2IH3B 3SN6N 5C97A 5E95B 5IOKA 1KIPA 4IDLA 1OSZA 4MXVE 5KSBB 1VF5C 5AAMA 1JPGA 2WXLA 2XN0A 4WSJA 4NX0A 3TC9A 4R2GD 1TCRA 3MCKB 4HS6B 4PG2A 1DSFH 4AW4A 4YFDB 4B53A 3QJRB 5I75C 4GKSB 3ABGA 2QADD 4NBXB 2XETA 4H25B 3NJIA 4PRDB 1BG9A 3V5HA 5A43C 2CUAA 4DUVA 3AY4C 2MNWA 2BHZA 2G5BB 4H26B 2L0DA 2M8XA 2O5YH 2G3XA 3JTSA 4N22A 2WVVA 4J12A 5KVFE 1ZHBA 3RWEB 4EN2A 1HS6A 3FB8A 3FU0A 3NPZB 4D9RE 3VXMA 3OMNB 1BBJA 1QSZA 1VFOA 4U31A 3IGUA 3LX9A 4PJ9A 5DQDH 3PGCB 2B8OT 4K7FB 4PCYA 5BS0B 3QXUA 1DJGA 1LE9A 4ZNEE 4U1GB 1LEIB 3LV3B 4CA4A 5AAPA 3OKKB 3UDWA 2HA1A 5BW7C 3IGKA 2WIMA 3TA3C 4JN2A 3HHRB 4QXUL 3II1A 2YIHA 4MQTB 4Y9FA 2OZNA 2Z8SA 1A4KA 3ARZA 2QR0B 1KWKA 1P7QD 4LCCA 3UPAA 5DS8B 1BD2D 3PWLA 4XNYH 1AR1B 3BDYH 1D5RA 1EANA 1T0NB 3KWXA 2XZZA 1GPOH 3SDXB 1J9QA 4BELD 3RZCD 2QLYA 4LSTH 4WUUB 1N26A 1RHHA 3T1FB 2CDGB 2XNAB 5DO8A 3BZ4B 2BW5A 3P3SA 4BFBD 5M94B 2YLHA 4KDWA 4WK4B 3ATAA 1T6WA 3GXMA 5E99H 1UUNA 2WVUA 1IC4L 1XGPB 3BAXA 1KXQE 5LWYH 4P5MA 4E42B 4DUWA 2AJZA 1JK8B 2Q86B 3QEHA 3ZE2B 1P4IL 3B7YA 5ACZA 3BUBA 4BFJA 3WTVA 4XPFH 2VQTA 3LQZB 4KKNA 3WTYA 3GJFA 2DM4A 2DIBA 4JGUA 2MSPA 1JZEA 4MHHG 4FFTA 1D5XB 3P30H 1MIML 5EOTA 3JTTB 2A9NL 4Y1AD 1ZHBB 5A2LH 5LGKA 4LIQE 4O9HH 4OLZH 1I1AC 2RHEA 1CT8A 1ETB1 2P7TB 1C1EL 2Q6WA 3VD9A 3HZVB 4FQXD 5HHVH 5SWSA 4M43H 3UAJA 4KVNL 5EOCJ 3MI6A 1P5UC 4ZNCD 3UTSE 2NY0B 2DPKA 4GYBA 4HUNB 1DZ0A 4YEEA 4ELKB 1WAAE 1PZCA 2WKGA 3ABKB 4LOFA 3C5JA 1IZJA 4P0DA 3I75A 2A6JB 1A8ZA 3FB7A 5J11B 2XQ0A 2HT4C 2WXQA 1ZDSA 5LGJB 2WLHA 4JX0A 3V4PL 1JGDA 1LO4H 2C3HA 3HZMB 1VADA 3B9VA 2DQUH 4NB7A 5DT1L 3AS1A 2AS5M 2FIKA 4P23B 5FYLD 3CK0L 1IAMA 3QJZA 4RFOH 2WUCL 1KPUB 5L2KE 5DJ8B 4WO4B 4WWNA 4AQOA 3KXFA 4P04A 5KANG 5DMKB 3MUGA 4B5EA 4GT0A 5C07D 5CLYA 1WFOA 2Y5TA 3TO4A 4JR9H 4AIZB 4XGZA 1L6PA 3BJLA 1A5FH 5JW4M 4HIEB 2ZUXA 2R0KL 1ZOXA 5B7FA 1NBYB 2W0LA 2KPWA 3DNKA 3CFKB 1JL8A 1EJ8A 4H8WH 3OXSB 3IJ9A 3IFOA 4YHMH 4YX2L 5TTRA 3QI9A 4FRWA 1L7IH 4IRJB 3DYOA 5AB2A 3L4YA 3LPWA 5AB9A 4IOSD 2EUXA 4OB5L 5DJ2A 2FJFA 3V6OC 2ZXQA 4N0FB 2XTJC 2NY7H 5AVSB 3E6FB 3ECWA 2XWBA 3LXAA 3QPXL 4L8BA 2XXCB 3H6JA 2K78A 3G6JB 1RIHL 4QLRA 4EZKA 2TSBA 1KYFA 1MWAL 3FU7B 2ADFH 5D5MB 3RBSA 1A6VH 1A6PA 1BPVA 3LQAC 4JDZB 1K8IA 2NZ1A 3SE4C 4ALAH 3FT4B 5AG8A 5T3ZE 3VVVA 1IFGA 5IEHA 3CQPA 4PJFB 4QT5B 2C3VA 1XWVA 1YMHB 5C0BA 4ZYKA 1A02N 2O30A 1GTFA 2WZ6A 1T5WB 3HMWL 2HVKA 1UXMA 1ZK5A 5LHDA 2DS4A 4TOYH 1SOKA 5IMLB 2H4EA 1KGUA 3ZW3A 1BDYA 5FW6A 4YZFE 4K3DL 1OE1A 4PG2C 4Y5VB 2WWKO 4M7KL 4G9FE 3QWQB 3L7EA 4YIQB 5E8EA 3DROA 3KL3A 3IU4L 1A1MA 1WZ1L 2VMCA 5DI8A 1NEUA 1BOYA 4I3RH 4ZUUB 4ODHH 5CZXD 4JN2B 5D1XB 4Y1AB 3TBWA 1OGAE 3GMOB 3QPKA 4AQ8C 3B3IB 1RK0A 3QORD 5E8NB 4JFOA 5KVDE 3FSAA 2JELL 4C4KT 4ZTOL 2F53B 1JWUA 1NBZA 4FQXB 2WIIB 5C0AD 4RRPA 1WEJL 2BIOA 4JFQA 2GAZA 5GRVL 5FO9A 4AM0Q 1AO7B 1NOLA 3LRHA 3THML 2Q3ZA 1CXEA 2O61B 2PF6A 3TBVB 3OF6A 4P5KB 4UM8A 3RURA 5IG7B 1SPDA 1QBLH 1YNTA 3NJVA 4QGTA 4MS8C 4BYHA 4IK6A 5ABAA 1IV8A 1CN4A 3CDZB 5C0FB 5CJXA 3BPCA 1AGCB 3POCA 3G6JA 1UEMA 2NQDA 2AJ3A 1FIEA 2ZXDA 3BE1H 1J0ZA 3S37X 4JY6A 3W2DL 1RXLA 4XPTL 4MA7L 2ATKA 2E7LA 3CZNA 4G6JH 5FGBC 3O0RH 3RWIB 4Z7NF 3RIAF 2WHVA 3QJFA 4RVBA 2XTSA 3AITA 3WS6C 5AOMA 2FX7H 2JQMA 2P8LB 3D05A 4NKOB 3FPXA 4NWUH 1G6VK 4X8CA 4L4VA 5L4IA 4HXBL 1YEHL 2E59A 3QO0B 3OKDA 2DWYA 3TFKC 2LU4A 5KYUA 5D7IF 4FOMA 4DESA 4NDMB 4NZ8A 4UB0L 4H5SA 4GIPD 4KUZL 4JGNA 1S46A 1OO2A 3ALWA 1JDAA 1M3JA 2I9LB 1UM6L 1SJEA 1QAWA 1RZGB 2N4IA 2AI0L 4LGRB 3VU2A 2AK4D 2X3BA 4JKPL 1V05A 5CNHA 4JPIA 5CGYC 4R26L 5FUOL 4L3FA 3ZZSA 4YXLH 5BCAA 4OJYA 2DBJA 4C57C 2PPEA 3D4YA 3Q3GA 1QBML 4AL8L 3P02A 2CXKA 5F9WC 2WBKA 1Z9LA 2YWZA 1A6TA 3GMQB 3RE0A 1Q90A 3GRWH 2AEPH 2ZQKA 2YUXA 1JGEB 3PL6D 4EVNA 4UDTA 4HV8B 5HHXL 1U9KA 4HFUL 4JREC 1EMTH 5DRZA 4BDVB 3UTTD 3K1KC 2WXMA 4TQPA 3SE3A 1OAZH 1JRHI 2VO5A 3F58H 4D7PA 2V5YA 4R7VA 4X5LA 2OA9A 5C0RH 4WFGE 1R33A 3JYCA 3D52A 1XCTA 2VJXA 3SIKA 3Q01A 4C54A 4Z7UE 1U8NB 3VMNA 2GJPA 1I7TB 3Q1SH 5FK9A 2C7UA 3FCBA 4X5WA 1QHQA 3MFFB 1EUUA 2JE8A 2H2SD 4MDIB 3O2WL 1F6LL 1EHNA 4KTEH 3VSQA 3U7YL 1SZNA 2ORBH 2F68X 3QI9D 4X9BA 3QRLA 1MI5D 1L5GA 5D6CA 3WOVA 4CVWA 2XWRA 2PCFB 4ZFQA 1HXYA 2BC4B 2PYEB 3KVDD 5KYUB 1U8QA 3D48R 2BERA 2CR0A 3J8F7 4DETA 4UQDA 1U8JB 4OTXL 4D94A 5EWIL 1SDYA 4AYEC 3FUKA 4RAUB 1Q0EA 3OHXA 1INDH 4J7RA 5INDB 2O5XH 4A6YH 2NUPA 2EKSB 2IGLA 1G6RH 4ODVH 5IEKA 5B8CA 4FTDA 2I07B 1OTUD 3BKCH 4JGMA 2ZOLB 3HBGA 2QFPA 4Y4FD 4GG6E 3FAWA 1T83A 4KMTH 1DUZB 1A6UH 2LFEA 3WHE0 2KKQA 2EXWC 3WIHH 3MV8A 3FN0L 1I8MA 4J3OF 4AKOA 4OH2A 2P9RA 4K15A 4XWOD 4PR5B 3EYFB 1JK9A 3GBNL 2VLJD 3Q5OA 3NABL 1XGUA 3EFDL 4W1TA 3CFJA 1QQDB 4M56A 2SEBA 4M3JA 4X4MA 3GINA 1JGLL 1X4YA 3SDCB 2J1WA 3T2NL 4JG5A 4Q9QL 1SXAA 3REWA 1FGVL 2DJUA 4WGWB 4H8PA 1UWEH 3RNKA 3L54A 2DICA 2XV6B 3KEHA 1BXUA 2HJLA 3FOLA 2B3RA 4E41E 1VKXA 5CIPH 2VAJA 5GRWA 2FNWA 2JJSA 3RUGA 3V4VL 4XBEL 1QZ1A 1RUMH 3JWOL 1X7TA 5DR5L 1KCSH 3IGAB 1ZV2A 3D51A 3QNZA 1E8YA 2A0LC 4PJIE 4QCIA 2L7QA 3PU7A 4JFDB 4OLYL 4Z7QE 4D8PA 1U8PA 5EU4B 1FZMB 4QDGA 3MZTA 5FKPB 3IM1A 3SKOB 4E9SA 3M8OL 2W38A 4EBQL 4MLSA 1FFRA 5DZVA 2GHZA 2HAZA 1DL7L 5L8JB 3B5TA 3GMPA 4WSGA 1N59B 2Y1ZA 3MJ9L 3UTTB 5EF2A 1QOKA 3FU9A 1CI3M 3IRCA 2AQ3A 4QHPA 5J1TC 1QYGH 3L2LA 4HUXB 1KLGB 4U1JA 4LKCB 3O3DA 4LU5L 3IYLW 1ZLVK 3PDOA 5D2LB 3B2VL 1UCBL 4PI0A 3W56A 2I5YH 3H2WA 3K4DA 3PWNB 2IH1B 4TVPH 4ZFOA 4Y4HA 3GJFB 2ICES 5HYIA 5AZ2L 1SHMA 1A9BA 2A9BA 2L7EA 3BP5A 3CZJA 4PLKC 1KUMA 4TLSA 1KBGH 3V6FA 3BVWA 4OIBA 4GUQA 1BVZA 1HFUA 1PYWB 1NCWH 1G7IA 3NCEB 3MC0A 4FI7A 3VE0B 2EDRA 3U9WA 1SY6L 2EVFA 5CCKH 1IM9A 3NJGA 5IROC 4BHUI 4LVHB 4YQXL 5CD3A 2F53E 4XPAH 4WU7B 1A4JB 3RAJH 3SE6A 3CDCA 3DTDA 2K9UA 5GZNA 3GUTA 1RZ7L 2CH8A 5HJBA 4AYDC 4JQVC 4ZMQA 4N2DA 5JIIA 3UX9B 4EN3B 1BX2A 4HUMB 4UI2A 4YBQD 4JFFB 4JHBA 1E9OA 3V4PA 2LABA 1SYSA 3CX2A 1Z0MA 2V5RA 2X6MA 3HG1E 2XICA 2BSTA 5K59E 5FUZH 1CDGA 1OGAA 3ZPDA 3KXFB 3VTAA 4WTZG 4IU2A 3D06A 3QDGD 2XWXA 1OP5K 3VSVA 4YSUA 3RJOA 1U3NA 3MXVH 2X2YA 1TG8A 4ONFH 3DETC 2V3DA 3VXSB 3BYYA 5LXGL 2AEWA 1YN6B 2DQFB 1WD9A 4HKXB 1EBAA 3MRCB 2NT1A 2FT7A 3CMOH 4HKZA 4P59L 4G7YH 4QRPB 3ZTJG 2HFTA 2EZ0C 1P2CA 4QXTB 5J6GA 5TDPB 5KWYC 4G72B 2NY5C 3KLSA 2YGPA 1IILE 1IC5L 4F7CB 4JY5H 2VXTL 3IDGA 1BQSA 4NGHL 2NRDA 4FQJH 4APQA 2AXFA 1XCQA 4OLVL 3RZCB 3UP1A 4WRLA 2O5ZL 2E6JA 3HW7A 2IANA 1XGZA 1FNAA 1OQOA 1ZTXH 4PLNC 1OB1B 1HSBB 1DBAH 1U8MA 1Z9SB 2P8PB 2Y25A 4R96B 5ECJE 4C56A 4N8VB 1WFIA 2ZF8A 3HNVL 3KGTA 2YKLL 5HYSG 2HFEB 3EF4A 4LAJH 2X1XR 1BG1A 1LO2H 3ZR6A 3P40A 4R0LC 1CTMA 2W65A 3CLEL 3U7WL 2D7PA 3D1MC 2VXQL 4JFZH 3C9NB 3HZYB 4OLWH 1R5WB 4P2OA 3WFEH 4CKQA 4OLEA 3DPDA 2BZDA 15C8H 2PXYD 3SYQA 4ABUA 1MCBA 1MREH 2YD0A 4APXA 1QUNA 3NJLA 1ZEAL 1BVKB 4M1GL 4MJIA 3GIVB 43CAA 1E7UA 3MRJA 2QSTA 5GJTL 3MRHB 4ZUWB 2JF1A 4K8RL 2FQGA 4NJ9H 4OIIH 1U4FA 4J39A 1D9KB 4IIZA 5FHBH 1UWFA 2KZWA 5BPPA 2DDQL 4MJJA 5E2WH 4X42A 2BNRA 3BVUA 5CN2A 4DNLA 2VDKB 3RWGB 4G3YH 3O6FB 1UZ6F 3EYVB 2HRGA 2P24B 4IQHA 1RFDL 5I6XC 1A1MB 3B5HA 2VITA 3R0MA 4HZAA 4UTBH 5GGSY 4ZXBB 3SEPA 4LAQH 4NZUH 5DMJB 1KXTB 4HUWA 2KDGA 5BXFB 2C3WA 1WDAA 1VKXB 2D7TL 1UXWA 1BJ1J 1D5BB 5AOJA 5IVXE 1OTUC 1GGBH 5G2NA 1M7DB 4CSZA 2P5EA 4DP1X 4DTGL 3L4CA 5F7AA 5J6HB 1SHXA 3MA7B 4LHUB 5KUMA 3A47A 1SVZA 2EDMA 2A4CA 3IMUA 5CUSH 3BPOB 5I18L 4YEFA 1RZKH 3A6CL 1EO7A 4PP1C 2GIMA 4R96A 1SVBA 1KJ2L 3CVIH 4DGYH 3EOBB 5DUJA 1YUHA 3PP3K 2C1OA 5TQ0L 1YJDL 4WK0B 5DZPA 1RI8A 1LWJA 2Z0BA 4HFWA 1AGBB 3FBQA 4J4PA 1RZ8A 1TEYA 4NKDB 1A0QL 7FABL 1PGRB 1FNSL 1QW9A 3PNWA 2NYYC 2F8VA 3T0BA 4EDWH 3OR7B 3A67H 2CIKA 3OPUA 4N90E 4DGWC 5A2AA 1RUPH 5FM4A 1O9VA 2EO9A 2OSLB 3DI3B 3RVUD 5D7JA 2KC0A 4E5XA 5HYSB 2E76C 4BE6A 2EEBA 1ETZB 3MA9L 1OSPH 3HCVB 3BMWA 3UYRH 4QRPD 4P9MH 5IMKA 4LRIA 2LE9A 1NAMB 5D9SA 4J8QA 2COVD 2KH2B 3QJSB 1V7ML 1OKEA 1N5AB 3GMMA 3OHMB 2O6CA 1J5IA 1SVCP 2AC0A 2H45A 3BWZA 2EYSB 5DYFA 1GIGL 4FTVB 3GHEH 4MQXD 1KN4L 3CXDH 5GRVK 4JVWA 2HN7B 3S7GA 4YJZL 5E8DH 1E2VA 5I1LB 1W91A 1VFAB 3WKQA 5IR1A 3KYOA 4PRBA 3ARXA 4IHOA 4KH2A 2F6AA 5C0CA 1OT1A 2YUWA 4C4KO 5AW5B 4G8EA 2DMHA 2BO0A 3MFGB 3NIFF 4EIBA 3IMTA 1JNNL 1AQKH 4PJDE 2LQRA 5CZRA 1SYSB 3QZLA 4M6NL 2K6WA 4XC3L 4ZAKA 5ABZA 2FZ3B 3IFLL 2UUDK 2XXMB 3ARDD 1MCWM 5C0EB 1CTOA 1F3DJ 1CICC 5SWZE 4QRRA 4AK1A 1MZZA 2CDEA 2X9WA 4NN6C 2H1XA 3DRTA 4E9VA 4PREA 2R9HD 1FJ1A 2IJ0C 4Y8DC 1FSKC 1RZJC 4F1SA 4I77H 1NFDA 1BFOA 2CO1A 5D4JA 4LP5A 3ZXAC 4AQ1C 1IAKB 3U1SL 3ZU8A 4NFBA 4ZS7H 1A1OA 5C0AB 4YL9A 4OZHE 1I7TA 2BVYA 2F7QA 3VWJD 4YHLL 3C60A 4KJPD 4MSWA 4Z8FL 4TQHA 4RLDA 4X6BA 1TOXA 4PJBE 4Z0BH 1KZYA 4KH9A 4H0IA 4IBTA 1G7HB 4ZJ9A 3BC9A 4HOWA 5D8JH 2O26U 1IIKA 3KJ4B 5TPWH 3EJTA 4PFEA 2F08A 2G3NA 2C9RA 4QXWA 4U7KA 2ED8A 3TNMB 1PD0A 2FX9H 2FX8H 1HXYB 3V6BR 1CE6B 1CXHA 2UWEA 1IEBA 5CEZL 1MRCH 3QCVL 1N8OE 4PAZA 4UU9A 3QB7C 3UC0H 4H88L 4FNSA 3LZFL 1JZDC 3WEOA 3V4VA 5I16B 5CEXA 5E2UL 4FG6D 4U6HB 4GRWE 4MA8H 4Z7OF 1XGYL 2NY2B 4MWFA 4WUKH 4PMEA 5BZXA 5KBLA 2I07A 2VXVH 1SY6A 3OMZA 3WENA 2WAHA 3F84A 1WHOA 3HRZB 2BDNL 4U6VH 5TQ2L 4KPHL 4F58H 3N40P 4MNGA 3N06B 1TYEB 1RSYA 4ZTPH 2J20A 1AMXA 2AGJL 2QQNL 3QIUC 3MV11 4RA0C 3UBXG 4WNJA 4QRAA 3VMPA 3S3SA 4HX1A 4LGSB 5I75B 5FO7A 3KYAA 4Y5XA 3UADA 1J9TA 4EKJA 2Z93B 3HG1B 4G8IB 4OCXH 4KTDL 1ZA6B 3ILDA 1EJ6A 4V11A 2X09A 3ARSA 5HGHA 1QRNA 5FGCE 1FDLL 2WUBH 4OUUB 1DQTA 5ICYB 4DEUA 1LMKA 3P11H 4I0PD 3SBQA 1K2DB 4Z95L 4LBEA 4HSAC 4IBQA 2VQ1A 1CL7L 2CLRA 4OQTH 5CLXA 4BK5A 4NJAL 4HJEA 1BIHA 2J8HA 2YSTA 5D70H 4QHLB 1G7MB 4PGJA 4X7EC 5IROA 4JO4H 2XLLA 4TSCH 4LMQI 4FQHB 4GY4A 2EABA 2ZPKL 5J9PB 4JAMB 3GSOB 4KVCH 1INEH 4CN1A 3ZDYE 4LSQL 1X5MA 3QEUB 4X4ZA 4Q6KA 3AQXA 4HJIA 4J3WA 2IBGA 3V4UL 3CUPB 1S7VA 5JXED 1WVZA 1AAJA 4YO0A 3MNDA 4ZDHA 1LE5B 2RALA 1NPUA 5ICZB 5CR8A 2PXYA 2W5PA 4KVPA 5EO0A 5IVNA 1Z6JT 2VDLH 4HEPA 1JUFB 4B3EA 1KTRL 4PP2B 2HPTA 1EV2E 2FHBA 3SDDA 2WCGA 5CSGA 3T3ME 3TZVD 4QF1B 1BPLB 2VN7A 1NLDL 1QTSA 1PZSA 1XF5B 4FFWD 1G94A 2RJMA 4X0KB 1AIFA 5GGSA 2B16A 4POZC 3W37A 2NNCA 5KBPA 4Y9CA 2JJWA 1QI3A 4KFZC 3ZDZB 2IFFH 4UT7L 2DQHL 3SGDH 4P2AA 4Z3TA 5K9JH 4G5ZH 3W3BA 1DVTA 3G5WA 3E2HB 3DDFA 4A66A 4Z3EA 3ISYA 1DVSA 3B43A 3CU7A 2HT3D 1UT2A 3P4OA 4N24A 4RISL 4EZLA 5FYLE 3FTGA 5JW4N 2V7NB 3LSOA 3N1FC 2H8PA 2EUZA 1UJ3A 2DEXX 4W4OC 5KYWB 4PS4H 4PRIB 4Y4HC 1KTDA 4Y19A 1EERB 4E41A 1T3FB 4MJ6A 4UOW1 3DUSB 2YMOA 5ESVA 1PCSA 2C9QA 1E42A 2OK0L 1MRDH 3BSZA 4K5NA 4HIIA 4ELMF 3TLRA 3MNVB 3ZDXE 3TEZA 5KVGH 2NW2A 5EOCL 3GXFA 2WZ5A 3NZ8B 3QC5X 5F1IB 4FQHA 4EUPG 3FHAA 1ZLEA 2FECI 1U30A 1FVEA 5EC1B 1XXFC 4DKFL 1BW8A 5D93C 3IB4A 4GG6F 1F2XK 5DQJB 2OXGA 3K72B 2YPVH 4KRPB 4L4VD 1KCUH 3MRLA 3RLSA 3L5IA 1E9PA 2AERT 4NQXB 5JPMA 4I3SH 3J27A 1LQBC 5A7EA 3TT3H 1DUYA 3IVKA 2KBGA 2CO2A 3CMGA 4ZFOL 4P5TA 2XXGA 3L3JB 4JK0D 1KY7A 3GC3A 4OCYL 4DQAA 3NEOA 4WNSA 2EEAA 5LBSH 2MFNA 4L05A 5JYLA 4Z7NE 1F6FB 4XPBH 4JJ5B 1Q72L 4YPJA 1TQBB 2IH9A 4L1TA 3EYQD 4NKMA 1KOAA 1YY8A 1Q9OB 1WFNA 4G80B 4YDNA 2UX7A 2VNCA 4R3SB 1E8ZA 3RWJA 1NBCA 4NQVA 2ZWLT 4WO4A 3LN5A 2BJMH 4GUPA 3MV7A 1MJUL 1HXKA 3AGVA 5C0JA 1T5KA 2DLGA 2MCMA 4TVSa 3RIFK 1Z3GL 3L9EA 3SDCA 1KT2A 5JW3L 3BDYL 4G70B 3OGOE 1KTKE 1GPOL 2EYRB 1GC1C 1HHGA 3APNA 2ZG2A 5ESQB 3HG5A 3AY4A 5IB3A 1D6VH 2W9EH 4EXKA 5B22A 1U2YA 3QG7H 3RPBA 3AU1B 1ET7A 3WFCH 2V9UA 3C5ZC 3OZLA 1MQKL 2PWGA 4AIOA 5EUOE 1U2CA 3NFPA 4OJDH 4O51B 1IC4H 1KXVA 3ARFD 3R18A 4JFDA 3FC8A 4UQEA 3Q9PA 3GSWB 5EO9A 4DQOH 5E8OA 3AXHA 5GS1C 1E27B 2CGZA 2HX7A 2WXPA 4N3UA 2YGQA 4NXKA 3CVHH 3OB0K 4P99A 1QASA 3VI4A 5HSFA 2YZ1A 1A9VA 4MVBC 4XI5C 4X5QA 1DDHA 5IB5A 5I9QC 2TRHA 3S48A 4ORGB 3DVFA 1FV1B 4O9HL 4OLZL 4JRXB 1HINL 5SWZA 1RUKH 4JAMA 1RZFL 3QIBD 4Y88A 2X2IA 1I53A 2DD8H 3K2MC 4CKVX 5I73C 5J5EA 3HR5A 3I50H 4L4TA 2EE6A 5D72L 1XO8A 5E4EC 3UTSB 1GS8A 1DBBL 5AW2B 2WVVB 1ZWIB 3I02A 5GJSH 5EF1A 5DMGD 1GXEA 1MJJA 4WFFD 4DPAX 1U93B 3MRPB 1TJIL 1MFDH 1QLEL 3V0EA 4HJ0C 4UIKL 3V4PH 4CU7A 2R15A 3UBHA 4E9RA 1RIUL 4Z0XB 2FBOJ 3TL5A 1KCRL 3OLGA 1P7QA 4AIEA 2EIMB 3OXRA 1YPZF 1UC6A 2F53A 3APFA 5D5ME 2NY3B 3D6GA 1VESA 3S5LB 3UAFA 1TVHB 3U82B 5DD1H 3VFWA 1ZLSL 4OFQA 2K0RA 4O58L 1RMFL 2WGNB 2EDYA 3FO1A 1H9VA 3QUZB 2RQ8A 3EGXA 3HA0A 3VQMA 4ZAKC 5KSVA 4MAYB 1XSOA 4FQLL 4BZ2L 1TZHB 2ARJQ 2J57A 4GAYB 2R0KH 5DD5L 4GBXA 3VRIA 1U92B 1IM9D 3FTGB 3HTLX 3IRPX 3MLVL 3D18B 1KYOJ 4R5TA 2NY2C 1A4BA 1TTFA 2AXJA 3AT9A 5FYKH 1SM3H 4WUUD 1JHKL 3D34A 3U4AA 1BECA 1TNMA 3BIKA 3EGSB 1V54B 3HNSH 5ENWB 5ANMA 1YY9D 5IVOA 2W0FB 3GSXB 3LKNB 1S7QB 2IANE 4PV9B 4XVSH 5MEQB 1HILB 2JKJA 1VFUA 1BJMA 1XR8B 3IDJB 3KS0J 2W94A 2NW2B 3MOQA 5F1IA 3DSFL 3U6XS 1QSEE 1T03L 3VGAB 4JRXA 4MJ5B 3IJEB 1P9MC 1D9KD 4E9LA 3SDXE 3RL2A 2IGFL 3QPQD 1F13A 3ARBC 5T1LA 2Y7QA 2IAMB 1P53A 5HDBF 1UOLA 4G8GD 1T66D 5DLMH 5K93A 2W91A 5DJDA 3LEYH 3BP7B 3MRLB 5T8IA 4F57L 5I1CH 5IHZA 4JHAL 2Q2LA 3ZVVA 2ICWB 1HK6A 4WNQB 4NRXB 3ZOAA 2PYFA 1EHKB 3QJVB 4MNQD 3UXFA 5IJBC 3UIZA 1OCOB 5JNYA 3NMEA 4XRCB 5BNXD 4AL8C 3BVTA 3OKEB 2AMUA 1TEGA 2ED6A 3VXTA 3BI9X 3B9DA 1JPSH 1DVUA 3ARED 4K3DH 4EEEA 1M7XA 4YBHA 3B9KA 2GSGA 5GSRB 3KYNB 2PWDA 3QEQB 2UXVA 1ZA3A 4I3RL 3EHBB 3MMEB 3ESNA 3S3CB 1MAKA 1IFHH 2VXUL 3DI2B 4IIQC 4OBSA 3LN5B 1WK0A 2D73A 3CNKA 5IMOB 3KPPB 4F20A 2JELH 1YPZE 4B9JA 4NAJA 4WKZA 2Q8BH 5IY5B 4UTAL 2H32B 3EJCA 2FJHB 3ZKMC 2WZ0A 3QC6X 5ID0A 2ADJB 4LF3B 1BF5A 1IEAB 5DHYA 1ZE3H 3UJJH 1C5DA 1HN1A 4R90L 3D39B 3SCMD 4U1IB 1OM3L 3KBPA 2PCXA 3DV4A 4FNTA 3S6CA 2OL3H 3DWTA 4XCNB 3UG5A 5A7BA 1QBLL 4WW2C 3VGHA 3X1EA 3FUNA 3CBJB 3MOBL 3QFGA 1I7ZB 2QADC 5DD0L 5I1GH 4MD4A 5AVUB 3AQZA 4FL4B 1OARL 1XGQA 4H1LH 4XC1H 3LZOA 3REVB 2E4FA 3V7MA 4JFFA 2XTJE 3U9PH 4NI3A 4JGJA 2I24N 5IHWA 2G60L 4UILL 4WI6A 5K5YA 3N1PC 1R5VA 4NN5C 3S0PA 2EUVA 4NQEE 3T1FA 3CZSA 1X5JA 3D3VE 2QQKH 1YC7A 1P5VB 2IAND 4QXVA 3PJSB 3FFCB 4Z3IA 3W57A 2G2PA 3NTCL 4WIQA 5I1IL 5JDSB 4FMKA 1ZPLA 5GQBA 2GITB 2CK0H 1TPXB 2FUQA 1AGBA 3GDBA 2C4XA 3GS4A 2MQCA 1BF8A 1JK8A 1GC1L 5KYNA 4MBOA 3DX8B 4HXBH 1XL4A 4Z7UB 1EK3A 4J3VA 4N2AA 3E8UH 5C6WH 4M6OL 3MRFA 1OE2A 2UY7A 3CHPA 1X7QB 4PJXB 4H8HA 3P4NA 3HNTL 1UM6H 2YD9A 3QUXA 4OZFB 4ZOAA 4X4YA 5JMOC 4TL4A 3PWUA 1DLFL 4JKPH 5F1NA 3TX4A 3I6KB 1TT6A 2XN9B 2CA3A 4UTCA 3EYUL 1I9EA 4BCYA 2EYSA 3QCUH 4Z3JA 2VM3A 4XNQB 2F5AL 2BSSA 1KIQA 1NEZG 3ULUF 3TCLB 4ZUUA 4AMKH 4JPSA 1CMOA 5FW8A 1M7IB 4NP4H 1S2EA 1ADQH 5DQ9B 3GSVB 4HWEL 4AEHH 4BFOA 1G7PA 3SODB 2QKIC 5BUPA 1SXNA 4QRRE 1YEGL 4F7PB 4XE0A 1BZ7A 5C0RL 1HOEA 4LPCA 1ZLUH 1PEZA 3SPJA 5H4YA 1N64L 3GK8L 5DUPL 2F8IA 4YHZL 3HUJB 2A6IA 2VLLB 3UABA 4DOHE 5GRZA 5BZWB 4CVZB 4UYPA 3TURA 4HJ0D 4CVXB 3ARPA 3D9AH 3QR0A 3TOPA 2P28B 3LN4A 4PJ8B 3D3VB 1I7RB 1AE6L 5DEJA 1PZ2A 2GK0B 3NCJH 3WAKA 3LCYA 1AY1L 2W9DL 3MOAH 3LB6C 1N12A 3MA7A 4LHUA 4J23A 3DTXA 1E2ZA 3EBIA 1DQML 2PCYA 2BSRB 5FYKU 3E38A 4ZFGL 3H9ZA 3AMLA 2ITDA 2WQXA 3F85A 3Q48A 3HZKB 2OMUB 3RWCA 2FR4B 1NDMA 4I48B 2JKIS 4I18C 4CADA 3FUDA 5DURD 3N0AA 4QNPF 2JB6B 5LDSA 4OGYH 2OXHA 4PWJA 5KVEE 3DX6B 2NUTA 5BJTB 1MXDA 4PG9A 4ETQB 4I0PB 3BKCL 3WJLC 1X5IA 1S7TB 1O75A 2WNKA 2HMID 5T33H 3HS8A 1S78C 4GAJL 4Y0GA 2DV6A 3GBLA 5DVLA 4LOVA 4QJ5B 1UFUA 2VR5A 1ZLWH 4JANB 1AGDB 2JXMA 3E0GA 1FVDA 4A68A 3ML8A 3QUZC 4A04A 3C6LB 4Y9EA 1E65A 1IE4A 2C9UA 2HP4A 2LU3A 3DRQA 3V0VB 1ZS8B 3V52H 5EBGA 3KPPA 1BXXA 3MREA 5TE4L 3S2AA 4A1RA 4A7GF 1FGVH 4X80L 1NDGB 2FTAA 5JQ6H 2FNBA 3QXAA 4NQCB 4UM9D 3MXWL 1AD0A 4KXDA 3QRBA 2ZIDA 3FCSA 1NL0H 1FYHB 2GG1A 2VL5A 3A4FA 3PPEA 3QEQE 4JFOB 5JIQA 4IGBB 1CXKA 2Z31D 4G8FB 5TK4A 1HHGB 4WDIB 4WI0B 3QHZL 3G5YA 4NBZB 4HOXA 5EORL 2CLRB 3SCMA 4EF3A 3L2MA 1XFPA 3QDMB 1GYCA 5JOPD 1WUZA 5CM1A 3D0LA 2V7HA 4MCYA 2IWFA 2HPOA 2B1AL 3T4AB 3T9WA 2D31B 1NMAL 4MAZA 4I48A 2O6PA 3ROLB 4ZS6D 3TF7C 3SGJC 4M93C 4O4YL 1JD7A 2WLLA 2NSQA 3G5XB 3UG4A 4TNFA 5I8EA 4NN7C 1QATA 4CU6A 2AXHA 3MCKA 1AGFA 4HS6A 4Y5VC 5EPMB 1UCBH 5JR1H 4OZGE 4UV4L 3S96B 2WXFA 1QABA 2CPUA 2ZD0A 3CPUA 3KPQA 3O6FC 1SRDA 4M4RB 5IQLA 3N6YA 4C58B 2Y0SA 3MR9A 2MOGA 4FDWA 5BZZA 4RMQA 3NJFA 4XVTH 5KW9H 4KI5D 3UTPE 4FYQA 4YSSA 5CCGE 5HGBA 2ZKMX 1P5UB 3L3DB 5J4MA 3B7TA 3GZQA 2G2RA 3HZMA 1ZVSB 1CGSL 1WHPA 3FSZA 3QDJE 3UERA 3GJEB 3A4AA 4N0UB 1FC2D 4XMKL 5IW3A 5I71C 4KRPD 4LLUB 2IQ9H 4G83A 4G6ML 4XPAL 4PVBA 3DX9B 1GCYA 2EIDA 4RBPK 1MCFA 4FHJA 4FLSA 4LXFA 3ZE2E 4DEPC 2DM7A 2YMXL 4MAUL 3IEAA 4Q9RL 5DURB 2MPAL 4J3OH 1P7QB 3BT2H 2EXSA 3CSGA 4IBLT 4PJ7E 3N55A 5HXMA 1F11B 1KB5H 4J3SA 4Y4KA 1MF2L 1NKOA 2MKLC 3G5VA 3ZE1B 5JHLH 1TSHA 1S9VB 2C3GA 3QUXC 4XMXA 5JUEH 5H2BB 2VKXA 3JUYA 4JEGB 1RZJL 5LAPA 4HUVA 4RFNC 3QW9A 4JQXC 3MACL 3VXSE 4L5FH 1JCKA 1NGYA 3HG2A 1XSIA 2BNQA 2CKBH 2V9TA 3CMOL 3QDME 4MCYB 5TH2B 5IV2B 4W70A 4KZ0A 2F74A 3RHWF 4J6IA 4AJ0A 1YUHB 1QRNB 1GGIL 5T3XH 1OTSC 5T3ZL 5L7XL 1MCOH 5C09E 2IADA 1TPXC 4JUSA 4NUJB 4XCEB 1BAWA 2KERA 1MSPA 2VDPB 2VE6A 5KAQG 3O3UN 3PHOA 1LEGA 5L8KB 3ASNB 4S1SL 4NQCD 4UM9B 4PRNB 1A9EA 1DBAL 1XVSA 5AOIA 2JTDA 2JJTA 3MJ6A 2ZWZA 4P2QD 4PRHE 2OMWB 1BV8A 1WTLA 2A73B 4A2DA 1LM8V 4X99A 2RIKA 4LKCA 4Q6IC 3WS3B 5DWUH 3ZMNA 3HZKA 1FQ9C 3V2AR 1KPVA 4OCWL 3MLSH 2HVKB 3PF2A 5F9WB 1JVOA 5KSAA 4PD4K 4Y5YA 5E6YA 3HB3C 1WV7T 2WOBA 4RSYA 5FHAH 4GRMA 1LO5A 1G9NL 5F9OL 2O6FA 4ONGH 4L1HA 3T77B 4M9PA 3KPRE 1EZSA 2WQUA 1CDCA 1AGDA 1A66A 4H7VA 5I66A 4OIIL 2P8MA 4FKEA 2N0KA 1FSKB 1UQSA 1TJHL 1IM3B 5EFIB 1TENA 4PIRF 5FHBL 4A55A 2FWOB 2AEIT 1YNKH 3MLZL 2QGDA 5AW4B 2CAKA 4YBLB 1RZQA 4M61A 4AQ1B 2AK4E 3VG0H 1A3LL 4WU7A 3V6ZA 4TQEH 1MFCL 2CHWA 3WL9A 4M5ZL 3P9MB 4L5FE 4CBPA 4OKVB 4WO4D 3UTSD 4ZFZA 4WJ5B 3IDYB 4IOIB 1ETJA 3WFZA 1UGKA 1TQWA 4W9LC 1W8OA 3V55A 4CC4C 2BWIA 3SGEI 3FQWA 4BFGA 1F3RB 2YXWA 4O5LH 3CCHB 2HT2C 4DHLA 4OCNC 1XSJA 3RHWK 2YD1A 4Y16D 5BO1H 1R3IH 1ZHNA 2J2ZA 4DTGH 1AC6A 2NR6C 4YHNA 4LLQB 4J8RA 2EDNA 4NUJA 1G87A 2J8UA 2NNRA 4FQ2L 3GO1L 1KN2L 4R0LA 2ZUQB 5DA0B 3WLWC 1ZXQA 3QHFH 1IL1A 8PAZA 5I18H 5CGYD 4K71C 4HF5H 2DWDB 4JRYD 5GGUA 2ZXWB 4I1NB 4K5OA 2XFXB 2V4LA 3BQUB 2LLNA 2GBAA 3ESPA 3PQYE 1GTNA 1XIWA 3KPOB 5IFHH 2OI9C 4A2HA 2DYPD 1MN4A 2VR7A 2X38A 4EDXB 4HBCH 3STLA 5AWNL 1RPKA 3JTBA 1L6XA 2LFGA 1TTGA 4ELME 3ZYIA 4WVRA 1FH5L 1WE5A 4LHQB 1K6QL 4V33A 3P4LA 1RVFH 3BZFB 4PJ5E 5KSUB 4MQSB 5B1JC 4PJBF 4YFEA 5IMMB 1II4E 1F5WA 1NLBL 4N25A 2PW2A 3EO0B 4M6ML 2PPCA 3FOMA 1TCRB 3RFZC 2H1PL 3MUUA 4PSRA 5CBEA 5DO2D 3O41B 1RERA 5IP4A 4XVUC 3OXRB 1Y1UA 1Y18A 4ENZA 5BRZA 1LDSA 1PG7W 3L3GB 4I18B 4YE0A 2Y1YA 3QZOA 1CBJA 3MRNB 1G5AA 2QT6A 4FTVE 2QZQA 4IS6A 4EE2A 4F9PC 4I0PC 4K55A 3DXAA 4U6TA 2HX9A 1OQXA 3D50A 4YDVA 5FIEA 1IGFL 1ODUA 1T04B 4CSSA 4OCRH 2P26A 2Y36H 4XWGL 5C0GB 3KYKH 3R7QA 2ICWJ 2VC2H 3VE0A 2E6QA 3GEFA 3B3IA 2F53D 4OCMC 4RGND 5E2JA 3EYVA 3VDCA 3U36B 3SGJA 2FJGB 3AXLB 2EYRA 2A9DA 2MHAA 4DFHA 1M1SA 5ENWA 2DQGH 3MLUL 1EIBA 4DP9X 4NNXA 2ITEA 4AENA 4JM4L 2B7DT 2WCSA 1JXDA 1QFPA 4HZ1A 1AYRA 4K3EL 4YXKL 2P47B 3VFRB 5FYLL 2XWEA 2XV2A 3GMRB 4PJHA 5GGQL 4EDXA 2VXQA 1OGTB 1IM3D 4JPVL 1RUAL 2YRBA 4HK3J 4UQIM 5F8RC 5EU6B 2A99A 3GSWA 1JWSB 1WICA 2C1PB 3BZ5A 4Q6YA 5AW3B 1HWHB 4PJXF 4YHLH 5GS2D 4LCVA 4OZHB 5C0FA 3FHQA 1FNGA 5HPMA 1CFSB 1L9RA 3PHOB 1E3ZA 4QTIL 4HEPG 1TFPA 4PJ5D 2J88L 1XHHA 4ZPTA 5IBUG 5CCJA 4NRXA 2A4EA 2GK0A 4MMYB 5TPWL 3RNQB 3WE6A 2XN2A 3ZDYF 2L3BA 2Y2TA 5LNDA 1P4BH 1VAHA 2DTMH 3OR7A 1PZ5B 2VDNH 1V3LA 5LKNA 3NK4A 1YDPB 4LVHC 2P8LA 3LQZA 4JL1A 4X98B 4YSAA 1TETH 4ODTL 4EJ1C 1OLZA 2X4TA 5CHNB 5DJ6B 1SYVB 2J6EA 5I1AA 2PWEA 3QZMA 4L37B 3Q9QA 1LD9A 4LFHG 4P3DA 4PJAF 5SWQA 3HBQA 2J8OA 1A4KB 1OP5H 2B14A 5D71H 1FN4B 3MNWB 3IAPA 3BKJL 1O7VA 5F7DA 5CIPB 3B1UA 3ZDYB 3ZZQA 1CU4H 2W65B 1W0VA 3DARA 1DFXA 1LP9A 1ONQB 1SJEB 4XNUH 1EAQA 2FWUA 4X6FA 5TQ2H 4APQD 3ETBF 3CFJB 4R4FL 2HFGH 2XPGB 3GSNA 1HL9A 4ELKA 3LKQA 2D7QA 1MFNA 4M7LT 3EFOA 2VN4A 5GIRB 3ALXA 3EYOA 3BAIA 1FORH 3BPNB 2AF2A 5DZAA 4Y9BA 1SN2A 2Y7MA 3U1QA 4OVVA 5C0IB 4WJ5A 3AG3B 1T22A 2XSKA 2JJTC 4WI9A 1E4WL 3VFRA 4HWZB 3FFOA 2IC2A 1U92A 1HNGA 4AW7A 1WWBX 5ALBH 1B3JA 3ESMA 1FVEB 3FZUC 1QRNE 4HIXL 3U2JA 3SE4A 1YCSA 4F2ME 5F70A 2XZCH 1YYMH 5DSCB 4R7XA 2AV7A 2X53A 1A4CA 4OZHF 1IGML 1CLZL 3WMSA 4IGBA 3TVMA 4UDUA 1JXKA 3JT0A 3N3EA 3LKNA 3OAWA 3CPLB 5H35A 2ZPKH 4QHUB 5CJQH 1CGUA 3FKUS 3B9EA 5AYTA 2ZUTA 3ZHFA 5C2BL 4CGTA 2G3ZA 3QNYA 3V4UH 3RTQB 3QI9B 4JRFA 1M2VB 5FUCC 4XOBA 5DJ0A 2AABH 1ICTA 2VDLB 4HOMA 3R4DA 3MYJB 1IC1A 5E6RB 4QD2E 4W9KC 5GRUH 4IRZL 5CGTA 3NN8A 4P5TD 2ZP8A 4FHBD 3T3MB 3TNMA 3N04A 4YUEH 4KGLA 4TULH 3F2LA 9CGTA 1A7BA 4PVLA 3L5HA 3JWNE 1KJVA 3NIDB 4NM4H 5BQDA 2WBXA 4U4BA 2IPTH 4LCUB 2DQEL 2YAMA 2DQHH 1DVZA 5DHDA 5IJVA 1LE9B 3GFUA 3QJHB 4L1BA 5A6MA 2GJZA 1RUQL 4ZXBC 3EBGA 2PNDA 3WU1A 5D96B 1SHSA 2OKMA 3AJ7A 5D7LE 1F58L 4PJ5B 3MROA 4LCYA 4PSPA 2NY2D 3UBXI 2OR8A 3B2DC 4DPBX 4AE0A 3ZQXA 1URZA 2UVEA 1GYWA 3PYCA 1NCDL 4K3GA 3ZGIA 1YLBB 1X44A 2C5DC 4O51A 2VT0A 1OAYH 3QJOA 2HX8A 4LCWA 2J72A 4WWKB 3BPOC 4GAGH 3WUZA 5IM7A 1D5ZA 1CD1A 2PCPB 3IGFA 4GXUM 4DK6A 3ME0B 1S3RA 4GKLA 4EN3C 2XWCA 3FO9A 2ZUWA 1XAKA 4P4RA 4DT2A 3ZN6A 4FJZA 4JM2A 4PRBB 3WMPA 2PXYC 1TTAA 3TN0A 1FNEA 1RJCA 5ICYA 1FO0B 2D0FA 2JCCE 3KPSE 2OZ4H 4I2XB 3KLDA 3T04D 1QA9B 1T4KA 1XDTT 4LBEB 4JFDD 5C6TL 5DMGC 1WZLA 4XMLL 1P4LB 3TXAA 3BMVA 4M02A 4NXSA 4OI8A 4G8GE 3BRFA 3ARTA 1KCUL 1J12A 1T1YB 2ZXCA 5DD6A 3F7QA 3IJSB 3PWJB 5JXEA 4LEXH 1F18A 5DEGB 2JK5A 3TT3L 3HS0C 4BUGA 4CMHB 2VIRA 2CO7B 3TVMD 3ATBA 2CRMA 1AH1A 1HH9B 3SPVA 2EDLA 2HFEA 4K71B 2P44B 5KYXB 4WEBL 3HMXH 4ZPVB 4I85A 5SWSB 1KGCD 3QIBA 4AGPA 2OFQA 4DCQB 4PBDA 1RU9H 2LTQC 1OM9A 2H0FA 1IBGH 1V3MA 4P46C 4FYSA 2NY4D 4X98A 1F4YL 1JPFA 1DVFA 1BVLB 2HB0A 4UT6L 1NUFA 2PO6B 3IAGC 1T6VN 3CN2A 4FHKA 1RK0B 1PZAA 3KXFE 1ORQA 1JOIA 1UA6H 1LDPH 1O5DT 3ZIMA 1KGJA 2WQVA 1AGEB 5B39A 4M62L 1LP9B 5FYKD 3SCMC 1SF3A 4ODXB 4BFNA 3QJTB 1XB6A 4K7FA 3P4MA 2NXZD 4NZRH 4OI9A 2NLJB 1PBYA 3RDJA 5E03A 5DRNA 5GISH 2NR6A 4QGYA 4RNRB 4GSUA 3WFCL 4U1GC 2DKUA 5CP7A 4OLXL 4OGQC 4JHVA 2P49B 3WYRA 3CFMA 4K94L 2Y07H 5AW6B 3IXTB 2NDFA 1ERNA 5DYOB 3Q3GB 1MVYA 1FNEB 1R47A 4R6UA 5E6SB 3BISA 2WP3T 4TLUA 5F9AC 1G5GA 2DTSA 4BFFA 3GJFK 3OXSA 3SB3A 3ZYJA 2ARWA 2AJVL 4R4ND 2NNFA 1VDGA 2OMXA 1NSNL 3IJEA 3QUYA 5JLZA 2CBOA 4S0HA 5D4HA 1OGAB 5JA8B 4H8WC 3NG5A 3IS0X 4P3CL 2DMKA 2Q76B 4WU5A 2QTVA 1YJDC 2VOTA 4PP1D 1WRFA 2FHCA 5HY9B 1MI5E 5JPNA 1NGPL 4F9PA 4NKOA 3O3AA 1E3FA 4WFEE 3F7VB 4H44C 4OZFG 5J6GB 4WWKD 3UPRB 1A2YA 3X14B 3RDTD 3MLXH 3VWJC 4F5CE 3PNWB 4ZMOA 4Q2ZB 1TYJA 5E08H 2GT9B 4KK8C 3NP3A 3NBNA 5I1JH 4GEJA 1N7ML 2C3VB 4GP8B 3GXTA 4LB8A 2UYLB 4L18A 1YNLL 5F96H 2YQGA 5HGBB 5DFTA 1A64A 3LQAH 1ZA3B 1T21A 1U0QA