3WFHA

Crystal structure of anti-prostaglandin e2 fab fragment pge2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
217
structure length
211
Chain Sequence
b'KVQLQQSGAELVKPGASVKLSCKASGYTFTEYFIHWVKQRSGQGLEWIGWFYPGSGSLNYNGKFKDKATFTADKSSSTVYLELSRLTSEDSAVYFCASHAYDKEPYWGQGTLVTVSAAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2
rcsb
molecule keywords mAb Fab H fragment
molecule tags Immune system
total genus 46
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfhA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfhA02
3JV6A 3DRQA 2X2YA 5HYEA 4BFIB 2VDLH 4JFXB 4Q0XL 4M1CD 1EVTC 3IFPB 1XF3B 4X9BA 1K5NA 3OV6A 4EJ1C 1FZJA 2ZUXA 4B41A 5EU5A 2CUMA 3U4EB 4ZD3L 1AQKL 1G7PB 2OP4H 1BFVL 2XWTA 4HWBH 3VD7A 2JB6A 2BNQE 3RDTC 3W0WE 3GI8L 1NGZB 1L6XA 5FHAH 5B22A 1MJ7H 4NN5C 1RFDL 3O0RH 2CUIA 4PJGF 5IIEA 2DLIA 4MZ2A 1A6VH 3PP3H 3IKKA 3KPRE 3IU4L 1A6UH 3O8XD 1TCMA 3QUZD 4PY8I 2GSIA 4PJDF 4PRDA 3CFBA 5LGJB 5F21B 5C0BE 5TJWK 3TJHD 2VDLL 3O81A 4NZUH 3F7YA 2VDPH 5I8OL 1ZLUH 4I4WB 1ITCA 4DZ8A 1KELL 3FRUB 3KPMA 4WUUB 3MACH 2YN3A 2ZPKH 1RZ8B 3QI9B 2CRIA 1NC4A 1KENL 2VISA 2GK0A 4YBQC 1X5XA 1QYGL 3B6SA 3OAYK 3O3AB 4HWBL 3T3PF 3P3YA 4XC1H 2R4SH 3DV4A 3LPFA 3MRDA 5FHAL 1T89C 4NZTL 3NN8B 1MJ7L 3BX7C 2EEAA 3CSPA 3TO2A 3G5ZB 3V0WH 1DE4A 1U8MA 5DQ9A 4BH8A 1BEYH 4Z78B 5EU4B 2X44D 1JWUA 2J2ZA 2HTLD 3O0RL 4H25B 5F1IB 4XXDA 3V6OA 5IR1A 4LLQB 2JCCB 4AENA 2DWDA 1A6VL 4JB9L 3IETB 4JO2L 4OLZH 3VG9C 1J1PH 4L4TE 1AQDB 2AJZB 2IAMC 5IEHB 1ZHNA 1T22B 4WO4C 2ZUQC 4MJ5B 4NZUL 4POUB 4V2BA 4YEFA 4GRWB 3EYUH 1SMAA 3GB7A 4N5EC 2R2HA 3FO0H 4P2CG 4NN7B 3KXFA 1EFQA 3GJFA 3QWRA 2A0LD 4PJIB 3CNKA 4WEMB 4UQ3B 5EUKB 5GZOD 2BSED 3L6FB 3RNQA 1R0AH 2ZPKL 1GAFL 5DHYA 4O2CA 1QVOA 4JANA 1QRND 3SQOH 2EDRA 5IK3B 4XC1L 3QDAA 4MVBC 2R4SL 2ITCA 4IS6A 3HI6H 3OKNB 3BIBX 3WS6A 1A2YA 3VXUB 4ZDHA 5ESAA 3W2DL 4Y7MA 3V0WL 2VLKA 3LS4H 1Z9MA 3L7EA 1JPTL 3IDGA 4RMWA 5KTEH 3B4NA 2QV2A 5L2KE 3T0DA 3LPWA 2EDOA 1E4JA 2ESVB 1G6RH 2ZCLH 3BPCA 3DOSA 3HUJF 4K9EC 4OLZL 1BVZA 4LLYB 3UTTA 2Z31C 1JI1A 4HH9A 5H2BB 4PJHB 2AK4B 3OHXB 3TV3L 5BS0D 1HSBA 4JLRA 2NXYB 5B21A 1P53A 4LPVA 3EYUL 1FNSH 2CR6A 2GIYA 5D7JB 1BQHG 3P9MA 5HGGS 5EU6A 4M00A 5C0IB 5I1CH 4HIXH 1OLLA 2MNUA 5IMKA 1NFIB 1EFXD 3JTSB 3QDME 1N6QH 5E70A 4DGVL 2ENSA 3SQOL 1K4CA 1NMAH 3VW3H 3HI6L 1T1YB 4X9HA 4ZO8A 1EAJA 3MRRB 4TUKH 2HJFA 4JFHD 1OM3L 5I30H 1T7XA 4FFVD 3TO4B 5CD3A 5IT2H 2PTVA 4KHTL 4NIKB 3VXQB 1G6RL 2ZCLL 5ICXB 4X4ME 1EBPA 2VLRB 3AXLB 4RFNB 3E2HB 3QRGH 1Z5LB 5DYOA 5F70A 3KG5A 5IJVA 4PGBA 1IGYB 4KTEL 1C16A 5BV7B 1I7RB 1ZV5A 3DXAE 1ETZA 4HUUB 5IV2A 1CFBA 3X14B 4OFVA 2F5AH 3QUKB 2NZ9D 5DUMH 2D31A 4KJPC 5EZLA 5I1CL 4HIXL 4RAUB 1RQ5A 1ZT1B 4X7TB 5DVNA 2X4TA 2VIRA 4IOFC 4P46A 2QADC 5L88L 4U1LB 2ORBH 4OCSH 2CIIA 4WEBH 1T5XB 3ARDA 3VW3L 2XQYG 4PRPB 4UOW1 4F9LA 1RZ7H 4TUKL 5SWZA 2OR9H 3HG1B 4X0KA 1F4HA 3Q6GL 5I30L 4Z0XA 3QIBC 4RA3A 4NKDA 4HKXB 4OI9A 3LEVH 5DGRA 3SDCD 5IT2L 3BKMH 4HS6A 1I3UA 4YXLH 2V2TB 1IFHH 3TA3A 2A1WH 1S9XB 3QRGL 2JE8A 4FQXC 4MQXC 2DQHH 2XZAH 1J8HB 5ITBL 4ZFZB 1GCFA 4JFEB 1M7IA 4JFQA 4BKLA 3MV9E 3UJIH 3UAJD 2F5AL 3QCTL 1R3KB 1CLZH 5DUML 5EWIH 5FGSA 3S88L 5GISH 3CDGA 5I1DA 1S7TB 4I0PD 3GNML 4RNRB 1FNEB 4MAYC 1HXYB 2C7UA 3U0PA 2VXUL 5FOBB 2ATPB 5HYSB 4WEBL 2DS4A 2Z91A 5DS8B 5DURB 1CICD 3LKNA 4F7PB 3I3DA 4LCYB 1VFUA 1RZ7L 3T0XA 1X5LA 5A3IC 3VXNA 2OR9L 4JFPB 4QNPE 4OIBA 2ZOLB 2F53E 4OTXH 2Y5TB 1AO7E 2ADIB 3AMLA 3HAEB 3HZYA 3LEVL 1UXSA 1NBYB 1RSFA 1D5ZB 1XIWA 2HVKA 1OTTD 4YXLL 4GRWH 3GHBH 2A1WL 3DURB 3UTZA 1F6FB 2XZAL 2HP4A 3QDGE 2FBJH 3UJIL 3SO3C 1TVBA 3TJEL 5EWIL 2WLYA 1KLGA 1ND0A 4GBXA 1EEUA 1A3LH 2PYEA 3QNZB 3WFEH 2BOCA 1A6ZA 1HINH 2VLKD 4JAMB 1OCWH 1UCBL 3LH2H 1KULA 4G43A 4UDTA 4EN3D 5I1AA 2H1PL 2JB5H 2NY5H 1FZMB 5DD0L 3GM0A 3VFRB 4WW1B 2VABB 5TPWL 5LXGH 3TESA 5GRUH 5C0AA 5C0CB 1V7MH 3VFGL 3VDAA 3V79C 2XWBB 2F15A 3R8QA 4WUKH 5F8QC 3VFMA 4OTXL 3LKPB 1MELA 3JTTB 4BFEA 4CVZA 4XPFH 1AR1C 3IKCA 1KUMA 4YEEA 3WLWD 2B0SH 1QA9A 2HFEB 3K74B 2NLJB 2AABH 3MUHL 4ZUSB 2H8PB 5T1LA 3D5OF 2NX5B 1MCQA 2DLFL 1IM9A 2FBJL 5C7XH 1BIHA 5HVHB 1KOAA 3TT1L 1W72A 3VXSA 3KNBB 1A3LL 5DMGD 3WFEL 2HFGL 3RAJH 5DJ8B 1OCWL 1OD9A 3LH2L 1TLKA 4LBEA 2O61B 4FQ2H 4PUBH 3L3GA 35C8H 2JB5L 1LHZA 1NANH 2P43B 1F4WH 4QRPA 5C6TH 4YNYA 3N85H 5GRUL 2AJSL 1V7ML 4NQSB 5CSGA 3D0LB 3FQWB 4WUKL 1R5VB 1BMGA 5I16A 5HI5C 2ZJSH 2V5TA 3UP1A 5EC2A 4UNVA 1TZGL 4XPFL 3LQAH 5GGSB 2NY7L 5CEYA 5K9QG 1BD2B 2CR3A 1OAQH 5SX4I 2J1KA 4FN0A 1DR9A 5IBUG 1I8LC 1X7QA 1QD0A 3OJVC 1CDCA 1K3IA 1PDKA 3GSXB 3LV3B 2WV3A 3MLUH 5GGUB 5C7XL 5JXAH 3VFPA 5I2IB 5BMFH 1DQDH 3RGVA 4OKDA 1GZQA 3GMNA 4ODXB 4FQ2L 2IBBA 4PUBL 2IBZY 35C8L 3JUYA 4HKBA 3AM8C 3RZCA 3WHE0 5JIKA 4XMLL 1F4WL 5KSBF 3K1KC 3N85L 1MHHB 2FEEI 4JFFA 5JLZB 2JELL 3RL1A 3FT3B 1T3FB 4GMSL 4UAOB 1DUZA 2C4XA 3I6KA 4ZTPH 3MCLH 2ZJSL 3VFSB 5F6HI 5DMKB 2O5XH 1W2KT 2HLAA 5BV7L 3RWIB 3LN9A 1BBDH 3LQAL 3RWEB 3VXMA 1ZA6A 5F88B 3Q3GA 4OFIA 3EHBD 3H9HB 3ARBB 4IOIB 4WUUE 1A47A 2NY0B 4O51A 4U0QB 3X3FL 3UBXA 3MLUL 3O6FB 3WJJA 1JRHL 5JXAL 3ARXA 3CFJA 3H7BA 5BMFL 1DQDL 3HC0B 3O4LB 1A1NA 2IGFH 2EDNA 4IBLT 4EUPB 5EIIB 3MBXL 1X5ZA 4YHOL 1VADB 2JCCE 1RURH 3IRZA 3MLXL 4NQXB 2HN7B 1NDGA 1KJ3H 5ERWB 4OZ4A 4JFYA 3MCLL 5IUSA 3E6HA 3QI9C 4G8IB 4JPIB 5E0QA 2XG5A 2PCPB 2YBRA 3WS3B 5CMAA 5F9JB 3DX8A 4Z7VB 3BUYB 5I1KH 2E6QA 1BBDL 3LKRB 4GRWE 2R23A 4LEXL 3CVHB 3MXWH 1OHQA 2FX7H 2DYPA 4GBXD 3LKQA 3BZFA 4QRTA 4PJIE 1YQ2A 5K9OB 1DCLA 5KOMC 3V5DB 1QSFB 4G80B 1C7SA 5E6ID 2EDQA 3QP3A 3PHQB 1AC0A 1ZWIB 4NO5A 3ROLB 4ENED 4JZNB 3CDYA 4PYHA 5EUOA 3HC3H 4PB9H 4Z95H 4TSAH 3VXUE 2IGFL 1MF2H 3W39B 5CSZB 2CUHA 5L2JB 4LP5A 3Q0HA 3OKDA 1MLCA 1G7IB 4XGZB 5FOJA 3D6GA 5F71A 4NN7C 1E28B 5JIIA 3KAAA 3MRQB 4I13B 1AFVH 2ESVE 3QWOA 4JY5L 4TPRL 1KJ3L 3TWCH 3QA3A 4KK9D 3TFKD 3FO2A 1U8KB 5E94A 4PJHE 2AK4E 2UZIH 4P0DA 4X7SL 4WVRA 2XNAA 2R0KH 3CFCH 5E5UB 2MSPA 4R97B 5LVEA 3GSOB 3MXWL 3OB0K 4J4PD 1BJ1H 5D7KE 2GITB 3LMJH 3KPQA 1IZJA 3GIVA 1OP5K 3T0AA 5IROC 2Y1VA 5D6CB 3G04A 5BQ7A 1YQVH 1PX3A 1F4XH 2D03H 4IEFB 4LVEA 3HC3L 5IJKA 4PB9L 4Z95L 3ZL4H 4TSAL 4Y1AA 1MF2L 2V2XB 3Q5OA 2PF6A 1UWXH 2ZUSA 2GJ6A 2IWGA 4ONGH 4RDQF 2NXYC 2R69L 1QZ1A 1LO3H 3RNKA 3X13A 3DLQR 3HPLB 5GIRB 3DO7B 3ZHKA 1I1RA 2IANB 4WJ5B 5D7JC 3MYJA 3K1DA 3BGFB 1Y18A 1AFVL 3BE1H 4ZODA 1WSST 3TWCL 2I07B 2VLRE 2L0DA 1FFOB 2UZIL 5JORA 2R0KL 3NZHL 1WVZA 3CFCL 2D9CA 2O5YH 4R4ND 1RAMA 3QUXA 5I1JH 5GS2D 5HVWA 3SGKA 2E9JA 1KB5B 4C57C 4FZEH 4KRPB 1IEBB 3FCTA 3RZCD 3TO4C 1F13A 4FTVD 3X11A 5J6GA 2R2EA 1FP5A 4FA8A 2CJUH 4PFEA 1I1YA 5EH1A 5HDBE 3QT2A 5F1KC 1CFTA 1OAXH 1F4XL 2EH7H 1YEEL 4GFTB 4XNMB 4RFNC 3E2HC 3ZL4L 3L3OA 4PRPE 3WXVL 1LEGA 5DK2A 4EI6A 1A3RH 3HG1E 1H9VA 3EO1A 1VGKA 3GEWB 4ONGL 5BV7C 4GG6B 2X9WA 3LQAC 4PJIF 3VRLF 2MCG1 4KAQL 1LO3L 4YK4B 1A9BB 1MRFL 1NH6A 1TENA 5EOTA 4XH2B 4FABH 1U8IA 4XNUH 5JOFB 1BP3B 3G9AB 3T0ED 2BSRB 1RU9L 2V7NA 5CKGA 4JO4H 4N90E 2X4PA 5EC1A 1U8LA 3HLAB 3EYOB 2EC9U 1QRKA 4JFDB 4MJ4A 1J8HE 3IFOA 2IPTH 1JZ8A 4E5XA 4M43H 1J0YA 4HIIA 1FJ1B 4WHCA 4LSTH 1JNHA 2V5YA 1M6OB 4FZEL 2LVEA 4X7FC 3G6JF 4NRZA 4AM0B 2H32H 4CMMA 3LRSA 5FYJH 1XR9B 3B9KB 2H3NA 1Z0MA 4JM2D 4EUPH 4GMTL 1WISA 3P0GB 4PJHF 1RULH 1S7XB 1Q9LA 4YHNA 2P7TA 4ODSH 1DBJL 1C12B 2G5BB 4KKBC 2XPGB 4WI2A 4N0RA 1KBGH 5IP4A 1WWBX 4C56B 4GUPA 2IH3B 5E2TH 4ODHH 4FABL 2IH1B 1SY6A 4M8VA 4F2MA 2LE9A 3CVHH 3V6ZA 3ZT5A 1BFOA 1TITA 4L9LA 3P4NB 4Y4FD 1JIBA 2IEPA 1GGIH 2IPTL 1KG0A 4HK0B 4OV6F 5F3BB 1RZKL 3ARFA 3KLHC 5FA3B 4LSTL 3ESVF 4MCYA 2VDML 2A6KA 1U3JA 3C6LB 3LN4A 5IB3B 1LEIA 2CO6B 3PJSA 4XVTL 2AXFA 2OZ4H 5FYJL 1SY6H 2R0WL 4NQVB 3CVIH 1TCRA 4GRLB 5EPMB 4MJ6A 4B7LA 5GJSL 4ODSL 5C0CE 5FM8A 1IGFL 1KBGL 2DIJA 3EGSA 1YMMB 1JGUL 3D1MC 5BXFB 4YHIB 2R8SL 2A6DB 5E2TL 3BZ4B 3T77B 5A2JH 5GGQL 4Z7NF 1T66C 1V8HA 3TVMD 1OWWA 2LAGB 3C08L 4PJGA 5AG9A 4NQDD 5FO7A 5HDBF 3RJQB 3CVHL 1H3TA 3D9AH 5IQ9B 1CGXA 3O45A 4NRXA 3VG0L 3KHOA 3VCLB 3MREB 4NDMA 1TZHA 5E08L 4PJDA 2NX5E 1IAIH 1UWGL 2HT3D 3N06B 3GMLB 2BMKB 3BP5B 5TGBA 3SGDI 4CVXA 1S5HA 3HAEG 4HIHA 1YPZA 3D87B 43C9B 2IQAA 3VGEA 1KF9B 5DO2C 3CMOH 4HX1A 2G75B 1KPVB 3SE8H 4AIZB 2CQVA 1P1ZB 1OQXA 3CVIL 2GFBA 4JN2B 1MCNA 2F8OA 2IPKB 3T4YB 4GKSB 1D5MB 3QIWA 5EZOH 5F7DB 1SJHA 4JKWA 5D1ZB 4N1CA 3AS0A 3WHE1 2RAMA 4P48A 1OP3H 1FNLA 2W0PA 4RGNB 4NYLA 5GPRA 4YX2L 1HHHB 5JR1H 3ARYA 2ILLA 1MAMH 5HVHC 4QOKD 4YBHA 4GXUN 2A38A 2FSEA 1OGTA 1UWEL 1KB5H 1RJYB 3LRGA 5HHXL 1WZKA 1IAIL 5INDA 3PV6B 4PTTA 5KSVA 2EDLA 4G5ZH 3C5ZB 2EECA 1UZ8B 2RHEA 4PJ8D 2C3XA 5D1XA 1EX0A 2EEBA 3DUUA 3CMOL 4OZHF 4HG4J 4KKLC 3VXPA 4ZOCA 5JW3H 5HHNB 3RDTA 4GJTB 4B7IA 4D9QD 4RMTA 1BPVA 3M1BA 1D5BB 4PJEB 5IB1A 2RB8A 4LSDA 4HLZG 2AEIT 3L3JA 4MD5A 1BZ7A 3TBWA 2ADGB 2DQIH 3PWUA 4JHBA 5C09D 4CADB 1MAML 2ZP0T 5ABDE 4NO0A 4L3EB 4AJ0A 5I1LB 3QDJB 3TBSA 3HUJA 3MZGB 4O2FB 2CGRH 2BNQA 1KB5L 4OZGB 1J88A 4LCCB 1L9NA 3W0WA 4PGCA 2V9QA 2F5BL 4G5ZL 3OKLB 4UZGA 4H88H 4UAOC 3QXDB 1SEQL 2YA2A 3O4LE 4TSCL 3V7MA 2CK0H 4G6MH 1WT5A 1S5IL 2VUYA 5FYJE 2XRAH 1JNNL 3P9WB 1KCUL 5CCKH 2PYFA 1P5UA 5C0BA 2QEJA 1AGEA 4ONFL 1ZXQA 3ARBC 1N5AB 2P24A 1JUFB 2NY0C 4LLVB 1KIRB 3O6FC 1RZKC 1J5OH 5J9PA 4S1DC 4Z7VE 4LSRH 1IVLA 2YSSB 3U4AA 5T1KA 1EUUA 4U7SA 1YA5A 3FB6B 4LARH 1GIGL 4XPAL 2CGRL 4UMGA 4WO4A 1IE5A 5A2FA 3AUVA 4HG4K 1QSFE 2JTDA 3MNVB 3QJHB 4LKCA 3BGMB 1JF1B 2H2PC 4ZUTB 4UTBH 4R4FH 4GW5A 4MNQB 1BQHA 3KPSD 1QSED 2GTZB 4YO0A 1KIQA 3WUZA 3WEXA 3QRFM 3QUMH 3SKNA 4XTRD 1CXLA 2LVCA 1KCRL 2XRAL 4HEPG 5GS1B 1CU4L 3B83A 3F12A 1I8MA 1CQYA 3JBG7 3WD5L 2MHAA 5I8CB 4M8QA 4QTIH 5HPMB 1EHAA 2F8VA 3PQYE 4HV8A 3CFKB 3DIFB 1I3VA 2IC2A 4QHNA 4UIMB 4P3WA 2AQ3A 2LAAA 2P8PA 2X4OA 3PGDA 1C1EH 4QTHA 1J5OL 3QFDB 4LSRL 1DL7L 2RBLA 3VMNA 2DLHA 3ET9F 2EYTA 5DGQA 5HGAA 5T3XH 4ELMB 1INQA 1A4JA 2X89A 1VKXA 4DVRH 4Y4KA 5DRNA 3KLAA 1H3VA 1BIIB 2GAZB 1W8OA 3T1FB 4ESKA 4R4FL 4P9HL 2NW3B 3FHQA 1FIGH 2A74A 4HS8H 5DHVB 1S78D 3PP4H 1ZT4B 2W07A 5CUSH 3L3HB 5L2KA 2C4FU 4F7EA 2Z4QB 3N1MC 3VD9A 3BESR 4URTB 5D71H 4J2XA 2AK1H 5L0QB 1WIOA 4OUUB 5LAXB 2ZG1A 2A9MH 3IDYB 1CT8B 1PBYA 4R97C 1J8KA 1WFUA 2IANE 4YDVA 4OLWH 4WHTA 1TVHA 4PRIB 2ED9A 4C4KT 4WDIB 3W5MA 2WINB 1I1AA 4W70A 1QBAA 1T0MA 2DKSA 4HIJB 4YIQB 1EHLH 4LSSH 3QDMA 3NFSH 5T3XL 5E7BA 5DJAB 2YPVL 4HXAH 3T8XB 3MUGA 5I75B 1YEIH 4DVRL 3PDOB 1CD1B 1JE6A 1EMTH 1KN4L 1MPAH 4I48B 2EIDA 3V5KB 3FOLA 4WGWB 4K94L 3BGFC 1UQSA 1EEZA 4DUVA 2G60L 4X6DA 1FIGL 2HJKA 3LOWA 2I9TA 3PP4L 1PKQA 2UWEE 2ZSWB 1NEZG 5GSVA 5GS3A 4EDXB 4PJ9A 2A9ML 3OKKA 4GG6E 4X4MA 2ICEA 3QJFA 4P5TA 1ROWA 2BC4A 4PS4L 1ZHLB 4Q9RH 1GGUA 2MWCA 4OLWL 1HXMA 5DEFB 1LQSR 4KRPC 2EE9A 3CSYA 5F1NB 4APQB 2BNQD 1XGYH 4YDJA 3TBYA 1PY4A 2P5WB 2FGWH 3WV0A 4Y19B 2ZKHH 1P7QD 1AXSB 3D18A 3S9DB 2UVEA 3NPSB 1EHLL 2Q3ZA 1U93B 2E7MA 4LSSL 3ECBA 5ID1A 1ZLWH 1A4KB 1TPXB 1YEIL 4DKEL 4YBQD 4Z7WA 3HA0A 1EPFA 4ZTOH 3MLPA 5E8OA 3KPRD 2BVQA 4YK4C 5FGRA 1MPAL 4S2SA 5JW5A 5HGDA 5C0BD 1RD6A 4G7VH 2UY6A 5SX5K 4KTYA 5HHOA 3FFDA 1KTDA 1IGCH 2C3HA 5FV2A 2SEBB 4NBYB 3KYOA 4KQ3H 1CLCA 2I60H 4C56E 4NC1E 4IRSB 2MQ0A 1NSNL 4JKPH 1NFDB 3HR6A 1JHKH 1RZJH 1MJJB 2APTA 2VAAB 3GBMH 1KJVB 5FDYA 2IAMD 3GSUA 5E2UH 1CVSC 2IJ0C 4WO4D 4L8BB 2HRPL 3F6IA 3B3IB 2FGWL 5C2UB 2FJHA 3MA9L 3B9KC 1GZPB 1XGTB 1G7HA 2ZKHL 4HWZB 4N5ED 5ESVB 3VH8G 5IG7A 1ZVYA 5EO9B 1KC5H 4ODVH 3UDWA 3H6JA 3WBDA 1A6AA 3RWCB 1H8NA 1JZ6A 4NC1C 4MVBD 2ZUYA 3K80A 3L5JA 4L4TD 2YUZA 3A6OA 1EO8H 4OD3H 3ZZ1A 2F53A 1AE6H 1AO7A 3SPVB 5KAQF 3AGVA 4PYGA 4YXKH 1IGCL 4G8GA 4JRYD 2A73B 1YECH 1YMME 2I60L 3RVUC 4NT6A 3BD3A 2B4CH 2Z31D 1MSPA 4JKPL 4XHJC 1JPGB 5TDNA 3GFUA 3GBML 3UJJL 5A43C 3BQUB 3PIQA 5KSBA 5E2UL 3C6LC 3QDGA 2X89D 5TDPB 2UWEF 2PXYB 4UU9B 1IRAY 4GRLC 1UKTA 3VFTA 4P9HC 4G8EA 3D0VB 1KC5L 4ODVL 2D7NA 5T3XE 3TYGH 3Q6FA 4N0UB 15C8H 1EZVY 5L2KD 2XKNB 5DHVH 2V9TA 1HHJB 1QG3A 4KJQC 4YPGA 5BO1H 2LU3A 3SBWC 3IJSB 4XP6H 5T1MA 1I8IA 3EO9H 4DKFH 2XN9B 3LEXA 3WHXA 1X5IA 4U6HA 4OD3L 3U48A 1AE6L 1Z9LA 4JPKH 1IQDB 4YXKL 4G7YH 1AD9A 5FF6A 5HPOA 3SN6N 2IG2H 3MLWL 3G6DL 3VFWB 2ADJA 1IGJB 1JK8B 1YECL 3I02A 5EBWA 1BF8A 3QUYA 3UEZA 1FC1A 2C1OA 4RGNE 4BM7A 1JGEA 3QDMD 1VGEL 3GUTA 5IMOB 1S7QB 4PGZA 4M02A 3EJYC 2FLBT 4ERSH 3MR9B 1FYTB 3AB0B 1NGYA 2R0ZH 4K94C 1PEZA 2Z93B 2HFFA 3CGTA 4KJPD 5DLML 4YFLF 4Q9CA 4LLWB 3U6RA 5D1ZC 1I8LA 15C8L 4IOFD 2QADD 4LSUL 3C60A 5GXBB 4U6VL 1NLBH 3G5YB 1D5XB 4RGNC 4MXVF 5BO1L 4XP6L 3INUH 2YEZB 3EO9L 4DKFL 2CIKA 4JPKL 5KVFH 3H9ZA 3DXAD 3QEQA 5JDSA 1CGYA 3QIBD 5I76B 5E1AB 5JW4Q 4G7YL 4P23A 4UDUB 2IG2L 5F6HJ 5GHWH 4PJEE 4ZAKA 1M4KA 5E03A 3RVVC 4H8WH 3ZMRA 3IFPA 3C5ZC 1LNUB 5AD0B 3WXWH 3FQTA 4MQXD 4FQXD 4XC3H 5GGVL 4BH7B 2FATH 2F74A 3S96A 4L3EE 3ZKXB 5KSAA 1G7PA 3SGEH 3QDJE 1R5IA 1QFOA 4OZGE 2R0ZL 4EI5B 3OAZK 5KVGH 4OQ1A 4E41B 1JNJA 4MAYD 4MAUL 3SDXB 4K3EH 4PRBB 1P4IH 4GQPH 3INUL 4H0HB 4HBCH 5HGHA 3TH2T 5KANI 3BD4A 4LGSB 1X4ZA 1WWCA 5A3ID 5JZ7C 4WWKA 4RMUA 2A6JA 1YYMH 3MV9D 3MJ7A 5GHWL 3E3QC 4LCCC 4G6FB 4YHYB 3P4MA 4XXCC 4R0LB 1IGIH 3FQXA 4H8WL 4I4WA 2DRUA 4BUGA 4WUUA 2FX8L 1GPOH 2Y7QB 4H1LG 2QSQA 3RTQA 2YPLB 3NIFF 1RZ8A 3QI9A 2KZ1B 4QXTA 6FABH 2EKJA 1RI8A 4KI1A 5GRVK 3VGFA 3P30H 1WFOA 3QHZH 8FABA 3IF1B 5KVGL 2F53D 5E9DA 1S7VA 3DX9B 5CLTA 3NFNB 3DGGA 3W81A 2HG5B 4YJZL 2C3VB 3D85B 5FXCH 3B9DA 4Z78A 5EU4A 4MNQE 4K3EL 1P4IL 1M7XA 3NOIA 3TF7C 1IQWH 1FL6B 1HWHB 1XH3A 2J4WL 4I3SH 2G9HA 4HBCL 1RJCA 4O58L 3IETA 1NAKL 3VFOA 2PR4H 4BQ8A 1YYML 4PIRF 3T4AB 3QDGD 4YDLB 4LU5H 1XR8B 1T22A 3P77B 4MJ5A 4U2YA 1JF5A 4ACPA 2D7TH 3ZYIA 5K9KA 1AR1D 1IGIL 2EE2A 4M1GL 3WNLA 4L8CB 1FPTH 2VMFA 4PRNB 1GPOL 2FCBA 1D6VL 1O7VA 2W9DL 4W4OC 5DZNA 3VGDA 3OAYH 4NHCH 1TMCB 4KUCF 5GS1C 3U82B 1VB9A 4PJEF 4PD4J 2YKLH 2EC8A 4XPTH 4OAWA 3IGAA 3VXUA 5EZJA 4DJMA 1T04A 3MJ6A 1I7UB 3UTPE 4PGDB 2VDRH 3DJ9A 4KKNA 5BJTB 3O2DA 5A16B 2X9YA 4TVSa 4NUJA 3EUUA 3EOAA 1IQWL 5ICZB 1G6VK 3G6JA 5HYJD 2PO6A 2ESVA 1NBVH 4U1MB 4OZGF 1B4RA 1XCQA 4N8PA 4R90H 1B6UA 3OPZH 5HI5D 3OGCA 3O9WB 1ZAGA 1LE5A 2WSKA 4DKDC 4LU5L 2D7TL 4DN4L 2P5EB 5EDXA 5DFWH 5EO0B 4OCYH 4NPYA 3GJEB 1UYWL 3FQUB 2XV6B 3BO8B 1BF2A 4NGHL 3HR5B 4QT5B 4NHCL 7FABH 5L0QC 4UIKH 5FAAA 3N1GC 3IDYC 2ARWA 4LDLB 5CS7A 2NZIA 1GRWA 3GZKA 2YKLL 2EICA 3L7FA 4XPTL 5EBMB 3W9DB 5ISZB 4FNLH 2DQEH 2FIKA 3L3DB 3V8CA 4H5SB 4PRHB 1FZKA 3H9SA 1CIUA 3D69B 4NRYB 2GSGA 5D5MF 4I0CC 3DETC 2BCKA 5C6WH 3RZWA 1INDH 3ZKNC 1NL0L 4R90L 2R29L 2VLRA 1TQCB 3JVGC 3IAPA 1BGXH 5IQ7H 3KYMB 4AYFA 5I75C 5DR5H 5MEOA 1K8DB 4Y0GA 1I7RA 5FKPB 2GJZB 3F7QA 4HUUA 4RFEB 4PGJA 1OQOA 1XF5B 4Y19E 5GGVY 1MFCL 2L7JA 5H37H 5HDLA 4OCYL 4YH6A 4RAUA 4KMLB 3NTCH 1MCWW 2ZCHH 12E8L 1AGDB 3LEYH 4U1LA 3SEPA 4CNIA 1BLNA 3BD5A 4KVNH 4M7JL 4UIKL 4OBSA 2Z8SA 5CP7B 2AJYH 4KFZC 3U9UA 4GAGH 4BFBD 1TJGL 4O2EA 5JIPA 3MLVH 3HG1A 2DQEL 4WFGE 1C08B 5ETUB 3CSGA 3T09A 4NM4H 2DICA 4APQC 4DUXA 3BAEH 2XA8L 5CEXB 4H8WC 3MZTA 5HVFB 4I3GA 1QFHA 3EOTH 1INDL 4Q9BA 3NPSC 4KGLA 5IMLA 1NFDE 3LKSB 1BGXL 3QI9D 5IQ7L 3DROB 1J8HA 1TPXC 5DR5L 5C08D 1HIML 4Q6IB 2AV7B 4DW2L 1UKSA 5C0DA 2IADA 1GC1L 3BIKB 3HMWH 3K0WA 3RY5A 3U0TB 2XTLA 4LCUB 2HRLA 2NW2B 4KTDH 3M45A 3NTCL 4IHOA 1FNEA 1T2JA 2ZCHL 4RQQA 2DB8A 1HXYA 3S4SB 4BQCA 4EKXA 4JDZB 1R3HA 3WCYA 4CVUA 1N4XH 2H9GB 2ICWI 2AJYL 1XGPA 4IRSC 4GAGL 2BFVH 4LCYA 3H9YA 1I8KA 3MLVL 2BNUA 2ZOLA 4GXVH 2WP3O 3BAEL 3HAEA 1TXKA 4Q2ZA 5CIPB 5DA0B 1BX2B 1NBYA 4Y2DB 5SWQB 1D5ZA 2J8UF 3GIZH 3PWJA 2Q1EA 5AAWA 4OZHA 4GS7B 2FB4H 1UH2A 2NY3B 3BRDA 5E8NB 1NCDH 4PJFB 1V05A 2FZ3B 4JKKA 3BH8B 3H7LA 3K8KA 1KPRA 3FAXA 4ZPVB 3HMWL 2VN4A 1CXKA 3PGFH 3LIZL 3WL9B 4YHPB 1X5HA 4JPWH 3VXUD 4GAFB 4KTDL 2WWKO 4FZ8L 2YA0A 2FO4A 5EOQH 3I3BA 5FK9A 1IAKB 3UCRA 1Z6JT 4PGEA 4N0UE 3D25B 1FZMA 4LCWB 2DJSA 4X99B 2ESVD 3VFRA 2Y07L 4U1SB 1JTPA 2BFVL 3GJFK 5DQDH 5C0CA 4WI4A 1RPQA 1AXTH 1CF8L 1UEYA 1DBKH 2XN9E 3BQUC 4RISH 1A7OH 2AK4D 1CICB 2OX5A 3OXRA 2YXFA 4LDEB 3LKPA 5ILTL 1BVLB 4PJCE 2NXYD 4ORGA 4MNHB 3WFBL 4HK3J 2PXYC 5JTWA 3GIZL 5D7JD 5D7KD 2CDEA 3F5WA 2YRLA 3TBTB 2FB4L 1DLHB 3ZTJG 2NLJA 4XP4H 4ZUSA 2COQA 2VRAA 3QIUA 4M7LH 5GGRY 3TYFA 5GS0H 1MVFA 5D70L 2VNCA 1SHMA 3QNYB 3PWLB 3PGFL 1UJTA 1ZHBA 2V7HB 4JPWL 1RUAL 2PW1B 3O3BB 3ZYOA 2YMXH 4WW2A 2VSCA 1BAFH 4PJAB 2O61A 5TE6H 1SJEB 1BBJA 3HS0B 3HI1B 3TO4D 4P2OB 1MFAH 4KMTL 4HUXB 3RPIA 1JGVL 3V6FB 1KJMA 5DQDL 1M7DB 5C0NC 4NQSA 2VLRD 3D0LA 1AXTL 3S35H 1DBKL 4ZUUB 1A7OL 4HLZH 3BKCH 3VWJB 5C92A 3HNSL 4M61A 1B0RB 4Q58C 1ERNA 2D4DA 5ITFB 5HTSA 5I8KH 2EEDA 1DLFH 4NNXA 1Q9WB 4QHMB 2OYPA 3AB0C 5B3JE 5MEQB 1IBGL 2IPUK 4IRJA 4F7TB 3WJLA 4PR5A 1QSZA 4XP4L 3GRWA 3UJTH 3NVQA 2MQ3A 1UKQA 4LSQH 3TH4T 2R2BB 5D7IB 5LBSL 5T1DH 4QYOB 4BSJA 5GS0L 4NQEA 5GGUA 5EBLB 3GK8H 3CLEH 3QCUH 4D8PB 4PG2C 1FE8H 4PRPD 3IJYB 3GMRB 1FGVH 1ZSDA 1P6AB 2YMXL 3DX7A 3ES6B 3HG1D 2EDKA 1CLYL 1KB9K 2IF7A 4E41E 5DWUL 3OKEA 1SYSA 4NC2B 2YWYA 1MFAL 3ZE1F 3SDXE 2YZ8A 1W0VB 1MHHA 2I27N 3DARA 5JLZA 3REWA 1JF6A 4N90D 4BZ2L 4KKBD 1T3FA 2VZTA 2Q8AH 3MNZA 3SKOA 2DLTA 4JQVA 3BKCL 1J8HD 4IMKC 5ANMA 3ZKXC 1CN4A 4LAQH 2Z8WC 4JFED 5I8KL 1GC1C 5DMKA 1L9MA 3SJVB 3RWIA 4EI5C 3RY6A 5BZDB 2B8OT 4GRMB 1FVCA 1J7VR 3ARBA 3UJTL 4Y89A 1MFDH 1VCAA 1MJ8L 2IFFH 5T1DL 3WDIA 2E6JA 2YPLE 4HK3N 4FXGA 4MNGB 3D39A 1HEZA 5DURD 4PJCF 4DQOH 3GK8L 4NM8H 1QBMH 3CLEL 3KLHD 2IBZX 3SDAC 3BUTA 3DX6B 4ZQKA 4HMDA 3S5LG 2HMIC 3MRIB 3K7UA 1QO3B 1CCZA 3BJLA 5BOPA 2VJXA 5T33L 4CJ0A 2C1PB 4YHYC 3PL6D 1H3PH 4R0LC 4BZ1H 2VN7A 1ZLSH 4K55A 4KXZH 1F58H 2Q8AL 4Z77B 5CLWA 4R9HA 2FWOB 4NO3A 5KG9B 2PCPA 3OL2A 3WS3A 5F9JA 2K1MA 1INEL 3FO1A 2QKIA 5EU3B 5ALCH 1VACA 1G9MH 5IMMB 1N7ML 1CFSB 1QFWM 3U0WH 2FJFB 3NGBB 5I15H 4TOYL 1RIVL 5E4EB 2IFFL 4G80A 2Z35B 5L6YH 1BECA 2ATKB 5KOVC 4BJLA 1L0QA 3T65B 4PJ7B 2NQCA 4DQOL 3ROLA 3HTLX 3QEUB 4NM8L 3BYTA 1TZIA 4F33B 5B3JF 2R4RH 1HILA 5FUCE 3LKOA 3ARQA 2ZCKH 3MJ9A 4L29A 1TIUA 2UY7A 4YDLC 4X6BA 1FLRH 5B4MC 5DO2D 2VXQL 5CSZA 4ISVB 5L2JA 1ZVSB 5ICYA 4TTGA 1H3PL 3NCJH 5GSRB 4HGMA 2R15A 4BZ1L 1ZLSL 5JQ6H 4KJYB 3PQYA 1E28A 4OGYL 2ADFH 3MRQA 5E8PA 3QAZB 1F58L 1JWSA 5DJXB 2NX5D 5IESH 3PGCA 4M6OH 4Y5XB 3OJDB 1DDHA 5H35B 4P4RB 1NEZA 3UO1H 4RGMB 5DC4B 5ALCL 5FUCC 3MJ9H 2P5EE 1X9QA 1G9ML 5CJOL 3U0WL 3HPJA 5I15L 5FUOH 1LO0L 4LEOA 4WFFE 3EFDH 3ULVH 4K8RH 5D6CA 4ZOAA 1H3UA 1P9MC 4I2XA 3P4OB 4HKJB 1WFNA 5E6IB 4HS3B 1OPGH 4MB5A 2R4RL 1QLRB 4L9DA 3TNMA 1T03H 1QFUH 3HB3C 3QH3B 1CDIA 2DD8H 2EIZA 3O9WC 1CR9L 5FUZH 2NTFB 3OKOB 1BFSA 1V3JA 4KKLD 3W9EA 5ISZE 4PRHE 3HPLA 3DO7A 5IB4B 1EJOH 4FQHA 4M1DL 4WJ5A 5JQ6L 1BD2D 3U7WL 3IAQA 1MHPH 3VJ6A 1B4JH 2I07A 2LV4A 3WIFB 2GUOB 1MHCB 1SYVB 4M6OL 4YZFE 5IESL 4IIQA 2VH5H 4TVPH 4KC3B 3UO1L 3NCCB 2V2WB 1EH9A 4P49A 3VXRB 2J6EH 2V6HA 2NTSP 1FYHB 3RRQA 1JYVA 4JE4B 1OP5H 4KK8C 1RJLB 1MCCA 2OJEA 2RJMA 4TNVF 1IEBA 3EFDL 4UQ2A 3ULVL 3IJHB 4ODWB 4K8RL 4KDTC 3MYZA 3RIAK 4KI5E 4L1DA 5CJ5A 1OPGL 3VH8A 4GT7A 5FEBA 2UWEA 1T03L 1TQCC 1QFUL 4GG8B 1MCWM 2DD8L 1IAOB 3RJDA 4OF5A 5FUZL 1ED3B 1ITBB 2DI7A 1NGWA 1BZ9A 4U7KA 4W6YB 3V4PH 4HUKB 1A9BA 1CWVA 4L4VA 2B39A 5AZEH 4XH2A 1JWMB 2Q87A 4LVHB 1XAUA 5IVXB 5C9JA 1UACH 2NY0D 4WU7A 3W82A 1G7JA 1B4JL 3IDNB 1H0DB 4Q6YA 3ZO0A 3RU8H 2VH5L 3HLAA 1FGNH 1KGCE 3O6FD 4G6KH 4OIIH 4KI5C 1QUNA 4S1DD 3B2VH 1RIHL 5JXEA 2AERT 2J6EL 2F54B 3O4LD 3KPPB 3MOBL 3LSOB 3CAFA 1FCCA 1PG7W 5FYJD 5B3NA 4AM0A 5LWYL 3DI3B 4R7DB 1YEDA 4YXHH 5HYQB 3JXAA 4PLOB 4HSQA 1A7NL 2WBKA 3MV8B 1C12A 1YEGL 5GRWA 4YR6B 5B39G 4G3YH 3DECA 5E2VL 3MUJA 4GO6B 2IH3A 4Q6IC 1X6LA 4V2CB 1RMFH 4X98A 3TIEB 3VGBA 1FO0A 3BPLB 3U9PH 4KRLB 3I9GH 1EJ6A 1UACL 2CXKA 1QSFD 5I17B 3L9RB 3RU8L 2BY2A 4BSVB 1ORSA 4PJFE 1FGNL 5FO8B 3ULSA 4G6KL 1MI5B 4NJ9H 4OCLC 4ZO9A 5TF1H 2ZUTA 3I6GB 4JRXB 3HRZB 3DBXA 5FA3A 4RBPK 2Z92B 2VZ3A 1A7RH 3BH9A 4OCMC 3UTOA 1JN6B 3C6LA 4UB0L 4ZOBA 2QBWA 4ZFGL 4ZPTB 5T5FH 5SWSA 1OWRM 4YXHL 3CSBA 4NQVA 4YZFF 4N9GA 2O5ZL 4Y2DC 1N26A 4UTAH 5KSUB 1NGQL 3P40A 4JPVH 4G9FB 3GMPB 4GS7C 4LCWE 1G0XA 1PW3A 1B0WA 2NY3C 3HCVB 3SKMB 2NXZB 1WBXA 1XGUA 2WM0A 4C55A 1YMMA 2O93L 3RWHB 3TPKA 1AR2A 1LE9A 3BZ4A 2VERN 1AGFA 1FBIH 2X4RA 3PG2A 3QZWG 1UEMA 5D6DA 1Y0LB 3I9GL 1HQRB 3B9VA 5EZIH 2B2XL 2NR6C 1C5BH 1VPOL 3MREA 1OTUC 4NQTA 5TF1L 3MRJA 3EZJB 4HF5H 2BNRB 4WNQA 2BMKA 3VFVA 5IFJA 5DJYB 2FH6A 1WEJH 2PTUA 1DVFA 2JJVA 4ZUWB 1CICC 4OCNC 4OFKA 4JFZH 1NANI 2J5LB 43C9A 3TN0B 5L9DH 4HBQA 5T5FL 4PJAE 1KPVA 3ULVE 4AIZA 4HWNA 2HVJB 2IAND 3LN5B 4PJBB 4UTAL 1CFQB 4GKSA 1D5MA 5F7DA 2XWJA 3HNVL 1ORQB 4U1IB 3CD4A 1IL1B 4PBXA 1DQQA 3TEUA 2WUBH 1HHHA 1JCKA 1N59A 4K3GA 3U7YH 4RX4A 3MX0A 4IOSD 4KRPD 5EZIL 3ZHLA 3ULVC 4HPYH 5CSBA 2X1QA 4K8RC 1C5BL 5IVNA 4P2QA 2D2OA 1UVQA 4P2OC 5FYLL 1BOGA 2W38A 5D7IE 3NAAH 2DQTL 2M2DA 1NCUA 1KT2B 2XXMB 5C0FB 3C5ZA 1WEJL 3H42L 1M05A 1B2WH 4U1NB 4JFZL 3SCMB 4EVNB 3VWJC 5FYKH 3I2CH 4YHMH 4H1LA 5CINH 4QF1A 3U36A 3KYNB 5HHNA 1RY7B 2FX9H 4YGVB 5ACZB 3N50A 2BSTA 3BVNB 3T0VA 3TC9A 1H3GA 3MQIA 4KY1H 2CLZA 1D5BA 3OB8A 2E27H 2UV3A 1IEAA 1MIMH 4JFDD 5TFSH 3QR2A 1G7LA 3BWAB 2XFXB 2DQCH 1CGWA 4CADA 5EU7E 3SJVE 5CZKA 5JHLH 3DVNA 4JGJA 4L3EA 4ZO7A 1P4LA 3IT8D 4I18A 4UT7H 2YD7A 4OZGA 4OD2B 3LY6A 3HE6A 3B9KD 4AZ8A 3NAAL 3FO9B 4M7KL 4KRNA 3CXHJ 4MNGE 4RMVA 2I24N 4S1SH 1B2WL 2OL3H 3BEVA 1YDPB 2AKRB 4AEIH 5FYKL 3I2CL 2BXZA 4MHHI 4C56D 4YHML 5HHQB 1U8OA 4YHKL 2VZSA 3PWVA 2ZZUT 4JFOA 1WZ1H 3OKMB 4KY1L 1JUFA 3MV7B 1Y6MR 2E27L 1FFNA 5TFSL 4NHUA 5MERB 3RVUD 2NCMA 4HHAB 4RWYH 3ULVF 2GT9A 5JHLL 2YSSA 1E6OH 4WI5A 4XHJD 2IPUG 5D5MA 5DJZB 4NKMB 1EHNA 3OF6A 3C6LD 1XF2B 3IDJB 3WNPA 1C5DA 3CUPA 4FQIH 4GRLD 3BGMA 2P8MA 3ALXA 1JF1A 4PJ7E 4ZUTA 3MROB 1ZT7B 3O3DA 4U6YB 4MNQA 4XNYH 3KYKH 1T7WA 1SMOA 3BHBA 3T2OA 4AEIL 4JHZA 3GSVB 2CKBB 4KJQD 4WEUD 4D0BB 4FS0A 5GS1A 1QKZH 5CHNB 5I8CA 2J88L 3VI3E 5D7IF 2NY2B 4N0YH 3VRIA 5D1QA 3CFKA 3DIFA 3NGBC 4HFWB 5E4EC 4Z7UF 4UIMA 1F90L 1CDYA 1UC6A 1WCBA 1G84A 3MLYH 1BWMA 5IB5B 3X3GH 2J3SA 3QFDA 5T3XD 4ZFOB 1IKNC 3MMEB 4LLDB 1Q94A 4AH2B 4PRAB 2VC2L 5DZLA 3UTSB 4UOJA 4ZS6C 3EJYD 5DVLA 4Z9KB 4FQIL 5FYLE 4U1GB 4QY8A 3S37H 1S7UB 2BOBA 1UB5B 1NKOA 1BIIA 3MBEB 4JZOA 3T1FA 1YMHA 5D1ZD 3QAZC 4XNYL 2OS7A 1K6QH 3KYKL 1U95B 1D3CA 1ZT4A 4EOWH 2NY6B 3JWOL 4Y5XC 3PWPB 1UFUA 4RGND 4EXKA 1WZLA 4U6XA 5LAXA 4RGMC 4M5YL 4N5UA 1QKZL 3VD5A 1IM3A 3MRCA 3GI9H 1GGCH 4N0YL 3TZVB 4V1DA 3ILPB 1OAKH 4H20H 1MWAB 1S9WB 2R56L 1CGSH 3RIFK 1P7KA 4WDIA 2APFA 1CS6A 5IWLA 5HJ3A 1A64A 2DF3A 1JBJA 1MCLA 3RVVD 4ZNEE 4ZO6A 3C5ZD 4MCZA 2ITDB 5E6IC 3JVGA 4H26A 4ORZC 3VXRE 3TNNB 2J8UA 5DJAA 5DEZA 1AD0A 3O6MH 5L7XL 3FKUS 5KS9B 1MFNA 5CP3H 1IKFL 1JHLL 3PDOA 3M17B 4I48A 3V5KA 1M1SA 4U1HB 4XNQA 4A6YB 2IFGA 1K6QL 5F89B 1CYGA 1LEKA 3BWUC 1P2CB 3GSRA 4R4BA 2ZSWA 4EOWL 5FYKE 4AG4L 5E5MA 4CUCA 5DVOA 2CO7B 3I84A 2FHCA 2X4NA 1RZFH 4KK9C 5JPNA 3CZJA 3AY4A 3GI9L 1ZHLA 3MGOA 3C8KB 5JZ7D 4L3ED 4H20L 3L1OL 2P8LA 5B38B 3FB5B 1CGSL 2F19H 3QDJD 3ZLQC 5IVXE 4APQA 4XX1E 5D8JH 1RZGA 4HIEB 3GSNB 4R3SA 1AXSA 3BXNA 4DTGH 4HGKC 3OZ9H 3T2NH 3BT2H 3VI3F 5ID0A 2F54E 3ELAT 3RWGB 4AEEA 4PP2B 5C0EA 1SEBB 4PTUB 5BZWA 2ICWJ 4PG9B 4FXKB 1CDJA 4LVHC 4MDJA 1HI6B 5L8JB 3D3VB 1LO5B 3RBGA 2JJWA 4IRZH 2W0FB 1XGQB 3MV8E 4NP4L 3KS0J 1FFRA 2WBJB 3ISWA 2Q7YB 1AP2A 4D9LH 4OD1H 1RZFL 5IFAL 4JY4B 3GBLA 4HGWB 3K2UH 3QFJD 1MJJA 3OF6D 2F19L 1RZIB 3G08B 1HKFA 3BP6B 5D8JL 4L8BA 3B3IA 1NCNA 4LRNL 1Z9SA 1GZPA 3PDGA 1PJ9A 1QR1B 1MI5E 2QJDA 1JL8A 4W81A 5EO9A 1OD7A 3BN3B 2K3TA 3JSSA 1EXUB 1ZTXH 3OZ9L 4MNQD 3T2NL 1F3DJ 3RWCA 4K2UH 2DDQH 4GQ9L 3E1F1 3U46A 4NKIH 4OCWL 1FG9C 2CKBH 3S6CA 1KLUB 4XX1G 5IHUH 4JN1L 3WUWG 3BPLC 3EIFA 2VQ1B 4XZUB 1ODAA 4G9FE 5SX5H 4IRZL 5JMRA 2BZDA 2WUCH 3LPGA 1YUHA 5C07B 3WKNA 4JDVB 1KXTB 3ME0A 1CDHA 4I5BB 1WBYB 5AUMB 3FQNA 4HC1H 3ZTJH 3MRFA 2ZOKB 3M8OH 4F3FA 4EBQH 1RV6X 3U83A 1IAII 2AS5M 1MHEB 1MUJB 2DIAA 5AAMA 4Y2OA 1WV7T 5TDPA 1XCTB 2AQ2A 5IHZB 4NOFA 2WAHA 5EA0L 5GGRA 3GSWB 3MOAH 3WNKA 1S7WB 2PXYA 4L4JA 4XVSH 5J4MA 3KPNA 4FQQA 5HBBA 3D0VA 1ZTXL 2BNRE 2C26A 5T3ZL 4NO2A 2G2RB 2B1HH 3JWOC 4BK4A 2NXZC 1RHHB 5KVMC 2XKNA 1NCAH 1YEHH 2EKSB 4K2UL 4OZFB 4CN6A 4IJ3B 2VO5A 1KIPA 5CAYB 3NH7H 2DL9A 4OLXH 2CKBL 3RIAF 4FFYH 5GJTL 1A1OB 1ADQH 3FFCA 2XN9A 5C2BH 3B9EA 4PJ5A 1JNLH 5BRZB 5J1AB 2Q7NA 1MIEH 1FAIL 3EBAA 1I1CA 4PJCA 5T5NG 4PRID 1IQDA 4NQCB 4F7CB 1KXVC 4JVPA 2WUCL 1S3KH 3DMMB 3QXAB 1IGJA 3DETD 3V5HB 5CILH 3ZKND 2YA1A 4Z76A 3V7AG 4YUEL 1ZMYA 1CLOH 2EXYC 4ZFOL 1DN0A 3H2WA 5F93C 2J5LC 2Q8BL 3DTXB 3VA2C 3TN0C 3IAGC 3SE3C 3MOAL 1FFPB 1R24B 1S7RA 1EZVX 1T5WB 3MV11 1AIFB 4Y4HB 4UILL 1CD9B 5J11B 1A6WH 4Z7QE 3CC5A 4J3SA 2B1HL 2BVUA 4LOUC 2XQYK 5ESQB 4K7FB 1NCAL 1ONQB 4N0CC 3TCLB 1ZVHA 2E7LC 5AEAA 1D5XA 3KGRA 3NH7L 3CFDB 4OLXL 4L8DA 1ADQL 5C2BL 4PG2A 1JNLL 5CJ8A 5C0JA 1MIEL 1OAZH 4D3CH 4APQD 2BY0A 1S9YA 5E1AA 3S5LA 1MWAL 1T7YA 2VWEE 5ADOL 1Q0XH 2P5WD 3LZFH 3VA6A 4Y19D 2E9WA 5EN2B 3OAUH 5CILL 5IVZB 3CXDH 1I1FB 3GSNH 5D2LF 3WIHH 3GHEH 2Y36H 1RUMH 4X6FB 5AD0A 1CLOL 1OSZA 2HT3C 1XFPA 1F4YH 2AXHA 3DRTA 1E4KC 4IMKA 3SCMC 4YWGH 1EHXA 1C5CL 1QOKA 5TDOB 3OR6A 2YD1A 2FEDC 4QOKE 4HUVB 4EI5A 4JM2F 4GAJH 4FHBD 4WFGD 1A6WL 3FHAA 4QO1A 1FG2B 1CZ8H 3V52H 2VWEC 3BEWA 2PETA 2W92A 5DD1L 4UBDC 3UZVB 2DJ4A 4A6YL 3AREB 2QQKH 2X4SB 4DVBB 2B20A 2R1WB 5IVOA 3RGHA 4DGIL 3HZMB 4TNWK 1Q9KA 4IRSD 3SDAA 2PTTA 4LASH 1KTLB 3C5JB 5GGTA 1OAZL 4D3CL 2VDQH 1KJ2A 2VLLB 2HTKD 1F00I 3L3IB 4S1QH 1Q0XL 5F96H 5F72S 2OXHA 3MV7E 1G0DA 3AAZA 4RAVB 3GSNL 1V7NH 3GHEL 2Y36L 5DT1H 4JR9H 2YD4A 4P99A 4NSKB 1WCQA 4KPHH 1NJ9B 1MCBA 2VB5A 1QLFB 3KPLB 2YPLA 4OJFL 4YWGL 5E6YA 1NAMA 5C09E 2F58L 3SGJA 2JK5A 3CLFH 3I75B 5HYIA 1SBBA 3PP3K 1U58A 1GHFH 2XY2A 3DGCR 4GAJL 1MCPH 3DRQB 3JV6B 3CCHA 1S7SA 43CAA 3LHPL 4F9PC 5T3ZE 2FRGP 4OKVA 4OCRL 3V52L 1NGPH 3D85A 3OG4B 4Z8FH 1ZGLB 3WSQH 2QQKL 1ZLUK 4AY0A 3EAKA 1FZJB 2DQUH 4J12A 5TH2A 5EU5B 4LASL 1NAMH 2H26A 4N9OB 3BQUD 3FT4A 2Z8VC 1X5KA 2XWTB 1KYOJ 2JB6B 4P2YA 4Z7QF 3O8XA 5F96L 3V0VA 4OV5B 3QUZA 3P77A 1YEJH 3AU1B 3EJZD 2JJSA 4L8CA 4JR9L 1X4XA 2HYMA 4YLQT 4AIXA 3RL2A 4CU6A 3MRHB 4LNRA 1C7TA 3O41A 2XZCH 5IIEB 2X70B 2ZNXA 3OWEA 3UTSE 3DVGA 3DYPA 3CLFL 2YPKB 3QQ4A 5C3LD 1MCPL 3EDKA 2XN9D 2OXGA 4PRDB 1CGTA 3CFBB 3QYCA 2X09A 2NY2C 1T80A 2OK0H 3OKYA 3RX7A 1HN1A 1NGPL 4Z6AT 3F7YB 3WSQL 4J7RA 4NNYA 3SDYH 1RUQL 3THML 2GHWB 5ADPL 4NNPH 1RIUH 1QSEE 2DQUL 3ARUA 5C0ND 3G5VA 3EO0A 1NC4B 2VISB 2GK0B 4LQFH 3B6SB 1MQKH 5DI8A 4Z0BH 5DMIH 1FYTD 3DV4B 2OTWA 4U1GC 3MRDB 5MP6H 4JZJA 3P73A 1DE4B 1U8MB 5DQ9B 4BH8B 4KK5C 3MBEC 1BQSA 4OGXL 1JWUB 5IR1B 5F9OH 2XZCL 4XXDB 3CX5J 2NY6C 3TLRA 2DWDB 2AV1B 32C2B 3MXVL 5D4QA 3QXUA 1QRNA 5KS9E 3IDIA 5HYFA 3WE6B 3WLBA 3CU1A 5KANG 5EBMA 2OK0L 3TZVC 3W9DA 2QHRH 5DJCB 4MA7H 5ISZA 3L3DA 4H5SA 4PRHA 5JA9A 1KYOK 1LVEA 2R2HB 5FCUL 3SDYL 5I1EH 1U8JA 3KXFB 3PWNB 4XRCA 1RIUL 4Y8DC 3RNQB 1JPFB 1A14H 3RWFB 3ZDZE 5DHYB 4O2CB 1IC4L 1QVOB 5CBAA 4CN4A 1HNGA 2AXGB 4NQUA 3KYMA 3SDDB 5FKPA 5DMIL 4IS6B 5B39A 1A2YB 5LGKA 3A0OA 4EI5D 3T3ME 4RFEA 1T1ZA 1XF5A 2YD2A 5ESAB 5BS0A 5MP6L 3GMQA 3L7EB 3MA7B 3K2MC 4E41D 3IDGB 3UC0H 1WJ3A 2BX5A 5F9OL 4M6ML 1YC8A 1DBBH 1AGDA 2CH8A 4XBEH 3UTTB 4X4ZA 1EFXA 1K3ZA 1H15A 4PP1C 4FFWC 4U1KA 1A0QH 1I9RL 4HH9B 3SOBL 2WQ8A 4EQ3A 2DL2A 2QHRL 4MA7L 1HSBB 4JLRB 5ETUA 1T0NA 2E9IA 4OQTA 1AGCB 3D3VE 1J1OH 1F8TH 1F3JA 5I1EL 4G6FD 1N3NB 3VFUA 1P7HL 3P9MB 3HNTH 3VXTA 5EU6B 1BFTA 4XP1H 2HKFL 3EW3B 5JW4M 3FQRA 3FB7A 1A14L 1EO5A 5AWNH 3FN9A 2YPLD 3ALPA 1YN6A 1K4CB 2ZG3A 4Z5RA 1I9IL 5IW1A 2AV7A 2HJFB 4OQTH 2HA1A 1J05A 3H8NA 5F7WC 2IMMA 4PBWD 3QZWA 3D85D 3UC0L 3QCVH 5CD3B 5DEGA 5GRXG 1MRCH 1DBBL 1A22B 4R96A 4FQJL 4XBEL 1VEPA 4HEME 2WBJC 2YK1H 5D9SB 1A0QL 2YD3A 3QXTA 5DYOB 5CGYC 1OW0A 5E2WL 4PGBB 4MD0A 1QFWH 5B4MD 5IV2B 1J1OL 2AJUH 5FECA 1NBZB 5C8JA 5CIPA 4AQOA 4LRIA 4O5LH 3HNTL 4Y2DA 5EZLB 4HJJH 5C07E 3SDCA 2X4TB 4DK6A 4P46B 3RIFF 5KS9F 1CVRA 4S0TD 1GOGA 4P57B 2CIIB 3BH8A 5JNYA 3ARDB 2FR4B 5FA4A 5C08B 2OP4L 5SWZB 2DMKA 3BDYH 5DVMA 4MD4A 4Z0XB 4XP5H 3WO3B 4NKDB 5FGCB 4XI5C 3X12A 3G5XA 1MRCL 4HS6B 2XOTA 3QG7H 4I0PA 3N1FC 4LSVH 4LCWA 3TA3B 4U1SA 5EO1B 1CE6B 4I3RH 1XF1A 4BFGA 5DRWA 3MNWA 3HB3D 1M7IB 1CICA 4WHYH 5BRZE 2OMBA 3O9WD 1QFWL 1Y6NR 1A6UL 3W5NA 1FNGB 1MFBH 3HC4H 4BKLB 4ONOA 2AJUL 2MOVA 1HDMB 2P5ED 4NQCE 1DJSA 5CJBA 1W0WB 4HJJL 3CDGB 5I1DB 4UV7H 4WTWA 4P2RD 2VDPL 3EYVA 2C7UB 4JRYE 3U0PB 4WFFD 5GS0D 3TPUA 3MACL 1V5JA 2Z91B 4IJ3C 3LKNB 2AQ1A 4OT1H 1UM4H 5HHVH 5I0DA 4XNXH 1NFKA 2ID5A 3VXNB 3QB7C 2V7HA 4F57H 1VFAA 4XP5L 5ISZD 3HZYB 5DJ6A 1WGOA 4PRHD 3WFDH 4KK8D 2XY1A 1SJEA 3HS0A 1XIWB 1UCTA 2HVKB 4Q97A 3DMMC 4Y88A 3A6BH 1BEYL 4EN3A 5MHSE 4JDTH 3CDCA 3GJFH 3UTZB 5KZCB 4S1RH 4RSVA 5DD5H 1J1PL 1MFBL 3HC4L 2Q20A 4QHMA 4YDIH 1TVBB 1KLGB 2EYSB 3C09B 1HSAA 2PYEB 2BOCB 2H6PA 1A6ZB 4Y4HC 5J11C 3PNWA 4UDTB 5I1AB 3SGEI 3FO0L 3PHSA 3NCMA 2OJZH 1UT9A 5IOPA 4U3XA 2CD0A 1R0AL 1PSKH 4KI5D 3RWJA 3DWTA 5C0AB 1UM4L 5HHVL 2VYRE 4G42B 1TTUA 3ARGB 4Z7UA 4JG1H 5CGMA 1VESA 2E6PA 5GQBA 3O3EA 4N1EA 2BVOA 3LS4L 4X4YA 1QA9B 2GCYA 5KTEL 2DWEB 5T1LB 4S1RL 2VKWA 2VXTH 5FO9A 5DD5L 1E0OB 1XMWA 1KGCD 4J6RH 1N8ZA 1FORH 2X6MA 2DQGH 1BVKA 1PYWA 4YDIL 1W72B 3VXSB 1EK3A 5F7FA 2BVYA 5E00A 1AHWA 4NCDA 3SGDH 1FNSL 3IVKA 3L3GB 1UM5H 1KNOA 3TBVA 2OJZL 3AREC 1MREH 4QRPB 2UVFA 4YNYB 5I1IH 1I85C 4MNGA 3I85A 1N6QL 5H8DA 3O6LH 4ELKB 1FQ9C 1U8PA 4JG1L 3OSKA 5DUBB 4QHUB 5I16B 1HHGA 1NMAL 2PNDA 3L3KA 1O0VA 1F6AA 4FQ1H 2A77H 5CEYB 3MRLB 4D9RD 2V5MA 4Y2DD 3UYRH 4MZ3A 1FCGA 3C9NA 1X7QB 1GH7A 4RMQA 1I4FA 2VXTL 2NY3D 4XCYB 3FONA 4ZG1A 1RK0B 1FNFA 3KLDA 1J9CT 1Q0YH 2DQGL 5KG9A 1JZ7A 5KN5A 1RVFH 1LP9A 5FGBC 2KQNA 3BYYA 1BJ1J 3C8HA 5EFIA 3RGVB 3FRPG 4X5XA 1YN7B 4POYA 5I1GH 1WC7B 4HQQH 1VENA 1UM5L 2NR6D 4HKBB 3UTQA 5E4IA 4CL7A 1MREL 1OTUD 1B3JA 2FH8A 4JFFB 1D9KB 3RL1B 4UV4H 2BJMH 4LCWD 3AVEA 3O6LL 4O02H 2ORBL 3QEUA 4OCSL 2G5RA 3BP4A 1OB1A 2VITA 2A77L 4ISVA 5FCSH 3HN3A 3VXMB 1ZVSA 1ZA6B 4GKNA 1A7PH 1A5FH 3UYRL 3MO1A 4CAGA 4O51B 3EDDA 1R3LA 3BKML 3OX8A 3PL6B 4OGAC 4G9DA 2XG4A 5DJXA 3C2SA 3VI4E 1IFHL 1Q0YL 1UADC 1RVFL 5H35A 3CFJB 4LF3B 1WZMA 2DQHL 3MRKA 3OG6B 1N6UA 5I1GL 1NCCH 3CH1A 2EZ0C 1QQDB 1I7ZA 3R06B 4X8JB 1CLZL 5D72H 3ULVD 4LFHD 4K8RD 2AJ3A 1U36A 5GISL 4P2OD 3V6OE 4UV4L 2BJML 2HH0H 4ZUVA 3FB8A 1NDGB 4NZDA 4HKJA 4U05A 4OZ4B 5E6IA 4JFYB 1CL7H 3R1GH 2YBRB 4OSUH 4WTZG 3DX8B 4KGJA 3QH3A 3VWJD 1ZEAH 2GJJA 1K9TA 4TNWF 1A5FL 2DYPB 5IB4A 3LKQB 3KXFE 3BZFB 2VE6A 4QRTB 1MJUH 4AEFA 4XAKE 4OLVH 1MHCA 3V6OC 3GHBL 5HYJE 1TETH 3ZE0E 4NO5B 1UJ3A 2QR0B 5EUOB 2NNAB 4MDIA 2VQTA 2JLLA 4QHLA 1UWXK 3MGAA 4J4PA 3OKDB 1MLCB 4KROB 1PEWA 3IJHA 1HINL 4ODWA 4G8FA 4KU1A 1LD9A 4MWFA 4LPTA 2P48B 2PW2A 3H0TB 4U1JA 3QWOB 1IEHA 3B5HA 3QA3B 1F42A 2ED7A 1CL7L 2J12B 2NY5L 3S3JA 3FO2B 4OSUL 5E94B 1DBAH 5LXGL 1CGVA 3OMZA 1IAOA 3C6SB 3SDDC 2VAJA 3WS6C 3SJVD 1CQKA 1U0QA 3C8DA 1D5IH 1W72H 1MJUL 4L5FH 1JWMA 5EU6E 4XVJH 3KPQB 3B2UC 3GIVB 4KZDH 3AS3A 4OLVL 3WUWA 2XICA 2B0SL 2OSLA 3G04B 4LLUB 2AABL 4NCC2 1TETL 5BQ7B 2DBJA 2VSDA 4BSWA 2NPLX 3CJJA 5JHDB 2VZVA 4QNPF 1G9NH 4Y1AB 3P9LA 2FD6H 2GJ6B 3RNKB 3X13B 4LGRB 4Q7DA 4Y16B 1UM6H 1E6JH 3KWWA 3RAJL 3MYJB 5HYQA 3HI5H 4QRSA 3VI4F 1FH5H 1Y18B 4XAWH 4FTVA 1N64H 4M3KB 5C6TL 1DBAL 5DTFA 3S35X 2GTWB 2EDTA 1K8IA 4RIRA 3QUXB 4E42A 1D5IL 1TQBB 1W72L 4LPWA 5KVDH 1IGTA 1YY8A 4D0CA 4KZDL 3FCTB 1T83C 5TQ0H 3X11B 1OAQL 5J6GB 2R2EB 3GO1H 3L9RA 1A6PA 5LJYH 1I1YB 1YNKH 3T0EA 1JPSH 1ULVA 1CFTB 3I6GA 3HRZA 1G9NL 3L3OB 5DK2B 1U8NA 2Z92A 5C08E 2FD6L 3EO1B 1VGKB 4QXUH 5D2LA 4ZS6D 3ULUH 4UNTA 1LWRA 4YC2B 5FGCE 2H32B 5EOTB 2LABA 1H5BA 1U8IB 2V7NB 4G9FA 3GMPA 3MRNA 1O5DT 3DVIA 1U8LB 4P46C 4JM2A 3QPXH 1ZHKB 4UT9H 1FVEA 4E5XB 3ARDC 4LHQB 4ZTPL 3QQ9D 1JNHB 4F9LC 5D7SH 2O5XL 4PB0H 1Y0LA 2YWZA 1A6TA 3LRSB 4XCFH 5FYLD 5DDHB 2H3NB 3JUZA 3GO1L 2JJTA 3GMOA 1JPSL 5EULV 4YHNB 1Q9LB 2P7TB 3OBAA 5F9WB 2BNRA 3TA3C 3V4VH 3IFLH 4Y4FA 4LPXA 1FIEA 4RBPH 5DJYA 4J8RA 3B8SA 4ZXBD 2Q86B 3ULUL 4GUPB 2VL4A 4ONHB 2HVJA 2DKUA 1JZ4A 5I71B 4F2MB 3V6ZB 2R2CA 5INCB 1BFOB 4RDQG 5AZ2H 1ORQA 3QPXL 5D2NB 1BQLH 3K81A 1RURL 4XBGA 1KG0B 1HK6A 3ARFB 4X80H 3VXRD 5F7MC 3OJ2C 2A6KB 1YJDH 3LN4B 3FN3A 4JY6A 2VDKH 4PBVC 1QP1A 5I1KL 1WIUA 1LEIB 4RWHA 4XCFL 2AXFB 2A6IA 2FX7L 3TVMA 1TCRB 2WBWB 1XIWC 4MJ6B 4NQDA 4XMKH 2NY5C 2N56A 3V4VL 5C0AE 4ZSOB 1LO4H 1U92A 2BDNH 5FYKD 3ORJA 3EGSB 4C83A 2A83A 5JQHC 1OAYH 1EEYA 4LHUB 1I3RA 4DCQA 4PJGB 3C09C 4YGVA 2EO1A 3VXOA 3BVNA 4NRXB 5E99H 2QHLA 4FQCH 2QSCH 1TZHB 2ERJB 4NDMB 4PJDB 5F1SA 3BZEA 3T0BA 3F58H 4U2ZA 1GL4B 1OT2A 5TGBB 2XFXA 4X80L 2RQ8A 1S5HB 3ARGC 2MCPH 1WBZA 4GW1A 3VXSE 1YJDL 4N0FB 2F54D 1YPZB 2VDKL 3HZVA 2IQAB 2DJUA 3NZ8A 4MX7A 1PG7H 4QOKA 2GFBB 1F11A 3UPCA 3LMJL 2JCCF 3QIWB 4QRPE 2OR8A 1MFEH 1T2QH 1EAPA 3DPBA 4JGMA 4KKAC 1LO4L 1KPUA 3MV8D 4F8TA 1OGAB 1YQVL 2I9LA 3NFPB 3FMGH 1YDPA 2AKRA 3EFFA 1MH5B 2D03L 4PJ8A 5DFTA 5I18H 4GRWF 4KXZI 1JVKA 1HZHH 1T4KA 3SY0A 3WFCH 5HGBB 3HMXA 1DUYA 3DNKA 2FSEB 2WP3T 2UZYB 4F9PA 4WU5A 1OL0A 1JGDA 2QSCL 1DQLH 5INDB 4PTTB 5KSVB 3BE1L 1MI5D 5MERA 2I5YH 4JRXD 1G9NC 2DLGA 5F3HA 5F6IB 5D1XB 4TTDC 4M03A 4JFEE 4NKMA 2EYRA 2O5YL 3DUUB 4LVNB 1XF2A 5C09A 5I1JL 3IDJA 4AT6A 1PG7L 2WWKT 3SE9H 1V3KA 1MFEL 1T2QL 4G9FD 3M1BB 3QNXB 4HKZA 4P5KB 1VFBB 3R4DA 2CJUL 3L3JB 2NXZD 3FMGL 1BZ7B 1OAXL 2CDFB 3ULUE 3TBWB 2EH7L 4NC0B 2BSSA 4J3OC 4ZYKA 2X4UA 1HZHL 1MY5A 4NWTH 3PABA 3RGVC 1A3RL 3WFCL 4NO0B 1NCWH 3VXME 5CHNA 5DRXB 5E5RB 3HUJB 1DQLL 1M71A 3IXTA 4XNUL 5E8EA 3U30B 3QEHA 4F80A 1J10A 4JO4L 1D9KC 2BNRD 3HHRB 1Z3GH 4ZFOA 1NCBH 2EXYD 1LMKA 5DHXB 4LLDA 5DC0A 3ULUC 4M43L 4PRAA 1NCTA 4QXGH 3WN5A 4AH2A 2DQFB 2W60A 4F7MB 3DSNA 3O11B 5IEKA 2RR3A 5DSCA 4XPBH 3TN0D 1DQJA 2FIRT 2PYFB 3ALWA 3SE9L 1AGEB 1UB5A 2GY5A 1YC7A 2AI0H 1J12A 2P24B 5FV1L 3QPQC 4LOUD 2AEPH 3PL6C 1QACA 4J1UA 1CE1H 1RULL 3QG6B 4N0CD 3S36H 3WJJC 3QUMB 5J9PB 3KPSA 1QSEA 4NWTL 5T1KB 3DVFA 5DJDA 5IKCA 3E6FA 1ES0A 3PDDA 1E4WH 1E4XH 3GKZA 1PKOA 4ODHL 1S9WA 2VL5B 1J18A 4OF8A 4LKCB 2W65A 5HYSG 1K2DA 3RWDA 4K7PH 1BQHB 2DMBA 2ITDA 4YO0B 1NCBL 1GGIL 1KIQB 5EUOE 3WEXB 3KVQA 3SKNB 1Q38A 5J0BA 3SCMD 1ZLVK 4XPBL 2FEDD 1S9VA 5KS9A 2MHAB 3IDXH 4M8QB 3MFFB 4MHHG 5E24E 3O2WH 4LCIH 2WK2A 2OZ4L 3U4BH 4HV8B 2AI0L 1EGJA 1SY6L 2EH8H 5ENWA 1NLDH 4A6YA 3MRMA 4HCRA 4LLMA 1CE1L 4UBDD 1QPPA 3NCEB 2P8PB 3PGDB 5DQJB 1E27A 4QTHB 2J8OA 5FDWB 2IBGA 4YQXH 5MEPA 1CXFA 5IBTH 1YJDC 1AY1H 1PD6A 2EYTB 4MA8H 5I8EA 2HLFC 1E4WL 1E4XL 5H94A 1A4JB 3QWQB 1VKXB 3FB5A 4Y4KB 4KROC 2L4OA 5DRNB 1BD2E 3KLAB 3D9AL 1G7MB 4W6WB 3ZDYE 4HCRH 4K7PL 2WMPA 1NMBH 2A74B 3S7GA 4OB5H 4DGYH 5JHDE 1QBLH 4RCAA 4F7EB 3FOMA 2GI7A 4Y1AE 2D7QA 1MLBA 2GJ6E 2AEWA 2AJXH 3IDXL 1QNZH 1XF4A 4YDVB 4LCIL 3SE8L 3U4BL 4WHTB 4MLSA 1OAUH 3GBNH 1NLDL 3DUHA 5JO5A 3MV7D 1I1AB 3FL7A 1T0MB 5EZOL 1EEQA 4YQXL 5IBTL 1AY1L 1YYLH 2CDGB 2XKUA 4KV5E 5IJKC 2R1XB 4HGWA 1TFHA 1HQ4A 5GGSY 2ZUWA 1L0YA 2B5IB 5JR1L 2JKXA 2GKIA 2IQ9H 4Y16C 4QRQA 3EDFA 3FOLB 4Z7OE 1TJHH 1CXEA 5EORH 1UQSB 1EEZB 1T20B 1B88A 5T3ZD 4M9OA 4X6DB 4FRWA 1QR1A 1NMBL 2HJKB 2I9TB 1PKQB 1EXUA 4K23H 4DGYL 1P7QA 2FECL 1QBLL 2I26N 4PJ9B 5DRZA 2X05A 1BREA 1BWWA 3OKKB 1UB6A 1ACYH 3AS2A 2ICEB 2LQRA 4OF6A 4P5TB 2V9RA 5D7LB 1QNZL 3QUXC 3EJJX 3SGKC 5C70A 2ED8A 1TQBC 5JW3L 1HXMB 2NY2D 3KPRA 3CSYB 4XZUA 3GBNL 3TGXA 3LQZA 4K07A 4YDJB 3TBYB 2OQJA 4X8XA 5BCAA 1T89A 3OQ3B 3MC0A 5HI3C 1HH6A 3D18B 1HHIB 3DHJA 3RI5F 1L7IH 4JDVA 1J0JA 3IDUA 4QGYA 2L7UA 1WBYA 2VTFA 2WANA 1KV3A 4I5BA 4B50A 3ECBB 3QQ3B 5ID1B 3QHFH 4NKOA 2DQIL 3UTSD 4Z7WB 1IARB 4GW4A 1MUJA 4YC2C 1XCTA 3QFJB 3GSWA 2IAMA 2DTSA 4S2SB 2O26U 1XT5A 1FV1A 4JHWH 5EORL 1MCFA 4KK5D 3MBED 4K23L 5HHOB 1F2QA 1KTDB 3MTRA 5BVJA 2B1AH 4LNVA 4OZFA 2NY6D 3KYOB 3PWPD 1ZA3B 1ACYL 4H88L 2YS4A 3WNMA 1S9KC 2ZG2A 2CK0L 1HCFX 4XVUC 4G6ML 1IC7H 3TZVD 5BRZA 3PXJA 4NJAH 5CCKL 2ICWA 4L4TA 2FJHB 4MSWB 4KMQA 1G7HB 4DN3H 5GZNC 5D2NE 5CJQH 1XZ0A 5F9WC 5HDOA 4JRYA 3QHFL 5JOPE 2MTPA 1A6AB 3FT2B 5DJ2A 3KHQA 2Z31A 4LARL 4EUPG 2LU4A 5A2LH 5I71C 1LK2A 3UX9B 2APBA 4M5ZH 4KV5F 4G8GB 4PREB 4WFED 2B1AL 4ZSOE 5D2NC 2XTJD 5CZXD 3O4OB 1N2RA 4UTBL 5CWSA 1KCVH 3K46A 3ARFC 3CFDA 4PP1D 2Y5EA 4FFWD 5LCVH 3QUML 3A67H 5TDNB 1P4BH 1T21B 5KSBB 4Z7OF 2XIDA 2QSVA 1UH3A 5KJRH 4PJGE 5DK0B 4MQTB 4QTIL 3VWKD 4UT6H 1CXHA 3ROOA 4X9FA 4MB3A 5CJQL 4PJDE 2ZSVA 5EN2A 2DIBA 5A1AA 1OSPH 4JQXC 3Q6FB 4X7CC 1D6EA 3VRJA 1C1EL 3GMMA 1GGBH 4CVWA 5IBUB 4NFDA 1YPZE 4YPGB 5T1MB 4K7PY 3RA7H 3VDBA 1HE7A 3LEXB 5I74B 3TIDA 3WHXB 4HUVA 5DJ0B 3J8F7 3S37X 2MKWA 3RFZC 4M5ZL 3FRPA 3T3PE 3D3VD 5FF6B 4WIQA 4X7EC 2ERJC 3LAFA 1DEDA 5FKAA 3AREA 1OGAE 3I02B 2X4SA 5EBWB 4DVBA 3KJ4B 4Q0XH 1I85A 2R1WA 3QUYB 4Z7VF 2WBJD 4HS8L 1KCVL 1JGLH 5CUSL 2Y72A 1JGEB 5LCVL 3IDMA 3A67L 2AP2A 3GUTB 1P4BL 5D71L 2AK1L 3QO1A 5CGYD 1X6NA 5KJRL 1AQKH 2DM4A 4OLYH 4M4RA 2VLLA 1NGYB 4GH7B 1L7TH 4GXUM 4X9IA 2HFFB 3DXAA 3GI8H 1NUGA 3EOBA 3QIBA 1FZOA 3QIWC 1PQZA 3QQNA 1HWGB 5E8DH 1AGBA 2QSTA 1DSFH 1RFDH 1RK1A 1GGBL 5DA4A 3C60B 2D0FA 4JFDE 4LHUG 1OVZA 5ALBH 3S8WA 1LO2H 4ETQA 3ZTNH 4N68A 1RUPH 2X4QA 3NFSL 3RA7L 4FQXA 3I75A 3IU4H 4HXAL 4HWBA 2CIKB 3RUGB 4JJ5A 3QEQB 4HUNB 5JDSB 4P23B 1KXQE 1DBMH 1EMTL 4XI5D 4ZAKB 5J1SC 1ZGLA 2DM7A 5C07D 3QULB 5I8OH 4I9WE 3C5SA 1GSMA 4MAYA 1JGLL 1KELH 3BRGC 5KAQG 5M95B 3RX5A 3MLRH 3FQTB 5F6IC 5D1XC 2F74B 3S96B 5KSAB 4CN1A 1KENH 2EO9A 4LVNC 4OLYL 4MA3A 3HUJE 1QYGH 1R5IB 1T0PB 3HFMH 4Q9RL 4OV5A 1L7TL 3L5WB 4WTZA 5JUEH 2YD6A 4POZD 3AU1A 4KZEH 4XCEB 2VKXA 1XGYL 3MV9A 4NZTH 4GAYA 4P3CH 5E8DL 5DXWA 3HE7B 1DSFL 4AIOA 5F7HA 3MRHA 5ALBL 5IM7A 4PLNC 1LO2L 3ZTNL 1RUPL 2X70A 5HGHB 4M7ZB 3M07A 4JB9H 4JO2H 2YPKA 2FL5A 4WWKB 2A6JB 4OM1H 4ZTOL 3U2SB 3N0PB 5BRZD 4IMLA 2H2SC 1CIDA 5M94B 1DBML 3MJ7B 1HH9A 3P4MB 4NQCD 2Q76A 3U30C 4G7VL 4ODUA 4QCIB 4KQ4H 3DMMD 3FQXB 1HOCA 1AC6A 1YPZF 4WHDA 5EOCH 2BY3A 1RUKH 3IU3B 3MLRL 3NA9H 3RTQB 1MCKA 1GAFH 4KQ3L 3OXSA 2WQRA 3SHSA 2R9HC 3GDBA 4QXTB 4RMSA 1WT5C 3HFML 2RCSH 7CGTA 2JIXD 1JHKL 1RZJL 5HHPB 5JUEL 8FABB 1FVDB 4KZEL 2XXCB 5CZVH 5E9DB 1S7VB 4Y4HD 3W2DH 3DGGB 1XGRB 4P3CL 1JPTH 3EYFB 1UXWA 1IT9H 5FIEA 5FFLA 1XH3B 5E56A 4GG6F 2G9HB 2VXSH 5MHSD 4QRUB 2AV1A 32C2A 3L5HA 1P69B 3VFOB 4OM1L 3WE6A 4GKZB 4FP8H 3TV3H 1MCRA 4CDHA 5DJCA 5FB8A 2CXGA 1EO8L 5K9KB 4KQ4L 4HAFA 3PWNA 5EOCL 3Q2CA 1RUKL 3VMPA 1KACB 2CRMA 4HJGA 4XBPB 3NA9L 4X5WA 1JPFA 1G6RA 3RWFA 2FNBA 1T1WA 2VQUA 5HYJA 2B4CL 4DGVH 4RRPG 3V9FA 2AXGA 2CLRA 5J3HC 4B0MM 2RCSL 3SDDA 2AXJA 4OAWB 3IGAB 5CZVL 5EZJB 1A1MA 1T04B 4MB4A 1OM3H 3ARSA 4U31A 4LPUA 3MA7A 2D3VA 1OP9A 1IT9L 4NUJB 3EOAB 4TYUA 3ARED 3VE0A 4KHTH 4H0GA 2VXSL 3G6JB 5CFHA 2PO6B 3TYGL 2QQQA 1XCQB 5D96B 4E0RB 1FAKT 2MQCA 3OGCB 4BYHA 4FP8L 1LE5B 4KTEH 3K4AA 1AGCA 4Y4KC 1MCSA 4WFHE 1N3NA 4BFIA 5J8OA 4NPYB 1WLHA 3MGTB 3AM8A 4JFXA 5L88H 4QLRA 1XF3A 4LMQE 1LGVA 3O6KH 3L7FB 3U4EA 4PV9B 4ERSL 3JZ7A 2FIKB 1OF2B 3Q6GH 4ETYA 4X6DE 1FZKB 3ARPA 3H9SB 3E3QE 3BGAA 2GSGB 3PHOB 1PKQE 1T83A 5MENB 1I1AC 1NGZA 1JZ3A 2BCKB 2H45A 2MKLC 1SJVA 4WV1B 5D9SA 5D7LE 1NLBL 2DQDH 4KKCC 5ITBH 5MEOB 2B5IC 3ARZA 5EIQA 1MQ8A 3QCTH 1NBZA 4QRRB 5KVFL 3MCG1 5LGJA 3T04D 2EXWC 5LQBH 1U91B 1AI1H 2YR3A 3S88H 3GNMH 2N7AA 4OGAD 2XACC 2VXUH 4CNIB 4PJ9C 1BLNB 3FRUA 3OR7B 4P57A 4Z7WE 3WXWL 4XC3L 3U9UB 4P5TC 3O6KL 2FATL 3VGGA 2V17H 3QFJE 2FR4A 5C08A 4ALAH 4O2EB 2EZ0D 4TNVK 3STLB 3O3AA 5EIVA 5TF0A 5HHOE 3MCKB 1QBBA 3NN8A 1T1XB 3CFEB 3G5ZA 1JJUA 4EXPX 5IMLB 4H25A 5EO1A 1CE6A 3Q5TA 2DQDL 5F1IA 4LLQA 2JCCA 4WI6A 1NC4D 1RZJC 1GJIA 4X9GA 5C0GB 1FNGA 1PY9A 5C0DB 2IADB 3CZFB 1HDMA 4PY7B 1AQDA 2AJZA 3S34H 3TJEH 5IEHA 3AS1A 5LQBL 1AI1L 1W0WA 1DANT 1W8NA 1PX4A 4IHOB 4U7MA 1I3GH 1BHGA 1UCBH 4RQQB 4EIZC 4PLJC 2YD8A 2H1PH 4PJIA 3FZUC 1R3HB 5DD0H 5EUKA 4UQ3A 3L6FA 1XGPB 5TPWH 3VFNB 1ZOXA 2V17L 3VFGH 3OGOE 4ALAL 1I8KB 4ELME 6FABL 3V95A 2BNUB 1G1CA 5IK3A 1V3MA 3DYMA 3P30L 3OKNA 3QHZL 4Q2ZB 2HT4C 4G8GE 4KRMB 3KXFD 3PWJB 4OZHB 3QWRD 3UDWC 4XAKD 5IROA 2B4CC 4I3SL 1FL5B 2HWZH 5DK3A 5KSBE 3GKWH 1LDSA 2DLFH 4LLYA 4X6DF 1KPRB 3MJ8B 3SDDD 3D2UB 2YUWA 2PR4L 5H2BA 4PJHA 2AK4A 3S34L 3TT1H 3OHXA 2EYSA 2WIIB 2HFGH 2FO4B 1TTFA 1I3GL 4PRIE 5FK9B 3B2UD 4FG6C 3P2TA 4PGEB 5D7JA 3O2DH 2IMNA 3O4OC 1FPTL 4P2RB 5C0IA 4YDKH 1NFIA 3MV01 3UTTD 3JTSA 2AJSH 4G42A 3ARGA 4JCLA 3OXRB 1HHKB 4QWWC 4ORGB 1H3WM 2VDNH 1T1YA 4LSPH 1TZGH 3MRRA 4EEEA 4HMEA 2NY7H 2CDEB 1JI2A 3F5WB 1H3XA 2VDRL 5EU6D 5ECJE 4Z7WF 3QEGH 4OUOA 3TO4A 2DWEA 5J6HB 2VR5A 3QIUB 2HWZL 3JV4B 3VXQA 3GKWL 3TYFB 1NBVL 5ICXA 2HJLB 2BVPB 3AXLA 4TUJB 2ZWLT 3OPZL 1Z5LA 1ZHBB 4YAQB 5I74C 4F58H 1IGYA 1Q8MA 4WW2B 3X14A 1BBJB 3QUKA 2P5WE 1YNLH 3O2DL 1KN2H 4PD4K 1I75A 4XMLH 3WFHB 3RPIB 4YDKL 3KJ4C 4X4XB 1ZT1A 1ZS8B 3QUYC 4X7TA 4XCCH 1KJMB 2JELH 4GMSH 4ELKA 1A7QH 3H3KA 7FABL 5DUBA 4QHUA 2X42A 4X6EB 3RUGE 4M61B 1T5XA 5F97E 3QEQE 3REVB 4NNXB 2VDNL 5JMOC 1UH4A 4LSPL 4PRPA 5BV7H 5BOZG 3B8YA 3MRLA 4FNLL 4O00A 4IRJB 3FN0H 4LIQH 4PR5B 4HKXA 3QEGL 4R7NB 4P46D 4XCYA 1RK0A 2YRZA 3C60C 2EIEA 4ELMF 3X3FH 2R1YB 4NQEB 2V2TA 4NN6B 4U4BA 3S3SA 1JRHH 3ARDD 1S9XA 2X1PA 4F58L 2KBGA 1ZSDB 2ICCA 2ZUUA 1YN7A 3DX7B 4JFEA 4ZFZA 5SWZD 1WC7A 1QSVA 4P23C 1R3KA 3OKEB 1SYSB 1YNLL 1GOHA