3WEBA

Crystal structure of a niemann-pick type c2 protein from japanese carpenter ant in complex with oleic acid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
FVFEDCGSEVGKFSDIIISSCDPSEEKCSIIRESEIHVSMKFTPSVDVKNVEAKAFGVLLDVPVPFPLKKPEICKDPDSGVKCPLKKDVEIEYKVTFFVEKATPALSLEIMWEFRNEKDEKITCVKFPAKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Niemann-Pick type C2 protein
publication title Niemann-Pick type C2 protein mediating chemical communication in the worker ant
pubmed doi rcsb
source organism Camponotus japonicus
molecule tags Lipid binding protein
total genus 26
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3webA00
3WEAA 3MTXA 2E56A 4G8AC 5IJDC 3VQ2C 1A9VA 2HKAA 3T6QC 2Z64C 1XWVA 1AHKA 3WEBA 5IJCC 3B2DC 3M7OA 5KWYC 1AHMA 2E59A 3VQ1C 1KTJA 3MU3A 1WRFA 3ULAB 3FXIC 1NEPA 3RG1C 2Z65C 2F08A 5IJBC
chains in the Genus database with same CATH superfamily
2JE8A 3PGDB 4PVLA 3F85A 5J12C 5EF3A 1S9VB 2GJRA 2QLVB 1BECA 3HG5A 3NCBB 1ZK9A 4A63A 3MRNA 1YEGL 4WDIB 3MOBH 2UWEE 1IAIM 2LAAA 3S97C 3JT2A 1TT6A 3OGCB 4RFEB 1CLOL 2G0LA 2JCCF 4ZPTB 3CMOH 2JLPA 3UTSB 3ZE0E 2XDHA 4AE0A 1IBFA 2B1AL 1KXQA 4N24A 2J1WA 5HYQA 5HDRA 5EU4A 1D5RA 3U0TA 4U1SB 1XMEB 4NNYB 3IFOB 4OCWL 5FOBA 5FM4A 5D55A 2JB6A 3BT0A 2H9GB 3UERA 3W39A 1VZGA 2CGYA 2DLHA 4PW3A 3OAWA 5D70L 3DSFH 2XICA 1GGIL 1BDYA 2AAAA 5BW7A 4OCRL 1QFHA 3CFIC 2YGOA 2WZAA 3U30B 1Z3GH 5IUSA 5AZ2H 4YVNA 5T3XD 1WHOA 1KT2A 4LSUL 1A2YB 3L4ZA 4LL4A 3I6GA 2ZX8A 4RAVB 2C1OA 4B9CA 2X4OA 3SE3A 2CKBL 2PO6B 4KROD 5ILTH 4OT1L 2A9AA 1E7UA 3TN0A 4PJHA 4RWYH 1K9TA 3V6ZB 2PYFB 5C2BH 1SMDA 3G04A 3F84A 4QO1A 4YBQD 4OZHF 5F7DA 3TBWB 2X4NA 3WUWB 4Y5VB 2X0WA 4JFWA 4BD4A 1BGXH 2JJWA 5SX4I 1CO1A 1AMXA 4FCHA 3TT1H 4CVZA 1BAFL 1MCOH 4WNQB 1KTLA 3W81A 4PIRF 5CBAB 4Q6YA 4QTFA 2IOOA 3VD4A 3GKWH 3SDDD 3VXSD 2HX8A 3S35X 5B1JC 1L4IA 3P3RA 4LKCB 1TCRA 5I8OL 1J7VR 1G1KA 4L4TA 1OGAB 1NPNA 4PRIB 4D0DB 4F7EA 2OPCA 4XB7A 3RVWD 3VTTA 1YA5A 4WWOA 2LU3A 3NH7H 1YYCA 1PCSA 2H1PH 2J88H 3H4FA 1BOGB 1LO0H 1KJ2L 3KJ6H 2O5YL 1TQUA 2P44B 4DPRA 4KJQC 1A6PA 2UWEA 3HLAA 1KBGH 4TYUA 2HJLB 1HOCB 1P4IH 1XH0A 4UDTB 3U2IA 2NW2B 4N9GA 4DKFH 2AJYH 5H37G 3ZN6A 3BPNC 5J4MA 3B3IB 4P5KA 3LQAH 5JHDB 3VFVB 5E8DL 1P7QB 3O2WH 1E9PB 1YVLA 2CHWA 2MCPH 1JGEA 4NRZA 3S88L 3RI5F 2DQFA 2DQJL 4QTIL 3HN8A 3IDNB 1YAZA 3VSUA 4E9YA 4QRPA 5E9DE 3RVTD 4BFBD 1OPOA 4Z7NE 3QJTB 1RZJC 5E70A 4KJPC 3H54A 4A2DA 2R69L 1A6TB 1DBMH 3CDCA 3MA9H 2K70A 3Q1EA 4TVPL 3TO4D 3V5KA 4OZFG 3RIKA 1F6AA 2I27N 2Y1YA 1PS3A 3TA3A 5I8KL 4ZMVA 2EIJB 4V2BA 4LNRA 3MBWB 3EH5B 1XF1A 5EU3B 1TJGH 4L4VD 4ZTOL 5DJ0B 4ONHB 3FT3A 2X09A 4KO6A 4L1HA 2IO5A 4J4PA 3WLBB 3BRFA 4KVNL 1L0YA 1HH6B 2ZSVA 3UZVB 1FO0H 3GXMA 2XWRA 4XPFH 4Z77A 1CE6A 3EJYC 1GC1H 4JG1L 3TIDA 1BM3L 2W38A 3UTPD 1IC1A 3JWDH 3D2TA 1XEUA 2Q3XA 1SYSB 2WXIA 4S1SH 5DVKA 4J23A 3BRGC 3MV9D 4CGTA 1HINH 3N04A 1MY5A 4F7CB 1WFJA 2R0LH 1RURH 4D7BA 4YMPA 2BWIA 3RB5A 3WS6A 1A4JA 3JVFC 3ZKQD 5T1LA 2F7IA 1P9MA 3MV7D 1LTXA 4LBEA 3LQMA 2WW8A 4P3CL 3ZHLA 4LBAA 4JQXA 4JMNA 2IAND 1S7WB 3OMZA 2IEPA 5C0CE 4CNIA 4Y9GA 1EFXB 2W65B 1TTBA 1MHPL 1TJMA 2NY4C 3FRPA 2Z92A 4G1EB 4Y2NA 4PJ9D 3MRQB 4XVOA 4Y16D 2HPOA 2XTJC 4YDKH 2FEDC 3L2NA 1IC5H 4XPBH 4ES8A 3OQ3B 4R26L 5MEOA 3BX7C 2AABL 5T5FH 5E9NA 3P54A 5IB5B 1M7IB 2ZUSA 5LBSH 1UB5B 5TE7H 1JZJA 2EDFA 3MRRB 4NHCH 2DLFH 4N2HA 3BSZA 4RIRA 1YRKA 3IJHA 3BCFA 4NB7A 1CDIA 4LCWA 5JIIA 4HS3B 4AYBA 5E1QA 3VDBA 5E7BA 4MKMA 1MRCL 5TPWL 2A9NL 2FBOJ 1ECYA 5DMKB 2G2PA 5LGYA 2H3KA 3H9ZA 4OCYL 1WITA 2CDEA 3W9DA 1USQA 2C1PB 3GSOA 4AYFB 4XWGL 2VQUA 1MWAB 2WSPA 3I6LD 4TL4A 3KDPB 4KVCL 4MAYA 4RH4A 4E41B 3P30H 1ACXA 1HHHA 1AAJA 2A4CA 2R59A 1TJIH 5A6LA 3JWOC 1A7OL 2BOLA 3MRKB 4MNQE 5F7WC 1AQDA 1QFWI 2FNBA 5IJVB 2VDLH 1U3HA 2DD8H 1DVQA 3ILQD 4LSQH 1AKPA 4M1DL 3S34L 4YFDB 1CFQA 3QXUA 4G9FA 4FTDA 3X1NA 1Q9KB 4ODTL 3NJKA 3UL4A 3BDXA 4N8CL 5C0DA 4PGZA 2ENYA 1QACA 5DYOA 3G6AB 3LN4A 4OLWL 3ARGA 1WA1X 4PJDA 5KS9E 1E5CA 3VFSA 2Y9RT 2XY2A 2R23B 4JG5A 3EDJA 4EBQL 3LSOB 3B5GA 2OULB 1A6VH 4C56D 2E76C 3J7HA 4XP9H 3ETBJ 3HMWL 3QCTL 5B39B 3W38A 1RIHL 3OB0K 4LCUA 4AYSA 4ZFFA 3I6SA 3B2VH 3L1OH 3LH9A 2VN7A 4GNKB 5GS0D 3SKMA 4KITB 3BT2H 1VKXA 4M6OL 3MRPB 3FJTA 2NXYC 2QVKA 3CBRA 4BKSC 3IAQA 5C0CA 5L4MA 3VG0L 1BA9A 5EBWA 3X13A 1CDUA 5E2VL 3FAWA 4JM2D 1J0IA 1KGCE 2OXHA 5K39A 2HRHA 2MPVA 3GINA 4FMVA 2CK0L 5ELIA 4GRWB 2Z7ZA 4Z5RB 5C70A 4OIIL 1VENA 2FVNA 2R0WL 2YEQA 3UACA 4BKLA 4LEXH 3HG1B 3VXPB 2W60A 1BQKA 3QH3B 3VWKA 4G6ML 3TVMC 4MXVE 4ZDHB 3QIWA 1J5DA 3KL5A 3RVVC 4PBWD 4JFYA 4N85A 3U48A 3IKCA 3QFDB 3TFBA 2ZE0A 1RZJL 3FZUC 1BYOA 1C1EH 3LCYA 1Q9LA 1IM3D 4B27A 1C5CL 3ARBC 2DB8A 3WXVH 1T6BX 5CEZL 1TETL 1KJVB 1NOLA 2IV9A 3PABA 3QEHA 4K94C 1UURA 3KBEA 4A55A 4IBZA 1N6VA 3HR5A 3MKGA 3TC9A 1N0LA 2F1EA 4AW7A 2HN7B 1HCFX 3BUQA 3QUMA 4GRMB 1H15B 2CLVA 5ENWB 4EF3A 3K1DA 3RAJL 2E7LC 5T3XH 3D39B 4NEHB 2VMEA 1KN2H 3VJ6A 4MA7H 2BSTB 1OGTA 2AJUL 5KSAD 3EYFB 3MLSH 4JZNB 3VFUA 5CCKL 5KS9A 4KKBD 5C0BB 1D6EA 4Z7UB 3MXVL 1B0GB 3BAWA 1UD5A 5ALCL 2X2IA 5LQBL 3VMPA 1SYVA 4M4RB 2EDEA 4WWNA 1WTLA 5JW4M 4LGRB 5GZOD 1N7ML 3GSQA 1BXXA 4Q0XL 1NMCC 5EFIA 1SOSA 3BC9A 5IB4B 2LVCA 5EU7E 2B5IB 4XPTH 3U9PH 4Y1SA 1CWVA 4NFBA 1PVHA 4PJ7A 4S0SD 4ZI8A 5FFGA 1FE8L 3ECVA 2WLLB 2ZCLL 3Q9QA 4G7YL 1PPIA 3DARA 1IM9D 1FNAA 1P5VB 2ADGA 1OTUC 1B90A 3DX9B 4K7PL 1GPOL 4OTXL 2GVYA 4PWKA 4Y2DD 5IROA 4AGNA 4AQAB 1G9NH 2P5PA 1AZBA 3NSFA 2ZYIA 2VLME 3KVQA 1K2DB 4P5TC 4L3CB 5TDOA 4X9HA 1PX3A 1HHKA 2X4PA 5K59E 3QIUD 4YLBA 2NTSP 3K1KC 2WIIB 3VXRA 3HPJA 4ODWA 3BGMA 1OKEA 3K8MA 3QIBD 3QXDA 5K9OA 1QWNA 3ZYJA 4R6UA 1OOWA 3FT2B 3QFJD 2XA8H 1JCVA 4JZJC 1OM3H 4ZMWA 1U91B 3T2NL 4GG6E 3CLFL 1U8PA 3DV4B 4GI6A 3IMSA 1KGXA 2X89D 3GBML 2QBWA 1DJYA 1OF2A 2ILLA 3NTCH 2EKSB 4OV6F 3JWOL 1TQBB 3EGDA 5KYWB 1DCEA 3QRGH 5E99H 4F7PA 4LL1A 5L2JB 2HCZX 1FGNL 3D09A 3P02A 2N7AA 4WUUB 4JFTA 5BRZA 4E9SA 1WPCA 2WSKA 3I74A 3TGXA 4JUTA 4MJID 4YGVA 3MXWL 3K4ZA 4YSCA 2YBGA 1GHFL 1I8KA 5GGQH 3IEAA 3HCVB 2DMCA 4AGMA 2PPDA 3W0WD 4FXGC 1MJJA 3F12B 2EYTB 5J6HA 3ZDZB 1M4KA 5IWLC 1QRND 4U6HA 4NHUB 3FCGA 4IKJA 2IAMB 1OM9A 4JFQA 3H2WA 3NIDE 3KAAA 1M56B 5FYKL 4D9QD 4NQVA 4QUOA 4KZ0A 4XXWC 5I82A 1HHIA 4GMSL 2P5EA 3GXTA 1AO7D 1E4WL 4GAAA 1G5AA 2CO1A 5E94B 1VF5C 2X70A 2QVIA 2X87A 4HKBB 1GJUA 1NIDA 3UEQA 3QG6B 4ICXA 1I4FB 1GMIA 4NPKA 5SWZB 3IWVA 2AK1H 2F1AA 2BH0A 1GYUA 5FYJU 5AAWC 5I1KL 3TURA 1IFRA 2GI7A 4FMKA 4JQIA 1PJ9A 4Q9RL 2KDGA 4HUMB 3UZEA 2OSYA 2WWMC 5DJCB 1MW2A 4FXKB 3MV11 3IXTA 3WMPA 3BAKA 4QPEA 1NCBH 4YFEA 3EYQC 5DEGA 3NJHA 1UB6A 3TEYA 1XFPA 4LE8A 3VO0A 2CPCA 1IZKA 1QR1A 1M6UA 1OXYA 2AQ2A 4K5PA 3NCXA 3MODL 1KPUB 2EACA 3CHSA 4UQ2B 5HGDB 5C08D 3KVPA 1DVUA 5L0QC 4UQ3A 1KSRA 3EFOB 1RP8A 2CUAA 1I7TB 2CR3A 4L4JA 3UTSE 4GG6A 3VTAA 5KJ7E 4J6RH 1PNCA 2P80D 3NZ8A 3NK4A 4DN3H 5BXFB 2VMDA 1B3JA 4JM4L 3O45A 3OWEA 4MMYA 4K94L 4PJEF 3FUJA 3T6XA 2PW2A 4FZ8H 4UV7L 5LAXB 4AI7A 5DHMC 4TNEA 3IRPX 4M7KL 4PRPB 1XF5A 5KSVB 2XWTA 3BQUA 3EH1A 2KZ1B 3K72A 3ARDC 5JA9A 3QAQA 5DRWA 2JMRA 3EYVB 4AW4A 4MZIA 2VM4A 1UM6H 3Q05A 2QPFA 2H6PA 1ZS8A 4GQ9L 3WFEH 4TUOB 2I9LA 4JFHD 3FRPG 2BIOA 2YGQA 4ZPVB 2PF6A 1CICD 4AK2A 3FQ4A 2ETWA 1DANT 4I5BA 4M00A 1AYOA 1EX0A 1M7DB 2IIJA 4P8QA 4K55A 4ERSL 4MDIA 4UOW0 4G5ZH 1MXDA 3NACH 1XGYL 4XTRC 3FCTB 1Q9WB 3L48A 1M9SA 3MFFA 4HC1H 1WS7A 4LHUA 4ODVL 3X3FL 2I9TA 3L3OA 1NSNL 2BSRA 1KCBA 2E3VA 2VL5B 2YEVB 1F4AA 3GLAA 3L2LA 3WKMH 5F9JB 2J8UF 1EAJA 4U1JB 4MSWB 5LGKA 3QNYA 1TJXA 2VQ1B 1TQTA 5JO5A 1CF8L 4JANA 5DFVD 5HD8D 2AJVL 5GS0H 4N20A 4KGLA 5DO8A 4PB0L 3RBGA 5FFLA 1OGAE 2OR9L 1NGQL 2VITB 4PRIE 3LS5H 5D7JD 2ZX6A 5B1AB 1A21A 1YNTB 3KPRD 3PREA 2APTA 4PG9B 5CP7A 1PIFA 4XP5L 3GNML 4KK9D 2BSEA 4Y19B 3PGDA 4NQSB 4DK5A 2W80C 3P9LB 1S9VA 5FYJD 4KAQL 4M48L 3QCVH 4XMWA 2NYYC 1UKQA 2CDGB 1CFNB 4WDIA 3EKCA 2EVHA 4MAUL 5E7FA 3OGCA 4RFEA 1P1VA 1MJUL 2WXPA 2OCCB 4N0UE 4ZPTA 2EEFA 1OAQH 3GHBH 3UTSA 2EDWA 1CLCA 1KTJA 1BX2B 5T1KB 4WK2B 4EIGB 1G94A 3II1A 4U1SA 5IQLA 4F57H 2NOYA 1IV8A 4NNYA 3WNJA 3IFOA 5JHDE 1P5UC 3WYRA 5I75B 2VXVH 2ITEA 5F96L 4LSPL 4DEWA 2H9GA 1S7RB 2JKIS 1QKZL 3OAUH 5GHWL 4YHML 5IB3B 1V3KA 1BZDA 3IPBA 3TZVB 4NI6A 3BWZA 3QQXA 4LAQH 1OP4A 3WXWH 3N41B 2X0UA 1E43A 2XPGB 4LSSL 3WJMB 5F6IC 1MUJB 1A2YA 2BO0A 1F2XK 1FFOB 4RAVA 1AZCA 1JNHB 2JCWA 2YA2A 4RMVA 4DAGL 2PO6A 1AY1L 3US9A 3I9GH 5E6UB 2YUWA 2PYFA 2RH0A 3V6ZA 3NCYP 5IFJB 3LB6D 3LMJL 4HAKA 4LRNH 1DJGA 3BPOC 3TBWA 3NFSH 3PRZA 4EI5B 3WUWA 2DQEL 3ARQA 3L17A 4Y5VA 3IMRA 3SDAC 4CSPA 1KMGA 3BWAB 1THAA 2CLZB 4BIKA 1B0WA 1NA8A 1S46A 4XNZB 1WC7A 3ARFB 4WNQA 3VCLB 5CBAA 5PCYA 4TSAL 4Y2OB 1AIFB 4EN3D 1BM7A 4EOWL 4LKCA 3QDMD 4P4KB 4GAJL 1GZPB 2WBJC 1OGAA 4PRIA 4D0DA 2CUHA 1NCJA 2FX9H 1BOGA 3RJDA 3AY4A 4D3CL 1RIUH 1MCKA 2WUBH 1SEQH 2VRAA 4XBPB 1IBBA 2DQCH 2Z7YA 3HI5L 5EN3A 3SKJL 3ZOAA 2R56L 3ARTA 4FA7B 4KRMB 3PDDA 1X4ZA 2ENSA 1HCVA 2X0VA 2HJLA 1HOCA 1GZHA 3MLWH 1LEGB 4UDTA 2NW2A 3UYRH 1E42A 1O9WA 1OANA 3HE7B 3NDYE 3O0LA 4NIKB 1GZQB 1MNUL 2X4SB 5HYSB 4CL7A 3K6OA 3O2VH 5ISZD 3B3IA 2PWFA 1VAHA 1VGKB 5JHDA 3VFVA 1PZ5B 1P7QA 2K7PA 4Z23A 3EJTA 1E9PA 5F1KC 1VIWA 1CTOA 3QNXB 3BFQG 3IDNA 4P49A 4OUUA 4L1LA 2GPZA 5FM5M 3ZQWA 2DBJA 2VLLB 3CX5J 4J2QA 4F80A 1IGJB 3HZVB 3O6FC 1N5YL 1A6TA 3RVUD 4FZEH 1EHAA 3AXLB 3TEWA 4A7GF 3AM8A 5F7KC 1CR9L 1QLRB 1J8HE 2XZQL 4E41E 1EVTC 4EMZA 3C8HA 3TONA 2HT3D 3MBWA 3GSVB 4XVJH 5EU3A 3QBTB 5DJ0A 4ONHA 4GRLC 1H3PH 4XMKL 4O51B 1SVZA 3ABLB 1GJIA 3WLBA 3AWGA 2VISB 1NBQA 1XSOA 4OI9A 3VFMB 4IRSB 1HH6A 3UZVA 3EYSH 2FO4B 1ET5A 4A68A 3GI9H 4WSKA 2EDMA 4Y5XB 1G6RB 2BNRD 2CIIB 4U6YA 1U3JA 5KYUB 1SYSA 2YPKB 5JHAA 2D9QB 1PJWA 3KD4A 4KDTC 1AGBB 4F7CA 1R3IL 1W0VB 3OR7B 4M4PA 5JIPA 2Q7YB 1F58H 1I53A 1NAMH 3G3LA 1UYWH 2WXNA 5EEYA 3LEVH 3QRLA 4ZD3H 5LWYH 5CJOL 2FX7H 5CGYD 1JHLH 3DRTB 1S7WA 3RA7L 5KG9B 4L0ZA 1EFXA 5F9WB 2W65A 4ZOBA 3DSNB 5GGRB 6FABH 1O7VA 2IGTA 3E6HB 3HN3A 4G1EA 1OP3H 3DYMA 1WBZB 1SRDA 3MRQA 2E4TA 2VR9A 1H6FA 1FIGL 3D0VB 1BYNA 3QRFM 5E6RB 4YX2L 5IB5A 2EJ1A 1M7IA 4ZUTB 1UB5A 3MRRA 2IOMA 3UBHA 4HF5L 2GJJA 3GBNH 3GRGA 4HS3A 2XWBB 3FN3A 2P9RA 1SY6L 5DMKA 1RU9L 4JPKL 4LCCA 5BO0D 3V52L 2OZ4L 2EDYA 2A6IB 2C1PA 3CVIL 4I0KA 4K9EC 5A2LH 4AYFA 3CNKA 5BOJA 4J3BA 5EOQH 1UWXK 4J3OC 4XMLH 5KUKA 5FGSA 3V10A 4E41A 1TZHB 2F5BL 4HUNB 4M1GL 4HLEA 1YEKL 1MCPL 2YKKA 4ZRGA 4A7SA 4F37K 1R33A 1SLVA 3MRKA 3O4LB 4LSVL 5IJVA 5DJAB 2ZYSA 4Z7VE 1IAIL 2RCSH 4HMCA 4WF7A 4PFEA 3IJYB 1DVFB 3X14B 4ZMTA 1Q9KA 1SNRA 5LJYH 2KERA 3N1FC 3UG4A 4AKQA 2NY0D 4G72B 1KYOJ 5D1XB 5D7LD 2OSWA 2MPAH 3G6AA 1O7DE 3TNNB 3SYAA 5HJ3B 4H2AA 4UMGA 2BVQB 2OMXB 4X8XA 2VXTH 2R23A 4UAOB 5C0BE 3ZTNL 1JHKL 5T5NG 3VYNA 3RZCD 3LSOA 2VR7A 1D5BB 1B2YA 5B39A 3NIFB 4PUBL 3QQ3B 4TUKH 1Y07A 4QXGL 4A39A 5C0GA 3GF8A 3MJGX 4CILA 3X1GA 1SOXA 2QZQA 3MRPA 1QR4A 1EO8L 4YSQA 4WO4C 5SWQB 3BESR 4URTB 3MCG1 1JF5A 1S9WB 1OL0A 1R24B 3LS4L 4R8WL 3VI4B 3T3PB 2B4CC 2BNQB 2NCEA 3KR3H 3BUYB 4AK1A 5JZ7D 4J8RB 3BZ4B 3OPUA 5EBLB 4K5NA 2YUZA 1JGLL 3JUZA 2E7MA 3TN0D 2VDPH 5GRJL 1FH5H 1JN6B 2Y2TA 4S0HA 4Z5RA 2A0LD 4EJ1C 4WI7A 1IFHH 2VSDA 3BE1L 1HWWA 4YHKH 3ESMA 3NQKA 2OX5B 3HG1A 3OX8B 1F0LA 1KTRL 2AJXH 4NUGH 3VXPA 3QH3A 4ZDHA 3GRWH 3U36B 4GAYB 1GOGA 3RE0A 3U1SH 5M7QA 4ZXBB 1GIGH 3QFDA 4LHUG 4RGOH 2XPYA 2R51A 4U7SA 1MRDH 1I75A 2J4WL 2X3CA 4PBDA 1VHPA 1F4XH 2AV7B 4PJXF 1XCQB 1G0YR 3T2LA 1KJVA 1MW1A 3MU3A 3VXOB 4L4TD 3LPFA 2JJTA 3FCUB 3GMPB 3R0NA 2GEQA 1KELH 2G2NA 3CN2A 3WN5B 3SGDI 3BP7B 2HN7A 3WAKA 3HC0B 4MMXA 4GRMA 4Y1TA 1H15A 3ULVC 5ENWA 2X2YA 1J86A 4WUUE 2WLZA 2EVGA 4ZNCD 3D39A 5IP4A 4JFXB 3HNVH 5CWSB 5JR1L 3DMMB 1CFVL 2BSTA 1FYTE 5E2JA 3EYFA 4JZNA 3FC8A 3ZDZE 4OIFA 4U1IB 5C0BA 2QHLA 4Z7UA 3SGKA 1B0GA 1A4AA 4U3CA 3EFDL 4M3KB 2P8PB 5I1HL 4M4RA 4B9ZA 4QRPD 5E5LA 4TSCL 3NCYS 2GK2A 1O7SA 4ZTEA 4LU5H 5IB4A 2OK0H 2HRGA 2WYTA 5BV7B 1AQ8A 3F3HA 2C3XA 2H45A 5EA0H 3TA3D 25C8L 4BQ8A 2PETA 1A9EB 4FQQB 4NC1E 5SWZE 2WLLA 4ALAC 1KBVA 2Y36L 4M02A 5T3ZL 2XV0A 5E23A 5I8EB 1P5VA 2DEWX 3CFJB 2C9UA 1E90A 3EUUA 3F7YB 2Y2YA 3D1MC 3DX9A 1I8MA 4AQAA 1E9QB 4LDOB 3H8NA 5L7XL 3POCA 2J44A 3L5XL 4D0BB 5C0EB 3BUBA 1BVKB 1FP5A 1K2DA 4L0YA 3CBJB 2AQQA 4L3CA 1MCBA 5LNDA 2AS5M 3WD5L 3B6SB 3QUHA 4RMSA 3CIAA 5LLIC 3DURB 5C0IB 2WIIA 4H0LC 3U83A 2ICWB 5KYXB 3SGEI 3W2DH 5IK3B 4K9EL 3FT2A 4LP8A 4MA1B 1U91A 3WUWG 2B15A 5MHSE 3SPVB 3DV4A 3N9GH 3ZXAC 3PL6B 2EUVA 1W8NA 1YYMH 1TVBB 5JDSB 2YWYA 2CBPA 3QPQC 2EKSA 4KK8D 4PM1A 4ZBJA 5GXBB 4PSRA 3IN0A 5KYWA 1FZJB 3TNMB 4YR6B 4PRPE 3NRQA 4NRXB 3V2AR 5HVWA 2EE3A 5L2JA 5D2NB 2H3XC 4BK8A 4J8QA 4GUQA 4WUUA 5D6DC 1EBPA 3DPDA 2GSIB 2J71A 3RNKB 4P2OB 4JK0D 2TRYA 2X6UA 5KVFE 4X50A 3HCVA 2D3VA 3LDBC 3WJLA 3F12A 2EYTA 5K9JL 3I75B 2Y6SD 4OGXL 1CU4H 3MUHL 4LCWD 1KYOK 4NHUA 1NJ9B 2IAMA 4AL8C 3L3HB 3VGBA 1EDQA 4KY1H 5I1GH 4DQOH 1K4CB 1A14H 5I1DB 3DUSB 2YD3A 3WEMA 5I1CH 4I87A 1RIVH 5E94A 4HIEB 5IMKB 1JNLH 4S11A 3PQYB 4N0YH 3SODB 4HKBA 3QG6A 2ZP8A 4L9LB 4KKLC 4D94A 1I4FA 2FIRT 5SWZA 4D9LH 4BFFA 2B4CL 3QUKB 4D9RD 4ZW5A 2C3VB 4K2UL 5C86A 5KAQF 4UINH 3VW3L 1AS7A 4FXKA 4JCWA 4G9FD 1PLAA 1T21B 5DYFA 5L8KB 3QWRA 4L1SA 4CA4A 1E9OB 1IGIL 1KPUA 1WD8A 5HGDA 4UQ2A 5AOJA 4H0HB 2PPEA 3ARGD 3DO4A 4A2LA 5KVEE 2BSCA 4HWBH 1ACCA 1EERB 3R7QA 3VQLA 1B2WH 2ROYA 1I7TA 5CP3H 3T6WA 2LTQC 3CWGA 1TPXC 3E1ZA 1CGSH 2GITB 5BXFA 4W4OC 3IFLH 1QMUA 3B7TA 3LKRB 3SE6A 1DQML 1ZGLP 3CZSA 2DY2A 4XP6H 3ILDA 5LAXA 3G7TA 1AE6L 4PRPA 5KSVA 3BCDA 3S3BB 5E1HB 3ULVL 5DD6B 1AS6A 3B7UX 2NCMA 4U6TA 1ACYL 1GSKA 4FL4B 3EYVA 4JDTH 1Z9SB 5GGTA 2G30A 1T2QL 2YZ8A 1A6WL 4NWTL 4IBVA 4I77L 2APFA 4TUOA 4X7DC 4DGYL 5FW6A 3G5VB 4ZPVA 3HI6L 4F91B 2V5MA 2NY5H 1N10A 4TKWA 4AH2B 1PY9A 2DQGL 4L5FE 1M7DA 3DJSA 2QZ5A 1F1DA 1MIEL 3QIWD 1UATA 2O5XH 2Z4TA 1DFXA 1BXUA 1L9PA 3QQNA 3HS9A 3FCTA 1Q9WA 2ZXCA 4AIOA 4WFFE 4BKTC 1QPKA 1A5FH 1YSOA 2VGLM 1LQBC 3BVNB 5I23A 2VL5A 2XN9B 4B9JA 4GSUA 2NUTB 3NA9H 5F9JA 4U1JA 4GW1A 4MSWA 3N42B 4YSOA 4DO4A 2VQ1A 4ALAL 4OIBA 1G5GA 1IBGL 2EC9T 2V5YA 2C9XA 4WAFA 1E3FA 4NZRL 4WFHD 3QPXL 5FO8B 5F8RC 4MRBA 1SMOA 3H53A 5FUZH 2R8SL 1MCEA 2NXZD 1E7VA 2VITA 3GS7A 1PD0A 3PS6A 4P2YA 1RUKL 1L3WA 1YNTA 2OYMA 3S36X 4HCGA 1B4JL 1BBDH 1U8OB 4Y19A 4U2YA 4NQSA 2EIKB 1AP2B 3P9LA 4I3RL 2VH5L 4PJAF 4A6YA 1E4XH 1LE5B 5IB2B 2CDGA 1BQUA 2Y25A 1CFNA 3EBIA 4WWID 5D96C 1ET8A 1ZHLB 2GI0A 4Z7IA 2CXKA 1WGVA 4X98A 5DTFB 4KK5C 3RU8L 1ZVHA 1RZGB 5CXPA 5F7LB 3OKOB 4UOW1 3LZLA 1BZEA 1BX2A 5T1KA 3T0EE 2Z65C 1FWXA 3SN6N 3D48R 4ZAKC 5K5YA 1SMAA 3B43A 4XPAH 1QP1A 3WEAA 2VDNL 2WLIB 1FZMB 3HVNA 5B39G 2D7OA 4X7EC 3D25B 4ENEC 1S7RA 3NSYA 4N4YB 3RTLA 2NDGA 2Z9TA 3FB8B 5IB3A 1AZVA 4F37F 3TZVA 2BIQA 2F58H 1E6OL 5IFHH 3LZRA 3SOTA 4FFVD 4GIOA 5IROD 5DURD 1A1OB 3ESNA 5HHMD 2XPGA 4NKOB 3LQAC 3WJMA 1X5LA 4IHBA 2WJ7A 3I3EA 1MUJA 1N68A 3CHQA 1FFOA 4NP9A 4YPGB 1F42A 5DGQA 1JNHA 4AL8L 1NFAA 4PJ8B 2V37A 4NKIH 4OLYH 3HMXA 3ZE2F 2GUYA 3VXRD 5IFJA 2QQKL 4MLSA 1KFGA 4HGWB 3AREB 2JCCB 4EI5A 4NOBA 1Q94B 4A7TA 2WQWA 2EICA 2F8VA 3DXAB 3BWAA 2CLZA 4JMXA 4PCYA 5A7EA 1PTZA 3ARFA 4V11A 5T1DL 1S5IH 2ZUQB 3VCLA 5D2LE 3IDYC 4Y2OA 1AIFA 2H0FA 3ZL4L 5A3IC 5FUOL 3STLB 5BMFH 4K5MA 4P4KA 1OARH 2WQ8A 1GZPA 5DU7A 5BRZD 5HDQL 2L4OA 3BD3A 4MNGE 4XN7A 3D51A 3KBPA 3NSCA 2GCYB 2OM5A 1SXCA 1GC1C 4FAAB 5KTEH 1JPSH 5D72H 4JDEB 3JWDC 5AL0A 2DW5A 3DHJA 4F93B 1KB9K 3Q8CA 3C5ZC 5CAYB 2OKMA 5KJRH 4XBPA 3CZNA 1A02N 1OALA 5EOCH 1JWSA 5ACLA 3KL0A 4LLVB 2IDCA 4OZ4B 1QSFD 2K4AA 4ZFGH 3SGJC 4HOWA 2F7RA 2KZWA 2ZJSL 1LEGA 4KY2A 4PY7B 1GZQA 2X4SA 2P5ED 5HYSA 1NUGA 4OZHB 2I07B 4R83A 3RKDC 2DQHH 2Q7AA 1SXBA 1VGKA 3MLVH 1PZ5A 5ADPH 5HHVL 5GISH 4HCFA 1X5MA 1IC0A 4I9WD 3MOBL 1JL8A 3QNXA 4W1TA 3AQDA 4M8VA 3US0A 3CMOL 2OMTB 4OD3H 3UADA 2VLLA 4QJ5B 1QZNA 2TAAA 2BOBB 1IGJA 3HZVA 1UOWA 4NO2B 2NY3B 4BELD 4IMKA 2DIEA 3D4GA 2ZZUT 3AXLA 4AEFA 1IIKA 1BMWA 4TV3A 1QLRA 1BVNT 4HCRA 1BZOA 2BWDA 3GSVA 4FQ2H 3TTYA 1XT5A 3X11B 3DSFL 4O51A 2VZSA 2VISA 4QD2E 1NL0H 3VFMA 1Z3GL 4IRSA 3BSZH 4XB8A 3BWUF 2FO4A 4U6VL 3W56A 2IPKB 4Y5XA 4G11A 1G6RA 1DO6A 1C5BL 2CIIA 1JPFB 4BZYA 1LLAA 1TTCA 4QHMB 5KYUA 3I2CL 2YPKA 5ILTL 2W07B 2RFXB 4RWYL 1AGBA 2TRHA 3T08A 1W0VA 3OR7A 1OAYL 5C2BL 3BQUD 1QYGL 2Q7YA 3Q1SH 4J3OF 5DK0B 3NIFE 4O9HH 4X4ME 5AW2B 2XG5B 4QHPA 3RILA 4Z76B 3WTXA 1S7XB 3O0RH 5JW4R 3GT6A 3SY0B 2Y7QB 1KEGH 1UM4L 4E9QA 1NBVH 3FTVA 3GO1H 3DRTA 4IGBC 3TT1L 4F1ZA 3ZT6A 1MCOL 1BD2D 5JIKA 5KG9A 1I8LC 2APBA 5GGRA 1TZAA 3DSNA 5LB1A 3GKWL 3E6HA 4I89A 4NNXB 5E6YA 3VI4E 1CTNA 1WBZA 2LAGB 3T3PE 2BNQE 3FOMA 3V9EA 3WFBL 5EUOF 4YZWA 3D0VA 2WCPA 4U31A 4YNYB 4JGNA 5AW7B 5F7YC 4DP5X 4ZUTA 1IBYA 1TXKA 4MQXD 3SO5A 3UJJH 2ZKYA 3NH7L 4R4NC 3VGAC 2Y72A 4PRHE 3RWFB 3X1BA 2H1PL 1GYAA 4PG2A 3HLKA 1LO0L 4XOAA 1F4WH 2HVKB 3KJ6L 4FP8L 3V9CA 5AYUH 2XWBA 1ASOA 1A7PL 5EF2A 4PW9A 2YSSA 4OLEA 1KBGL 1X6LA 3SE4C 2J6WA 3DV6B 2VW4A 4DKFL 2AJYL 1U8LB 2A6IA 1GAFH 3BKCH 3QB7C 1RK0B 3N50A 2FO1A 3WY4A 4E5XB 1YQVH 3RYMA 2I7SA 3EAKA 4W9EC 3LQAL 2DWYA 3ZKMD 4XOCA 2V2XA 1TZHA 2DQMA 2MCPL 1WGOA 4CN4A 1FAKT 1I85A 5FA3B 1JPGB 2BSED 4JG0L 3UX9B 3D08A 1A66A 3O4LA 1W8OA 2P48B 5DJAA 1PZ3A 1CXIA 2Q76B 3QDGB 1DBML 8PAZA 3AXHA 1DVFA 2CR6A 3H1ZA 3IJYA 3X14A 1MDAA 1IAII 4H0IA 4EVNB 5D1XA 3ZYZA 3C2AH 4KX9A 2YRPA 1P2CB 4QTHB 5BUGA 3TNNA 3S2CA 5HJ3A 1TJGL 1OF0A 1VPOH 2BVQA 2OMXA 3QHTC 1HIMH 1MJ8H 1BF8A 4YJZL 3H3KA 2F08A 1KN4H 3ZPDA 1D5BA 4BSJA 3QQ3A 5E8NB 1M53A 1HYSD 4PCTA 1FO0L 1X4YA 2CA4A 4U1GC 1BJ1H 5D4HA 2GYSA 5ITFB 1QO3B 1GC1L 4TM9A 2WTPA 4J3WA 3JWDL 4KROC 4O00A 1MPAH 2QSTA 4S1SL 2FT7A 3B56A 5SWQA 4WUKH 1HINL 4YEEA 3QUMH 3ZZ1A 2KYIA 2P1YA 4YBQC 1S9WA 1R24A 3SDYH 3VI4A 2R0LL 3O6KH 3ZHFA 1RURL 2BNQA 4KJWC 1A65A 3BUYA 3D34A 4OKVB 4J8RA 3BVUA 3BZ4A 1PFCA 4Q7DA 2PO6D 5EBLA 3S9DB 4PU2A 3ZUCA 3RKPA 4ZMYA 1JN6A 3WE1A 3H9SE 3GPSA 4OM1H 2OLDA 1BQHB 2O72A 4FHKA 3SDDC 4J7RA 2OX5A 3OX8A 4YDKL 3U36A 1E4HA 4GAYA 4XPBL 4WTQA 4ZO9A 4ZXBA 5T5FL 3HB3B 3RVWC 4HIHB 4L37B 4ZUVB 2DPKA 5FGCB 5LBSL 1EQWA 5TE7L 4Y4HB 1KACB 1G84A 4F9PC 2AV7A 4PJFF 5KVGE 1XCQA 3W1ZA 1U92B 3KYMB 3VXOA 1RZQA 1VFUA 3O9WD 3GMPA 3PHAA 12E8H 4F20A 3WN5A 4GAFB 1JD9A 4G8GB 3BP7A 3HC0A 1S2EA 4W9GC 5D2NE 4FQIH 4UQEA 5CLTA 1T66D 4WTZA 1RQ5A 2HYMA 4PSPA 2VR6A 3S3PA 4WV1C 4HWUA 1HI6B 2K9UA 2ZKXA 2V9TA 3P30L 4JFXA 4C59B 2OJ1A 5CWSA 4CJ0A 1KB5B 4DK3A 3DMMA 3RVTC 1U9KA 2VKXA 2OR7A 1TJIL 3MX0B 4X7TB 5HHPB 3LX9A 1HQRB 5TQ0H 4NN5B 4RNRB 3K80A 3HHSB 5JHLA 4LOUD 2DD8L 4U1IA 4OV5B 4LSQL 1P7QD 2XX1A 4XPGH 5BZDB 3EDDA 3UCRA 2P8PA 3ULUF 3FMGH 5F88B 3HIZA 5I0XA 2L3BA 4C47A 2C7FA 4NZ8A 4KXZI 2ZG2A 1G1YA 5IW6B 4ZK8A 2J1YA 2XWCA 2G0KA 3CBKB 2J7LA 2APWA 3PQYE 3WSQH 3CSGA 4KKCD 1A9EA 2ERJC 4FQQA 1CXFA 1A6VL 4XP9L 4HS6B 2UVEA 5I8EA 3CFJA 1JXKA 1I1CA 2UY7B 3F7YA 1T2XA 1ZTXE 2WBKA 3KPTA 4XMVA 3T6VA 1E9QA 4MQSB 1QTPA 1MQKH 2XRAH 3PU7A 1X5ZA 3WO3B 3BT2L 4A7UA 4HV8B 1ZE3H 2OJZH 4D0BA 5C0EA 1BVKA 3RDTB 1BW8A 3ZE0F 1HSAB 1H0DB 3B6SA 2Y1AA 1V8HA 4PWGA 5DHXB 3NIGE 3DURA 5C0IA 2J55A 5DSCB 5J9PB 2FYYB 2ICWA 3EJPA 3NSDA 3TBBA 5KYXA 5IK3A 1INDH 1KBKA 5IFAL 1NANI 2J12B 2EXYD 3V4VH 3SPVA 1KV7A 4RMWA 2XVGA 3HAEB 2AK4B 1M42A 2K6WA 3PL6A 4JKKA 4LEXL 4PJ9C 4TUUA 1TVBA 2ZXGA 5JDSA 1M7UA 5FR3A 1VGEH 4W81A 1FZJA 3TNMA 5IIEB 4YR6A 4JQIH 1HCZA 4ILDA 1EFXD 4NRXA 5F3HB 1C1EL 3HG4A 2UZIL 4OQTH 1W72B 3K5SA 5D2NA 4RGNB 4DFHA 5A2KH 3QZOA 3WXVL 3DUHA 1MHCB 2GSIA 3ISWA 3SDXF 3RNKA 4P2OA 1TNNA 1KFAH 4ABQA 4GQRA 3BAEH 3OPZH 4UIKH 3D3VB 3I75A 2BFVH 3L4TA 4KU1A 3SDCB 1NJ9A 4Z3TA 3L3HA 4UQ9A 5T3XL 1F02I 4YZFE 5HYEA 4XP4H 3LZPA 4FULA 4HUUA 1AZUA 1UG9A 1K4CA 1UT2A 2YPVA 4H5SB 3DUSA 4JFVA 4GKZB 4MA7L 3ERXA 5FYLD 5I1DA 2XN9E 1XGZA 4HIEA 4KVPA 3MLSL 5IMKA 3PQYA 3ILQC 1QFWH 1IGYB 2X05A 4L9LA 3ATDA 2P8LB 2OXGB 4FG4A 3QUKA 1QW8A 1NEZG 2VXQH 2C3VA 1T7XA 4P06A 4P2CG 5MENB 4NQCE 3WTWA 4ZFQA 3O3BB 4XPTL 4J3TA 1F3DH 3U9PL 4G7SB 1T21A 3TJPA 4KI5D 1JZEA 1TVHB 2VXUH 5C0AE 2VWEC 1AQMA 1RVFH 4X6DF 3D06A 4R2GD 1E9OA 2QL1A 4K5LA 1FORL 5DZPA 3BPLB 3FYEB 3A47A 4IBYA 4M8RA 3A22A 3EHBD 4ICWA 5GS0C 2QPDB 2SEBB 1TEGA 3WTTA 2EDXA 1JXDA 2P4AB 3FT1A 1DP0A 4R9HA 5GS2D 3T4AB 1XTLA 3UC2A 1IILE 2AQPA 2IH9A 2GITA 4Z78B 3LKRA 4BSVB 1MCLA 4JM2C 5DJZB 3ZHDA 3RPIA 4JNXA 3Q2WA 4JY4B 1E5AA 3SCMB 4FLSA 3L3JB 4OJYA 4YC2B 5FFOA 3QFGA 1A4BA 3UEZA 4PH8A 2A74B 1PLGH 1OM3L 4P57B 3T09A 5DD6A 3NDZE 3CHRA 2AXFB 2B9BA 1JTOA 2I5YH 1HXMB 1Z9SA 2XBZA 5E1AB 1ITCA 4CRPA 2IWKA 5CZRA 3NTCL 2AP2A 3BH4A 5EWIH 1AH1A 1IMHC 5JXED 3MBED 3DRQB 3G5VA 3QRGL 4LPVA 3T77B 5E99L 1JD7A 3VGDA 1L9SA 2JJSC 3HG1D 4AH2A 1DQTA 2DZEA 2XV2A 3CGTA 4HPYL 5DS8B 4DP1X 4PI0A 2YRZA 2WZ6A 3QWQB 2QPUA 5GGQL 2C3HA 3T9WA 3BVNA 4YWGH 3B7RL 3LPWA 5BS0D 2JCCE 2XN9A 2ZOUA 3SBWC 2XQYA 5MP6H 5L88H 5CJQH 2NUTA 3DXAE 4L1DA 3W5MA 1T80A 4PJEB 3VB8A 4DIXA 5DD5L 2PUQT 5DUPL 3EXJA 3RL2B 5D1QB 5CJ5A 5FO8A 3ARUA 2BWQA 1FL6B 2PYEE 3Q3GB 5KSAC 4OZGE 1JGUL 1J5IA 1TFPA 4KKBC 5DZOA 5H8DA 4DKEH 1P53A 1LDPH 5DO2D 5AUMB 2IBZY 3DJZA 3D39D 3FO0H 2NQ3A 2PTTA 2YMOA 1U8OA 2AK1L 1AP2A 2BDNH 1G9EA 4QEGA 3VQMA 4ZFZB 1LE5A 3FU8A 1MAJA 3TYGH 5IB2A 2QEJA 1N9PA 1CDHA 5LO7A 1ZHLA 1NCBL 4W9ZA 4B41A 5DTFA 1XBDA 2ITFA 1HNFA 1RZGA 2BY0A 4WEMB 4QAMB 4F8TA 3F2LA 2JJUA 4Q56A 1DCLA 3Q2LA 1J18A 1N5AB 4GB9A 4Y2DC 2IQAB 2WLIA 1FZMA 2J8UB 2VDKL 3D25A 4XWOD 4F2FA 1BSIA 3FB8A 2DQIH 4D8OA 1I3VA 4MJ5B 1EMTH 4OF5A 4J6RL 3UP6A 5I71B 4DN3L 2JKJA 3VRJB 4RGMC 5EZJB 4JFFB 3QIUC 1BFSA 4ORGB 3QS3A 1A1OA 4FZ8L 1JAEA 4NKOA 2W94A 3QI9B 3QIBC 5INDB 2Q8AH 1EJ6A 1DBAL 1B6UA 5E2UH 3APNA 3BZEB 4YPGA 2DKSA 2WQVA 1U4FA 3C5JB 4NI3A 4PJ8A 3HA0A 1UM6L 3G6JF 3QNFA 4XO3A 4HGWA 2GY7B 3WFEL 4JFDE 3AREA 1R75A 4YK4C 4KTDH 3P0VH 4G6JH 1KGWA 1QEWB 2JCCA 3FQWB 4U1MB 4ZQKB 1Q94A 3OF6A 4WSGA 1V05A 5F1SA 2EDKA 3DXAA 3L5JA 1FG2A 1VEOA 5TH2B 3V6OC 2Z31D 4HSCX 2CO6B 1DLFL 4M6MH 3GZPA 5FUCE 5LGHH 4G5ZL 1E4KA 3NACL 5FO2A 5A2CA 4HXBH 2QADD 5F7EL 3B2UD 1KJ3H 4HC1L 5GQBA 2BRRH 3BPCB 4EE2A 3UTTB 3STLA 3KM1A 3R4RA 1MIML 3FULA 1E27B 4M8QB 3LEYL 3WKML 3B5HA 3LPPA 3MAWA 2DI9A 1SM3H 4JDEA 1FRGH 2WLJA 4UTCA 1UT1A 1BMGA 3OJ2C 4ZSOB 4TOYL 1NDTA 1WT5C 3QYNA 5GS0L 4DETA 1DQDL 3C6EA 2ISDA 4LLVA 1ZEAL 2F19H 4OZ4A 4R3SA 4FYSA 4M61B 3V4PH 5EF1A 1BVLB 2IAMD 4OJEH 2ED6A 2Z1KA 3LS5L 4PY7A 4QXUH 1OPGH 4OZHA 2I07A 3VVVA 3LNFA 3TEUA 3RGVB 3N40P 3B2MA 4L3EE 1QBLH 3QCVL 3PPSA 3SQRA 4J5VA 2Q86B 4QRTB 5SWZD 3OLGA 2KS0A 3RIFF 3GHBL 1OAQL 3U2JA 2OMTA 3B2DC 4OD2B 5ES4B 1U8NB 4NO2A 3HHRB 1DSYA 1EBAA 4MXWH 3C6LD 2VXVL 1FGVH 2QSQA 4DZ8B 3B7SA 3QWRD 2MCMA 1JZ2A 4Y5YB 1RK7A 4A38A 5D93B 2JI3A 3OAUL 2YKLH 2ZCHH 5HBBA 1HNGA 3FK3A 3X11A 2AQSA 4BZ1H 4TVUA 5AB0A 1QI5A 2Q2LA 4GP8B 2DTSA 1YG9A 2Z4QA 3LNIA 1IX2A 3QDGE 4LAQL 3WXWL 2XXCB 5F71A 2O6DA 1F4HA 1MVYA 2GTWB 2OMZB 3PWPB 2KZBA 3TT3H 5F9OL 1UEYA 1JPFA 4C54A 4QHMA 4JRYB 3MOAH 4AQEB 1GGCL 3G5XB 3I9GL 4X4XB 1BIIB 2HB0A 2RFXA 3PUCA 5FYLH 3SEPA 3WIHA 3LYRA 5ERWB 2OCJA 4LRNL 1MWAH 5DK0A 5E1GA 4A67A 4Z76A 1CICC 2XG5A 3NFSL 4AMWA 1CYWA 1S7XA 4C57C 3JZ7A 1OSZB 1DBJH 3R8QA 3BKYH 3SY0A 2Y7QA 3PJSB 1FDLH 1LO4H 1FCCA 3H56A 2NY4B 4H13C 1QWHA 35C8H 4B5EA 1AGEA 3QK0A 4NNXA 1N67A 1DJZA 4ADIA 2NZIA 3S4SB 2XWJB 3Q8AA 4YNYA 2N7SA 1L0QA 5K59F 5J3HC 4XMPH 2FX9L 3S98A 5C07D 4DTGH 3UC0H 3RWFA 5DFVC 1IGTB 3FQTB 3ZJAA 4OQ1A 5HD8C 1RIUL 2HVKA 1QW9A 2WUBL 3FL7A 1SEQL 5AB1A 5JTWA 2DQCL 1OGPA 3FO2B 4UCFA 4XMXA 5GS2H 3IDXH 2G2RB 5D7JC 4WJ5B 2HTKD 3UYRL 3MLWL 3PWUB 3DV6A 1LILA 4ELMF 4X8JB 1U8LA 2QKSA 3EOBB 2XSKA 5FGCE 5HI4D 1NCTA 2COQA 1A7QH 1RK0A 1JMZA 1T7YA 4N8VG 4E9RA 5BOPA 3GDCA 3IE4A 3O2VL 4E5XA 1BEYL 1UM5L 3RPKA 1CG9B 1EHKB 3ATEA 1C08B 3LH2L 1WP6A 5FA3A 4B9PA 1JPGA 4NOFA 4Y19D 5FWQA 3TF4A 3G9VA 4G8GE 3GTNA 1CLOH 1KGYE 1SJHB 2OMVB 3RBSA 2Q76A 3QDGA 3AW5A 2FJFB 3MNDA 4GRWH 4U0RB 4WFEE 1X5YA 2X4UB 1TO5A 1XDTT 4NN7C 2NR6C 3NIDF 4OM0L 2GQHA 3UPCA 4EVNA 4JL1A 2OYKA 2IC2A 2HWZH 1RSFA 2MH4A 4K71C 1P2CA 4LDCA 4O4YH 3HS8A 2ZNXA 4QTHA 5C6TH 4XVJL 5JQHC 2HFEA 5HYJD 1H3PL 3HS0B 3RY4A 3II2A 1QPXA 4FDWA 3QUZB 3IJ8A 4JRXB 4WWKD 1RL1A 1OP3K 3UBXI 5HJBA 3N44F 2R15A 5E8NA 3E1F1 1G7PB 3GI9L 1OV8A 1N8ZB 5EEUA 5ITFA 2OTUB 1GTNA 3HI1B 3FBQA 4LSUH 3NJXA 3CH1B 3KGRA 2VR5A 1Q0YH 3GMMB 2H2SD 4NCC1 2TSAA 3LB6C 2CKBH 4I2XE 2EKJA 4J1UB 1NFKA 4AGLA 3C5SA 2OFQA 3WLWD 1F58L 4BFRA 4OKVA 1KENH 1V54B 1EO5A 1NAML 2DMKA 3QAZB 1UYWL 4IBLT 3LEVL 4ZD3L 5LWYL 3EBHA 2FX7L 5F1OB 1JHLL 3E80A 2YXFA 4JGUA 4TUJB 5EZOH 3P11L 2OR8A 4FTVB 1BQHA 2AERT 3CVHB 4EN3C 6FABL 4BWTA 4EI5D 1BAFH 1AJ7H 4U6XB 2XXMB 3UAEA 1U42A 3NSXA 1QRKA 5DHYB 3RDJA 3ARFD 4FJ6A 4HIHA 4L37A 2A6JB 4DFIA 4PB9H 4PMEA 1TFHA 3GSRB 3KNBB 3R19A 4Y4HA 3MHZA 1NEPA 4FQXB 2VNCA 3CMGA 4UOQA 2XQYG 3K6IA 1U92A 1TZGH 3GBNL 3KYMA 2AK4E 4KX8A 2E74C 4W93A 1MI5B 4GEIA 2FECI 4QXTB 1J9TA 1PDKB 4WHTB 3R8BB 5F9AC 4YEFA 2XI9A 3S3CB 4G8GA 3AWEA 4AC2A 3LRMA 1TG8A 5C2UB 4RGNE 3RFZB 1WZAA 3MGOB 3APMA 4XMLL 3G5YB 1HI6A 1ZANH 4BFOA 4JFED 3B9KD 1HEZB 1KB5A 3TFKC 4QHUB 5E8DH 3HE7D 3MX0A 5KBKA 5HHPA 4X7TA 5AYTA 1HQRA 4LLWB 5C0ND 3EO9L 2W0KA 4RNRA 2MTPA 2D4DA 3EDFA 4F9LA 1QBMH 5I9QC 4HP5A 4OV5A 3BZFB 5BZDA 1DANU 3RVUC 4NC0B 2Z7WA 2RCSL 5H2BB 3UP1A 1K8DB 1MFEH 3H42H 4IJ3C 2R69H 1NMCB 4W70A 1Z0MA 2VDRB 2HT3C 2C7UB 5F88A 4Q9QH 3K91A 2MPAL 2NPLX 1GCYA 3UTQB 2ORBH 4WI4A 4M1CD 4PJXB 1IL1B 4ENZA 5IW6A 3GKZA 4HJIA 4L8CB 1XZ0B 4HH8A 2VXTL 3FU3A 1EEZB 3JV5A 4X9YA 3RX5A 2KLTA 7TAAA 4HS6A 2MQ0A 2CKNA 4TUKL 5F0PB 3ILPB 4KVNH 1JZ6A 1IE5A 1L7IH 2UY7A 2WKOF 5AQ0A 4NQQA 4OJDH 5FYKD 5EHFA 4F7MB 1U58B 3OHMB 4HV8A 4JG1H 5HVHC 1BM3H 4IBTA 5M94B 4J2XA 2AKRB 3RDTA 1FVEB 3FQUB 1HSAA 1H0DA 2DWSA 2VKWA 4JHUA 1HL5A 3KR3L 4JKPH 1N18A 5LNGA 3T65B 5DSCA 3AROA 1XD0A 4XXCC 5J9PA 3WL9B 2FYYA 5CGYC 2VUKA 1H5BC 1NC2B 2A77H 4OI7A 1FH5L 4N2LA 5FYJL 1ZHBB 3TA4D 4NJAH 4YPJA 1KTBA 1EXHA 4YHKL 3HAEA 2AK4A 1C5DB 2F0CA 1JYVA 2QPSA 1I9JH 5GZNC 2E27H 1MHPH 3GRWL 4TL5A 1AR1B 2J6EA 1L9RA 4CKVX 2GC7C 1JZDC 1GIGL 2W5PA 4OLZH 5DVNA 4WU7B 5IIEA 1NC4D 2ZOKB 4RGOL 2YBRB 5F3HA 1YZZA 1W72A 1FNSH 2XBTA 4MBRA 1F4XL 3FSAA 2DLTA 3RY6C 2NLJB 1M7XA 3WNKA 1MHCA 3ARBD 3LKPB 1AZNA 4TVPE 1ND0B 2VYRE 1IIIA 4M3JA 1KELL 4V33A 3WY2A 1YECH 2J72A 1FLTX 1U8QB 3RTQB 3SDCA 7PCYA 5TDNB 1KWGA 3T6QC 2GJZB 3P77B 4AYID 4PLNC 3EF4A 3FUHA 2DS4A 3HNVL 4H5SA 4X9GA 4GKZA 1ID5I 3IDUA 4ZO8A 4U33A 2DQTH 1BFVH 1EK3A 2OL3L 2MIZA 1CI3M 3RWDB 4UYPA 1IGYA 1OP9A 4EZJA 4DP7X 2NY5C 3F62A 2K8MA 1RZFH 2KDYA 2P8LA 2OXGA 1INQB 3WIIH 4ZX6A 4LRIA 2EVIA 3G9AB 2NY0C 1NBZB 3PAZA 5D1QE 3O4LD 1MG3C 2FE0A 4LU5L 5GGTH 5MENA 2OK0L 4MCZB 1HL9A 1RKRA 2FGZA 1J0YA 1KCLA 3JWNE 3O3BA 5CZXD 5I6LA 5B4MD 3CDYA 3N91A 4X4YB 4DUXA 1FFQA 1TVHA 5EA0L 1WISA 2XBDA 4OLWH 4NQEB 5D1XD 2WKLA 2B0SH 5FV2A 4FN0A 3F00A 3GDBA 3PPEA 3QJHB 4OH2A 4EBQH 1LO3H 3GSUB 5L0QB 1PAMA 5IV2B 2ZSWB 3MYZA 4IDJH 3HMWH 5CO1A 1RIHH 2ZP9A 5BW7C 2OW7A 2SEBA 1Q0XH 4OIAA 1AIZA 1OTUD 3T4AA 4MDRA 4GQPH 4M6OH 4LOVA 5E24E 3Q0HA 3ROOB 3SO3C 4Z78A 1SJXA 1XGRB 5DVPA 3ZLQC 5JZ7C 4M62H 4QIRA 4JDZB 2FZ3B 1TSHA 5DJZA 4BSVA 1QX1A 3SE3C 4OFKA 4WW1B 4JY4A 2IQ9H 3SCMA 3VD5A 3L3JA 3TN0C 2DLEA 2QT6A 3ARDB 2MNWA 3W2DL 2A74A 3EUDA 2A0LC 4P57A 3REVB 3CSFA 2AXFA 4X4ZA 2CK0H 3GB7B 3N9GL 1HXMA 2R9HD 2O5NA 2AMGA 5E1AA 1YYML 4JFFE 5E56A 3ZU8A 4YBLC 4GSRA 4BCYA 1S9KC 1HJCA 1XTMA 3DRQA 4G6MH 1PY0A 2Z8WC 4PLKD 4XI5D 3T77A 1WAEA 1KYFA 5KBLA 2NY6C 3U0PA 5DS8A 5AKVA 1D9KB 2W9DH 2WXMA 4B0MB 5CUSL 2DLIA 2X53A 1CQKA 2GBVA 4ZXBD 4W68A 1TETH 5G2NA 1JV5B 4WHDA 3VFTB 1QHQA 4M7LH 4WHCA 1Y1UA 4PJEA 4L23A 2WJ5A 5EOCJ 5IUCA 3OZ9L 3RL2A 5I1GL 5D1QA 4DQOL 1A14L 4F92B 1FL6A 4HD5A 3VA2C 2L04A 3Q3GA 4AQ1B 5GRZA 5KJ4A 5I1CL 1RIVL 1VA9A 1ZSDB 2A1WH 3PWJB 5K9QI 1XH2A 3O41B 4N0YL 1DN2A 3HZYB 1KG0B 5AUMA 1A22B 1MRFH 2YARA 4PWIA 1JGIA 2FDBP 1GRWA 4D9LL 4MXQD 4NCDA 3DMMD 3VYOA 2CHDA 4ZSOE 4HZLB 5E1IA 4K3EH 4ZFZA 3QP3A 1UFUA 4FQ1L 3VX0A 1KLFB 3ISRA 4FG2A 5TFSL 1EPFA 3UBGA 3P4LA 3TA3C 3L3DB 4HISA 3V9FA 5ETUB 3MLZH 4R90L 3IJSB 4EUPH 1HN1A 5J13B 3VWJD 3GTTA 3EYQD 3CZFB 1P5UB 2QQQA 5J56B 1N5AA 3BQVA 3MV8B 3T3ME 1SOKA 2IQAA 3P4OB 2J1XA 3L4CA 4HWBL 2J8UA 3SJVB 4H88H 1ZJBA 1U3YA 2DM4A 4K7PH 2X6AA 4OTXH 4XO8A 3VQ1C 4MJ5A 1F4YH 3GS4A 1CGSL 3VRJA 4TS6A 5EZJA 3IFLL 4JFFA 4F5CE 1J1XH 4ORGA 3AQZA 5F7NC 1K6QL 3KPPB 4XP6L 4Z7VF 2EDBA 3C75A 5JUEL 3QI9A 4RAUB 5INDA 1SPDA 4PJ5E 4BYHA 5F6IB 3QYMA 2RB8A 2EQDA 4X4KA 4XE5B 2JLLA 3BZEA 3BISA 1H3TA 1F2QA 3WS6C 4GXVH 3C5JA 2WUCH 3FFOA 1DE4B 4JDTL 4PJAB 2HPTA 3IGKA 1FZKB 1VLXA 3CLFH 5IBUG 4KK8C 4LHJB 2X1WL 5I28A 3BPOB 1BQHG 1JWUB 4HWEH 1QEWA 3FQWA 4ZQKA 4U1MA 5F3BB 1GOHA 2D7TH 1BV8A 4CDHA 2NY5L 3FTGB 3EOTH 4FI7A 5F93C 3QNZB 5TH2A 1FGNH 4IBQA 3E0GA 4XNQB 4JRYE 2DWXA 2O5XL 5B1KA 3MLYH 3WBDA 4E36A 4CGUB 3BPCA 3MRGB 2IFGA 4CMHB 5J89A 1JVLA 1A5FL 3DETD 4I4WB 1KIPB 2XVLA 1CBJA 3BVTA 1B3IA 2Y6SC 3MYJB 1DTUA 1E27A 3QZMA 4M8QA 3NA9L 2KT6A 4HCRH 2ZUTA 3BJLA 3LIZA 2Z6FA 3CD4A 1OAKH 3OMIB 1JV2B 4XOBA 5AZUA 4AVKA 1TSRA 4PGCB 1URIA 3PG2A 4ZSOA 4FQHB 4PWEA 1Q1JH 5FYKH 4FJYA 5FUZL 1JZ5A 2BM3A 4M61A 4NZTH 1BVLA 2OZNA 4BQ6A 1JDAA 4MAYC 1BQLL 3ZE2B 3UO1H 3CE1A 3QC5X 1KTDB 1NOFA 2BHYA 2FO8A 4XVTH 4X99B 5DDHB 3H2PA 3LXUX 5HGBB 3IXAB 4I85A 1E4XL 5HVFB 5JORB 1UH4A 2Q86A 1F41A 5HPOA 2CGRH 1D7FA 4RX4A 4QRTA 2D7PA 4LK4A 3NFPB 4NXKA 5CFHA 4OD2A 2RAMA 2VUYA 4Y4KB 1U8NA 3MMEB 4HU2A 2MTAA 4OZFB 5IHBA 1CFBA 3ARGC 1AG6A 1C8PA 1JZ7A 3ECWA 4DZ8A 5DQDH 4Y5YA 4IU3A 1UD6A 4LVOB 1OB0A 3TH4T 3CN1A 3MJ7B 3SE9H 4YIQB 1JDDA 3ARPA 2F58L 5IFHL 3T6ZA 4LSDA 1BJ1J 4LVHB 1YN7B 4KKNA 3GZKA 4P59H 4JHZA 4J3UA 2GTWA 1JZHA 2OMZA 5ICXB 2N4IA 4Z3IA 3QJOA 3PWPA 2V9QA 5SV3A 3S8GB 4JRYA 4NKIL 4W6XB 1DDTA 3G5XA 4OLYL 4AQEA 4X4XA 1BIIA 3H55A 4OGAD 3BVVA 4Y2LA 5ERWA 3NPSC 1MW0A 3TWYA 7PAZA 4BE5A 3HJ0A 2FLRT 4JVWA 4N2AA 4GQ9H 3MCKB 1OSZA 1IBHA 1ZKAA 4MWFB 3VWKC 3PJSA 3QIWC 1SXAA 1HH9B 3JSSA 4JE4B 4A7GA 1S5IL 2AZUA 1IJ9A 2VO5A 5CGTA 2RQEA 3S4SA 2XWJA 5BMFL 4PS4H 4ODVH 1OARL 5JMRA 2O6EA 2JXMB 4WKZB 4YQXH 2H32H 5D72L 3E8UH 4HFUL 2OS7A 5EORH 1IGTA 3FQTA 1W80A 3FH5A 5EOCL 4AX3A 3FO2A 2NXZC 4ZFGL 2AJVH 2G2RA 4WJ5A 1SDYA 3N06B 2E9JA 3PWUA 1X9QA 4X8JA 3EOBA 2OR9H 3TBYB 1KNOB 1GOFA 4ZQTA 2CNYA 2OAAA 3BVWA 3ZVVA 5LCVA 1XGTB 2DQHL 3GNMH 3MLVL 2ZWNA 1CG9A 5ADPL 1MI5E 4NO0D 1C08A 1WFOA 4KAQH 4M48H 3RRQA 2QFPA 3BRDA 2UZXB 4MAUH 4OD3L 1PD1A 4MB5A 1MJUH 1PU0A 1SJHA 2OMVA 3HVDA 3T8VA 1L6XA 5EUOB 5BPPA 2FJFA 3MFGB 2CAKA 3IB4A 2X4UA 4AG4L 2NY1B 2Z91B 3O6FD 4FQCH 3W37A 3MRCB 2GSGB 3OLDA 3VB9A 3DI2B 5C1MB 4LSPH 2WZ5A 4FQ2L 1CXLA 1D6VH 5KBDA 2M8XA 2FGWH 1QKZH 3OMNB 1KXVA 3W82A 1FUNA 3HS0A 4FFVC 4YHMH 4XNBA 5IROC 2QTEA 3QUZA 4BDVB 4MD4B 4XC1H 4JRXA 1TQCC 1ZHNB 1NL0L 4GRLD 5D7IF 3BSZL 2KHAA 1T0MB 2AQTA 1G7PA 3L9BA 4Z3GA 3H85A 1N8ZA 3GTVA 5LBVA 3K7UA 2OTUA 2VAAB 1F90H 4YHYC 1LEKB 3BMVA 4LIQE 3HI1A 4LSSH 1KZQA 1NTDA 4LLUB 3CH1A 4PJXE 4EO5A 2IGFL 4MZRA 3GMMA 4DAGH 4QHNB 1A7NH 1JS4A 2LVEA 2ZAHA 3DK2A 3LZNA 3FU7B 3OAZH 4J1UA 2H1XA 4HJUA 5KUMA 4O9HL 4S1QH 2JKTM 5C92A 3LKNB 3O0RL 1ZWIB 1BPVA 1G7QB 1KLUB 3L4YA 3L5IA 3UTOA 1YNKH 4TUJA 1KEGL 2Y24A 1BBJB 1NBVL 4JHVA 4FTVA 1DJWA 3CVHA 5JHLH 2GB2A 4HLZH 1D7CA 1DZBA 4U6XA 3DXAD 1OAXH 5CIPH 3UGUA 3WTSA 3F7KA 4EOWH 5DHYA 5B3JF 5ABDE 2A6JA 3IK2A 3KNBA 1JVKA 4FABH 4BWWA 4LP4A 5JMOC 5BV7H 3FQYA 2AJ3B 1ZE3C 3HEIB 1PZ2A 5AYUL 3JXAA 3PXJA 1MI5A 4QXTA 1PDKA 2HA1A 4WHTA 1X44A 1NGPH 2VERA 1OWWA 1NMBH 1GS7A 2R56H 3BKCL 1GAFL 3JWNG 3QARA 5EU7C 2PABA 3RFZA 4N22A 4JR9H 4AUYA 3MGOA 4XO5A 2EC8A 1YQVL 5IW1B 1MNUH 1ZPUA 4XBMA 3G5YA 5LG1A 4GP5B 4QRRE 3DGGB 1HEZA 4DP2X 3D9AH 4QHUA 3KYNB 5EU5B 4LFHD 3ALPA 3HC4H 3NJMA 3WMQA 4LLWA 2FATH 4AXWB 5I0WA 5JQIB 3FTWA 5B7EA 5KSBE 3BZFA 2Y0SA 4FFZA 2HXAA 4LNVA 1ORSB 4S10A 5H2BA 1SXSA 5DMJB 2QELA 1K8DA 3ZZSA 2WNGA 4X6BB 1NKGA 3ESPA 3QQ9D 4XO4A 4QKXB 1HDMB 2C7UA 3C2AL 3EFFB 3UTQA 2WCGA 1KY7A 3M88A 2JB6B 3T71A 4PJXA 1IL1A 4PJFB 4X0KB 4L8CA 1VPOL 1XZ0A 4OF3A 4C4BA 1HIML 1MJ8L 4KZDH 3RG1C 5HVGB 1RERA 3PGCB 1EEZA 1KN4L 1UVQB 4OSUH 2BZDA 2VDOL 4TQEH 3ILPA 2EC9U 1IKFH 1L9NA 4DSYA 4Z7WF 4P2RB 4F7MA 2VZ3A 1U58A 2FJGB 3H7LA 2XZZA 4XT1C 1CVSC 2WLHA 4WUKL 5IQOA 2AKRA 3BQUC 3QUML 4LP5A 4AGOA 1FVEA 3FQUA 3SDYL 2DAVA 4N6RB 2WINB 1FJ1A 1GY1A 3GZQA 4CBPA 1EJ8A 3T65A 4WK4B 1CFSB 2ADFH 2Z35B 2UXVA 2WVTA 3WL9A 1U8CB 3I9AA 3EIFA 1NC2A 3MRBB 3T8MA 1MVFA 1DVSA 1LWRA 2LLNA 4OM1L 4PYGA 4XHJD 4Y89A 1ZHBA 5CJOH 4KRNA 1CLVA 5HDOA 1C5DA 3OJVC 2WHVA 1KPVB 1KTLB 1GVIA 3ESOA 1RY7B 3ZTEA 5CN1A 1OSPL 4WU7A 4MQXC 2ZOKA 1FIGH 2WXGA 3A4DA 2YBRA 4PY8J 5FIEA 4LEOB 5IGXH 3LN9A 1ML0A 1TEFA 3RURA 2NLJA 3C2SA 5FCSH 3FYIB 3M17B 3LKPA 3UAFA 1FVDB 2HKFH 1ND0A 4IBUA 12E8L 5DZLA 4KOCA 4WK0B 3IM1A 1PMYA 3GFUA 4MD0B 1RU9H 4HSAC 1Z5HA 3NCEB 3OL2A 4IRJD 3V52H 3ZE0B 5L8JB 1U8QA 3RTQA 1ADQA 1YEIH 2CM6A 5TDNA 3CVIH 3MNVB 2YD5A 1A6ZB 1ETB1 3ISYA 4MMZB 2GJZA 2HG5B 3P77A 1PEZA 4JPSA 3OKEB 2LE9A 1I8UA 2OTPA 4F7TB 1OZTG 5D2LF 4OI8A 1QUPA 4A7QA 3F6JA 1IAMA 2F2HA 5TQ0L 5MI0B 3DWTA 3U79A 3N40F 4HIIB 3RWDA 1YO4A 2CMRH 1GMEA 1Q1PA 3D4YA 1FFTB 2BZ7A 1INQA 3L1FA 1SJMA 2B59B 3S37H 1T1XB 1NBZA 4L48A 3FMGL 5DWUH 4X8CA 2XN0A 1WWCA 4MCZA 3ZR6A 1PIGA 4G6KH 3WY1A 2Y7OA 3N6YA 5T33H 4JPIB 2PLTA 3DGDA 4X4YA 3WSQL 4JHBA 3SDXB 3R4DA 1TMCB 3N1MC 4NQEA 4ODUB 4Z7QF 2H3NB 4HUWB 3BP6A 1HYSC 3QJHA 2Q87A 3RX8A 1S7QB 3GSUA 4HHGA 5IV2A 2ZSWA 1UCBH 3OM3B 4NUPA 4PUBH 1W15A 2DKUA 5I2IB 2JB5H 2XRAL 1MQKL 2LTQB 3QISA 1SBBA 2AZAA 3ARVA 1QQDB 2OJZL 4HJSA 1WFTA 2AMUA 5J8OA 3ROOA 1XGRA 3OC8A 4TQ8A 4JDZA 2FZ3A 1SVBA 4GFXA 4WW1A 2PO6C 1BWWA 1KXHA 3MV8E 4WGWB 1JYNA 3ARDA 1C9SA 3SJVE 1X5KA 4M93C 1INDL 5EULV 5GGVH 3REVA 3S96B 3UJIH 2EVJA 1KCUH 5J11C 2VDMB 3V4VL 2AANA 3GB7A 4NN6B 3CXDH 1FHGA 3WFHB 4Y5VC 3ES6B 2Y69B 1ERNA 3SPGA 2VLKB 5LG6A 2WWKO 3PWLB 4EUPG 5J1TC 4H8HA 3IGFA 1N8OE 2Z93B 1VGEL 1KLGB 5I6MA 1SQ2N 1MOEA 4JQIL 3S4SG 5MEOB 4OQTL 2IJ0C 4X6DB 3ZRSA 4UILL 2EDRA 1YYLH 4P46B 1D9KA 1G9MH 5LHDA 3T0DA 4PJAE 4YFLF 4LCIH 3HB3D 3I9IA 4RIRB 1KFAL 3PGFH 5HI3D 1JV5A 4HK0B 4P05A 4R96A 4Y4HD 2DH3A 2I69A 1L9OA 2HFGH 3BAEL 1I1AB 3OKNB 3AY4C 3OPZL 2NSQA 4UIKL 4FQPA 2YJLA 5E9DB 1MCSA 2BFVL 2P5WE 1T66C 3E8VA 1CL7H 2R2EB 3JVGA 4UT9H 3VH8G 1GZHC 2FBJH 4XP4L 2EDHA 2VMFA 4I9XA 4N90D 4AEEA 1YNLH 5BQ7B 2Q6WB 3CQFA 3P40A 5DQ9B 4AQ1A 4LGSB 1Z9LA 4AV5A 1ZSDA 3PWJA 2FLMA 3O41A 4LOUC 3K2UL 5CJBA 3WGUB 4ONGL 3QWNA 3I50H 3IBEA 4DP4X 5IEHA 3ZDXF 2VXQL 2IDUA 3UFIA 2RA1A 1JFQH 3ORJA 3NQIA 4HU8A 4HZLA 4BK4A 4ZTPH 3ZQXA 3MPCA 3O2DH 1KLFA 5D96B 3E9TA 2EXSA 1Z5YD 5F70A 5JHMA 3AM8C 1V3MA 3HFML 3O81A 3OAYH 4KKCC 2YUVA 3L3DA 3QUYD 3ZE2E 5ETUA 1F6LL 1BQSA 3GC3A 4U05A 1RVFL 5DEJA 1U41A 3DC0A 3AVEA 5IQNA 2XT1B 1P5UA 3CZFA 4XR8C 2V33A 3MV8A 2YOCA 3P4OA 3SJVA 3IU3B 1SY6A 4RFOL 3ZY7A 2G3NA 4YAQB 4BZ2H 1T0OA 3O3AB 1DHKA 5L8LB 5L9DH 2DI7A 2VC2L 3KPPA 1UJ3C 2HLFD 3TBTB 3WD5H 1DVXA 4RAUA 3PUUA 2BP3A 3F01A 4B7IA 3A3YB 3RDTD 2EXYC 1AVAA 4K9EH 3QXAB 1S7VB 3D85B 1EV2E 2I5YL 1UOLA 4PJAA 5SWSD 1FZKA 1FV1B 3WCYA 4JFZH 4NQXB 5EWIL 5HDBE 1JWUA 4C83B 4PRNB 5F3BA 5C71A 2ZWYA 3VXUE 2ZIDA 3MRHB 4Q52A 3FTGA 3V79C 3AY2A 3QNZA 4UNIA 4OFYA 4XNQA 4FLQA 4Z8FH 4BCXA 1BHGA 3IDYB 3LRGA 3UBXB 3LEXB 4KUCF 4JQVC 4H8VA 3MRGA 4WFGE 3UABA 1UA6H 4I4WA 4YWGL 3VU2A 5I6XC 7CGTA 1KIPA 4RGND 3VACA 2V3EA 3MYJA 5L88L 5MP6L 2J3SA 4NKDB 5CJQL 3V8CA 4MNQB 3WU1A 1WBXB 4OGXH 3CC1A 3ZMRA 1O0VA 4PGCA 1E28B 4FQHA 5E4EB 3VM5A 3D3VD 3T04D 5EMYA 1R3LB 5T3ZE 4E9TA 3SDCD 1Q72L 2JVUA 4NZFA 4DKEL 1OGTB 1LDPL 1KTDA 1UWFA 3BVXA 3FO0L 3G6JB 4P2QD 4X99A 4NFDA 3QZLA 5DDHA 4Q4EA 5HGBA 3IXAA 5E4OA 2M1KA 3WIHH 2DL9A 3TYGL 5JORA 3EGXB 4J27A 4ORZC 4PIBA 4KRPB 1E4XI 4N1HB 1DQVA 2ZICA 4N2KA 4KI5C 3VW3H 3NFPA 5CEXB 1CLYH 2ICEB 2ZONA 3RWCB 2ZT9C 3CVCA 4R2GC 3QEQD 4Y4KA 1W0WB 3MMEA 5MEND 4KK5D 1CBVH 1CE1H 3DX2A 3EHBC 5D1ZB 4ZAKD 3GXNA 3NJNA 2LLGA 2QQLL 1RUAH 1NIAA 2JWYA 4PS3A 3RNQB 2WQXA 2DQIL 3EDEA 3MJ7A 1EZVY 4YIQA 4PPTA 1NKRA 2ZXQA 4NUQA 1S6NA 4P9MH 4DZBB 1YN7A 5EUOE 5I6PA 5CJ8A 4FEIA 1NCWL 5DHVA 3RWIB 2PCYA 4N2OA 4HKZB 5ICXA 2Q8AL 3VFGH 3ZHNA 3CZKA 4P5SA 4UTBA 2WXJA 1SGKA 2F18A 1C7SA 2VDLB 3V55A 4KDTA 4PW4A 2O93L 4KNQA 2QGBA 1B4RA 3SCMD 1N26A 3MLXL 5J1SC 2JTDA 3DTUB 3HBPA 3MBEC 4M6NH 5JXEC 4KTDL 3P0VL 4Y9BA 4DP9X 3AS1A 3ZX1A 3V0DA 4FHJA 3FO1B 1WV7T 3MCKA 5FX3A 3V5DB 3U2SB 3NN8B 4MWFA 1UKTA 3U82B 5HXMA 4U1NB 4IGBB 4XCFL 1WO2A 1HH9A 2WO4A 3FTZA 2DQGH 1ZVSA 4LCVA 4OVVA 4L8DB 2YD1A 1KJ3L 4BE6A 2BRRL 2VOTA 5SV4A 2H6UA 3VG9B 3KPLB 4G8AC 4Z9KB 3RPBA 2BFGA 1BVZA 5E0FA 3B8YA 4EQ3A 3VGAB 2JXMA 3NIGF 4WKZA 2E5EA 1SM3L 5EO1B 3CSTA 5J6HB 1LO2H 4OGZA 5D7KE 4YFLI 5E6ID 3KDMB 3C5XA 3MJ8B 1CQYA 2AEIT 1D5XB 1WFIA 1EAQA 2B1OA 2ZX7A 4LO9A 1HK6A 4X2UA 3AG1B 4UIMB 1WLHA 2A9BA 2CLRB 5IW3A 1K5WA 2WLKA 2ZAIA 4PMFA 3JYBA 2WVVB 1ITBB 3QPXH 3V4PL 5DO2C 1ZLWH 1PF3A 3D87B 1MHEB 3L3GB 4KC3B 1IUZA 1KNOA 3COOA 4XAKD 1OPGL 3GLZA 4UQBA 1TOXA 4QXVA 1XGTA 1QBLL 1W6WA 1J5OH 1VCAA 4Y1AD 1NLBH 4KQ4H 4OB5H 4ODSH 3SGKC 1XMWA 2K4WA 5ABAA 3S5LB 3TESA 1OWRM 1UC6A 4FJZA 2UZXA 4KV5E 2ICCA 2OMWB 5CD3B 3ULVE 5I0DA 4GJTB 3CAFA 3P2TA 4KX7A 2KBGA 5EU6D 4F8LA 3RU8H 4POYA 3NCCB 2PWHA 5EUOA 4CC4C 1BZ8A 5EUKB 3NCFB 2A4EA 4R7VA 1J8SA 2Z91A 3IMUA 1FGVL 5LBGA 4ATWA 4XWOC 5L2KD 2W0FB 3WEXB 2BCKB 3ZW3A 3H7BA 2GSGA 3MRCA 2EH8H 2VDNH 2YKLL 1ZDQA 2ZCHL 2ZYRA 3E9UA 3CZEA 3Q2VA 3B1TA 1N59B 4BZ1L 3QJVB 1QSEE 2D0FA 4BFIB 2L7JA 1AXTH 1AKJD 3Q13A 1U3NA 4JL2A 4BDVA 4MD4A 1PG7H 3INUH 4NIYE 1E6OH 1ZHNA 2IWFA 3WEBA 3BGFB 5L6YH 2NNAB 1T0MA 1KBPA 4ELMB 2FHBA 1PYWB 3TT3L 3ZYOA 2VAAA 3KW7A 1LEKA 4KROB 1BZ9B 1A25A 4LLUA 4JFFD 4PJFE 5D4QA 3RB7A 3MOAL 3I02B 5JXAL 4K5OA 2BP0B 3QI9D 5DT1H 5FYLL 2IBGA 3FU7A 4ZZFA 2LU7A 1LYQA 4PR5B 3UIZA 1MWAL 3QJZA 4DGWC 3LZFL 5KAQG 2MOGA 2R83A 1EWHA 3HE6B 1I1YB 3LKNA 4B60A 1ZWIA 1DBJL 2ZWSA 3WENA 5AL8A 1B6DA 3BKYL 1G7QA 3WG7B 1KLUA 1FBIH 1LO4L 1BBJA 1UOKA 1NH6A 1EZVX 3VXSB 1TQBC 2QADC 5KZCB 3B2UC 1FYHB 3NIDB 3LIUA 2FQGA 3PLYA 3Q2NA 2QSVA 4Z3FA 2YAHA 4RESB 4LHUB 5J1AA 3ZL4H 5FUOH 4XMPL 1QLEB 2C26A 5HDQH 3DECA 3KLAB 4DTGL 2BZCA 4JY5H 1YC7A 3UC0L 3UTTD 2YWZA 3N44B 2AJ3A 4G7QB 4TLSA 3VE0B 2CCLA 3C60D 3WJLC 4DOHB 3ULUE 4LVNC 4Z3EA 3IFNL 4B3EA 1KYAA 4YE4H 1CPUA 3N5AA 2IAMC 4FA8A 1ZGLB 2PWGA 3IDXL 4N8PA 2YQBA 1ZS2A 5I76B 4X5XB 1A4KB 4Y4FB 3BAJA 3FT9A 4OF7A 4MRCA 4B9GA 1UACL 1A7QL 4MVBD 5HGAB 4UNVA 4H1LG 1V7NL 2F8OA 3LRLA 2P28B 5DD1H 4ZX5A 1JVOA 5IW1A 3N85H 3A6BH 3FUFA 4ABUA 3DGGA 2WZ0A 3KYNA 3EJRA 5EU5A 5HHVH 3RIAK 4FNSA 2V7NB 4QLRA 2E8ZA 4JREC 4AXWA 5GRYA 3E2HB 1QSEA 3RGVD 5TE6H 3TO4B 3AADB 1ORSA 4FXKC 1CD1B 3C6LC 4KO7A 4X6BA 4KHXH 3JQOB 1RK1B 1YMME 3HAEH 1HDMA 5HYFA 3SOBL 2GBUA 2HWZL 3EFFA 4WI6A 4CMMB 4O4YL 5C6TL 3GIZH 4PJFA 2J6EH 1T03H 4X0KA 2ADYA 5J0BA 4NKQB 2D0HA 4OZGF 4DCQB 2ERJB 1KCVL 3PGCA 4YGAB 3SYQA 4TLKA 1UVQA 4PVNA 1CC3A 1J88A 2GAZA 3FO9B 1UWEH 4YHLH 5ESAB 5F8QC 5EEXA 5AW0B 4P2RA 4U6VH 3VU1A 1U2CA 1I7ZB 3MV9B 4LQ1A 1RAMA 2FJGA 5FO9B 3AMKA 4CJ1A 1C5BH 3SDXE 1Q0YL 4U49A 4WTXA 2A9DA 3TBCA 3AACA 3U1PA 2WQUA 3I2CH 1HEHC 5HGHB 4JO4H 1MH5B 1M1SA 1UXWB 2HAZA 3PWPD 5AAMA 5JOPE 4N6RA 2WINA 2BIPA 1ZLSH 3J27A 3NZSA 1OAYH 1KENL 4F27A 1CFSA 1QYGH 2AVGA 2Z35A 4KJWD 2IANB 2X2UA 1RV6X 1U8CA 2YPLD 3MR9B 3W3BA 3MRBA 3S2AA 2ATKB 5EZOL 1SUHA 2NSMA 4IOFD 9PCYA 1HFUA 1UM4H 2D0GA 4Y16B 4UM9B 1WC7B 3LXCA 1KPVA 2I60L 5EEWA 4GY4A 1AJ7L 3VRLF 5J6GB 4XGZB 2WXHA 1I9IH 1JOIA 2VLRD 5DJDB 1QI3A 3NT0A 3WFBH 2YXMA 3O6LH 4PB9L 2EDQA 4Q6KA 3DYOA 3BYYA 2G60H 4LEOA 3K6DA 5DS2A 5ECJE 4HOMA 4OCNC 5BZXA 4UDUB 2RJMA 1TZGL 3M17A 5HY9B 1FVDA 2VLKE 1NQBA 4FP8H 3HJEA 2HTKC 2YJQA 4JVUA 1A7PH 1B9KA 4MB3A 1A3ZA 3NJVA 5EOTB 3UG5A 1O9VA 5HI4C 3L3IB 2V3FA 4MD0A 4N0UB 4X6DE 2QQNL 2CBTA 3MNVA 4RCAA 1A6ZA 4FGMA 1ZIAA 4MMZA 2K9FB 2HG5A 3I85A 1ZANL 3OKEA 4F7TA 2ZWKA 15C8L 5EDSA 2R4RH 1QBML 1U8HB 4HIIA 4OUUB 3BWSA 4KPHH 4FD0A 3MJ9A 4JG0H 4X6EB 3Q5OA 2LW3A 3ELAT 1YEFL 1MFEL 3H42L 4G6AD 2IMNA 4IK7A 2B59A 1T1XA 4M7JH 3V6FB 4Q9QL 5AB9A 4J28A 3U4EB 4H40A 4MCMA 1A7BA 2ORBL 1NCDH 4JPIA 3TJHD 5AVRB 3SDXA 5I75C 2FHCA 4C56B 2EXWD 1FL3B 4ODUA 2H4EA 2QLYA 4WWKC 5CR1A 3VX1A 1SHXA 3GI8L 1DR9A 2H3NA 4HUWA 1HILA 1S7QA 2X7LB 4PTTB 4FNPA 3CCHB 1L7IL 2K7QA 4P5MB 5I2IA 1T6WA 1OD7A 1UZ6E 2DF3A 5HDWA 4JRXD 5IHHA 1QQDA 2H2SC 4U6YB 5CLYA 2B9AA 3MCLH 3MRLB 4A37A 2FEEL 4XOEA 3A6CH 5CJXA 3A6OA 2NZ9D 4WO0A 3WLWC 3BDBA 4JKPL 1AOZA 3DHMA 4FNLL 3AGVA 4BFEA 1J1PH 3MQIA 4WZ9A 5IREA 4NKMB 2A77L 3LTVA 3S96A 5E2WH 4YXLH 5EZPA 3T0VA 4NJAL 4EI5C 2RALA 3WFHA 2OYLA 4GBXB 1J8RA 3ES6A 1I9JL 1CD0A 2VLKA 1BG1A 2E27L 3PWLA 4XNZC 2Z93A 3ARFC 4OLZL 1KLGA 2VMCA 1FNHA 2D3JA 3QUGA 4FTVD 2VDQB 4N2GA 3FU9A 3MO1B 1AR2A 2FNWA 4X6DA 1FNSL 4P3WA 4AVHA 1UD3A 4P46A 4Q14A 2C5DC 4KXCA 2AXWA 1SBSL 5CBEB 4HK0A 2Y4SA 4O02B 3SZKC 3B9VA 2OMBA 5AZEH 4AMKH 2JFCA 2F6AA 1YECL 2PTVA 3GRBA 1I1AA 3OKNA 1YMHB 4FQXD 4EDWH 4S1RH 3ASOB 4B97A 4KI1A 4LCCB 5DJYB 5E9DA 4ANVA 4CN1A 1S7TB 2UZYB 2R2EA 2XYCA 2D7NA 3EF7A 2EXTA 3B9KC 4J3OG 3HE7C 5BQ7A 2QHRH 4A04A 2Q6WA 4YH6A 1J8HB 5DQ9A 5C0NC 2DQTL 4D8PA 1BFVL 4RFNB 3NYKA 2BHZA 3QJXA 2FQDA 2GTQA 4GKOA 4UT7H 3CFQA 3QO1B 4GMTH 2PCFB 1JF1B 4OCLC 5FECB 1RZFL 3KCWA 3MUUA 3WIIL 3VM7A 3BD4A 2KPWA 4WCYL 4FKKA 5CGBA 5GGTL 1R5VB 2W95A 1H6EA 3K8KA 1W9XA 4M1CC 1EHLH 1FNGB 3PE9A 4ZS7H 4Q9CA 3QPKA 2MSPA 2IDSA