3WEXB

Crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
209
structure length
195
Chain Sequence
b'KVTVAFNQFPENYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELGRPEAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II antigen
molecule tags Immune system
source organism Homo sapiens
publication title Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5
pubmed doi rcsb
total genus 40
structure length 195
sequence length 209
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wexB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3wexB01
2ADFL 4YBQC 4YAQA 4NYLB 1RZKL 3A0OA 2EYTB 3CMGA 2XN9B 4N0UE 2IQAA 1Z0MA 3K8MA 1T04B 3IKCB 2ZG3A 1LEKB 2YMXL 5HD8D 2KUTA 3PGFL 4HDIB 4P9HC 3BEVB 2V2WA 4EXKA 5SX5H 4F2MA 1CICD 5ADPL 3BO8A 1FL5B 3QEHA 4ZUVB 3QNZB 1JNHA 1NDGA 1NPUA 4P2QA 4DUVA 1EGJA 2GQHA 5JXEA 3MLSL 3X3GH 3ZKMC 5FYKL 4I2XA 4A2MA 4XNQB 4KK8D 4LQFL 5C6PB 1C12B 1OTUD 2R8SH 1H8OA 3EYVB 4K7PL 2R56H 4EKXA 4ZODA 3RDTC 4H0IA 5HDQL 3VXTA 3TBVA 2EICA 4M9OA 2VC2H 1JI1A 1IKNC 4XZUB 3U46A 4LPTA 4PUBL 3QIBB 4WTWA 4BK4A 3PWPA 1MEXH 2ATKA 2X70B 3DXAE 3N1PC 2MQ0A 3DBXB 1UM5L 2F58L 2E8ZA 2NPLX 3CSYB 4P2RE 5AZEH 3HR6A 1PZ5A 3T2OA 3KPSB 4H20L 3TESA 1RZ7L 3IKKA 3UTPD 4QHKI 2A6DA 3FB8A 1X5YA 5F1NA 1QSFE 2C4FU 4PGCB 4LPCA 4M8QA 1NFKA 1WWAX 2O5YL 1P53A 4ZDHB 4JFYA 3CCHB 2UWEA 1S7WB 3MLWH 1IQWH 2AAVA 3CUPB 3W0WD 2X6MA 1G6RB 3PGDA 2F74A 4LOUD 3ESVF 3T4YA 3NCYP 4FQXB 3IJYA 4ZO7A 5L88L 3U0TA 1K8IA 3KDMB 3QUYD 4PRPB 2BVOA 1U8IA 3UZQA 1OAQH 3C5ZD 2HG5B 1UG9A 2GAZB 2SEBA 3O6FB 1HWHB 4LARH 1MQKH 5EU5A 4AL8H 3VGFA 1JMZA 3B8YA 2XPGA 3B43A 1HSAA 3BZEB 4PJIB 2P49B 3FN0L 1S7UA 3SE3A 5E7FA 3FQRB 5FK9A 3GKWL 5IVXE 3WXVH 5T5FL 5C09A 5C08B 5AG9A 1KUMA 1QSEA 1MHEA 3BZDA 4BSWA 4OBSA 5IBUG 4HX1A 5T3ZE 4CVZA 1D5BB 1IM3B 4HZLA 1H0DA 2EDHA 1EEUA 1PSKL 3GM8A 2I07B 3VXME 2ZUWA 4CDGC 1MCIA 3HZYB 4HJJH 1QD0A 1HINL 2GSGA 3CAFA 2E27H 1MI5E 1EVTC 1C5CH 3QA3A 3QR2A 1GXEA 2WWKO 4BQBA 5IMKB 5BMFL 4GW5B 2X4RA 1ZGLM 2OR9L 4NNPH 3LS4L 4PJ9C 5F9OH 4K71C 4X83A 3CX2A 2NW3A 5B8CA 2ICEA 2G75A 5LQBH 4KK9D 4UTBH 1ZT4A 4OCWH 3NZHH 4CN4A 2MSPA 3E6HA 3GJFK 3L3IB 4LSPL 4TUJA 4YWGH 1QLRA 2BVPA 3QSKB 4ZUSB 5E5UB 3PV6B 1M05A 2ADGA 3QXAB 5ILTL 2F5BL 1CVRA 5KS9F 4J12A 3O8XB 1VPOH 5DFTA 4XNYH 4LEOA 4BZYA 1QRND 4U0QB 4CKVX 2HAZA 1Q0YL 4EN3A 5I8CB 3BMWA 2J6EH 1S5IL 3QDMD 2D2OA 3O9WC 5F21B 4Z7VE 3QDHA 1UENA 3DPBA 1QRKA 1N6VA 3OMZA 5J13B 4MQTB 3MC0A 3O6LH 5L2KB 4D0DB 1LP9F 3ZKXB 4DUWA 5T5NF 2YN5A 5GGSB 4UNVA 4JFDE 2O26U 3H6JA 1HI6B 2W9DL 4NZTH 4XCFH 2HWZH 5J4MA 2I60L 3WDIA 2IAMC 4GXUM 4LIQE 3EW3B 1MWAA 5D1ZA 2WBJD 4UT7L 3Q0HA 3RA7H 5FYJL 2ZJSH 3AS3A 5CD5C 2K7PA 3QDJA 1D5XA 3VG0L 1GVIA 5BV7H 4DWHA 3V4PH 1U58A 1T80A 4CADB 3QFJB 3F7PC 4Z7WE 2E9IA 4WEMB 2WP3T 2DWDA 3MRLA 1AP2B 3GSWA 2SEBB 4PG9A 4P59L 3A6CH 2LVCA 1JZ4A 1I3RA 1AJ7L 5DEGB 5JUEL 1TTUA 3MRFA 3QDGA 2VQ1A 3ES6B 4JEGB 3E3QE 4JM2B 4KV5E 3RHWF 1EUUA 1IGYB 2EC9T 2VLLB 3KXFE 4RMRA 3RUGE 1YY9C 2P8LA 3PQYA 2DD8L 2YD5A 4Y4HC 1I7TB 5IB4A 4HMEA 1PG7W 5HY9B 1UVQB 3D39D 2R2HA 4PREB 3LH2H 4Y16C 1B6UA 2XT1B 5ALCL 1FNSH 3SDCA 3MYJB 4JB9L 4OZHA 4KZDH 4N5ED 1RJCA 5EO0A 4E41B 3MNVA 3HMWL 1JNLL 5JORB 1G9NH 4WENB 4NT6A 1BBJA 1A5FL 3NPSB 5LWYL 4LSUH 1I9IL 2DAVA 2XY1A 2ED7A 3IXTB 4QRSA 4YDVA 4PB9H 5JOFA 5T3XD 1LO5A 3EYSH 2HJLA 2HT2D 2CDGA 4JKLA 3NN8A 4P23C 3PHOA 5D96C 4HUUA 3C5ZC 1MVFA 2MNUA 3DV6A 4QTHA 1KJ2H 3T2NH 4I2XE 3NFPA 3L1OH 1RFDL 3STLA 4OV5B 4TVPH 1K4CB 2RQ8A 1KLFA 3GMMA 1HHGB 5FYLD 5M7QA 4WDIB 1CFSB 1OP9A 3I75B 5EN2A 4C4KO 5HHXL 1A6ZB 4BSVA 2VIRA 4H25B 4M7LH 3Q2CA 5IKCB 1DN0B 4AIZA 4GBXC 1CICA 2VLJD 3EFFB 3THMH 4RFEA 2GJ6B 4P2RB 3OX8B 3D39E 1A6PA 3WLWC 1SYSA 3HMXL 4OSUH 2VLJA 5E8OB 1YNLH 3GSQA 3V4VL 3QQ3A 1OTUC 1K5NB 3PWVB 1FVCB 4ODTH 5L6YH 5FOJA 5J12B 2ESVA 4PJGE 2V9TA 4TN9A 5ID0A 4S11A 1CFBA 4OCYH 2EKSA 3VE0A 1YN6B 5ITBH 4MVBD 1GOGA 5D5ME 1J11A 4YE4H 1JN6B 4E0RA 4IRJA 3QIBD 4X4XB 2HRLA 1IC1A 5CJOL 5L2KD 4JHBA 1Q9KA 4NP4H 2Y06H 2BVQB 3TVMB 1G6RL 3T09A 4RRPA 3HPLA 2QBWA 25C8H 1WV7T 3PUCA 5DEGA 4HK0A 3TBSB 3UJTH 1Q9OA 3SGDH 4TNWK 4UQ3B 1ORSA 1Z5LA 1HHGA 5FA3B 4I18A 1A0QL 1AO7D 2VDRH 5E8NB 5ICZB 1BM3H 2WUBL 3TCLB 4P2OC 1B2WH 1X5GA 4P2CG 4ZSOA 1JWUB 5I1HL 3BJLA 4OKDA 5EIQA 1CFVL 3H7BB 1WISA 3S7GA 2ITCA 5INDB 2IPTL 2GI7A 3RKDD 2OI9B 2ZNXA 1XF5B 2Q87A 4P2RA 2FSEA 4RCAA 4QRTA 3SDCD 1TPXB 2VR5A 2Z93B 3E2HC 5BS0D 2HKFL 3ULVE 2H2PD 2VR4A 4XNXL 3SN6N 5CKAA 3PP4L 3CSYA 4H1LH 2J12B 3HE6C 3RTQA 2XNAB 3PWPE 4P5KB 1MCSA 4CVXA 1MOEA 2VDPH 4ZS6D 3EO1B 3DYOA 3ZE0E 5IFHH 5E2VH 3EIFA 1QR1A 4JY5H 1GGUA 1ZXQA 2NNAB 1CTNA 3IXTA 1RU9L 4QRSB 1BQHG 5J12C 2VISA 4K55A 4R4FH 4X9GA 1FZJA 5MHSD 3MREA 3BQUC 2MKLC 5L8LB 4NQSB 1J5OH 1ZWIB 5B39B 5JMOC 5GS0L 4NN5B 3T4YB 3MBEA 3G04B 5DRWA 4XMLH 4Y4HB 4ZPTA 2RHEA 1NBYA 4OLUH 5FA3A 2XACC 5IP4A 3TT3H 3FO2A 2DI9A 2KZ1B 4UTBL 1X5IA 4X5XA 4HBCH 1XIWB 5BZWB 4XXDA 3KLAA 2DTML 8FABA 1JPSH 4J4PC 5TF0A 2ORBH 5DR5H 3MRJB 2FSEB 1G7MB 1PKOA 4OLVL 1P2CB 3EFDL 5L8JB 1SMOA 1BD2E 1YMMD 2QHRL 4EI6B 5GRJL 4ETQA 4UT6H 4Z7WB 2BMKB 4QRPD 4XNYL 2PR4L 3FT4A 2X41A 4L3ED 1QUNA 3ARBB 12E8H 1MCPH 3UJIL 1LP9E 1U95B 1M7DA 2BK8A 4ESKA 4MD0A 1JYVA 3T0ED 1RUPL 5F96L 2UVFA 4PGBA 5KVFH 1C7TA 2DQJH 1DUYA 2NY4B 4Z7NF 3FB7B 3QUMA 1F45A 4NNXA 1DLHB 4HPYL 1HHJB 2CPCA 2DIJA 2X4SA 4F9PA 1CIUA 3J7HA 1EGJL 3VRIA 4Y4FA 1U3HD 2APWA 5DRNA 3DI2B 1UZ8B 1JZ3A 1FE8L 3RHWK 2PYEA 4HJ0D 2Q7YA 2RJMA 5KANI 4R7NB 2B5IC 3FO2B 3I50H 2VN4A 3S88L 1U93B 5F6HI 4OF6A 4Q6IC 1A8JH 4PP2A 3ZKSD 4NO0A 4BZ2L 4V1DA 4H5SB 4G43B 2VXSH 4JO4L 4GW4B 5F7LB 3TF7C 4M5ZL 1CDCA 5GJSL 1JZ2A 4AEHH 4HUNB 3QEGH 4OT1L 5CBEB 2X40A 3ZHKA 4K2UL 3RL2A 5DK0A 5C07D 4K3JH 1ZGLB 5HI5C 4D9LL 2IAND 1GPOH 3HAEB 5DJ8B 4TTDD 4HG4K 2OR7A 4XMKL 3WMSA 1UFUA 2OM5A 5DJXB 4KZEL 1DQTA 1TZGL 4UT9L 4ELME 4FQJH 1OP3H 3V6BR 4P3DB 4PTTB 2XN9D 3QEUB 3L3OA 1YPZE 2Y5TB 4PJHF 1I1AB 1T5XB 4Y1AB 2CO6B 4M1CC 2EZ0C 1PVHA 1ZHNB 2P42B 3HB3C 5CGYD 2DQFA 1SEBB 4RMSA 5KOVC 5DK2A 2ZOKB 4JPVH 3U0TB 3WFEH 5I66A 3QXTA 3V5HA 4MJID 4URTB 2Y72A 2WINB 1M7IB 2WWMC 3OAZK 3H0TB 1AXIB 1J1XH 4NWTL 5DJAB 3NPSC 1C08B 3EYFB 4L4VD 3CNKA 4R3SB 3VWKB 3H3PH 5EU3B 2OTUB 4WU7A 3ARTA 2NY6D 4JM4L 1NAML 1FNGB 3F7YB 1LO2L 4K71B 2LTQC 3BESR 4U1HB 1D5BA 4L5FL 1F58H 5ITFB 2XWBA 1MLCB 4OZFA 2NY6B 1P7KA 3PQYE 43CAB 4WI2A 2Z92A 1BGXL 5GGSA 2UYLA 3UX9B 1XFPA 2LE9A 3F6IA 5F9JB 4JB9H 1FGNH 3K8KA 2EDWA 1HHKB 2FGWL 5IMLA 1XGPB 1U8KA 4XVSH 3BZFB 5F1IB 3EO0B 3TN0A 5H8DA 4KJQD 5KN5A 1FORL 3OKEB 3Q5TA 1QRNE 4PJCA 2X42A 2IJ0C 1JZ5A 3L7FB 3BGAA 1AC0A 2J8UE 2PYEB 4ODUB 1MF2L 3VDBA 5DMIL 4CMMA 2DM4A 4MA1B 3MV8A 2JJUA 5BVJB 4ZXBC 4S0SD 2XQYK 2JCCB 4NQXA 1KFAH 3ARSA 4DEPC 4W6WB 1NUNB 4M5YL 2QADC 3FO9A 3B4NA 3QUZA 4C57C 3F58H 1RZIB 5I9QC 4LLAA 3GSUA 4XTRD 2I5YL 3CFBA 1ZA3B 4X8JA 4G6AD 3GBLA 4NZUH 1A1OB 4GBXD 1KF9B 2HT3C 3O4LE 1OGTA 2F54A 3FB6B 4FP8L 2NX5A 4Y4FD 4HF5L 2J7LA 2DM3A 4HUVB 2PETA 4HLZG 5CSGA 2WW8A 3MJ9H 3DVNB 3WFBL 3UROR 1E4XI 5I74B 1IGCH 3SDAD 3QQ3B 4FN0A 4YXLL 2NY1B 1U8KB 1E6JH 4GG6A 4AENA 2D7TL 5HDBE 1JYXA 1CE6A 4ODTL 1MFBL 1NFDB 2C1OB 4KROC 4OD1H 1IJ9A 1CDGA 4S1QH 1AGEA 3FT2B 1K85A 4ZOBA 4FQQB 4M4PA 3QFJD 2BVUA 1M4KA 1R3IH 1NDMB 3AGVA 3QUXB 3GSNH 1HILA 1QLEL 4KK9C 3K0WA 3T3ME 1HOCA 5CJ8A 1T7ZA 4M7JH 1LE9A 5JNYB 1VPOL 2FHBA 1MCOL 1G1CA 4X6DA 3OKLB 2NX5E 4ZD3H 2V5YA 3GSXA 1TVHB 1U41A 4TULH 2J4WL 5DI8A 4KDVA 3LRHA 1MI5A 5IMMA 5I73B 4LSQH 1DBAH 5SX4H 2CXGA 3DETD 1MHPH 1UKQA 3R0NA 1EJOH 3T0XA 2KPNA 2Q3ZA 3VGAC 3HG1D 1IM3A 4K7PX 3PWUA 1DEEB 5HDOA 4PJAF 3RZCB 1JK8A 3HI5L 2AJ3B 3DMMB 5E9DB 1JJUA 1J0ZA 2WUCH 5MENA 5D7LB 1XEDA 2QSQA 4U6XB 4KUCD 3LVEA 1KJ3L 3CFJA 4KK5C 5D7IA 2QHRH 1J9CT 4G7VL 2IQ9L 3FONA 3KPSD 4M02A 4XNZC 3C8HA 1DTUA 4NQVB 3RGVC 4NFDA 5TDPB 3VFSB 1T0NB 4P46C 1MFNA 4U1SA 1BJ8A 4I0PB 4J6RH 2R1WA 1HCVA 5E6IB 3NH7L 4AY0A 5I2IB 4EI5C 5F3BB 4OAWA 4C55A 5FUCE 1QQDA 4KI1A 2ZG1A 4X6DB 3MRKA 1A7BA 1WZLA 2Q86A 3OKKB 4N0CC 4R96B 2AQ2A 2EYSB 3S37X 4DZ8B 2W9EH 4PJBB 2BRRL 4L5FH 2C5DC 3EZJB 3DNKA 1AO7A 3CC5A 4YBHA 5F7EH 1J88A 1YEHH 2AABL 4QWWD 1MFDH 1MCFA 5HI4D 4NRXB 2CKBB 2NTFB 4HCRL 1X6LA 4HWBL 4BZ1L 1F6AA 5ID1A 1WFUA 2Y7QB 5D7LA 4MJIB 3D0VA 4LFHG 5T3XL 4NKDB 3DJ9A 2L7UA 1C1EH 5IBTL 3RA7L 2XWJB 4YPGA 4NYLA 4D9QD 3JSSA 4PRHE 1HQRB 4KRPD 4DJMA 1UADC 1AKJB 1KBGH 3ZKND 4HIHA 1FNEA 2FIKB 1Z9MA 3O2VL 3VD3A 4PJ8C 3KGRA 4MX7B 4XXCA 1H5BC 1Z9SA 4XCYA 4QNPF 5DJCB 4QHMA 3EOTH 2X89A 1AGCB 1NBZB 4LPWA 4N1HB 3AREC 4UT9H 1X5KA 4PBWD 3T3PE 3MLWL 4D8PA 2P47B 4F33A 3V8CA 4S1SH 2WZPD 2ICWA 4HUMB 5C0CD 1YZZA 5C2BL 1FL3A 3MPCA 4X5WB 2F5AL 2PO6A 1Q0YH 4IHOB 3VFGH 4TSBH 4L8DA 4YGVA 5D2NA 4JCMA 4LCIH 1FFRA 2NY3D 1IGYA 2VLLA 4FQXC 4UQ3A 3SGKA 3DYPA 4PV8A 1S3KL 4X5XB 3UEZA 5A16B 4XHJC 3CH1B 3MUJA 3DETC 4UOJA 5FHAH 1M6OB 1MFEH 4G6MH 1AD9B 1L0YA 3MA9H 2Y7QA 3X11B 3AROA 1IGFH 3QEQD 4ODWB 2RIKA 4GMTL 2NMSA 4MAYA 3AREA 3VD9A 4H1LA 1PGRB 4HKBB 4PJXB 1KCLA 1T1YB 1MJUL 1LEIB 4WI7A 4MSWA 4P5MB 4H0HB 5KSBB 5D7IB 4YBLC 1JGEB 2COQA 1UC6A 3QXUA 1X44A 1YNTA 1UWXK 2V17H 1FH5L 1YEFL 1DVFB 2DQUH 4MXQC 1JN6A 4UMGA 3RL1B 2E27L 1MUJA 1RV6X 4FQ2H 5E99H 5BO1L 2OJZH 5JPNA 4P3DA 5GJTH 1VFAA 3FN3A 4MXWL 4Q9CA 1MCJA 4MJ5B 4I4WA 4NQEE 4MJ6B 4LAQL 1RFDH 3K4DA 4X5WA 3UJJH 5FHBL 3MBEB 3TWCL 4K9EL 4F8TA 1BOGB 5AYUL 4J3OC 1N59B 3PG2A 1AR2A 1TCRA 3CDGA 5CEYA 1YEEL 4UOW0 1U93A 1TETH 3C60B 4QYOA 1WCBB 1IZJA 1ZSDA 5EC1B 1IEAB 3H0TA 1BFOA 1TITA 2EDJA 3CMOL 3G6JB 3ARWA 1T83C 5DTFA 4PJ8A 5IJVA 4R8WH 2Y07H 3RX8A 1TTGA 4LCYA 2LQRA 4FQLH 4PLNC 4YFEA 1FZMA 1GZQA 3CFDB 4JM2F 1CXKA 1RY7B 3H7LA 2APTA 3WLBA 3VFTA 5AG8A 1UM6H 5L2JB 1XF3B 4L4TB 1MLBA 3EO1A 1SBSL 1J12A 4U6YA 3TBTB 2FIRT 4I0PC 1YN6A 1I8LC 4YHOH 2JB5H 3A6OA 1II4E 1KT2B 3BKJH 1CVSC 2DMCA 3R1GH 4NO3A 5F7MC 1SYVA 3D9AL 4XPGH 3EYSL 2EKJA 3DSFH 3KLHD 3DECA 1IGCL 4R2GD 3P73B 4XP4H 2BSTA 3HPLB 4Y4FB 4AJ0A 2D03H 5TE7H 3MV7A 4ACPA 1JFQH 1SEBA 5F3HA 1T0MB 4KRPB 4ZUTA 1MFCH 4U1MA 1DBJL 1YA5A 3RKDC 4R7NA 1U8QA 4FABL 2VB5A 2V2TA 2OZ4L 2R2EB 3REVB 2YEZB 5E2UH 3MRRB 4MA3A 2GITA 4JE4B 1FAIL 2Z8VC 5IW1A 1CT8A 3HRZB 4M7JL 5CSBA 4U33A 4PV9A 2JE8A 4X6DF 4X80H 1OGAE 2BMKA 1BIIB 3T3MF 4XCEB 2EIZA 3T0EA 2YA1A 3VWJA 2NY5C 1ZGLA 3VFPB 2EDFA 5E1HB 5J11C 3HZMB 2CIIA 3K8LA 2IQAB 3LEXA 1CG9B 4HBCL 1Q9LB 3BKMH 5JHDA 3VMNA 2E7BA 1G6RH 3ARRA 1H3TA 4TRPL 5T1DL 2BOBB 1MPAH 3T8XA 3RU8H 1FGVH 3JVGC 1KCSH 1FZJB 4AENB 2CQVA 4L1DA 4KRNA 3BH8B 5CGTA 1YEGL 2Q76B 3HC4L 5FDWB 5EBLB 3R06B 2DKSA 4P2QB 2M26A 1YNKH 3RZCD 5FUCC 5D8JL 5I1LB 1BM3L 2VOTA 5C0AE 1MQKL 4PYHA 4AT6B 4KPHL 1KXVC 1TETL 5KJRL 3P4OA 2P45B 3MA7A 4RAVB 4Y5VC 4ZS6C 1FFQA 3LKRA 3FRPA 5I1DA 4WEUD 1UWGH 1M7IA 4U1KB 2ZSVA 5J6GB 3BRDA 5CAYB 1VKXB 4OF3A 3HE7A 2VXQH 3V6ZA 3WXWH 1DLFH 2UUDH 4ORZC 1UVQA 1WVZA 5E9DE 1B0GA 2GEEA 5FM8A 4YO0A 5FO9B 3WNPA 3ZTNL 5FOBB 4PGCA 5ADOL 4N9OB 1RIVL 4NCC1 3ULVC 5GIRA 3IU4L 1NCCH 2Y9RT 3LD8C 1WAAE 3IAQA 4X9BA 3MLVH 3CLEH 5IV2B 1I8KB 4JFHE 5JLZA 3TWCH 3UBXB 3FCTA 4Z7UB 1T6WA 1D6EA 4OI9A 3MACH 5D7SH 3L3IA 1F4HA 1T83A 3DUHA 5SWSA 1EHAA 4QLRA 1T66C 2ZOLB 1N3NB 1HSAB 4FTVD 1BBDH 4MZ3A 5DR5L 3VH8A 4NWTH 4JRYB 4R3SA 3VWKA 3ZDZF 2A9MH 5DD3L 2DKUA 2Q8BL 3SGEH 1IGMH 1AKJD 2DB8A 1QFWH 4KKAC 5DD6A 5B8CC 1T0PB 3W11C 4XHQA 1OLLA 3BKYL 3A67H 4ZUUA 4F15B 5I17B 5D7KE 2WBJB 1JWSB 1I4FA 5C0EB 3QPQD 1CFVH 5CEZE 2CIIB 3LEXB 5F7HA 3V7AG 3WCYA 1DQML 2P5EE 3OKMB 4Y16D 1OHQA 4KFZC 5L0QB 1AO7E 1YECL 1NGZA 4XNZB 2D03L 3UBXA 4PJGF 3FQUB 1ONQB 2VXTL 4LHUB 3BWUC 2E9WA 2NXYC 2BNRA 3MXWL 3AU1B 3DARA 3QUXD 4JHAH 1AGEB 1RUMH 3WHXB 4N9GA 3BKCH 1SJHB 1FG2A 2BNRD 5IF0B 5HGBA 5IR1B 1E4WL 1RJZB 1I1CA 3U7AA 5F6IC 1KJMA 2RCSL 3GSNA 1R3LB 4QNPE 5D1QB 2H32A 3QQ4A 4PRHA 4K7PH 3VA2C 2VAAA 3GHBH 1TDQA 5F7DA 2P5WE 2VITB 5SX4I 1Z5LB 3O9WD 3OGCB 3HR5B 4J1UB 4PJBA 4HBQA 5DD6B 1NCBL 3ARDD 2VDKL 5HBBA 3CX5J 5MENE 3PWJB 3FQTB 4ODBD 1I4FB 4IBLT 5I1CL 4Y19B 4X4MA 1A9BB 3ORJA 1RQ5A 5T1LB 2ICWJ 3MJ9L 2X9YA 5J1AB 4UAOB 5D2NE 3QCTH 3EYUL 3S4SG 3D85D 5MENB 4APQC 4JG1L 4XBEH 1CXHA 1HHHA 1E28B 3QISA 3PDOA 3PF2A 3V2AR 1HEZB 3O2DH 5IBLC 4HKXB 5EOCJ 1MWAL 4HV8B 3DVFA 4KROB 5JO5A 3LKPB 1PY9A 5EU6B 1FPTL 1CGVA 5E2VL 3F7RA 4PRAA 5FCUH 4P4KC 3ARQA 2C4XA 4Z7OE 1EPFA 3IVKB 2V7HB 3NABH 1W72B 1N3NA 2GJZA 1JGVL 5B4MC 2VDMH 1CE1L 4L8DB 4YGVB 4ZG1A 1K2DB 1Y0LA 4TQEL 4UBDC 2IAMD 1ADQL 3HE7C 3MRPA 1DBKL 5BZWA 5IEHB 4JFOB 5GISL 2Z8WC 4PFEA 3ARXA 1FSKC 4ERSL 4NZRH 1UJ3C 1JWUA 5D1ZD 5GS1B 4HULB 4YBLB 1U8OA 3AY4C 4Z76B 1CD1B 5C0GB 2D3VA 2PTVA 5EBWA 3QUMH 5E8DH 4D2NA 2E6QA 1HI6A 1E6JL 3PJSB 3Q3GB 1RZ8B 1OW0A 1I1FA 3RTQB 1XIWC 1RK1B 5HGGS 4P57B 4O02H 3TV3H 3GK8H 5HGAB 1BD2D 1YMME 5I19H 1Z3GH 3DGGB 4N5UA 5FKAA 4MZ2A 1OSZB 3S35L 3S3PA 4OCMC 1E4WH 4FMKA 2EDNA 1QSEE 2HFGH 4M48L 4TVSa 1NBVL 4Z8FH 1GGTA 4DN3L 5DUBA 1HCFX 1YMMB 1KN2H 3MREB 4Y8AA 1DQDL 1EZVX 1AGCA 1XGUB 2JF1A 5F88A 1UZ6F 4PG9B 3RRQA 3HNVL 5DJYA 1F5WA 4YDIH 3DUSA 2Y1VA 4ZQKA 1UH2A 1IGJB 1L6XA 1UEYA 2C4FT 1NGYB 2H41A 3G6DL 5KS9B 3QO0A 5DEFB 2FNBA 3QO1B 5L88H 1U8QB 5ACLA 4LRIA 4HAFA 4PJFA 1XT5A 4DVBB 1JCKA 5MHSE 1F4WH 4BK5A 1KENH 3EJYD 4RMUA 3VXRB 3DURB 1R5IB 3TNMB 4A2LA 2R29L 4ZFGH 4YK4C 1V3LA 3QG6B 4JKWA 1KB5A 5DJ2B 2CMRL 2VXTH 3TNNB 4M1GH 2CO7B 1HHHB 2E5EA 4O9HH 2WBKA 1X5HA 2HTKD 4Z7QF 3WV0A 4OCYL 5ITBL 1A3LL 3ZYZA 1IL1A 1LO0L 1N64H 3L5XL 4Y5YA 3MXVL 4YR6B 3X12B 1HINH 1OTSC 4MNHB 5HHPA 2O5ZH 1HE7A 5ADPH 1VERA 3QH3B 1NC2D 4UILH 3ARVA 5BXFA 3RDTD 1DJSA 2P24A 1TQCC 3SE4A 2AEIT 5HHOB 3OHXB 5C0AB 4U7KA 4ODVL 5HSFA 2VDML 3TBSA 2ENYA 3GDBA 3OKKA 2Q86B 1ZT7B 4Q2ZB 5DXWA 1QBLH 3STLB 2W59A 3RX5A 3E8UL 5F3HB 3HUJF 3MUGA 1S3KH 3VWKC 1OOAA 4D94A 3FB5A 1NJ9A 5E4EB 2MWCA 1TCRB 4G8FA 3GI8L 3OL2A 1IVLA 3W9EB 1KPUB 3NCBB 4MNQE 4X99A 1WFNA 4PIRF 4G43A 1LD9B 2MHAB 2YUZA 3KPQB 1KJ2B 3L5HA 1CD1A 3WE6A 1BLNA 1G7LB 2WNGA 3U7YL 4JJ5B 4LSRH 4F7TB 3SDXE 1AHWB 3MLRH 4K94L 3OR7A 5F96H 3C6LD 4WV1B 1EA9C 4MA1C 3CFIC 4NZUL 4O02L 3TV3L 3QHZL 4Y5VA 3TZVC 1Q9WB 2EE3A 3G9VA 1WFTA 4NO5B 1CN4A 5E2JA 2EYTA 3ULVH 1A14H 3RWIA 5D2LB 3WEXB 3DGCR 2X1PA 3D85A 3L9RB 1EEZB 6CGTA 2GHWB 1NBZA 3TBWB 4QHUB 4MJ6A 3K7UA 3HHRB 2X4SB 3PGCA 2CH8A 5DJYB 1A4KA 3QIUD 3VI4F 2IBZY 2IH3B 2ZWLT 1TJIL 3KPOA 1ADQH 4K23L 1QYGL 2KKQA 4PJEF 1YEHL 3OXSA 1MRFL 3Q5OA 3TPUB 4MAYD 1MHHA 3LQAL 5JW3H 3P4NB 4NQXB 3BQUD 1IEAA 4KV5F 4OGZA 4HCRH 3M1BA 1LD9A 2AQ1A 4N0UA 1LDPH 1OGAA 3DX9B 1RHFA 4I9WE 4UQ2A 1YYML 2X89D 5EU6E 4EN3B 3KPMB 1LP9A 4PRHD 3CVIL 2X7LB 2W0FA 2Z35A 3A6BL 4D9QE 4ALAH 2YHGA 2YPLE 4IRJD 4KTYA 3SGJA 1QG3A 4PRNA 5EPMA 1R5WA 1H15B 2J6EA 3OBAA 1LEGA 3OPZH 4FG6D 3UDWC 3GJFA 1F6LL 4CVXB 3SDCC 4JO2H 1WZKA 1N7MH 1C5DB 3OKDB 2DN7A 1KGCE 4JPIB 3E6FB 1VEMA 2FD6L 3WIHH 4EN3C 4F37F 3DMMC 3IU4H 4I13B 3C09C 4YHZL 5D1ZB 3DSFL 3PL6B 3WN5A 5LXGH 5TJWK 1FJ1A 1ODAA 2CR3A 5B39A 4MB5A 4FQLL 1ITCA 2X1XR 4IOIA 4H26B 4POZC 2B1HL 1INEL 1UB6B 3BDYH 3VU2A 1BD2A 4MWFA 4P5TB 2F53A 5GGVY 2N4IA 2AXHA 1MVUA 1T0MA 1ZHBA 5IESL 1EVUA 5IB5B 5I15H 4J23A 1UM4H 3NAAL 3QFDB 1URLA 3P4OB 4MA3B 3AUVA 4PJXE 5DD0H 1BJ1H 1G9MC 4M9PA 3GHBL 3MRFB 3M8OL 3QDGB 4POUB 4L1HA 4N8VB 2YBRA 2C1PA 4JLRB 1ACYL 3LKOA 5ELIA 3A6BH 1C08A 2YRZA 2ED9A 5TDNB 2KZWA 4Y5XC 5DDHB 4F7CA 1A7PL 3QAZB 4M43H 1FP5A 4Y19E 1HWGB 1WEJH 5EUOE 5DLMH 4PRIB 3U2SA 4WW2C 2VDKH 3TJEH 1RU9H 1J0JA 1JRHL 3WLBB 3V4UL 4H8WH 1WCQA 5GJTL 4Q9RL 3ECBB 4B5EA 2OP4L 4LMQI 43CAA 1AI1H 4GAJH 2CRIA 1A6UL 1EBAA 3C5SA 1DQMH 3UJJL 4N1EA 2PXYA 3OF6D 3O3EB 4P48A 3JTSA 3FONB 4LVOC 3D69A 4KJWD 3DRTB 3CU1A 4P5TA 1ZT4B 1HH6B 1Z3GL 2YK1H 1KNOA 2CKNA 5D71L 1JPSL 1CL7H 1FVEB 2BDNL 4ZNEE 2DQCH 3TVMD 2JJTC 3NA9H 5K59F 1H5BB 4DEPB 2EXWC 5LKNA 4Z7OF 2D7QA 3PE9A 3ZYOA 1CFNA 4NBYB 3WJLA 3TBVB 3IFPA 3FRPG 2GSIA 1BZQK 5DJAA 2X05A 5GZOC 4HWBA 1T89C 4X6CF 5T33H 1H3XA 1GGYA 2FO4B 4V1DE 1CBVH 3I75A 4XT1C 1T1ZA 2IBBA 5JMRA 3MCLH 4QY8A 5KTEL 3DX8A 4HC1L 3F62A 4BFBD 2PR4H 4LHUD 1U8LB 4RMTA 4HKJB 5K9QI 5ACMA 3O45A 2FZ3B 1EFXB 3RZCA 5MEPB 3ARPA 3BKML 1PX3A 2WBJA 32C2B 2R0LH 1VGEL 1HXYB 3M17B 4UV4L 4RRPG 2IF7A 4NN5C 3EYQD 2X4QB 1NSNH 4K3HA 1NMBL 1FE8H 1OP5K 3RVWC 4L4JA 4PBXA 2ICCA 3MGAA 1EK3A 1FG9C 3GHEL 3WKNA 1D9KB 2IQ9H 3C8DA 3U1SL 1KCVH 5HI3D 3EAKA 3CK0H 2N7BA 1S8DA 5C8JA 1MRCH 3AAZB 2XTJC 3IF1A 1GSMA 1JZ8A 1QHOA 3P9LA 4FQXD 5IW6B 1EERB 1IGIH 1CXEA 2BSRA 5JXAL 1MEXL 1VA9A 3C5JB 5B38A 3OR6B 4QTHB 5KANG 3VH8B 5IHZA 3G5XB 4D9RD 5JNYA 4TVPL 1UCBH 4NO2A 2VC2L 3GEWB 5C2BH 4ALAL 1JPGA 2XKNA 3EYFA 2BXYA 4NHUB 2F54D 1MI5B 1GPOL 1OTTC 1WEJL 4YHIA 4J3VA 3MO1B 4K3GA 1AXTH 4NFCA 3SKMB 1MFDL 2ENSA 4NRXA 2YSSB 2R2HB 3VXQB 5ENWB 2R15A 5TQ0L 1Y18B 4IMLB 1SM3L 2P43B 4PRIE 3DO7B 3SDYH 1ORQA 2MCG1 1EXUB 4YZFE 3X13B 4HS6B 5MEOA 4U1LB 1NCWL 4H1LB 4IDJL 4G7VH 2PW2B 4XI5C 1RAMA 3UBXG 3O2DA 2YRLA 2F19H 4I9WD 2A1WH 4Z7UA 4XMPH 4HIIB 3BN3B 3QDGE 3JZ7A 3ARBC 1RZKH 3ARUA 1SJEB 3CFKB 4LEXL 3VXNB 3QIUA 4E0RB 1JNNL 3TN0D 4GUPA 4KMTL 1JV5A 2JK5A 1NLBH 4NQSA 2VH5L 4N5EC 5CEXB 2JCCA 5F3BA 4MNGA 3U83A 3QDJE 3LB6C 3W11D 4AEEA 2XWTB 2GCYA 3TJHD 2HYMA 2R0WH 3D25A 1N4XH 2B0SH 2R4RL 3D39A 5IBUB 2JB6B 3EGSB 5FYLL 1F8TH 1VCAA 1T21B 4JPWH 2K1MA 5EC1A 4PJEA 1F97A 4K23H 4G8GA 5GRUL 5BRZD 3PDGA 3QQ9C 2GTZA 1MCDA 3MGTA 5D1XC 2VZSA 5K59E 4UAOC 2GJ6A 3DX7B 3FQXB 1YDPB 3ARDC 3MLTB 4X7SL 3UTQB 4HS3B 1MFBH 4FQHA 1NL0L 1MWAB 1K5NA 3PWVA 3NGBB 3ROOA 5DVNA 1DUYB 4KQ3L 1FNEB 1QPXA 5HVFB 3BSZH 5MP6L 3CFCH 1YMHB 3ARGA 3DTXA 4L8CA 1MSPA 2BC4A 4MXVE 2VO5A 4PRHB 1N26A 3D1MC 1Y6MR 1L9NA 4M6ML 1OARH 2R4SH 5HI3C 1FLRL 2MPAL 4LSSH 1VESA 4JFDA 1K6QL 4TOYL 4KGLA 4Q97A 4TTDC 3VD7A 3BXNB 3AM8C 1RMFL 2D0HA 4HIJB 4KVCL 5I75C 5F7NC 4ZYKA 3D0LA 5CEYB 2PYED 4JQVC 4OIBA 3CSPA 4JQVA 3E0GA 2DQTL 3T04D 3RWGA 3B9AA 4OLYL 4JFPA 4LDOB 1GCFA 4U1GC 1AHWC 5C0IB 3UZEA 2XXMB 3HI6L 1INQB 1S7TB 1QSZA 3B9VA 5DS8A 2Y36H 5EPMB 4WWKA 1IAKB 3JWDH 3WHE1 1HN1A 2ARJA 4U6XA 3ZE2E 5GRWA 2I60H 2AJXH 2R2BB 4TQEH 4ZNCD 2J5LC 3GJFB 5H37G 2YUVA 4Q0XH 3MJ7B 3P40A 5IG7A 3CDCA 4FFVD 4MX7A 4JO2L 1LO3L 2ZCLH 3SCMC 3IGAA 5K9QG 1NMAL 3QUMB 3WSQL 5D93C 5DUBB 4DAGH 5CZVH 1JV5B 2LAAA 1CDUA 3P4LA 3PHOB 5BV7C 4MA8H 3RWCB 1UXSB 3KYOB 3VRIB 3MRDA 3E2HB 1DR9A 4UZGA 3CH8A 1WBYA 2PO6B 2R8SL 5JHLL 1KTRL 4ZPVA 1S9YA 3S88H 3EYVA 2CRMA 7FABH 5E5RB 2X4PA 2VDLH 1NCBH 5CP3H 1KPRB 1QSED 2AV7B 4X6BB 3QEQB 4PP2B 3QCTL 3ZE1F 3WFDL 1AQKH 1ZSDB 4XZUA 3U46B 4G8GB 1HYSC 4LU5H 5HHMB 4N90E 5IT2L 4OLEA 3V6ZB 3IAGC 3V5DA 2F53E 5KVEL 3N06B 3H3PL 3IRZA 5DD3H 4WV1C 1CK0L 3CVHH 3U4EB 2VXVH 3RIAF 1ZVYA 4NRZA 5LAXB 5T33L 1H15A 1KBGL 1VADA 2P1YA 3KPSA 4MAUH 5F89B 4U6VL 5D7JC 5KSBA 1U95A 3KPRD 2GK0B 5BRZE 2FIKA 1HHIB 3O41B 5GS0D 2CDEA 1VGKB 3C8KB 4HJJL 1RUQL 2VE6B 4HLZH 1WBXB 3LZFH 3MV9E 2HVKB 3IGAB 3QQNA 3QUKB 3MRCB 2ATPB 2RB8A 4JM2C 4OIIL 3B9KC 3HLAA 3VFRB 4IRSA 1GIGH 3LRSA 1I1AA 3TIEB 2ADJB 2Z8SA 4OTXH 4LBEB 2OMBA 4BM7A 1T2QL 3GIZH 4XPFH 4EQ3A 4M7LL 1R3HB 5C6TL 4OD2A 4CNIA 3G6JE 2BRRH 3SE3C 2VDNH 4CU7A 2XQBL 3QEQA 4WW2B 1U36A 3V0WH 4TPRL 2AJUL 3BP5A 3S3JA 5HHMD 3PHQA 3RWJA 4OT1H 4R4NC 5JA8B 3IXAA 3O11B 1AGFB 1V7ML 3EBAA 4JKKA 4KHTL 3U4AA 2X09A 2FYYB 1T2XA 3DX8B 3BPNC 4ZUUB 5T5NG 3DX6B 3K2UH 4Z0BL 4XCEA 5L2JA 4N8CL 2AEPH 5I18L 2CRYA 3QULB 4NQEA 3HAEH 1KT2A 3VDAA 1QR1B 3AFLA 4GQ9L 4MNHA 3SE9H 2H32H 3LAFA 3UTZA 4JFEB 1PY4A 3EDEA 3KJ4B 5EU4B 4D0BB 5DRZA 2NY7L 4MJ5A 2NX5D 5DUMH 1HDMA 1EBPA 4HK3N 4JPKL 3E6HB 2H2PC 2PNDA 4OD2B 1XGQA 1CFQA 3ZKQD 4EUPA 3RVUC 2BJML 3O3DA 2VLRB 3ULVL 1GC1L 4P9MH 1J1XL 3RJQB 5LGJB 5EU5B 4HG4J 1MRDL 3B3IB 3LIZH 5BVPL 4I0PD 1DQQA 4JRYA 3QUZC 2YBRB 1SMAA 4X9FA 4KHTH 1XF2B 1QSVA 1VKXA 3GMLA 5K9KA 1I7UB 2QQKH 4M4RA 2DD8H 4FFZL 4V2CB 1RIHL 2NY3B 3EJJX 1S9VB 2P46B 2V5SA 4NJ9H 1A3LH 3C6LB 3RWDA 4NRZB 5DJ6B 1NANH 4HXAH 4NQCD 2DMKA 1A14L 1ZA6A 3ARFA 2GFBB 3OKDA 1I1AD 1SHMA 5FOBA 1KTDA 3O41A 1J7VR 5MEOB 4V2BA 3SCMD 5DQ9A 3QI9B 3VFVB 3QIUC 4NZTL 4XCFL 5H35A 3ZL4L 5IMKA 2HT2C 1I3UA 5B39G 3UAJC 5CBAA 5DVLA 4HIIA 1WBZB 1CWVA 4FNLL 3RI5F 5LGHL 4YHYB 4LLWB 1D9KA 5ANME 4K3JL 4P5TD 2X4OA 4D3CL 3OKEA 4KC3B 1NGWA 3WFDH 1JZ7A 1A2YA 1HH9A 5E8PA 3GBNH 3SDXB 4KQ3H 1NLDL 2DQIL 3D2UA 1REIA 2X1WL 3P4NA 4U6TA 3HC0B 5IFJB 1R5VA 5ESVB 2A9ML 3U79A 3G5XA 1T1WB 1EHLH 3VJ6B 5CEZH 3O6FC 4PJ5E 3GI9H 1QFWM 3D25B 3DX9A 2VZ3A 2VXQL 3MZTA 4M62H 1YUHB 1ZS8B 4U2ZA 1B0GB 2IANB 1FFNA 4TYUA 2FCBA 2P5EB 1IM9B 1LNUB 4Y7MA 1H3WM 4NWUL 5CS7A 2EIZB 3MNWA 3FO1A 2NTFA 1OT2A 3KYNB 4YFLI 5D2LF 5DFVC 3BZ4B 4DCQA 2GY7B 1EFXA 1OAXL 4HPYH 2A6DB 3FB8B 3NTCH 3RP1A 3UC0H 3W39A 4EIGB 4AYFA 3DO7A 4LIQH 1WITA 3RGVD 5HYJB 2OI9C 4KZDL 3CFEA 2UWEB 5CMAA 3UTOA 3OXRA 2FWOB 1QO3A 4HWZA 1KCKA 4JFQB 2X4RB 1CGTA 1H3VA 1NC4D 4QRRE 1XGRA 2CLZA 4L9LB 4JN1L 4PRAB 4BZ2H 4YE4L 1A2YB 4HS8H 2V17L 2GIYA 4AIOA 2X5PA 3BJ91 4YHNB 2OXGA 3L5IA 2NY2C 5HYSB 2OQJA 2YZ1A 4MVBC 2BOCA 2DBJA 1QQDB 1FGNL 4R4BA 5C0BA 3L6FB 3GJEB 4RFOH 2HKHH 3I3EA 1TLKA 2XYCA 4P59H 3FQRA 1QFOA 5DQDH 3BISA 4TSBL 4MMXC 5I1GL 3HE7B 1MFAH 4J1UA 4M61A 1TXKA 3SPVB 4KJPC 3QDMA 1EMTL 4NJ9L 3TJEL 4CVZB 1LQSR 2PYFA 2F58H 4BH8B 4HKJA 4YQXH 3RWDB 1YEDB 2Q3AA 5D4QA 1MLCA 3SDDC 2AEQL 2NLJA 4J3TA 4XBEL 2IG2L 2NXZC 1ND0A 4ZOEA 1CXIA 4YFDB 4TRPH 5T1DH 3V4VH 1AGDA 4ZTOL 5CBAB 3MQIA 3TZVD 4TSCH 4NBXB 4JPVL 4U6HA 5IG7B 1UM4L 2ICEB 4PJ7E 5ACZB 5D72L 3RL1A 2CGRH 4JJHA 5JR1L 2GUOB 2V6HA 4JREC 3SEPA 4AIXA 3O6MH 3OGOE 2D7PA 5HHOE 1XR8B 4G9DB 1J8HB 3K4AA 5DT1L 4C83A 2Q8AH 2FX9H 4J3SA 4WUUD 3BD5A 3MLXL 3N0PB 1BOGA 2AJZA 4APQA 2R1YB 1FNHA 3MROB 4YK4B 1G9EA 3NZ8B 2XWTA 2H2SD 1NJ9B 1WJ3A 4OZGE 1OTSD 5DZNA 4NUJB 3BPOC 2OCFD 3L95B 1JMXA 1AO7B 1I9JL 1BGXH 1CD8A 3CC5B 3VXPB 3D3VB 2J3SA 3DO3A 4JRXE 5I1CH 3U7WL 1QSFD 4P2YA 3FB6A 3NCJL 2NLJB 3G5VA 2IPKA 5J9PA 3HI6H 3ZDYF 3WL9B 1YY9D 3DV4B 3HUJE 3K81A 3U4EA 4Y16B 4X98B 4Z7VB 2ARWA 5BRZA 3PWNB 3O2DL 3PP4H 4MAYB 4PJXF 3OAYK 1RZ8A 1YYLH 2EH7H 4UDUB 1IC7H 3LKQB 5DMIH 1EFQA 4N0FB 4P4KB 4MQ7B 5L6YL 5ID0B 3OKOA 5FGSA 3AU1A 2J88H 4R97C 1YEFH 2DQUL 2RCSH 4LSVL 4WTZA 1NLDH 5KOMC 2YK1L 3GIVB 3PGFH 4EJ1C 1LHZA 2FJHB 3L3DA 4OCNC 4HCRA 5HYJD 1OT1A 4E9LA 3NCMA 4HPOL 1A4KB 3B9KA 2BCKA 5DZOA 1CS6A 2XTLA 3MNZA 3L6FA 1E27A 5DI8B 5I8EB 4GT7A 2MOVA 5GS2H 1U8JA 2NY0D 3GSOB 4HC1H 1BECA 1UEMA 4X6DE 4GAFB 4N68A 1F4YH 4YHIB 2EE9A 5EUOF 3I6GA 5JPMB 3TA3C 4R90H 2IGFH 5C0IA 4ONGL 3P11H 5IT2H 1I3GH 3F5WA 3QCVH 1RUKH 5AD0A 4Q9QL 3IDJB 3PWNA 1A7RH 1IAKA 1BPVA 4E41A 3TFKC 3DIFA 1SBSH 3SDDB 1RHHA 2OJEA 4OGXL 5F89A 3VI4E 4AMKL 5HGAA 1LEIA 2HMID 1WFOA 3KPTA 3JBG7 4ZFOL 1D5IL 4UB0H 4F7PB 1LK2B 1NCNA 1CLZH 3LV3A 5SV3A 3TIDA 1SYVB 2QADB 3ARYA 4HXBL 3WN5B 4WHCA 1R3JA 2O61B 2QSCH 1RULL 3C6SA 5DRZB 1GYAA 1NDGB 3RWCA 1JGDA 1F11B 4DFIA 2NY7H 1QLFB 3ZT6A 1KEML 3N1GC 4HHAA 4LKCA 5DVKA 4Z77B 1V7NL 4PJAA 1RZGB 2AI0L 2B4CH 3DROA 1P4BH 3BWAB 2FECL 1A9EB 5LGJA 5ICZA 4FABH 4N0RA 3SBWC 5GGSY 2MQCA 4I5BB 1P84K 1C5BH 5GGVH 1J87A 1DSFL 1LMKA 4Z78B 4NC0B 4XPAL 5C9JB 3K46A 4UUJA 2OTUA 5DMYA 3LPFA 5KVMC 4PV9B 1WT5C 4HH9A 2QSVA 1S7SA 5CINH 1IGML 4NM8L 4RFNB 5D72H 4LEXH 15C8L 4LCIL 1P7QD 8CGTA 4WV1A 2WUBH 4TUOB 1F6FB 3LKNB 1BWMA 1FYTB 2WWMD 2GFBA 4KQ4L 2F19L 1A6VH 4P5KA 3BVNB 5GS1C 3D48R 3FKUS 2WWKT 3QA3B 3RVXD 3IKCA 1F4XH 4JFYB 5DHYA 1MHCB 5DJDA 5F1IA 2FX9L 2X2YA 2Z9TA 3FB7A 3OAZH 3VH8G 3LMJL 1V3MA 3OB0H 5F7WC 1ZE3C 3L9RA 4WHDA 1NAKL 3NCYS 4PJHB 5CIPB 3CU7A 4ONHB 4LLUA 5I8OL 1E4KC 4WEBH 1SBBA 4OZIB 5LVEA 1F90H 1K4DB 2R0ZL 1KCVL 4HHAB 4MHHI 4JHAL 4PRPA 5FDYA 1L6ZA 4PG2A 4I18B 4C4KT 3N85H 2DMBA 5F6HJ 4X6FB 2UY7A 2R56L 5EUOA 3P0VH 4HW6A 3QHFL 3P11L 2E6JA 1JF6A 3LKOB 2QQLH 4HGKC 3UBXI 2AXFA 2BSSB 3RWJB 4LSRL 3T2PA 5FYJU 3EYQC 4OZ4B 1J8HE 2ZUQB 5DK0B 3KPRB 5I1GH 1IKFH 4HT1H 3PV7A 1UYWH 1MH5A 2JIXD 5ETUA 4PRBA 2VE6A 3MOAL 4QOKD 3VW3H 5TPWH 1ZVSA 1C5CL 1KSRA 3HC3H 5EA0L 1T3FB 5JLZB 3KR3H 3LN5A 3WNLA 4BUHA 2DTSA 4LSSL 3ZYJA 1FDLL 3PWLA 5EU6D 3BO8B 1QLFA 1Q0XL 4JFEE 1I9IH 5C0NC 3DRQB 4YHNA 3V79C 3BN9C 1IAIH 5AYQA 5IB2B 4PR5A 4HUXB 4OFYD 2R29H 4ZFGL 4RX4D 2XZCH 3VXOA 1U3YA 2HG5A 2V7NB 3C60A 4RDQF 4OLWH 4XAKD 1KPRA 4WI3A 1CFTB 4JZNB 4NO2B 1M1SA 4X6CA 2VZOA 1ZLSL 1MJJA 1BLNB 2FYYA 4IEFB 1I85C 1MHPL 3JWDL 3JWOH 1QPPA 4IMKA 1U3HC 4WU5A 4Z7WF 3ZSTA 1A9BA 1ZT1A 3IDNA 5K93A 5F7YC 3L3KB 3EHBC 2YD9A 4JRWA 5SWZA 1T04A 4KAQH 3KLHC 5HYJA 4ODXA 1WTLA 3GMOA 3QDME 5GGUA 2BVEA 4LLQB 3VXUA 1YEKH 1JWMA 2YKLH 5D5MF 4ZDHA 3RY5A 3REWB 1XF1A 4XPHL 2CRZA 3ARDB 4UDTA 1LVEA 1FLTX 4M03A 5JW4R 1S9KC 3TIEA 1WBZA 4IOSD 5GS0H 5I16B 4NZJA 4ZUWA 4Z0XB 1JZ6A 1S7VB 4QTIL 2R1XB 1NGWB 2R9HD 3O0RH 1FVEA 3CFCL 2QQNL 5D70L 3GSRB 5J1TC 2J88L 5I30L 5B38B 4S2SA 5BVPH 4DGIL 4MAYC 1OY3B 2YPKA 5HHNB 5E03A 1LE5A 3M1BB 4K94H 4IDLA 1AD0A 3EOYG 3V6FA 3ALPA 5HHQA 15C8H 5I76B 1TJGH 5DQJB 1MJJB 2VRAA 2NXZB 4RA0C 2BXZA 1FV1A 3N1MC 4K07A 1IM9D 2B8OT 2W0KA 2Y07L 4L3EB 1GGCH 3MBEC 3CLFL 1ZLUK 2VUYA 4BSWB 4L4TD 1IM9A 1LNUA 3PWJA 3MR9B 5H37H 3G5ZB 4BKLA 3TYFA 4WY7L 1C7SA 1JYWA 5J1AA 2HT4D 2VLJB 5E8OA 4ONGH 2ZP0T 4KWUA 3PL6D 3GRWL 5IJKA 4HIXL 4YDLC 1RD6A 5E08L 3VXMB 1Z9OA 4XWOD 2AS5M 4OIIH 2L0DA 5EBLA 3JV6B 3LKSB 4CBPA 3UPRB 3OZ9H 4NHCL 5B8CB 2EYRB 3IDMB 4OUUB 3F7QA 2R1XA 1SJHA 5IR1A 4EUPB 4OGYL 4JDVB 5HXMA 4PLKD 1BFVL 1JGUH 4C83B 1TZHB 4QGTA 5AEAA 3QWRD 5CGMA 5BMFH 4GRWE 4MJ4A 4ZFFB 3X3GL 3BX7C 2R1YA 1KEGH 2EYSA 4DZ8A 1EJ6A 1D5MB 2XN9E 5EWIH 2ZCKL 4BH7A 5GISH 2WM0A 2UVEA 2VLKD 1GGCL 4LHJB 3MRMA 3GSUB 4HQQH 3LQMA 4H25A 4G6JL 4PJDB 1DQLH 1OD7A 1OGTB 4ZXBA 4GSDH 3X11A 3MMEB 4HUWB 4FFVC 5EBWB 3MV01 4AEIL 5SWZB 3MYJA 4UNUA 4Q9QH 3MLTA 1C1EL 1I1FB 4GKNA 2PW2A 3FMGH 4P9HH 1OAQL 4HWUA 1EO5A 4KPHH 3F8UB 4MAUL 1O7SA 1YNTB 3QHZH 1JPTL 1CU4H 2FR4B 2NNAA 3CD4A 2CLZB 2HN7B 3BDYL 3IF1B 5EU6A 2DQCL 2ZCLL 5J3HC 3QXDB 5EC2A 1MCWW 2AJVL 2A74A 3SDAC 4KUZH 5CP3A 4M6NL 4CADA 1YMMA 2OQJB 1Z9LA 3LHPH 3O81A 2MQ3A 3OR6A 5GSRA 4I3GA 1WC7A 4K9EC 3IFLL 2C3VB 3VGAB 3QI9C 3S5LG 3VI3F 4W68A 3WIIH 4NPYB 1QSFB 5LBSH 6FABH 5B3NA 4L3EA 5EH1A 2WIIA 3NIGF 1G0DA 1NC4A 1CLCA 1AY1H 5DGQA 3U0PA 5E70A 2R0LL 5JPMA 4LCWD 5FUOH 4JHZA 1UB5B 4HUWA 1U8OB 5DA4A 4LPYA 1A6TA 2HVJA 5EZOH 3SY0A 4FNLH 2OTWA 2VDOL 5AD0B 5AUMB 3CDYA 3QUXC 3T0BA 3CFEB 4PJFE 1E4XH 1N64L 4PGBB 4MCZB 4PRID 1VFOA 2BY1A 2YD4A 3IDGB 1XR9B 4MDIB 1D9KD 1TNNA 4KHXL 5MERA 4PTUB 2HVKA 3GMQB 1RUAL 1FG2B 5IF0A 3GBNL 5GRVL 4G9FE 5C08E 3MBXH 4XVTL 5DHXB 3ZDXF 4HXBH 4NNPL 5IROC 5HYSG 3GSWB 2YC1A 4XPGL 2VAAB 4AG4L 4Y88A 5K9OB 2BSTB 3G04A 3JWNC 3VRJB 1I75A 1TJGL 3NA4A 5E2TL 4WRLA 3GI9L 5C0JA 4I1NB 3STZB 3RNQB 1I8LA 1GOFA 1U91B 2OXHA 4CW1A 2QJDA 2XZAL 3MJ8A 2A77L 3PABB 1CD9B 5DUPL 5D6CA 3BPOB 2GTZB 4JR9H 1LP9B 3DURA 1T20A 3IDIA 1W8OA 2DTMH 5IIEA 3NGBC 1ZLSH 2DJUA 4OCRL 4WUKL 4NQCA 4PJDE 3QUYC 1BJMA 4HLJA 5KVFL 5KZCB 4JZOB 5D1ZC 4N0FA 2IPUK 3PXJA 2ZZUT 4PRBB 2HLFC 2HLAB 4DVRL 2CUHA 1OQOA 3Q48A 3ARBD 4I0KA 3BKCL 1YMHA 2YOCA 2DQEH 4HS8L 2ED8A 3BFOA 3SJVD 4I0PA 5JPNB 3MLVL 5JA9A 4QHUA 5DQDL 1INDH 4AG4H 3LRSB 1YEGH 2NYYC 3HC4H 1F02I 1X3DA 2NY4D 4XPHH 5EWIL 1H8SA 1Z2KA 4WNQB 5DK2B 4MLSA 5IB5A 4NJAH 4X6EA 4ZYKB 1D5ZB 4R7DA 4DKFL 1ZK9A 1NAMA 1ZLWH 3FQNA 4GRLA 5KSAB 1O5DT 4WW2A 4V1DB 2X44D 1A7QH 3MODH 1B90A 1J1OH 1T1XA 4JKPL 4GMSH 4OZFG 4PJ9B 2GT9A 2B20A 5GRXG 2ZG2A 4DGIH 2GYSA 1BVLA 5IGXH 5J9PB 3LEVL 5IHUL 1FFPB 2QR0B 3WDJA 4YDJB 3SY0B 5DGRA 5JIHA 4OV6F 4JY4A 2BFVL 3TBYA 2VDRL 4YEEA 5IM7A 4E5XA 1M7DB 4ZO6A 5FO8A 3LZFL 2V2XA 4ZS7L 5E7BA 5GIRB 2CKBH 2VZUA 4MQXC 4EZMA 3T4AA 2A9NL 1KN4H 5F8RC 4M8QB 5A2FA 1VGKA 3C8KA 5EZLB 4GAYB 1DVFA 4QHMB 3RU8L 2PO6C 2HWZL 1MHCA 3Q6GL 4J8RB 3PGDB 3CZJA 4IIQC 2XG4A 2Q76A 3IAPA 5FDWA 3H9SE 2DQGH 3MRBA 3TGXA 2P48B 4EVNB 3QO0B 3GSVB 5I8EA 4JRYE 2NY6C 4NSKB 2AJUH 3QFDA 2DI7A 1CGUA 1YEJL 4Y4KB 5GZOD 4WW1A 4OSUL 3MFFA 4PJFB 3RVTC 5HHNA 4PJIF 3WUWG 3VFMA 2DLFL 2GY5A 5J6HA 2CIKA 1P6FA 1XIWA 2VZ1A 2YXMA 2ITCB 3KLSA 1FZKA 4N8VA 5DO2D 5INDA 3WNNA 5CJXA 4HWBH 4BZ1H 5IK3B 5D7JB 3CVHL 1H9VA 5TE4L 3FN0H 2OR8A 1WAAA 2R69L 3HPJB 5E5MB 4KKLC 3BKYH 3MR9A 4GKZA 4NWUH 1KB9J 1FCCA 3SDDD 3B5HA 5CD5D 2NY1D 1ZA6B 5FGCE 3FOMB 4APQD 1E4KA 3GMOB 5CJBA 1ZHKA 1I1AC 3HCVA 1S7WA 2H8PB 2MKWA 1VFAB 3KYAA 4PTTA 1L7IL 5I8OH 3BRFA 1ZHLB 4JO3L 4HFUH 4LBEA 3C2AL 3HNVH 5E4IA 3PWLB 2EDXA 3U1SH 4KI5E 1UM6L 5FGRA 4ZPTB 3D5OF 1GC1H 1CF8H 2N1KA 4NC2B 1PG7X 4EN3D 1U8NB 2P4AB 4AZ8A 4JZJC 3P0VL 2PTUA 4JZNA 4CRPA 1X9QA 2APXA 1UWEH 5DJZB 1OB1A 1PLGH 4PRPE 5E6YA 4BH7B 3PQYB 1YJDH 5IW1B 1PSKH 3MLSH 1KLGB 3GMLB 5K9KB 1IQDB 2PTTB 1RZJC 4WFGE 4HJGB 2R0ZH 5I1IH 4QOKE 1XGTA 5CJQH 2JKXA 3NOIA 2FZ3A 4WU5B 2AEPL 5ISZB 4DVRH 3G5ZA 1NH6A 4KK8C 4FFYH 4E5XB 2B2XH 5GRVK 1Q9WA 3VFPA 3HZYA 4OUOA 1U8HB 3KYMA 4YHLL 3OTTA 1MAJA 3SDYL 5JQ6L 4QRUB 1AGBA 5EOTB 5DJDB 1RIVH 3GKZA 4GW5A 3S34H 4HUKB 4NOFA 4PRDB 4FG6C 2K7QA 2EE6A 2I27N 3JTSB 4AEFA 4LLUB 2G75B 1LILA 1T7YA 5EU7E 3QJHB 1RZ7H 4XCCH 5TDPA 3VFSA 4GUPB 1MY5A 2HJLB 2E6PA 1KNOB 4FMFA 3HB3D 4GRMB 5JUEH 2O5YH 3I2CL 3BEWB 5FYKU 1ZOXA 2IFGA 4QF1A 4XVUC 5E1AA 2W38A 5DURD 3ARGD 4JFXB 5C0ND 3HR5A 1B0RA 4GJTB 5SWSE 4K8RC 2E7LC 2FO4A 5F1OB 2CR6A 3HZVA 3S96B 5I1IL 5D6DC 1Q0XH 1RUQH 3C6LA 5GS1A 1XGTB 5C7XL 5E0QA 2D0GA 2FRGP 5I1HH 3FO1B 3WD5H 4JN2B 5DJ8A 1W0VB 2X4UA 3OG4B 3IS1X 2ZNWA 1I9EA 4RIRA 1I3VA 3M8OH 3ILQD 4QOKB 1EX0A 5AWNH 4F9LA 5JQ6H 4U3XA 1EDQA 1RSFA 5T1LD 3LQZB 3VXSD 3MGOA 2FECI 4QRQB 1MJ7H 2EXYD 4RGOH 1ONQA 1QO3B 4HWZB 4N90D 4X7TB 1P69B 3O2VH 2FEEL 2ZUSA 1VFMA 4NQDA 3U9UB 4FQPA 3SBWA 4Z0XA 5KAQG 4L8CB 1KULA 4G9DA 1ZTXH 3Q6FA 4WUUA 2AK4B 2EDRA 3QHFH 3CLEL 5HI4C 3C5JA 2ZSWB 3QIWA 1UM5H 5KS9A 1E27B 4YHPA 2DWEB 2C3VA 4NC1E 1Q94A 3RNQA 1QBAA 1MIML 3T1WA 3AY4A 1RZJL 2XZZA 1UYWL 5F7EL 2CUIA 3MACL 4Q6YA 2XFXA 3FRUA 3BOVA 2PTTA 3MNWB 4JFFA 3AB0C 3V95A 5JXED 4I8DA 4UTAL 2HFTA 2X1OA 4CVUA 1A1OA 3CDFA 2G60L 1QZ1A 3HC3L 4OZFB 5EA0H 1S7TA 1KC5H 1YEDA 4JR9L 1KFAL 2VTFA 4OM1H 1DP0A 1NQBA 4HUVA 4G7YH 1E4JA 5ALCH 3SCMB 3Q3GA 1F3DJ 4DOHE 2XWJA 3EZ8A 4YPGB 3MNVB 5FIEA 4O00A 3HNSH 3FFCE 4O2CA 4PJIE 2JLLA 5BZDB 4OBRA 1JI2A 4QXUH 3TP4A 5I16A 1NFIA 1HYSD 4MS8C 3BYYA 4OCLC 4MYWB 4MXVF 2VJXA 3GKWH 1ACYH 4RDQG 3O4LB 2ESVE 5JW5B 4JHWL 2W9EL 3QQ4B 3ZMRA 1FL3B 5HGHA 4JO1H 3S9DB 3PDDA 2F5AH 2APVA 2W92A 1F90L 5GS0C 1CLYL 1KG0A 5I1KL 1L7TH 4NPYA 4UU9B 3MRMB 3I3BA 5F72S 4JM4H 1A7PH 2NTSP 3OAUH 5HHOD 1P1ZA 2NQCA 1PW3A 3KPQA 1F4WL 2IANE 4R6UA 3IJHA 3MOBL 5I0DA 2HRPH 2FX8L 1S9WA 4JN2A 3JWDC 1W0WB 4RBPH 1T6VN 4WO4A 1FFPA 4YXHL 1ACZA 4OZGB 3AC0A 1BVKA 4WWKB 1FZMB 3N9GH 3SGEI 2DM2A 4QT5A 3TNNA 3IRPX 3LQZA 3RVVD 3TYGL 1U0QA 3TO4C 4XRCA 4AK1A 5LGKA 4XP6L 4LHUA 3C5ZB 3CVHA 4Y5XA 4C56E 1CGWA 4LCWE 5GGTH 3TBTA 4BJLA 3RIAK 4YDLB 4AMKH 4PRPD 1IL1B 4P23D 1YC7A 4OLZL 1DZBA 3HI1B 3GUTA 2EKSB 3MX0A 2WBWB 4KK5D 1JBJA 4JVPA 5I30H 1NGPH 3BHBB 3G5YB 1F2XK 5ANMB 2QQNH 1PX4A 1PKQE 1CL7L 3LHPL 4J8RA 3BW9B 3QNYB 1BZ7B 5HYSA 5F44A 4XPTL 4JHWH 1G7PA 2FJHA 4IIQA 1NCUA 4BA8A 2DQHH 1OF2A 3BYTA 5D5MB 2P5WD 4Q74A 3TO2B 5CEZL 1CLYH 2WIMA 4WIQA 3P0GB 1QYGH 1JTPA 1MFCL 5KAQF 5E8NA 1CF8L 3NFSL 4WGVB 4EXPX 3TJHC 3RTQD 2E8YA 1GZPA 1CFSA 4Y4HD 3WS6C 1YEJH 3O8XC 4PJDA 2B5IB 4B50A 5IWLA 5E6ZA 4QO1A 2BERA 5C0DA 5ISZE 1N6QL 3WL9A 3JTTB 4O4YL 1UXWB 1INQA 3AVEA 2A6IB 3HE6B 1T20B 5C3LD 1KB5B 4WFFD 4X80L 3WFCH 3T0WA 1OSPL 4YXLH 2O5XH 1OPGH 4Y5XB 3O3AA 3GBMH 2P5ED 5EOQL 1X5FA 2BNQA 3SGJC 2X4TA 4F9PC 1KIPB 5EIIA 5IBLD 1EEYA 5DJXA 3AMKA 1J0HA 1CZ8L 4IM8A 4X9HA 2VSDA 4XCNA 2OP4H 5IEKA 3X12A 4EBQH 1YPZF 3BIKB 4N0CD 1BZ7A 5FV1L 5BXFB 1IE5A 5CCKL 5F9WB 4JO1L 2HTLC 1HZHH 3H9SD 4XWGL 3DWTA 1A3RL 3GSOA 1C12A 2VXUL 3RPKA 1U8NA 5DEZA 2V7NA 4EUPH 4R2GB 4O2FA 2FL5B 2NZ9C 1DQJA 3BUTA 4X6BA 3KPPB 4OLVH 5CHNB 1UQSB 5F93C 2WK2A 1OVZA 5C09B 5DMKB 2BNQE 4XTRC 4IJ3B 3RY6C 3MLPA 1P2CA 1DN2A 2XTJE 1A7RL 1IARB 4XP9L 3OG6B 4WI4A 4R8WL 4QHNB 1MCHA 1T7WA 3BQUB 5ISZA 4LGPB 4JY4B 4NQUA 4XX1E 3LKQA 4YAQB 2VLKA 1AKJA 4PJ7F 1YY8A 4HT1L 1KV3A 4WCYH 3MLUH 1N7ML 4JANB 5JOPD 2Q6WB 4XCYB 5CP7A 2XY2A 5JOEA 1T3FA 3CUPA 3MA9L 2N56A 4KY1L 1HKLL 4TNVF 4OTXL 4CUCA 1E6OL 2IH1B 3L3OB 4LAJH 3TA3D 3L3DB 2Y4SA 4Z9KB 1TIUA 1ZHLA 5KSUB 4H26A 1JUFA 3WFZA 2DL2A 4KMQA 3C2AH 2ADJA 5DFVD 3BDXA 2Z4QA 5FM5O 5DWUH 5K9JH 3WFHB 3FHAA 5DC4B 1ZT7A 3D6GA 4P23B 3CXHJ 2X4NA 2XZAH 1KIQB 2YD7A 5GS3A 1XGYL 3CH1A 1TQBC 3QIWD 3B83A 4QF1B 4X8XA 5E1AB 5ICYA 1RI8A 2FEDC 4FQCL 4N0UB 1INDL 3QJFB 2FDBP 5C08A 1YUHA 2VERN 4MNQB 4UOW1 1R24B 1VFBB 5IK3A 3OKNA 3F7YA 3S35H 3J8F7 3P2TA 5SWZE 1F3JA 3U6RA 2ARJB 4OZIF 2A2QT 2R0KH 3CFDA 3MBXL 2JJVA 3V4UH 5ERWB 4PG2C 5GSVB 3O6KH 1FC2D 3H3KA 5EIIB 4CMHC 2A9NH 5FYKD 4DQOH 3NFNB 4PP1D 2XN9A 4L4VA 2OYPA 4GAYA 2WBJC 3I6LE 4AEIH 3ZTJG 1SY6A 4DN3H 4HDIA 5HPMA 3S5LB 1OAKH 5GQBA 4JAMB 1KCSL 3C2SA 5ICXB 3DSNA 4FQIL 5D71H 4Y1AA 4RGND 3P73A 1F3RB 3GMNA 5T3XE 3MRHA 3QUYB 5C92A 2IC2A 1T89A 3TZVA 4OCWL 4P99A 1M05B 2ADGB 4WHTB 5GRZA 5I66B 3ULUD 1XGYH 4QRRA 3BWAA 4PD4J 3MRGB 1R6VA 4ETYA 1CFNB 1TVHA 2VYRE 3B3IA 1T1XB 1D3CA 2DLTA 5SX5K 1DEDA 1HSBB 2UUDK 4Z78A 3OWEA 3G6JA 4J3XA 4JFFE 5CINL 1A0QH 5JIKA 5I8CA 1XF2A 4FZEH 3RIFF 4WU7B 1F58L 2PF6A 2QV2A 4OKVA 5TDNA 2AKRB 1F8TL 2W91A 4PRNB 5ISZD 2VL4A 3K1KC 2DBLL 1LWRA 4M43L 4PJHE 4PS4L 1BEYH 5KS9E 3MMEA 1CDYA 1FYTA 1QRNA 4PJCE 3DOSA 3ESUF 4PJBF 2UZYB 4FXGB 3ZKMD 4L3EE 2R23A 5ADOH 4Z7UF 4ELKB 1FDLH 4Z18A 4YXKH 4G9FB 3C09B 2DICA 1S7RA 4NQVA 2ZUVA 3IT8D 4N9GB 2CGRL 1UZ6E 3QWOA 4QXWA 4G42B 1MVUB 4CMMB 2FBJH 5JIPA 4QRRB 5HJ3B 3BD4A 5KVEH 4AT6A 4YUEH 1O7VA 1W72A 3OJDA 4G8IB 3P9MB 2QKIA 1I3RB 1V5JA 4C54A 1ZLVH 3UYPA 1Y0LB 1ERNA 4ODSL 4ORGA 2EDEA 4HFWB 3T1FA 4U1NA 3EFDH 1ZLVK 1CTOA 2VIRB 3L7EB 3QDMB 2XFXB 3FRUB 3I84A 4HK3J 5D7IF 4ZAKA 2DKMA 1CXLA 5BOZG 2FGZA 1S5IH 4G6FB 1JGLL 5CGYC 3HZKA 5HI5D 1P4LB 2GJJA 3T0AA 2XWBB 1QVOB 3IDYC 2XKUA 4OZHF 4YHLH 2ZUQC 1UWGL 3BAEL 3FOMA 5D1QC 1JF1B 4DKDC 1MWAH 2BOBA 3SDAB 3GMPB 5EUKB 4DW2H 3FTGB 3REWA 4NT6B 3TYGH 3NCEB 4LNRA 5CMAB 3WKML 4QRQA 4GG6B 1FJ1B 3QYCA 3V52H 3V4PL 3I50L 4DTGL 3RX7A 1RIHH 3KJ4C 3ULSA 4RSVA 4TTGA 3UZVB 3KPNA 3OV6A 2FR4A 2IAMA 1PG7L 2B39A 2VL5B 2ZJSL 3U9UA 3EDFA 3BKJL 1B2WL 3BSZL 3FT3B 4FZ8L 3L7FA 4J3UA 3LCYA 5HJ3A 5IFAL 1FPTH 3O2WL 2BSRB 3HE6D 3LKRB 4J2XA 4L8BB 1N4XL 2B0SL 2PXYC 3D2UD 4YHKL 4XH2B 3PXHA 4XAWH 3MROA 4FXKB 4XNXH 5E6ID 2D7OA 2VQTA 3OPZL 2AK1L 3OGCA 2CUMA 4XVUD 1A64A 4GFTB 4NUGH 2IADA 2HJKA 3VMOA 2W0PA 3ABZA 3K2MC 4XWGH 1FFOA 5IOPA 2WUCL 1M6OA 3VXMD 3O0RL 5GRUH 1KJVA 3HZKB 1PD6A 2X4UB 5GRYA 4PY7A 4P2QE 1NFDF 5EOCH 4ZTOH 3C5SB 5L2KA 4X98A 1EAPA 4QT5B 4LSTL 3MJ7A 3WFEL 3EHBD 3JUYA 3RWEA 4XC1H 2XA8H 1B3JA 5IEKB 2MTPA 2VH5H 2HTKC 3JWOC 5KVGH 5IUSA 5SWSB 2OL3B 3AM8A 3KYOA 1S7XB 3GSRA 1R3LA 1ZV5A 2ZSWA 1G7PB 3Q6GH 1HOCB 3EO9L 1RMFH 1G7HB 2NY2B 3F7VA 1D5ZA 4R7DB 4ZSOE 2HLFD 3SOBL 4J4PA 3QG7L 4PJAB 4HKZA 2BX5A 1SVCP 2D7MA 1IT9L 1GAFH 4G9FD 5C0FA 3H9SA 4WI9A 4QY8B 1T21A 4J4PD 5FHAL 4GG8B 2DI8A 4KK6D 1KCRH 5F70A 1U3ZA 2JCCF 2CKBA 5CJQL 3S8WA 4ERSH 1CICB 1OAUH 4Z76A 3A6CL 1BIHA 5C0DB 5LCVL 5DS8B 1OW0C 2AW2A 2HFFA 2ZCHL 1I1RA 3GB7B 3P9WB 3QPXL 4QEGA 1IEHA 4EOWH 4QOKA 1G7QA 3P4MA 2WMPA 3K80A 3PJSA 4WO4C 2C3GA 1BMGA 2H3NA 2ZCKH 3IETB 1MLBB 1YNLL 5EO0B 5CZXD 3X3FL 4KU1A 2WLYA 1JGEA 5GGTA 3IFNH 4XCCL 4MCZA 1XGRB 3V0AC 3EOTL 3WUWA 4JANA 4EI5D 3MRCA 5HHPB 5DYOB 3QCUL 3VWKD 1JGUL 5D7JD 1RULH 3W9DA 2QQQA 4UILL 1FGVL 2V9RA 3PGCB 5E99L 1BP3B 3SDXF 2YC1B 1WIOA 1WWCA 3TT1H 5D6DA 5D5MA 5LBSL 4K7PY 4NJAL 3P30L 2JELL 5DEFA 2G5BB 1FRGL 1U8JB 3OJMB 1CU4L 3V5KB 4UV4H 4U1GB 1FO0L 1JGLH 2B1AL 3WD5L 1G1YA 3HE7D 3U0PB 1QEWB 1N5YH 1CD0A 3QDGD 1YECH 5FYJE 2E3VA 4PJEB 3T77B 1FZOB 5ENWA 4ISVB 4UUJB 2W0FB 4PJ8B 3RUGA 3QZWB 1KENL 3VFUA 1UKTA 2AGJL 2QTEA 4K7FA 3UYOD 3SKNA 4C58B 3X13A 1CK0H 3W5NA 1NMCB 4CDHA 4NQCB 2KL6A 5A2IH 5F9WC 3K2UL 4X0KA 4Y2OA 4Y5VB 3EJZC 3HNTH 1P7QA 1DBKH 5EO1A 1RK1A 3IJSB 3I6KA 4OB5L 2P8MA 2NR6C 2B2XL 1DBBH 3ULUE 5A40E 1FBIH 4QXGL 3PP3K 3RDTA 5E2WH 1UJ3A 3VXSB 4UBDD 4P3CL 3C08L 5KSUA 4PYGA 4U7MA 3OAYH 4LRNH 4M1DL 2Z31C 4IOFD 5FKPA 1JGDB 5IVXA 4GOSA 3ZDZE 2FX7L 4NUGL 5IVNA 3WFHA 3BXNA 4NGHL 9CGTA 1WAAF 4NN6B 3MRRA 4WTZG 5J0BA 3W9EA 1DBJH 4EQ2A 1M71B 3MCKA 4IJ3C 4ZSOB 3S4SA 4UQ2B 3VFWA 1UQSA 3PWPB 1IAOB 4OLXL 3ZO0A 5EZOL 4KK6C 3MRJA 5SWQB 4LSQL 2ZKHH 5I74C 1TFHA 2AJYH 4QRTB 5TFSH 3U36B 5DD1H 5D1XD 3DLQR 3MLYH 4LCCC 3OR7B 3IDNB 3IFNL 4P4RA 5DC9B 1EEYB 1Q9LA 3VW3L 3KXFA 4ENEC 4KRPC 3JV0A 3BVNA 1A1NB 4G8EB 4PGEB 4XNMA 1XGPA 4NN7C 3BIKA 3IFLH 5FYLE 5GXBB 3W9DB 2V2WB 4W4OC 1QFWI 1Z6JT 3BW9A 5CZXC 1P6AB 4JRXA 5TE7L 3GIZL 4XPFL 1HYRC 4JAMA 5ICXA 4TUJB 4WNQA 1ZHNA 5D2LE 4YH6A 3QWOB 3V6OE 1RUML 2CLVA 3MV7D 3CGTA 1NKRA 4WFEE 3O3DB 4MJIE 4QCIA 3V5HB 1IFHL 1GL4B 4JY5L 3R8QA 4DVBA 2OTPA 2VDOH 1CLOH 4PLJC 3ROLA 4LLVA 3S4SB 4L8SB 4Z5RA 4JY6A 3BD3A 4LAQH 5CCKH 1EFXD 4F7MA 4K8RL 5GGRY 3U36A 4F7CB 1PQZA 4I3RL 2H1PL 3ZSSA 4PJFF 5FAAA 1F42A 4RWYL 4HQQL 4P4RB 2W1NA 2BNQB 5DMGD 4KJWC 3IJSA 3VCLA 3MCG1 4NRYA 4S1SL 3KYMB 1SM3H 4PY8J 4ZFZB 5CUSL 4GXUN 1KCUH 1MCRA 1I9RL 1FIEA 1OP5H 1BQLL 4I18C 3MV8E 1IAMA 3B2UC 2YRPA 1RJLA 4OUUA 1F11A 4X7CC 1RJZA 1T7VA 4S1RL 4Z7NE 4DN4L 1S7VA 5IW6A 1XGQB 3MRLB 5E8PB 1IFHH 5BVJA 4WCYL 2I26N 2X4PB 3NFSH 4LDEB 1HK6A 2P8PB 1NGXB 3BI9X 3GRWA 2PUQT 4PJIA 2MCPH 1DVFD 4FXKA 2ZSVB 3RGHA 4H5SA 3G08A 2EC8A 2AV1A 5I76A 3SGDI 3KJ6H 2EO9A 1GGBH 5TGBA 4UV7H 1ZA3A 3VXRE 2HJKB 1IGFL 1HXMB 3IU3A 2PYFB 2LU3A 5H2BA 4L8SC 4XBPA 2ICWI 5I17A 4LSUL 4HJGA 2I5YH 2NX5B 4LFHD 4LLYB 3DX6A 5DJ6A 3SKOB 3PIQA 5FO8B 1LEGB 3SQOL 4Q0XL 5E2UL 1NSNL 3ZDYE 3GRWH 3INUH 1T22A 5JW4Q 2DS4A 4UB0L 4RIRB 3DVNA 1LGVA 5SV4A 4F57L 4LASL 4QHKJ 5BJTB 4JPIA 3TCXA 5HDBF 4HJ0C 2FLRT 3VDCA 5HHME 5KN5B 3ALXA 4Q6IB 1PKQA 2GW5A 2EECA 3ZDXE 1OAYL 3OZ9L 4MD4A 1NDMA 1T5XA 3UTTB 4R2GC 4WUUE 4RISL 3HKFA 4EVNA 2VSCA 4MWFB 4ZUSA 3IVKA 1NUGA 2ZOKA 2I9LA 1IC5L 4C56A 2X4NB 3NIFE 3WO3B 4M7ZC 3MFFB 2J8HA 4BUGA 2AJSH 3F7VB 3NZ8A 4Y4KD 3P0YH 4OFPA 4NQED 4BYHA 1RZIA 4D0CB 2NY5H 2X7LA 2Z35B 3LOWA 4PGJA 5EU3A 2H1PH 5H2BB 1GOHA 3SO3B 2P5EA 5E5MA 4YC2C 2J6EL 4LVNB 3I6LD 2DQTH 1S9VA 3VXUE 1EZVY 2BHZA 2DYPA 2HFGL 3PIQB 1Z0NA 3LMJH 5ID1B 4WVRA 4E42A 4DCQB 1NC2B 5IQ7L 1HXYA 3M17A 5HDLA 1W72L 5CKGA 2EZ0D 4FTVA 4M6OL 5EZIH 5BJTA 5BOPA 2ICES 2HA1A 1PFCA 1FL6B 4OM0H 1UH4A 3VXMA 5H35B 4KGJA 3OB8A 4MQ7A 1OL0A 1BX2B 3KS0H 3JWOL 3ZYIA 4GXVH 3LKPA 2YWZA 4IRJC 4UI2A 3OKYA 1JPTH 3QJHA 3UPRA 1C16A 5D1XB 4OD1L 4LLWA 4WFHE 5CWSB 5C0RL 1NGPL 5BQ7B 4G42A 4I77L 4M7LT 1Q9KB 4KMTH 3TM6A 4OCSH 5I2IA 3FFCA 5EORL 1HH9B 2BCKB 2X9XA 1LE9B 1G7IB 2FJFB 2QSCL 4MQSB 3SQBA 1SEQL 3MV7E 3SJVB 3FFCD 3MLZH 3MRQA 4JFXA 2MFNA 4ZFFA 4AQ1B 2VITA 2HFEA 4HKZB 4NUJA 3FQWB 3S96A 1IZKA 1X7QA 4OKVB 1A6ZA 1AC6A 4K2UH 1CDHA 1YN7A 3PQYD 1LDSA 2JJSC 2Y25A 4FQ1L 3UTSA 1UXWA 2EXYC 4P2RD 1VACA 5FA4B 1Y18A 4LP4A 2AXJA 4ZTPL 1BVKB 4FTVB 1YDPA 3C6LC 4FXGA 2A38A 5EUKA 5H94A 2Q20A 2H3NB 1JWMB 1OAZH 3EUUA 1DCLA 4OGXH 4MXQD 4UINL 4KTEL 3VE0B 4YIQA 3EYOA 4U6HB 3DGGA 5FKAB 4PJ5D 2OK0L 3H9HA 3WIFA 1AQDA 1MCLA 2LU4A 3RUGF 2EIDA 1Y6NR 4ZMAT 4U1SB 3BEVA 2W65B 4M3KB 5T3ZL 3NN8B 3OHXA 3O6ML 3HN3A 2ORBL 3KWWB 5C0AA 2JJSA 5MP6H 5K9OA 2QQKL 3BEWA 5JW5A 1INEH 1MCQA 4YJZL 4YHPB 1DUZA 4R4BB 4LKCB 2GK2A 3WNKA 2Z31A 3U4BL 4MB4A 4ENED 3D39B 5DWUL 3W2DL 4WDIA 1NAMH 4XXCC 2IPTH 3QIWC 3UTTD 2BNUA 1I7TA 5IB4B 2XKSA 2I24N 4OGYH 4OLYH 4X7DC 4TVPD 1DN0A 2XV6B 4Y4KC 4AIZB 1J18A 1G84A 1OGAD 3QZWA 4FQCH 5DFWH 1CLOL 1F2QA 4XB7A 2O93L 1CR9L 3BQUA 3MGOB 3ZTJH 1I85A 2FGWH 2K9UA 3TEUA 2A6KB 1RHHB 2OJEB 4O58H 3HFMH 4XVJH 3O3AB 4P5MA 4QTIH 1AE6L 1G9ML 1EJOL 3VGBA 4PJ5B 1MIEH 1IBGH 4E41D 3VGDA 4PB0L 1FYHB 1MY7A 4RAUB 4PTUA 1XAUA 3D18B 5D7SL 2OL3L 3B9KD 3QIUB 1JVKA 2BDNH 1KPVB 3JXAA 4M93B 3GNMH 3FHQA 4N8VG 4LP5A 4U49A 3KHOA 4OQ1A 1S5HA 1BQLH 1LO4L 3MRBB 2V7HA 4BQ8A 1KJ3H 4LVHB 2BVYA 4XVSL 3HRPA 3LS4H 3MUGB 1VEPA 2IBZX 5D2NB 5EIVA 4NQDD 4HEPG 3W2DH 1K8DA 2HTLD 1QFUL 3K1DA 4NKOB 3H8NA 5JHLH 2AV7A 5M95B 4LIQL 2EH8H 2XQBH 3HS0A 4JFFB 1GZPB 2H26A 2NZIA 3RWGB 5EZJA 4Z5RB 5DT1H 3D3VA 3MSPA 2GJ6D 2BSSA 2VLMD 4XPAH 1FZOA 3B2UD 1G7LA 1QSEB 5FA4A 4JFZL 3KS0J 4MJIA 3G6JF 2A6JA 4JGUA 4IS6B 4XHJD 4L9DA 1MJ8H 4KMLB 4U1JA 1L7TL 4MDJA 2FATL 4I77H 3VGHA 4PJCF 1XCQA 1P7QB 2ADFH 3NACL 3U7WH 3MLUL 2YPLB 2HN7A 4BFGA 4OJFH 4AL8L 2ZUUA 3R0MA 1OAUL 5JQHC 2W65A 2DDQL 4PGZA 4KI5D 4WEBL 3D3VD 5FYKH 4M3JA 3AXLB 4S1QL 5F9AC 5HYFA 5LGHH 2BY0A 3CK0L 2BVOB 5FV2A 1OM3L 3S3SA 4JFDB 4DFHA 3ZE2F 1X5LA 2WINA 5TQ0H 2V2TB 5EFIB 1NGXA 2XZCL 4G8FB 2UWEF 4JZJA 1H3UA 1DANT 3KHQA 3CXDH 1N5AB 4XPTH 3MFGB 4QXTA 3G5VB 1W0WA 3ZHDA 1KLGA 1FNGA 4LMQE 1UH3A 2HT3D 2XZQH 2OK0H 2XA8L 3JUZA 4M5ZH 3CVIH 4OF0A 4FQHB 3BE1L 2RFXA 1FO0A 4N0YL 2JELH 4LOUC 3RI5K 3MLRL 4GRWH 1KN4L 3L3KA 4R0LA 1WIUA 1XCQB 3EOAB 1I7RA 1BEYL 2P8MB 1WUNT 2C7UA 4KJYB 4M7KL 4P2QD 3VCLB 3NIDF 2H9GB 3MRNB 5IB3B 3UTTE 5JDSA 1JGVH 3UTZB 3IFOB 4G8EA 4PGEA 4L29A 1ZEAL 5AWNL 5DHYB 1HNFA 1W72H 2APFA 2GKIA 1NLBL 4V1DD 4NO0D 3TFKD 5HPMB 1FL5A 3QEHB 4ZUVA 1D6EB 3MZGB 3D9AH 1CXFA 1UB6A 4LGRB 5DUML 2N7AA 3OAUL 4PD4K 2YN3A 2VDPL 1CE1H 3GJFH 1LO0H 3L5XH 1A5FH 4HUXA 4ZAKC 3ZZ1A 1U91A 5JOPE 4Z7UE 1NGQL 4JZJB 1D9KC