3WG9A

Crystal structure of rsp, a rex-family repressor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
209
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 74
structure length 209
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wg9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wg9A02
1S7AA 1A9ZA 3EK2A 2QQ5A 4A0XA 1Y8QB 4E30A 2MC3A 1TQPA 1R4MA 3FMRA 3TKYA 3O6BB 1V35A 1X15A 3K73O 5G2OA 3VH1A 3PQKA 1SAXA 1B4AA 2PMHA 3QPHA 5LGUA 1U3EM 1ML3A 1W4ZA 2J3JA 4FD3A 1QLJA 3JTGA 5JCJA 2OORA 1LVAA 2I66A 4OQZA 3DFUA 4U88A 1Z82A 3E6CC 4IGEA 4TSKA 5KJ1A 3OEWA 5EQFA 3WGQA 2WD8A 3IHUA 2EFPA 1ZK4A 4AJLA 2WTEA 1HSJA 3K2ZA 3R3SA 5H82A 3L4BA 3WJ7A 1DOHA 2QZ8A 5JI6A 3KZZA 4DYDA 4UVEA 4OL9A 3VPSA 2MLGA 5JW6A 5D8LB 5KVSA 2J5OA 3JQAD 1NFRA 4U5QA 1VSUA 5T8KC 2GA2A 2ZFWA 2BH9A 1IXRC 5F64A 4CM4B 2NVBA 2JTVA 2FA5A 2YQ5A 1AHIA 4QECA 4W4TA 2DBBA 1CETA 3B1JA 4GLOA 2QQAA 5CVJA 1E1MA 5LHGA 1PJSA 3A14A 1CF7A 1MXFA 2V7PA 3S2IA 1WKMA 4DQVA 2OOSA 4UHTA 2X5OA 4CMJA 1JWAB 3PJDA 1QR6A 5CG1A 4AIJA 2M8EA 4I9UA 5CJ9A 2PKQO 5ER6A 1UCRA 3WTBA 4R5MA 2MLKA 2P8TA 3WQSB 2Y75A 3ZWCA 3GH3A 3E03A 2M30A 2A6EF 2XRNA 5H20A 1I3LA 3GVXA 1XEAA 3WWZA 4B3JA 4D0SA 1SC6A 2PFBA 4WK8F 3QSGA 3WTYC 4R9RA 4RPHA 5H6RA 4XDYA 4D45A 3JAMZ 3M1LA 2DTXA 4YPOA 3SZPA 3GRPA 1PGJA 4IS2A 3UXYA 3DZIA 4I5GA 1UUFA 4ONEA 3OJEA 3SJUA 4B3HA 4B09A 2EP7A 3N97A 2YDXA 3FSRA 3OOPA 1T2DA 1LJ9A 4L75A 1EVIA 1MJAA 2DPHA 2JD0A 1LNWA 1KVQA 4NBRA 5DCMA 1F5TA 1QG6A 2PKQP 3D5TA 4B4OA 1M75A 2AQIA 2FPPA 4HA8A 4L8VA 4HBLA 3M8FA 4DVJA 1ZSVA 3DBRB 1NTOA 3DAFA 4QQRA 4RDIA 2VBZA 3VKUA 1UHMA 3GGGA 1YDEA 3H8VA 4LVCA 4U8GA 2E7XA 3ECOA 2F5FA 1E5LA 3UF0A 4K28A 4I2OA 4PZCA 3AY6A 4P5OA 4Z6KA 4J2HA 3CH6A 4R79A 1R66A 1U7TA 2MBFA 2D0IA 5DF1A 1BVUA 1J9IA 1RUNA 2GERA 3BTSA 3VPFA 1ZK0A 3EY4A 2XAHA 1E1KA 2JKVA 2WD7B 4R69A 2AE2A 1E0DA 4L9NA 1R0LA 1SEPA 1JGSA 2I5PO 2YYYA 5T67A 2Q1WA 5EN4A 3SLKA 3S2EA 4YXFA 3OICA 1TTYA 3R0AA 1EVZA 1RM3A 5D4RA 2CFXA 3NT5A 3PHGA 1GADO 3F1KA 5TT1A 1PGPA 3LA7A 3GGPA 3GEZA 1XWFA 4J43A 3RUIA 3BMOA 2CGPA 4J16A 1V4RA 2CG4A 1JAYA 4HX7A 2ZJ2A 4UVBA 4RF3A 5HS6A 3ZWYA 1QKIA 3H9QA 5K1YA 4B3IA 4S05A 1HDOA 2HKXA 2YUTA 2NV6A 1J6UA 3C1AA 2Q4EA 1U6GA 2IEBA 5THKA 4A0SA 4Z9YA 1TT5B 5HM8A 3OM9A 1BVRA 4WK6A 1FP1D 4BNWA 1RUOA 3CUQA 4M86A 4DQXA 1V6AA 3VEPA 3PJFA 3UVEA 4YT8A 2BGLA 2UAGA 1FDSA 4E32A 5TS3A 3WFJA 2RIRA 3TSCA 3DHNA 1LXCA 1GZ4A 2OP0A 4P4LA 2FRDA 3VZPA 2DQ4A 4XYGA 3M7GA 3LT1A 4XR9A 3BMQA 3KP2A 5JS6A 2O8XA 3HSKA 1TW2A 4HX8A 4A5MA 3J7AO 2Z5UA 4W9NA 1MB4A 4CM8A 3JQFC 1U5AA 2M5WA 4H3VA 1J5YA 4G2NA 2DC1A 2DW4A 4BXUA 1IUKA 4WUVA 5L3FA 3I4FA 4ND5A 3ZV4A 1TVEA 3BMNA 4IJAA 3I9NA 4HP8A 4MTDA 1Z73A 3NYWA 4TRJA 4IQGA 1RKXA 3S8MA 3HRMA 5A5FA 5IF3A 2JPCA 5FD6A 4GYGA 2NNYA 2IRWA 1BXKA 2ZYGA 3RC2A 2PI0A 4EJ6A 4GSLA 2PZLA 4LRSB 3I59B 1PZFA 5DBGA 4RGBA 3ZW8A 5K5QA 4K1LA 4NR0A 3QOPA 2RVCA 4BHTA 1I24A 2XF8A 3V8LA 3JYOA 4I0BA 4PLFA 3JQAB 5L3EA 5A2QZ 3BROA 3J81Z 1U5TA 3ZMVA 1DPRA 1GU7A 1P45A 4WLVA 4WKGA 2VE8A 3JTMA 4J1QA 4FSHA 1GEGA 1EZ4A 1V3UA 4EUEA 4MVJA 2L01A 3EVTA 4QTZA 4CO8A 4BQRA 2G5CA 4PLZA 4B4UA 1MC5A 1DAOA 2PR2A 4U0JA 2DM6A 3DBHB 1PJ2A 2A5YB 3GMDA 4DGSA 3UFXA 3Q3CA 1UDCA 4U0KA 4CM3A 4CXFA 4JROA 3ANNA 4DPKA 2GDZA 2NU9A 3JYLA 4I5FA 5C7IO 3K6JA 3PYXA 4RF4A 4E2XA 4UV8A 1YQDA 2CQKA 2IXBA 4Q47A 1LTHR 1Z7UA 1PQWA 3G79A 4PCQA 4CM9A 4LK1F 3JQBA 2HOEA 4WPGA 3UCXA 1Q1HA 3HSFA 1H9BA 2QX7A 4ZQEA 3QP9A 3ZHZA 3QWHA 2FR0A 2O48X 3I64A 5A3JA 5FB2A 3QWIA 1N92A 4ALLA 1JLLA 4RORA 2EA4A 1DPUA 3BMQB 4EUHA 4MVJM 3NDRA 4UUVA 4UULA 1AWCA 3AUTA 3I1JA 4YFKF 3FXRA 2EEZA 4WCFC 1A27A 1HETA 5TNXA 2P9GA 3TOXA 3F8MA 1R6DA 3V4GA 2EKQA 3D5LA 2QM3A 3WQQA 2I3AA 4MTEA 3GDGA 3HDQA 2BKAA 3OSUA 3QIVA 2OZ6A 5CVVA 3BZUA 1FZPB 3TQNA 1G6KA 4H0EA 1BC7C 1DHTA 4W82A 1H0MA 5T8KA 4A03A 1DIHA 7MDHA 5I8WA 4CHUA 3GZNA 5TQVA 2I3GA 5KVCA 4YWJA 2FZWA 4BHCA 3ZN1A 1ENPA 4XYEA 3PQFA 4NFYA 3FN4A 3GZ4A 1IZ0A 1FXSA 2GLXA 5CPFA 5A9TA 2BGMA 5E8GA 2HS5A 2C7GA 3OH8A 3TFOA 2X86A 3RD5A 3KXDA 2JCVA 1VJ0A 4FJ2A 2DTEA 5FD5A 4U7DA 2BD0A 4JP3A 1K79A 4XB2A 3HRSA 1FBQA 3LDHA 4HF1A 4I1IA 5L9AA 3DF8A 5ENVA 5CEFA 4HQMA 2I99A 1I6XA 4J90A 4BNFA 1DJQA 2R00C 3HSRA 2GAUA 3D4NA 4G7ZF 2O7SA 4A5NA 2IA0A 2KIFA 2HWVA 1MP0A 2J3KA 5J23A 1E3EA 4MNUA 1IE3A 3JYPA 4BO9A 5LHHA 3I83A 3JCZA 4BNUA 1XQ1A 4HAMA 1F9NA 2QLZA 2AEJA 2Y67A 2NADA 3K9TA 4N0BA 4E2YA 3KP5A 4OMZA 5L40A 1H0KA 5D4SA 3LSYA 1UXIA 2HQ1A 1IPFA 5B4UA 3C7JA 4WCFB 4GKVA 3D3WB 4DLBA 4IDDA 4BNKA 1HDZA 4A2UA 3SXYA 4CUZA 4DYVA 2B0LA 3SBOA 4OKNA 1Y0UA 4KUEA 1HKTA 4I08A 4BH9A 2NU6A 4DQUA 3DDNA 2J5PA 4OINF 4MKRA 1K3TA 3FF4A 3NDJA 1FDWA 5HRUA 4GGOA 4CLDA 3DKWA 2B37A 2QBYA 4KDPA 1ONPA 3DMTC 5LC1A 5CDGA 8ADHA 1M6HA 2ZTUA 3DONA 1U78A 5K5RA 3AUSA 1T2CA 4WE3A 3WFIA 3U49A 4DWVA 4PLPA 3RCBA 1MUUA 4NHEA 4ALNA 5AONA 3RUDA 3OETA 1FYLA 4PLCA 1ISHA 4GLLA 2VHXA 3B73A 4JLWA 4QO8A 4BGEA 2R7FA 3ZWAA 2ADUA 3CUOA 1JXSA 4KIBA 1HTBA 1GR0A 3C8MA 3KEOA 3P2OA 4J7UA 1XSEA 3KO8A 4B8ZA 4CR6A 2Q1SA 5ILOA 1HQCA 2HMSA 1EUDA 2GIVA 1GPDG 2PGJA 3S2WA 2XGXA 4LISA 3G3EA 4GX1A 5BQTA 1PU2A 2GCGA 2D5CA 3STHA 1L7EA 2EB7A 4M72A 3LAPA 1KETA 2JHGA 1CERA 2O3SA 3EUHA 2WDZA 4RVDA 1GDHA 4GX5A 2I6TA 1IXSB 3TOAA 1LEHA 3DHYA 2PA3A 1ZZEA 1XGSA 1D8KA 2IJLA 5DDGA 2EXXA 4F45A 4EM2A 1STZA 5E1WA 3JD1A 1P4AA 4HNHA 5L53A 1ZYRF 3QAHA 5LGTA 1YB4A 1P0CA 2YZ7A 3ZW9A 3FNGA 5A9RA 1TLHB 2VBYA 4UVDA 3VZQA 4OOIA 2WM3A 1USSA 2HFHA 3RYPA 1KVUA 3I9LA 3I53A 1FLIA 2BMAA 4BB5A 2FBKA 1BI0A 1V9LA 2LDXA 2O4UX 2GF2A 1W5SA 4BNHA 1NVTA 4XRRA 1U8RA 2V1XA 3LC7O 1B7GO 3U0BA 3WR5A 3JQDA 5E17F 1LLUA 4MEXF 2NACA 5F5NA 3WGZA 6ADHA 1WMBA 3MZYA 4E31A 1MLDA 4J9VA 2EFWA 1RIOH 2NTJA 3F5SA 3L6EA 3PFWO 2AHRA 5AXCA 4BNGA 3U09A 2QUFA 3OIFA 4BNMA 3TNLA 5JDCC 1S6YA 3CPSA 1X3UA 1LDGA 1XU7A 1G3YA 4PLGA 1FJHA 4MOWA 4OSOA 1LQTA 2BYVE 2X1HA 3FHLA 2RV8A 5EQDA 5CEEA 3KOUA 5KJ6A 4B4VA 4ITUA 1K7AA 1YONA 2I65A 5IN5A 3V8BA 2L4MA 5TLSA 2JCYA 3U3XA 3CO7C 5AXAA 2PY6A 4I02A 3RU9A 3VHRA 3F22A 3ZHBA 3BWGA 3DAGA 5C37A 1E77A 1XSVA 1HW5A 1ZFNA 3RUEA 1X1TA 1Z6ZA 2G76A 2UDPA 1C14A 2DLDA 4GL4A 3IC5A 5FF9A 4BO0A 1XGNA 4IHTA 3ROPA 5KVQA 1X7DA 3WYCA 4ZN6A 4WNIA 2UUOA 1S3JA 3PIDA 4JBGA 4ZVVA 3VC7A 2YX4A 3A1NA 2G7HA 3G1UA 1SB8A 4RB2C 1Y8RB 3L9XA 2BGKA 4R9SA 3R4KA 3TZQA 4BB6A 4K26A 3WBBA 3VH4A 2O6GE 1UJMA 1ZIDA 1XMAA 2OFPA 1OYIA 4NK5A 5HOOA 3JSPA 4WECA 1YL6A 1A7KA 4M71A 3F8FA 3RBZA 2K27A 1PSDA 1I36A 5E1XA 1YL5A 3NX4A 4TRRA 1XD7A 1E6WA 4DXHA 1A4IA 5HTOA 4RL6A 1FDTA 3E6MA 2FY8A 4I0AA 2AW5A 1EVJA 1PZHA 1WMAA 4FBGA 3B02A 3JD2A 1ZEJA 4J2OA 4Q3AA 5J8CA 2E1CA 3I4CA 4GYIA 2I67A 4R16A 3WU0A 3ONDA 4GQAA 1EQ2A 4ZA2A 2L02A 4ZYHA 3EUWA 4R1TA 4YJHA 3IL2A 5JMWA 3KP3A 1HW1A 3CE6A 2V6CA 3ZH2A 1KOLA 5DCYA 3GUCA 4YG2F 2DTRA 3OF2A 2CVZA 3RJ9A 1T39A 5B1YA 4BNJA 3GYHX 1PGNA 2O61A 1H2BA 2WE8A 5BR7A 5G0SA 2NWQA 2YW9A 5B37A 2FR1A 3BZ6A 4FT8A 5COAA 3ZV3A 1TXGA 1ODDA 4F6LA 4GWGA 4OO3A 5TGDA 3LT4A 3TZKA 1P44A 2EG9A 3DOJA 5JAZA 4MVJI 5D5XB 3HSEA 3WU1B 1P2FA 5LLQA 3GDFA 3EDMA 1TT7A 3F3SA 4GSKA 5CDSA 3HADA 2RQPA 5D8KB 3PHJA 3QWAA 4OIOF 5TJHA 1JWBB 3W8FA 5CDYA 1DDOA 3J80Z 4CM7A 3EETA 3GVAA 3PXXA 3I4PA 4L9VA 2Z33A 1PP8F 5DNAA 5I7FA 2X4GA 4ND4A 2Z99A 1LNQA 2NVUB 5K0ZA 4XGKA 3QPTA 3G0OA 5G0WA 4CJXA 4Y6PA 1BTOA 2QIOA 3HHHA 3KYBA 1CQIA 4CLXA 3P7MA 4CR8A 4DIBA 4UXNA 2BFMA 4G7OF 1VL6A 1VRWA 1T1SA 2CD9A 4D7AA 1D1TA 1HKSA 3K0LA 3E5MA 5K6AA 5L45A 2UUPA 3F8NA 4CQMD 2VZ9A 1VJTA 2GYYA 1K6IA 3E48A 4PRLA 4URFA 1S8NA 3SXPA 3DO5A 3Q6IA 3IS3A 2IYPA 2XAJA 3M1EA 2G9WA 5HLIA 3K1PA 3TZCA 4E5KA 3LVFO 4N7RA 2GWRA 4PG7A 1WW8A 4BNYA 4L18B 2WYUA 2ZYAA 4RGRA 3F8BA 4Z0PA 1GVJA 3O3KA 4NB5A 5HDNA 1QLHA 2GN8A 3TDKA 4QO7A 2AE1A 3NGXA 3RKUA 3DPTA 3ONFA 2IA2A 1P1IA 4L4SA 4YAJA 4A6EA 2FPIA 2ZK7A 1XGOA 3T4XA 4KIFA 3PHHA 1L1FA 1MD0A 4UVCA 1D8AA 2ZCVA 3LLSA 1FDVA 3AWDA 3KVOA 1SOVA 5I9LA 4FHTA 3IIEA 3L77A 3LT0A 2ESNA 4MIYA 1Y9EA 2FR8A 5JDIC 1ADCA 1I8TA 2JPBA 1NASA 2X5KO 4P4GA 3PLRA 3ZU4A 2D2IA 3ELKA 2PGDA 1P4XA 1UZNA 1LDMA 3K9QO 3MTJA 4PRKA 3VZRA 4TRNA 1JQBA 4KOAA 3U1DA 1JDJA 5DULA 5D6FA 4L0QA 3WGOA 1NBOA 1WP4A 1QV6A 4DNCA 4OAQA 2XV4S 1W73A 2ZQZA 2B69A 3JQ8A 4IJUA 3EZYA 4XWYA 3CZRA 2NQTA 2DQRA 4OOFA 5BSGA 4AJHA 3HN2A 2XIGA 5F21A 4J91A 4CQLA 3VH2A 1HEUA 1Q2XA 3QWBA 3Q0EA 3UCFA 4DTIA 4BKUA 4EI2A 2RBEA 3Q2KA 2VYND 2X8LA 3WOHA 1ZRDA 3NGLA 3JQGA 3VTFA 3V7RA 5DN9A 1YOVA 4RVFA 2O3RA 3ADOA 2DBQA 4XKJA 1BM9A 2R3SA 2X9NA 4GBJA 2C2YA 3AU9A 2HKOA 3DZGA 2HRBA 4BHBA 2ZCWA 1FF9A 1LB2A 4RB3C 1HDRA 1HLDA 4Y9DA 4M89A 1FOKA 3GVPA 2EJRA 2W57A 1EE2A 1E7QA 1ZSYA 4UEKA 2EJWA 5HVQC 1G0NA 1LDBA 1PJTA 2HMWA 2P4WA 4XQ9A 5A9SA 2VTEA 3WTSC 4BV9A 3ORFA 4J3FA 1ORRA 5FFFA 3H2ZA 2FMLA 1YJ8A 2PQ8A 3DMYA 1B9NA 4YR9A 2GZ2A 4PG8A 4BMSA 1I33A 5CYVA 4UVAA 4H15A 5T6BA 1UB9A 5TC4A 4D0RA 1HBXG 5JFRA 1UXKA 4NFHA 3Q9UA 5D5UB 4KFCA 1T1RA 2IVMA 4WASA 3TWOA 1T98A 4RGXA 2O03A 3DEUA 4ZRMA 3RUCA 4LG0B 3F21A 4A12A 3NT2A 3WICA 5G0TA 1AUPA 3WTUC 3PI7A 1Y8QA 4TV7A 5TJJA 4FS3A 4XYLA 4RVSA 4E3ZA 1NFQA 5JC8A 4INAA 1SMYF 1O0SA 4BIIA 2VN2A 1KEWA 3EMKA 4NI5A 3B1KA 2JL1A 4KTVE 3AAFA 4NU5A 1XB4A 1EUCA 2IT0A 4R5HA 4J9UE 3HOTA 5DYMA 2ZO4A 2FOIA 2XAAA 4BO3A 6LDHA 2R7DA 5BMZA 3JQ8B 3AUAA 1XR3A 2ISZA 1F12A 1I0ZA 3GFGA 4FC6A 3QVTA 3RKWA 2A61A 2EK5A 4ESBA 4AJ4A 2CDBA 2V6BA 4HQEA 3CTAA 3OJ0A 3FR8A 3S1LA 4L5JA 3WGGA 2BLLA 2GN4A 4CM4A 1BXGB 4I7HA 2CDAA 3SFZA 4DMMA 2VUUA 3QQPA 1YOVB 4WCGA 1ZARA 2JRTA 3U9GA 2NLOA 3GLXA 3O2PE 2NUAA 3AFNA 3GVIA 4IPAA 1EBFA 4JQCA 3PHIA 4DIOA 2VYVA 4E12A 5JCJD 2OZPA 4HFNA 3MOIA 2VE9A 1O95A 4FDAA 3AOEC 3VFZA 3ISPA 3NJ8A 1IN8A 2X9VA 1A04A 3PPIA 5FEUA 3TO6A 4BO1A 1GCUA 1P77A 1WZIA 3BXXA 2KJBA 1FBUA 1ZW1A 4CMGA 2XKOA 4L74A 1LSSA 4XQEA 2OAZA 4LD5A 3Q5FA 4HDVA 5TF4A 5FFZA 1NWCA 2NVWA 3I54A 2Y93A 3V8KA 1E7SA 3VKVA 3QVOA 5T57A 4YAKA 2WC2A 2IDZA 3WXBA 2JSCA 3W4IA 3ZV6A 2DFDA 3ZWMA 4DPLA 5BQFA 1R4NB 4FOOA 2PD6A 3N74A 4RAYA 1I10A 5EJ2A 2HLPA 4JK3A 4MJLA 4J1TA 5DUKA 2Z3YA 3D3EA 3H3UA 4H7PA 4J49A 3ICCA 2P9EA 5LGNA 2O0YA 3C7DB 5IT9K 3F4LA 4CL8A 1R5GA 4Z0TA 3RFVA 3BTOA 5L7YA 2COMA 3AM5A 4WWCA 4WJZA 5JY1A 2WJPA 2FBIA 3DBRA 3K8ZA 3GNSA 4TKMA 3F9IA 4HADA 4I9NA 1V3FA 5EEHA 2QVOA 1FY7A 2P5YA 5L7TA 3IUSA 4NK4A 4WOJA 3QVSA 2EP5A 1FWZA 2QRKA 3WE2A 3GHHA 4O59O 1MXHA 5A02A 1T0FA 3T4EA 4TZKA 1W0CA 1C1XB 4WLOA 3GOHA 3Q11A 5JFOA 2IRFG 3DV8A 5DV5A 2V65A 1QSGA 1LC3A 2WD7A 3Q2IA 3RJPA 5KVRA 3I23A 3W4JA 3WJAA 1O89A 4XBFA 3E9QA 3GFBA 5G4LA 3LQRA 1ZGAA 2UZKA 1EK5A 2O7QA 3RBVA 4RVUA 1SPXA 3ZZNA 4ZZLA 4F3YA 3I58A 4N54A 2VZ8A 2C59A 3WIDA 5KCZA 1UXGA 3HE3A 1KBZA 1X14A 4HNGA 1HDCA 1HWYA 4I9HA 5LHIA 1H2HA 4CLRA 5U1PA 1RM4A 3IWZA 2IZ0A 1T6SA 3HRUA 3IRQA 1YB1A 2C6YA 1MJBA 2VWGA 5CDTA 2ZKZA 4I5EA 4R1SA 5DCFA 2GN9A 1B26A 1YH3A 2HMUA 3E82A 4FC7A 3WB9A 2H6BA 1PGOA 1TT5A 1O7LA 2OP1A 4RVHA 3FNFA 4BMNA 3WQRA 1YS4A 1M66A 2YHUA 4PGHA 3R61A 3T0YA 1KC1A 2O3UA 3WGTA 1K6OA 3BMCA 1W7PD 1R36A 5JHUA 4D44A 5MGBA 4EGYA 4J4HA 4RPGA 2NAZA 3V1TC 4AVPA 2POQX 3H6KA 2VRCA 1LEAA 3MJSA 3W8EA 4RVGA 2X0RA 3KM0A 5ILVA 2DU8A 4HWKA 4EM0B 4MQVA 1QORA 4UAGA 4GGPA 2EIHA 1SAYA 3RI3A 1DBVO 1A4UA 5DP1A 2ESHA 1YE3A 3BPXA 1XLTA 2CUKA 4OOEA 1YW8A 2HU2A 1P3DA 1HL3A 4J7XA 3KE2A 4GGGA 1GL3A 2VWHA 5L7WA 2DVMA 2NSDA 1R16A 3ZMTA 2Z1NA 1DC4A 1NHGA 3FWEA 4U7WA 3TOBA 1VI2A 2ZB4A 5EERA 4HV6A 1YG2A 2QRLA 4ZJUA 2EKPA 1N9GB 4BMVA 1MG5A 1DIRA 2ZQYA 2P5VA 4K9DA 4TRMA 4E2ZA 1I3NA 3B6ZA 3LT2A 2PJPA 3Q1LA 4K6CA 4S3MA 1QZYA 2EFQA 2UV8A 4IRHA 1ZRFA 2PGLA 4IXTA 5FI3A 1YIOA 3I59A 3KZYA 1ZRCA 1ISGA 3FI9A 3RWBA 5IDWA 1IZ9A 2RHCA 3TZHA 2ZMEB 4FJ0A 2A07F 1S6LA 3D7LA 3JQAA 4IQ0A 4OIQF 4NMHA 1TEHA 4DPMA 4DMLA 4DLAA 4O6JA 1HRDA 3PJGA 2V6GA 3JQ9A 4X54A 1G1AA 1ON2A 3HHPA 1GZ3A 3ANLA 4JNKA 1P1JA 4MHGA 3QW2A 7ADHA 4OQYA 3DBHA 5KKAA 2J5QA 4U0VA 1SO8A 4YRDA 1XSDA 4CLRB 2C2XA 3IOYA 4ALKA 2VZ0A 3RUAA 2VONA 2CWEA 1YTYA 4MVJF 2FBHA 3MAJA 4HLXA 2VCYA 3NT4A 3JTHA 5H81A 5GMOA 3IDSA 4KWIA 4WLUA 3LFKA 2O50A 3OIDA 5CDUA 3EQLF 2V1DA 1KQ8A 1LDYA 2QYTA 4YQYA 1JHFA 3PDUA 3IWFA 2IA1A 3GC6A 1Y6JA 2HCTA 4YVFA 3RDIA 3EZLA 4BGUA 4PGGA 1GUYA 3IMFA 3BMCB 3PJEA 2EV6A 3P5SA 4RF5A 3REOA 2HEOA 1PZEA 4WNCA 3M6IA 5LEKA 3HOSA 1ZK3A 2J5RA 1Z6TA 3H9GA 4IZHA 4M1QA 4M8SA 1ENYA 2DQLA 1DO8A 1F17A 3BJOA 2B4QA 2DK8A 2G1UA 2ZATA 2P6TA 3UGKA 5ICMA 4QT0A 2E1NA 3ETDA 4AD9A 4CDGA 4Q3CA 4IRIA 3RBXA 3QV1A 4HXYA 2JFGA 1O57A 1NWHA 1LLDA 4KQWA 1KYWA 5FFXA 1NAIA 3LC1O 1UDAA 2B5VA 1U4SA 4YBZA 3MCZA 3RASA 3S2GA 5A1TA 4NJOA 3AY7A 1VL8A 3AY3A 5IAAA 2YPRA 1ULUA 2PLAA 1R0KA 3OQ1A 4Z9FA 3VODA 1PJ3A 4R54A 1DC3A 4BNTA 5DEQA 2OD5A 4A0ZA 2HK8A 4IIUA 1N8KA 3OJFA 3FNEA 4OGWA 1EE9A 3AFMA 1NQ5A 2Q1UA 3T7EA 2CNBA 4DREA 1CWUA 3BHJA 5HBRA 1A71A 3G3ZA 4CL3A 1H6AA 3AU8A 2OGUA 4XEHA 2GQQA 3CUQC 3GFLA 1LLQA 4G81A 4Z3DA 3NKLA 4CMEA 5AXBA 4PLHA 1WDLA 3FXUA 2WWYA 2ZYDA 3VTZA 3OBBA 3V1YA 1HSZA 3HJAA 4PG4A 1YKFA 5HS4A 5IJZA 5IZCA 1YXMA 5KVVA 1LQ1A 5JPIA 5I9MA 2VOOA 1HKUA 1X13A 2Y1OA 1WWKA 3L0DA 5DDIP 4MKXA 4OH1A 3U9LA 3C7CB 2OO5A 3UCEA 5B4TA 1QBJA 4E2WA 3DXJF 2NS0A 3GEMA 1BDBA 5L3BA 1QRRA 4E70A 1LDDA 3FMQA 3RPQA 4ENMA 1M76A 1PWXA 1ZJYA 4D3SA 1GCOA 4FJ1A 2A9FA 5C7LO 1GQQA 1HF3A 4UEJA 2KRFA 4LCJA 4YAIA 1HYEA 1SD4A 1E5QA 2XAGA 4GMFA 4IJWA 1PDNC 4J1SA 5BSHA 3MZ0A 1W7PB 4Q4ZF 1PL7A 1QP8A 3D3WA 4WCFA 3GVHA 4XGIA 3AW9A 4HV5A 4ZYGA 2CVOA 1UZLA 1QYVA 5F3RA 1AOYA 1ZJZA 2A68F 3D64A 4NG5A 3Q9VA 5D5WB 1KS9A 1PS0A 1WI9A 4NBTA 2CMDA 5A05A 4EZBA 1EUZA 2NNNA 1VC2A 4R8HA 2X0NA 1AGNA 4TROA 5G0VA 4CUKA 5TT0A 3WGIA 3ZP5A 3RIHA 2D1YA 2WE7A 2VOJA 3QP5A 4KA4A 1M2WA 1A9YA 1U5TC 1XYGA 4IY1A 5TRTA 4DA9A 2BGCA 1KA8A 4XLNF 1NHAA 5AIPA 5B12A 3AOGA 2AEFA 4JJIA 2RDPA 5C3MA 4FFRA 4NU6A 4RO0A 3W1VA 1YBVA 3BA1A 2PH3A 3PQJA 1Y1PA 2VC0A 1ZVMA 2GN6A 2EGHA 4FFMA 3ZMZA 2ZIZA 3FXQA 2DBRA 4FQ8A 5J6XA 3RC1A 4AJ1A 2RKHA 4WLNA 2R00A 3KEQA 4LLNA 4LCEA 4M87A 4IIVA 2O2YA 4G5HA 1PEDA 2BI7A 4LSWA 3DFGA 2H9IA 4NPCA 2W2KB 1SD6A 2HJSA 3JQBC 4ENJA 3MFKA 2D59A 2HSDA 2P5LC 1HZZA 1ZKMA 3CUKA 2WEKA 5E20A 4JXKA 2OMEA 1XSXA 4IUYA 3V2GA 3WSWA 4EJUA 3WGYA 3NV9A 2A4KA 2O3TA 5IZ4A 1A7AA 4P55A 1FSEA 4UNOA 5BNFA 4M6XA 5DOZA 3GN1A 3FBTA 4RQTA 1S29A 1ZXLA 1BG6A 2DT5A 3PHLA 4CYDA 4EW6A 2YU3A 1HSOA 2K7LA 1NVMB 3E8XA 1UFMA 2LF8A 1LDEA 2AQKA 2B4TO 2FPGA 3K5PA 3GF4A 3BHIA 4DLLA 3HUGA 4F7ZA 2J8ZA 1P33A 3HFGA 4PLVA 1OOEA 2YV3A 2RH8A 4DL9A 4G94A 4R51A 1GD1O 2G17A 4NQWA 1PJLA 1NR7A 3I5MA 2YFHA 4LMRA 1YO6A 4KNYA 2MD5A 2ZTVA 3FZVA 1C0IA 1TNTA 1HYHA 1IPEA 5DOVA 1I2BA 1E3SA 4N5LA 1MGOA 2GA1A 2BFPA 3BIOA 3ITKA 5LDGA 1MDMB 2NU7A 1OPCA 1H94A 5DZSA 2ILTA 4IDFA 2B5WA 2LKPA 4EGZA 2DPGA 2IZ1A 2FU4A 2K86A 2EERA 2E82A 4HFMA 5J8FA 4BNIA 1T2KA 3O38A 1SMTA 1XELA 1KC3A 3O8QB 1Q7BA 5HS8A 2JFHA 3JD0A 4II3A 3TDUC 2D5AA 3DXFA 2F5CA 4IDCA 3VVCA 1BI1A 5GZ3A 3KB6A 4Q3BA 1EH7A 4I01A 1BXZA 1V8BA 1Y8RA 5HDKA 2EW2A 3DAPA 5LEJA 1D4FA 2H94A 4EEXA 5IDQA 1H6BA 2YSRA 1Q1NA 3KHUA 1LSOA 3H7AA 4BS9A 4WEQA 2PK3A 2C5EA 4BO8A 5JYEA 4HY3A 1PS8A 3GX4X 2KKOA 4N18A 4XD2A 2DAOA 3ZWXA 2UXNA 4U6SA 2D1VA 1IN7A 1E2XA 1YO5C 1WVGA 2AXQA 2QYSA 1EFLA 2WTBA 3OMLA 4MPDA 4CLOB 1A5ZA 1TQMA 4AICA 1P0FA 3NEUA 4IM7A 3ZHYA 4RQUA 4CLEA 1KU2A 3HYIA 3ZQ7A 4A6DA 3FHZA 1C1DB 1ZBQA 4PG6A 1IW7F 1L7DA 5E8IA 1CQJA 9LDTA 2OZUA 4G9YA 3NEPX 1DRWA 4BNXA 5L4NA 1GEEA 1I1GA 1S7CA 3RTRA 2HKIA 1R23A 3AK4A 4TKLA 4WGGA 4WCDA 5T64A 3UH1A 2EF1A 3RVDA 1YDWA 3MZHA 2ZB7A 3HRTA 1IN5A 1N1EA 2E6UX 3ZWWA 2VBXA 3LLVA 5AXDA 3TO9A 5CHEA 3GEGA 3QY9A 5KOIA 2HRZA 5DCUA 5FLXZ 3T1BA 1QXSA 3QP6A 3HQ4O 3HIFA 4UUOA 3I9OA 1PR3A 4PIVA 4Q5SF 4UUNA 4YYZA 2NYXA 3F46A 2F5EA 3MJVA 4K2EA 2DBZA 3NTQA 1OC4A 1TB4A 2H09A 1LDKB 4HX5A 4BGIA 1W8DA 2HQRA 2C82A 4QWQA 5BPDA 4FR5A 4ND1A 1WLYA 4EBFA 4ZICA 4RGUA 3FR7A 4EJMA 5BOXA 3QU6A 1DIGA 2PWZA 3GG9A 3F6YA 3JSAA 4KMSA 1X0XA 3M2TA 4LN1A 2VTDA 5AYVA 1K6XA 3I0TA 3ZU3A 3PIIA 1OYYA 2X23A 4L0ZB 3JAMK 5FI5A 1ONNA 2VOEA 1R00A 5JNLA 1J5PA 4GMGA 4PFJA 1RI7A 4AG3A 1B59A 2F00A 4LK0F 2A3SA 3E6BA 2NVUA 1DC5A 3D0OA 2P91A 4R68A 1P4WA 1Y5RA 3AI1A 4UV9A 4PLYA 4KMUX 2Q50A 2D8AA 3K1MA 3MJTA 3OQBA 3H9JA 3VDQA 3TO7A 1NR1A 1GFSA 2ZB8A 5AOVA 1CEQA 1YQAA 1P74A 1KQ9A 4S04A 2A92A 2JCXA 3FTPA 3HDHA 3RKYA 1U3VA 4M9ZA 2Y0MA 2HK7A 1IXCA 4EM1A 1RYEA 2YJZA 5COBA 3V5NA 3VAZA 4OU0A 5BNIA 2AG5A 5KKCA 3S55A 2CY0A 2STWA 4EJOA 3KLMX 4E5MA 5L4SA 1FSHA 4NBVA 2TMDA 5IDXA 3ZN0A 1OBFO 3H3ZA 1E3IA 4D42A 4XCVA 1GQYA 1REPC 1SCUA 3K96A 4XZ3A 1HE3A 3L4SO 4FFOA 1Z7EA 3QRFF 2XASA 4CZZA 3JQEA 5H83A 1L0OC 4UREA 5JAIA 4N9HA 1BW9B 1G3WA 1U5CA 2CDCA 1KVTA 1VKNA 4YFNF 3HHGA 4L9JA 4LMPA 2OA4A 3RFXA 4M74A 2EWMA 4TQGA 1R1TA 1U2WA 1ISJA 2GRAA 3ZMDA 4B79A 5KJFA 1T25A 4RDHA 2L54A 5KJCA 2KIMA 3M2PA 1Q0HA 2FF4A 3WTWC 1ZLKA 3GFMA 1ENOA 4RB1A 2W84A 2OBNA 2XAQA 4FPXA 3AJRA 2CW0F 4MVJG 4BQPA 3HB5X 3FNHA 4G7HF 1NYTA 4O1MA 3EAGA 1O7FA 2GNAA 2WV0A 1YL7A 3M8EA 3E3VA 5EESA 3HFSA 2X0LA 2WWRA 4WXDA 1LC0A 3H2SA 1ZAOA 3ZI0A 5KWEA 3E97A 2VWQA 3RPUA 1ZN2A 3FWNA 4YJGB 3DZFA 3ZNOA 2QENA 4L9RA 2DI3A 1H9TA 1KEUA 2CZCA 3G49A 4KZPA 3TN7A 4D0PA 4Y13A 2FNPA 4RS8A 1WSUA 4Z3KA 1EK6A 3ZNQA 1R1UA 4P8RA 4PZJA 3CEAA 1X7GA 1KU7A 4CPDA 4C7JA 3RROA 2Y48A 4QLCU 3BTVA 3ZWVA 1NP3A 4DQ2A 3N7UA 1ZMOA 1V0JA 3K69A 4L0YB 1O9BA 1FMCA 4P96A 3T8RA 4AIKA 3JYNA 3ONEA 2O3JA 1CJCA 4HUJA 1BN5A 1LX6A 3OV8A 2JT1A 1KVSA 3WTCA 4ZQBA 2BF7A 2HMVA 3TZ6A 4HF0A 5JDIA 1YB5A 4Q9NA 2RH4A 4XYBA 3AUUA 1UH5A 3QRWA 1G0OA 4LSMA 2EWNA 1IHYA 5A2QK 2W8ZA 4R4JA 5EMHA 1YW7A 4MIOA 3J81K 1EQUA 1Y9AA 2FEZA 1PWZA 2X22A 2C0CA 2X58A 2Z95A 2YHIB 4YAEA 4DIFA 5F1RA 1HDGO 2M45A 2VN8A 4LG0A 1WPQA 4M55A 4NNJA 3UKOA 3C1DA 2AS5F 3N58A 4KMFA 1LU9A 5KIAA 1F4KA 2GR9A 3KLPX 3VH3A 4BQAA 1E7WA 5I7EA 3ANMA 4O63O 2C5AA 3U4IA 1LBEA 1R5HA 5I8ZA 3IUPA 4RZIA 2PN6A 4U0WA 1JKJA 1GYQA 5B4VA 4RF2A 2C7VA 4YA6A 1J4AA 3I6IA 3WTTC 1VE9A 2IPQX 2B36A 2IODA 3EDPA 5I9NA 2LF7A 3ZPLA 2TDXA 1YRLA 1RYDA 1LRJA 1IY8A 4LJZF 5H6QA 2O4CA 2GZWA 1IHXA 3CKYA 4MDHA 4Y6SA 4R41A 5FO5A 3EYIA 4N9IA 1YQGA 2BRUA 1VM6A 3RJ5A 3G73A 3DBLB 1MA0A 4JBIA 4FB5A 2OL4A 3ZV5A 3CSDA 4FGWA 3ZDFA 1BXGA 2ZJ1A 3HN7A 2ISYA 3LA2A 4LB5A 1D7OA 2ZBKA 1EDZA 1OZAA 4GX2A 5IXSA 3IP1A 1VKOA 2F1KA 2H5LA 4YQZA 4QUKA 3V2UA 4PCVA 4M9XA 2VHZA 3A06A 3L2CA 4J4BA 4LLGF 1TNSA 5A06A 3OEYA 1C0KA 1I2CA 4YT4A 3M1AA 1PJ4A 1VLLA 1N2SA 1W4MA 3GZ5A 4JN6B 1ONOA 1OMIA 4M73A 1ADFA 2UXXA 5ADHA 1ZK2A 3LC2O 4G65A 3S2FA 2X4HA 4BL5A 4CMIB 1N7GA 3SHFA 3PLNA 5ILUA 4XJTA 3DZHA 1JU9A 3E5UA 4MQ9F 1OR7A 1IULA 4B8XA 3KLOA 1TBXA 1LDNA 1QYWA 2C29D 4HV4A 1U8FO 4AFNA 1ZG3A 1R4NA 1U9JA 3EYYA 4OXNA 2DBVO 1E17A 2VYVD 4IS3A 3W8DA 2AXLA 4LK3A 2OQRA 1I5ZA 1Z6RA 1I30A 2DKNA 2Y1EA 3L07A 4G8XA 3QJ5A 4RPKA 4KDFA 1DFIA 1OFGA 3WNVA 3PRJA 1IOLA 1ONVA 2VXZA 2GGSA 9LDBA 1XGMA 3ZNNA 1E3LA 2P68A 2FMUA 2I9PA 3LK7A 4NH4A 1Z9CA 4BGVA 4OIMA 4JJFA 3P9KA 1JW9B 3CMCO 4CUJA 4UEOA 2PTGA 3D4PA 3WYEA 4BO4A 4W7IA 3LZ6A 1MG0A 1CIVA 3JD3A 3ZWPA 1JAXA 4ZHSA 3L6DA 2BFOA 4BOYA 5ITWA 1J2XA 3F47A 1MKMA 1ENZA 1XU9A 3ENKA 1UP7A 4KP7A 4R1HA 1C1XA 1IAWA 1EEHA 2JAHA 2Y68A 5TSDA 3NUGA 4B7CA 3VPGA 4OMYA 4KN7X 5BSEA 2VYNA 3AOEA 3C85A 2D1HA 4OSPA 1PTJA 2ZNZA 3O4RA 4IMPA 2IYOA 3PFFA 3UW3A 5F5LA 3TOZA 1VL0A 4PN3A 4FX0A 4DC0A 3VPXA 4IRGA 3C18A 2A35A 2PBIA 2EFNA 3MQ0A 4P9FA 4HFJA 4J6FA 3JQ7B 1E7MA 2OHXA 4IJKA 5IDYA 4CQMB 1PJQA 3B70A 2XKPA 2W90A 4ROSA 3U4HA 5I7SA 2BI8A 1B9MA 1B3BA 3V2HA 5FWNA 4Y67A 3COSA 2FXAA 4MGRA 4GH5A 1IZ1A 1HE5A 3KYCB 4ND2A 4A26A 1KY4A 5A4DA 4RB0A 4CICA 4LLLA 1UHWA 2FSVA 5TJ9A 4PVDA 2FP4A 3DR3A 3TL2A 1ZMTA 2MA3A 3FTNA 1ON1A 1DC6A 1MFPA 1WNTA 1Z7BA 2HJRA 3GUYA 3WBFA 3WMWA 4WF2A 4BO7A 1PZGA 3D0SA 3SX2A 3H9UA 5ED4A 1PL8A 1GV0A 2JD1A 4KUMA 2P4HX 1BI3A 2G82A 3EVNA 3UHAA 4DBZA 1N7HA 3D4OA 1T4BA 3WDSA 4B8WA 1I1SA 3ULKA 4PLWA 2H1SA 1HT0A 3KTDA 1GPJA 4GXOA 5JXWA 2DPDA 1KIFA 3WGHA 1UP4A 1ZHFA 4ESFA 1UZMA 3HB4X 3OA0A 5JAMA 1ZXBA 5CLSA 3FBGA 4MIEA 4EITA 1E7YA 1HDYA 4K6FA 1USTA 3SLGA 3ZWNA 1G3SA 2VC1A 3K31A 3RI4A 1ZH5A 1DB3A 2HUNA 3CLOA 4M9SA 4I8XA 4MEYF 4L4XA 4EGFA 3W6UA 4KYWA 1N9GA 3MJEA 4NQZA 3ZHXA 1PX0A 2PG4A 1R37A 3ROMA 3I5UA 2P6SA 2W2LA 4UVGA 3VOEA 3C7AA 2YY7A 3M9AA 3AM4A 3OJOA 2BHLA 5BNTA 4BAYA 4GO1A 3PGJA 2PLYA 2ZMEA 1U4OA 3L09A 2YV2A 2V9VA 2JZYA 3DP7A 2Z1MA 3ETGA 3BJAA 4EJTA 4XSZF 3OP4A 1MJ9A 1U1IA 1ZEMA 1L3LA 2X5JO 4RLHA 1NNUA 2V1UA 1D8JA 2VUSA 2PFGA 2R6JA 3WX0A 1AE1A 3FF5A 3ZWOA 2OUIA 2BFAA 4P9UA 2C54A 1I3KA 3X2EA 3VPHA 1WWXA 1J0RA 5A5EA 4L76A 3ABTA 1BIAA 2IXAA 3C24A 3HG7A 2HO5A 4J1NA 3TQHA 4PDKA 1K78B 3T8TA 1P1HA 1XA0A 2GD1O 4FN4A 4MP3A 3ICPA 3GF2A 4CMHA 1SFXA 2SCUA 1QV7A 4EYEA 3H92A 1U3WA 4XYMA 3KYDB 1T4DA 4RV9A 1QZZA 4PGFA 1Z45A 4XIJA 2HYGD 3UN1A 4YT5A 3F1LA 2JFFA 5DBFA 3GO5A 4YDRA 2L3DA 4OIRF 2C07A 4PZDA 2QYOA 2P9CA 3L4BC 4IDEA 3DQVC 4YJFB 1FC3A 3KBOA 3MWMA 2VBWA 4TMFA 4Y15A 1IRGA 5ICCA 4JGBA 2FSWA 5JE8A 1HXHA 2DK5A 1GQ2A 3JD4A 1JVSA 5DD4A 3SZTA 5HLHA 3QA9A 3ZNPA 2GXBA 4BVAA 5BS6A 4RGSA 5T5QA 1HKQA 5GZ1A 2J3IA 3FX3A 3G17A 4WXCA 1T38A 1W6UA 3D1LA 3MTGA 4ID9A 4YJDA 3DOCA 3RQSA 4HF2A 1UAYA 2L4AA 1UXHA 2H63A 1EDOA 2CFCA 1LSUA 3QHAA 3DQPA 5L95A 4I98B 5JVTA 3LSTA 1ZGJA 4KT5C 1YS6A 1CDOA 2IZZA 2Y05A 3ZN2A 4DUPA 4A27A 4FCCA 2DU9A 3ERED 2FOKA 1WDMA 3R0IA 1YFHA 1DDNA 3IQDB 4O3MA 1BSVA 1TW3A 1AXGA 5F1PA 3PP8A 3N4MA 1E3WB 4KQXA 3BP8A 4EV0A 1P31A 4XA8A 1LLCA 4YRBA 1J7KA 2QG4A 3FM3A 3K92A 3JW4A 4RPLA 4L5IA 5JR3A 1H5QA 1SB9A 4KUHA 2E4AA 1DP7P 3V1UA 1IYZA 1R4MB 3W6ZA 2EV9A 2X0IA 5CP8A 3I6QA 4NBWA 3WMXA 3J80K 3LQFA 2EJVA 5AQ1A 1P6RA 1I27A 4EJ0A 6PAXA 4BYYA 2X7HA 4AJIA 4TZTA 5F1KA 2Z5LA 2EV0A 2FNAA 1N1GA 4HFRA 3CTMA 3PEFA 3DTTA 4IZIA 1B8VA 1F8GA 1K89A 3PQDA 4TVOA 4ZRNA 1JHHA 2HYFA 4WLEA 2ZXJA 4LW8A 1DFHA 4GVLA 1H9AA 4OYRA 2O23A 4GI2A 4ZGWA 5CFZA 2Q46A 4AVYA 1NM5A 1E1NA 1RZ4A 1U3TA 5LDHA 1UDBA 1DIAA 3E5XA 1W7PA 1HE2A 3JQFA 3KV3O 5GY7A 3MJ4A 3IC7A 5JO0A 1TI7A 2D4AA 3E6AA 3LF1A 3LU1A 3C1TA 3KZVA 1LUAA 1PS9A 4WLFA 4MVJD 3TFQA 3WIEA 1DXYA 1H9GA 1K0UA 4O0LA 4IGFA 2JHFA 4XDZA 3E5RA 4JCOA 2G7UA 1H93A 3I52A 3I9JA 1CF7B 4PG5A 4YCAA 2YQ4A 5C7OO 1KU9A 1GV1A 3ADPA 1ZSNA 2PMUA 2O2SA 3WWYA 4DBVO 3A9WA 4MKZA 1P1KA 2Q99A 2QW8A 2BV6A 3JQ9C 2DTDA 1UXJA 4A7PA 1F8FA 1NQAO 4EQQA 4NHJA 1Z91A 5EINA 2Y1CA 1QQIA 3F3XA 3T5XA 1SOWA 1Y7TA 1V3TA 2XXJA 3H65A 3WS7A 4DRYA 4EDFA 3HDJA 2HTSA 4CM5A 4DC1A 2QRJA 4CM9D 4LMYA 4E5PA 1JKIA 1R12A 3B20A 3DOOA 3ON5A 3QWFA 4D41A 3BY6A 4L4RA 1LQUA 4ND3A 2GXGA 2NQ8A 2GUGA 3MWEB 3UOGA 3EYWA 3GUDA 2Z9OA 1Y5MA 1B8PA 2W2KA 3QLJA 2P5UA 1IB6A 5L4LA 4GCVA 3P19A 5COQA 3E9MA 3FPLA 4II2A 2CF5A 4MINA 5DCMB 1G6NA 3RU7A 2GO1A 1E6EA 1NFFA 3PK0A 5G0UA 4E33A 1LEBA 1KVRA 3GDOA 1GAEO 3IKTA 3H5AA 2Q2VA 3GNQA 3VOSA 1SBYA 3R0JA 1FPQA 4I09A 2M87A 4M6YA 5ER9A 4IXWA 4W9NC 1ARZA 3GFIA 4TVBA 1Q0QA 4ZQFA 4O5VA 4QSMA 1DRVA 3H5RA 1D3YA 2B0JA 2Y1DA 3BPVA 1DEHA 4KN4X 2EKLA 4JIGA 1NQOA 4ZYDA 2NTNA 4CM1A 2V79A 4E6PA 1FX7A 4E0BA 4CMCA 2XPCA 4ENNA 3ZWBA 5ITVA 1PGQA 2KIUA 2PZJA 1X7HA 2D3TA 5ICGA 3GK3A 1JN0A 1BJAA 2DFIA 1IF1A 1ADGA 2W98A 3K30A 3BMOB 4HDUA 1WAMA 4A2CA 4XRGA 3BOQA 1Z1DA 2H6EA 1E3JA 1MDMA 3R3JA 1IUYA 3PZRA 4CMEC 5TX7A 4BO5A 4D79A 4UUPA 4BNVA 3E1KA 3MWDB 4HYEA 2F5DA 1DUXC 2E37A 3A4VA 5IG2A 2IW5A 2HDHA 5IZCC 2VHWA 3O26A 1SZJG 4C4OA 2EA2A 3O8QA 2BELA 3DTYA 3NRVA 2Q4BA 2EHDA 3MEXA 2E49A 3CUQB 1R22A 2I76A 1EVYA 2PZKA 2O3QA 4KIGA 4R3NA 4E4YA 1ISFA 5ENDA 1FBSA 3GEDA 2RAFA 3ASUA 3BYZA 2G0TA 3DL2A 1YLFA 1J0XO 1B14A 1XGKA 2PD3A 2Q49A 5KTKA 5L3CA 3ZU5A 1GYPA 3H3JA 3CIFA 5JCXA 4U0YA 1GZ6A 1E92A 4YRAA 4AJOA 2ZTMA 1SNYA 3VZSA 2K02A 4BNZA 1B16A 1JKFA 1DJNA 1T2FA 1ZG5A 1PJCA 4CM8B 3INTA 1P9LA 1YWGO 4UVHA 4CLOA 1XMKA 1G3TA 1W5TA 1LRLA 2FWMX 2Q2QA 2Y99A 3O03A 4FFLA 4OXYA 2IEDA 3HNPA 3AI2A 3EHEA 3BMNB 3G1TA 1NHWA 3OQ6A 1C1DA 3QE3A 4OJNA 4QFDA 3UAGA 2PZMA 1WQ2A 1G4DA 5IXYA 4F46A 4BO2A 2DAPA 1JTVA 5DD8A 1GXPA 3SC6A 4YEDA 3P9CA 2VOPA 1ULSA 2K4BA 4U6QA 3EGOA 3RC9A 2XHKA 3CJNA 4HOBA 1GXQA 1GYRA 1WZEA 3ST7A 2VUTA 4B7XA 4BNLA 1QNTA 4OMUA 1K2WA 2WSBA 1R7JA 3KP6A 3BTUA 3QU3A 3DMTA 4NZ9A 4IPTA 4B7UA 4LGWA 2VWPA 4W7HA 1I01A 1X0VA 1ZNQO 4HLYA 3HDYA 3DFZA 4QXMA 4YACA 1CRWG 2E48A 1U5TB 4IHSA 3H4VA 3AM3A 3Q9SA 4NDNE 2BEOA 1PL6A 2DUUA 2QQBA 1Y81A 2PNFA 1H6DA 4Y98A 4JP2A 3MEQA 3WNQA 3PTZA 4ESOA 4O6VA 1R0SA 2PH5A 2Y0EA 5L3ZA 3GR6A 2Y0CA 2A94A 3CMMA 4RJTA 3F6OA 2Q45A 5JC1A 3B1FA 3HTUA 1BI2A 2PKRA 5ICEA 1F1ZA 3L9FA 4ALIA 5E18F 2H27A 4P4NA 3HZZA 3WLFA 2UWMA 1XIVA 3P7NA 1I2ZA 1D5VA 1PR9A 4D46A 3FM5A 3SJ7A 2H6CA 1U8XX 3ZMSA 4MVJH 5JY6A 3CINA 4LVUA 1XCVA 1OYWA 4YTEA 1FYKA 1UAGA 3GRKA 4P38A 4CLHA 5EEGA 3C1OA 3CDHA 5AIQA 3CXRA 3GN2A 4RPJA 4CV3A 3KP4A 3RYRA 2ZCUA 4HX4A 2AEMA 1QYCA 5A3VA 2X9GA 3E6DA 4PZEA 4AL4A 1WDKA 4KDEA 5KJEA 4YIIA 1DRUA 2HK9A 2Y0DA 3TGNA 3SEFA 1YJQA 3CO6C 3LYLA 4GVXA 1F06A 3F8CA 3IAHA 1SEVA 1A72A 3SQNA 3ROKA 3KFWX 3QVXA 4CMKA 3TPCA 3F4BA 4AJ2A 2AQ8A 2Q1TA 2EGGA 1YW9A 4L9TA 3TF5A 2VHYA 1AXEA 5C5IA 4IVNA 1H6CA 4Q3NA 2VT2A 3GPDG 4ZQHA 5KK1A 3GZNB 1JE8A 4ALJA 4BKOA 1BIBA 1BW9A 3LAJA 1KERA 5JDCA 1B2LA 1XQ6A 4BKRA 1BWSA 4NIMA 1O6ZA 1I3MA 3IP3A 2AQHA 4XSXF 1B0AA 2MH2A 3WG9A 1LI4A 2AG8A 1KYQA 4MO2A 1O3TA 1XDUA 1DLIA 1B15A 2B83A 5JSFA 1J75A 2ZJ0A 1IN4A 1XKQA 5EPOA 5JO9A 4BKQA 2CVQA 1HW2A 1Z75A 2W4QA 5CEJA 5K9ZA 1YVEI 2ZKLA 3R1IA 4AJNA 2DFVA 3DC2A 3K2BA 2QQ9A 2MH9A 1U2DA 1U2GA 5ILSA 4L73A 4GAEA 1GY8A 1OC2A 1BOAA 3HUDA 3R60A 5FGMA 2ELHA 3LF2A 2DPUA 5IT9Z 4IDBA 3U2RA 3GWZA 4FIZA 4H16A 5U9CA 3KLNA 1PQPA 3IKVA 1YBMA 2CSOA 3FCOA 3ECHA 3RFTA 2VNSA 4JQFA 1DPGA 3FWZA 3H9EO 2PD4A 3DEYX 4YJGA 5LCXA 1YYVA 2A6HF 5CVIA 4FFPA 2FZEA 3Q9NA 1ZG1A 3DBVO 3GHYA 4OHUA 1X1EA 3KETA 1B3RA 4E5YA 3PZBA 2V6MA 2RHRA 2GSDA 3LA3A 3NAQA 1ZH8A 2FQ3A 2PEXA 2J5KA 3GG2A 3WE3A 1BMDA 1ZCJA 2RGVA 2NNLD 4R1NA 1CYDA 1U28A 1D3AA 2J6IA 1WRJA 2XAFA 2GASA 4M54A 1D1SA 2QBYB 4ZU3A 2V6FA 3ETEA 3WTVC 3X2FA 3TJRA 1E6UA 1MFZA 1C0PA 3PYLA 1C0WA 3EC7A 4JK1X 2UYYA 4U7BA 1KGSA 1ISMA 1I32A 1QYDA 2B4RO 1C3VA 2HTJA 3ML6A 1RWBA 2W24A 2ZB3A 3DZKA 4BV8A 4XGNA 2NRAC 3ULQB 3RUFA 2BBYA 1GTMA 4E5NA 1QPMA 2XUBA 1R58A 2C20A 4BNNA 4D3DA 3INRA 3TL3A 1YS7A 4Y6RA 4EEZA 2JJYA 2Y1GA 2YR2A 2GZ3A 1KQ0A 1FYMA 5F6FA 1HE4A 5DCWA 2ZTLA 4KWHA 4BNCA 5CAEA 1B6AA 5D5VB 3LWFA 1YGYA 2YHIA 3P2YA 1PJBA 3PGXA 4GKBA 4I5DA 4XQGA 3UICA 4OIPF 5A04A 1BHSA 4R1UA 3R6SA 1EFKA 1OMOA 2HGCA 1I5RA 1T2EA 2GPTA 5GZ6A 4QEDA 5CG2A 4XB1A 1S7OA 4CV2A 4IDAA 3ASVA 4MP8A 1EBUA 4ZZDA 3GLQA 1CGPA 3I3OA 3IJPA 5A03A 3ROUA 2CSUA 3V7CA 4C7KA 2FMYA 3ROQA 3ZU2A 1R15A 1TLTA 2HZTA 1OKRA 2E7WA 3HWRA 3U4CA 3F72A 2XXBA 4YT2A 1O3QA 2VODA 1SFEA 2D2WA 1FNNA 1MX3A 5TIIA 4AJKA 2STTA 3GQVA 2X6TA 4GX0A 3L00A 5DT9A 3GVCA 2P2SA 3E5QA 4IF4A 1BGVA 2YFQA 4FFNA 2FE3A 4OM8A 4Q39A 4Z0HO 4B4WA 4CV0A 1KYZA 2XOXA 1XN7A 4XQCA 5L3GA 4ZYEA 1DLJA 4Y8VA 4CV1A 3H5NA 2B35A 4XIYA 2XVCA 1PIWA 2Q0OA 1XDSA 1QYXA 3DBLA 2EV5A 2FN7A 3AI3A 3RSHA 3RAJA 4ALMA 2EFOA 5MDHA 1Q7GA 4WX9A 1RJWA 2CF6A 2FHSA 5ICFA 1NVGA 1O3SA 1PP7U 5ICSA 1GUFA 4XR4A 4CR7A 1MZBA 1QO0D 1SD7A 1NXQA 3KRTA 2LDUA 1JVBA 1KY5A 4TWRA 5JYDA 3WTZA 4J4TA 3GT0A 3L9WA 3I9KA 4S1VA 1F0YA 4N5MA 3WYBA 1IRFA 5CVRA 2Q2WA 5KNLA 5L3DA 4AWXB 4KUGA 4P22A 3ABIA 1O94A 3C3WA 3NQOA 1BDMA 1BRMA 3DWFA 3INGA 3WTXC 4NFSA 4ILKA 4YAGA 2WYWA 2O3FA 1BBYA 4IXAA 3ZMUA 4ASNA 5LBQA 3R6DA 4LFUA 3DHEA 5EL0A 3DPLC 1NPTO 1M67A 1XG5A 5JAQA 4OXKA 3L6OO 5DUIA 1FT9A 1RNLA 4AJEA 2QHXA 4CMIA 3JYQA 3OHSX 3DZBA 3T7CA 4Q3DA 3KSZO 1DIBA 4RAZA 1N5DA 4IMRA 2YDYA 4HBGA 1NPYA 1U3UA 1O8CA 1RM0A 1XDWA 1HSTA 2W25A 1Q0LA 3COAC 1YBAA 4JBHA 2P7CB 4ON0A 3RIRA 1ZO8A 2VRBA 1SD5A 2PV7A 5G4KA 5U4QA 3GW2A 4YFXF 1ZUD1 2LDBA 4M49A 1P1FA 4JX8A 5THQA 4A5OA 1DFGA 4XJSA 1Z05A 2WMDA 3DZJA 3NRCA 2FRHA 2VQ3A 2ETHA 2QZZA 2YV1A 2Q3EA 3NDIA 5JMPA 1HLPA 3K2EA 1TA4A 2IP2A 2DO7A 3W6JB 3NJ4A 3JSOA 5F1OA 5TRDA 1EH6A 3GXOA 3WSVA 1U7HA 4Z2YA 3OFSA 5K6AC 2FSSA 2DUWA 4CGZA 5CPBA 3P9IA 4A0YA 3IRRA 1M6WA 1O5IA 3I9MA 5BT9A 5DP2A 4YIFA 3EW7A 4HZFA 4F6CA 1ISIA 5LRSA 4YJHB 2RN7A 4PLTA 4WXHA 1V3VA 5I7VA 3RUHA 4PVCA 5LRRA 4AJPA 3U62A 2DLLA 2HAEA 3GFJA 3ZCXA 1VTNC 4Y17A 3GNTA 2P5KA 2P7VB 3C3XA 3BJ6A 3KCCA 5JBIA 2HQNA 5FYDA 2LSOA 3LQQA 4YB8A 3RKRA 1OAAA 1KU3A 1CF2O 3TDZC 1T26A 3ENNA 5L51A 3TRIA 1ZLJA 3KSUA 1AN9A 2ACJA 3OIGA 3RKXA 4QX6A 4EUFA 5D6EA 5HLGA 4W6ZA 8LDHA 5HS9A 1GHCA 3JQ7A 2TMGA 4NJMA 4CQMA 2OU2A 3ABUA 4BHPA 4ZD6A 4KTTE 4FX4A 2VT3A 2CYYA 1HXDA 1XCBA 2QWWA 1SFUA 1XHLA 2UVDA 1OI7A 3GMSA 4E21A 3BHMA 3E18A 3KYCA 3IJRA 4MVJE 4UVIA 1JA9A 2RCYA 5E1ZB 4R01A 2RNJA 1K5HA 2X0JA 4R3WA 2XROA 5IT3A 2W85A 2VHVA 3GZ6A 3I71A 4WEOA 2Y1FA 4MP6A 1KEPA 3FPCA 4G6DA 5JLAA 1EMDA 5IFLA 5K5OA 3PVZA 3E9NA 4XLPF 3U5TA 2JD2A 4ETSA 5BPIA 2AMFA 1LDJA 3FMSA 3OECA 4W99A 1E1LA 1T24A 1VPDA 1ZK1A 1LRKA 1VSVA 1WXDA 3JQ6A 2HR3A 2D45A 1YQXA 4LGVA 3H3FA 3JV7A 5G4KB 1K6JA 4E13A 1MC4A 4NBUA 2NU8A 1LJ8A 3FRJA 1QGPA 2HDCA 4D3FA 3GA0A 3SVTA 4RLSA 4CM6A 1F14A 1EH8A 1SMKA 3PWKA 1DAPA 1MGTA 3V8JA 1NX6A 3VDRA 4BO6A 4LB6B 1P1RA 4KICA 4O5OA 5HA5A 1HDXA 1B1BA 2RC4A 2NM0A 3UUWA 4Q48A 4G6QA 3DB2A 4IDGA 3PYMA 4RCVA 3RC7A 5HDGA 2ZNYA 3QVWA 2WYVA 2YX7A 2LNBA 3KSDO 3D5QA 4GWKA 1B8UA 1LA2A 2JAPA 1C0LA 3HTSB 1HZJA 4A10A 2AA3A 2CO5A 3OA2A 4FOSA 1FK8A 3F6VA 1QMGA 3WODF 2F2EA 5HS7A 1BC8C 1DSSG 2J3HA 1ULYA 3A28A 3ITDA 3ZGYA 1IN6A 4IJVA 1NPDA 1J59A 3PFIA 5ES3A 1TQIA 3VB2A 1O3RA 2NTVA 4BUCA 3GPIA 5BSFA 4Z9XA 1J49A 1NQTA 1RM5A 2EW8A 1EV7A 2KJCA 4J0FA 1HYGA 4N5NA 2OXIA 4JBAA 5CVUA 1NAHA 1UP6A 4NJMB 3L7WA 2W2LD 1K78A 1T2AA 3GAZA 5ILGA 1ID1A 4J7CA 3O9ZA 1R1VA 4CQLB 4BKPA 1FP2A 4XRFA 4EJVA 3NTOA 4JJGA 2IE0A 3U4DA 1IL0A 2OBYA 3KYDA 3BAZA 2OBPA 4Q3EA 3K1NA 3FD8A 3JQGB 3VVBA 2VNAA 3GY0A 3PWSA 1PQUA 5ERIA 4AIHA 1GUZA 4CODB 3PDJA 3W6KB 3CZMA 3JQCA 5EIOA 1Z74A 3NTRA 5AVOA 2QZ9A 4YJFA 1P92A 1KEVA 4EVIA 1PUEE 3MCVA 1E7RA 4ZQGA 3W4KA 4MVJP 2A69F 4XX0A 2Y66A 4IINA 3OJLA 5DBIA 2M1BA 3KUXA 4EMSA 2P4QA 2Q2EA 4ESJA 1LSJA 1DHRA 1VJ1A 4EJWA 3F5QA 3SC4A 3PWZA 4AJJA 4CMAA 5HWSA 2GZ1A 5IN4A 1FDUA 5A9SB 1UR5A 3KP7A 3WLEA 4CMBA 3V7SA 3GGOA 3GAFA 4IQ8A 4D43A 1MV8A 4RZHA 1RPNA 4UUMA 4WOKA 4HKTA 1ZREA 1AHHA 3PQEA 2HMTA 2OQGA 4FGSA 4LRTB 1ADBA 4QFCA 3MJCA 5FLXK 1Q7CA 2K4JA 4FW8A 2VRCD 4HW0A 3BDDA 2ET6A 4ENKA 3MOGA 1E3WA 4GPD1 4OKIA 2Q8KA 2R2GA 4A73A 4ZH4F 2BE5F 3F23A 4IBOA 4J0EA
chains in the Genus database with same CATH superfamily
1G8XA 2C83A 4BQEA 3MB5A 3HA3A 2I66A 4LYAA 3I39X 4FYXA 1ZK4A 2QKLB 3S2DJ 3MTQA 5H82A 2QZ8A 2Z5VA 3OMXA 1I6HJ 4M8KA 5SYAA 3IHWA 2GA2A 3ET4A 3Q7SA 4LDAA 4ZZ0A 4L07A 4BJ1A 2LRHA 2VA9A 1S1CA 1QH0A 3HYNA 2HQSA 1MMNA 3PXDA 1DBIA 1LBQA 3QSGA 3KUCA 3JAMZ 3M1LA 4YPOA 4EKIA 3I8SA 1X58A 3JVIA 3MWEA 3FUXA 2G77B 1F2UB 5EIXA 2LK2A 3FSRA 1I0LA 1P4HA 2JARA 3CNBA 4HEA1 3D5TA 2FPPA 1YDEA 5AJUA 4MKHA 3I4MJ 4N3NA 2UZ3A 5I47A 4DZRA 3EY4A 1UKCA 1JKRC 3SEQA 3OICA 3R0AA 1RPWA 3LA7A 2SICE 1EWVA 4ZAXA 4HG2A 4RS4A 3LWNA 3IHLA 3ZWYA 5I45A 2IS6A 4ZAFA 2HA5A 1QIGA 3QXCA 3CUQA 4M86A 4B81A 1MIOB 2BGLA 1CY6A 1VKZA 3QUCA 3OP1A 4FFWA 1OBVA 5H8WA 1YHQI 4EM6A 2H4YA 3K3PA 3DEZA 4TRJA 4KPGA 1RKXA 2JG3A 2EU8A 2JPCA 5BQ5A 4XLZA 4M7PA 4YRIA 4ZYYA 2NYRA 2YZGA 2QN9A 1Y6FA 1W34A 3H2KA 1EZ4A 1WCV1 4MVJA 4QTZA 1SKUA 2MSWA 4U0JA 4AN0A 1U7DA 5EMMA 1AA6A 1L5RA 3N5CA 4Q47A 2GKOA 1Z7UA 4JJ8A 1I50J 2Z8ZA 2EJUA 1BWRA 2NTYC 5A3JA 5E79C 1DJMA 2ODEA 1E2FA 1DCMA 4RORA 1DPUA 4DUGD 4FKMA 4UULA 1AWCA 2UUAB 4CQNA 2B4YA 5EXTA 3QIVA 4IOLA 2AK3A 2BM1A 1WXIA 1DIHA 4YJ2B 4L22A 3LMMA 1TC1A 2RFLA 3IA2A 3B6JA 2Z56A 2FSHA 5CPFA 1Z7WA 1VLQA 4URYR 3CC8A 4I50A 2OT3B 4DB2A 5K0LA 1EXWA 5IYZA 1XDZA 5J23A 2J3KA 2WICA 1R8JA 2A9VA 1NN3A 2HTEA 3L8EA 4MW7A 1IBKB 3D3WB 4D81A 3BIJA 4KUEA 1PF7E 3G6EI 4M9RA 3DMTC 3QPUA 5CDGA 3DONA 1HORA 2GD6A 1FYLA 3U4AA 4PLCA 2JFNA 2QUIA 3C8MA 1H4VB 1GR0A 3KO8A 4D9MA 3CCLI 4L8GA 1VQNI 5KYWA 3SBXA 3OQIA 1CERA 2O3SA 8GPBA 2IITA 1ZVQA 2FXVA 1P4AA 4YCBA 3QAHA 1DP4A 2JVIA 1JLMA 1WMFA 3CV3A 2WUVA 4HDMA 3U44B 4Y2GA 4J9VA 2NTJA 3U09A 1RZVA 2SKDA 5HKAA 1RLMA 1S2LA 1TO2E 5EQDA 1DQUA 1I1NA 1W581 1C4XA 3U3XA 2WNHA 3F22A 3BWGA 1K3UB 1CP3A 3IC5A 3UA3A 5KVQA 2Y9YA 4HGOA 3G1UA 3DOHA 1SB8A 3WLOA 3V33A 1ISPA 4LRYA 2XODA 3JSPA 2ZRNA 5JH7B 1JIXA 3I9FA 2PMZA 3R7NA 1E6WA 4QEZA 2HU9A 1G5TA 1Y1QA 1CQJB 3L8FA 4R16A 3HBJA 2HSGA 5CK5A 4RKEA 2XWQA 3NAZA 3KEGA 3QPCA 1LLFA 3T0GA 3CVJA 1WEKA 4BNJA 2EIMH 4OF4A 3EDMA 1QPIA 4PAQA 4DDUA 1J56A 1NI4A 1M0SA 5CB4F 2B9VA 1ZD1A 5GJCA 1NXVA 2FTKE 1RTTA 4MS4B 2VQHA 1QIHA 2HSWA 4XAQA 2PE5A 5AUQA 1WW8A 5JVDB 3O3KA 2ZULA 2A86A 1XGOA 1DVRA 2VHJA 3HB7A 1Q57A 1W19A 3IIEA 1NASA 1RYMA 4ZYVA 2Y76A 2ZBQA 2Q41A 3VZRA 4G5XA 4K03A 4WK2B 4OAQA 2XV4S 1W73A 4OOFA 4TV8A 2A0KA 2OESA 1Y3DE 4YRCA 1X2NA 2B8WA 2X8WA 1UF9A 3DXYA 1ZHOA 2R3SA 3FCAA 4KSCA 2PT5A 3GRRA 1T3SA 1J33A 4M89A 1JL3A 1AQ6A 4YBZA 1EE2A 2CMHA 2BGWA 1LDBA 2VTEA 3DMYA 3SJAA 4KRXA 4YR9A 2GZ2A 5CYVA 4ZVUA 2IVMA 1EJBA 4RGXA 2O03A 1ZWLA 4BIIA 4LXUA 5C5DA 5DNCA 3D0RA 1SELA 2QAGC 2QMQA 3O94A 3AFIA 3HTXA 1ZI8A 4ZPXA 3EQ8A 3W2FA 2VQ6A 4CM4A 3THXA 5C81A 3D8HA 3DLTA 2H1HA 3WK7A 4EKDA 2X9VA 2B82A 2WJWA 3AGQA 1SWWA 2WJGA 1KMMA 1BRTA 5KUTA 1DOZA 3QVOA 4RH3A 5JXJA 3KT0A 1PFUA 2QAGB 3OYEA 1NMSA 4RJKA 1CB7A 4KN8A 3A4TA 2O8NA 3U3KA 2HRRA 1MMFB 3DBRA 4KDRA 1VL1A 3ZHVA 3IUSA 3DOFA 3QF4A 3GHHA 4O59O 1C1XB 2QA5A 3GOHA 4F3NA 4IIJB 3FZEA 1G3RA 2V3CC 2Q6KA 1DWOA 1UPAA 4F3YA 3AGPA 1UXGA 1X14A 2ZRHA 1VFCA 3L1PA 1VGQA 2IPOA 1N2CA 2HMUA 4EYSA 3E82A 3WB9A 2H6BA 2XX3A 1L5MA 3HUTA 5SICE 2QS9A 1IY9A 2IZ6A 4RACA 421PA 5GIOE 3MJSA 2HLDA 3CXUA 5ILVA 3KM0A 5HM6A 2MWMA 4CF4A 3M6MD 5B1DA 1WV0A 2KB0A 3S99A 1YW8A 2PRKA 1YB7A 1XEWX 1IMJA 5EP4A 1P17A 1L5ZA 1VI2A 2ZB4A 3PVSA 4JOBA 4BZXA 1PT6A 4FMPA 2ZQYA 1B6GA 2EFQA 1V37A 2VJPA 3FK7A 4HDNA 1S6LA 4OIQF 1S72I 4WZAE 3E70C 1AS2A 2R5FA 2XPUA 1W59A 3FXKA 1PI3A 2AFRA 3RS2A 3ZH9B 4CKBA 2VONA 2FMXA 3MAJA 1SK9A 4RTKA 1G5FA 2QYTA 4Z9BA 3IWFA 1FFGA 1KDRA 2ZUDA 4YVFA 1VB5A 2ADFA 1CUDA 3RK4A 3GBPA 5AM3A 3DTVA 4CDGA 5E3MA 4DLSA 5BV1A 3QV1A 3MILA 2MINB 1QRYA 1UDAA 1U4SA 4NJOA 3OZGA 3B2EA 1YA8A 1CQTA 3GBSA 1ULUA 3OQ1A 4PXYA 5E95A 5AW5A 3DW3X 5IWCA 5DT2A 4CL3A 4XEHA 5KQSA 3L8DA 3UG6A 3AHEA 2VO1A 4FX5A 1ULAA 1X13A 2Y1OA 1WWKA 2MT9A 1SUCA 4K8OA 4C43A 3DXJF 1Y4AE 1TO1E 2HMAA 1HDEA 4IOJA 2C9YA 3MJHA 4DCJA 2V7FA 2XTNA 1X7XB 1N6RA 1W7PB 1QP8A 2CXXA 2VT6A 2K7ZA 3AF5A 2XDWA 5F3RA 2EP8A 4PK4A 5ECYA 5G0VA 1LNSA 2NYVA 3X3HA 2CH0A 3UUEA 2CUJA 4FFRA 1T8TA 2X13A 1ORDA 2VC0A 1BFUA 4ZGBA 1I5EA 2M8GX 2P9FA 4ZYZA 4NPCA 2CMGA 4PAWA 1W5EA 4JXKA 4EZEA 1XSXA 2C7OA 5AVYA 4Y7NJ 1NVEA 3WGYA 2ABWA 1NXPA 1R0WA 1CQXA 1M72A 2HIMA 2DT5A 4B74A 2LF8A 1Z35A 3BHIA 2C5SA 5BUCA 4LXTA 4PLVA 4GRDA 2J0SA 2HUPA 3ED1A 5HPYB 3K9NA 3OX2A 2YFHA 2FZKA 1N9ZA 2HPHA 3TTYA 2J41A 1U02A 3TJMA 4WKNA 2BFDA 4FMCF 1BJZA 4GWLA 2QF7A 3P52A 2B5WA 4HFMA 2DPGA 4A9AA 5FQOA 1GPH1 3K9BA 5F73A 4RTLA 1Y56A 3FOFC 3VVCA 3TLAA 1OB2A 1EA3A 3BG9A 1ACJA 2AZ4A 3IPRA 4AP5A 3MINA 3ZWXA 5BN3A 3LYAA 1NW5A 2MW8A 4RQUA 1T4CA 2O0LA 4JX9A 4U7HA 5T4FA 4LY6A 2X8JB 3QE2A 1Z12A 3IT3A 5T64A 3ZY2A 1ZJWA 3SY8A 1SXJA 3DDSA 2XCTB 2PL9A 3HOWJ 1YDGA 1ZIXA 1QS0B 5DK6A 1YF3A 4JYMA 1YU9A 4F2DA 3F46A 2HCBA 2HA3A 1GZSA 4FR5A 3O4GA 3QU6A 1X0XA 3UQZA 4F96A 3ILXA 3IRUA 3UK6A 2OFFA 2F00A 3IBCA 3E6BA 3EIWA 3PX7A 2UXBB 1BE1A 4C0XA 4NE2A 2Q50A 4DB4A 4H4DA 4DJAA 2ZB8A 3VAZA 5TB5A 3ZHSA 3OE4A 1UBCA 1NONA 1CEXA 2AJTA 4N9HA 3HHGA 5HGJA 4PJMA 1JXMA 1RI1A 2Q9AA 4EATA 1BN7A 3FVTA 4NYIQ 4KO4S 3AETA 5TPWB 1SXGA 2H29A 4Q12A 4OI0A 3E97A 3Q10A 4J03A 1D5YA 1M2OB 5LQAA 3GEPA 1F3OA 2E21A 3JWHA 4F93B 3ZDZB 4N5DA 1BFKA 1F0PA 1OV6A 1GA6A 5ALUA 2HU5A 1BHJA 3A3NA 3U4QB 2WIGA 3PFNA 3PQ8A 2BF7A 4UE6A 5FTKA 2JLVA 1J8VA 1X1CA 4MIOA 1Y9AA 3ASYA 1PWZA 2C0CA 3HYCA 1GN9A 4CHTA 1NDUA 4IHJF 2OC4A 4KMFA 1F4KA 2GR9A 2WVGA 3EGWA 4DMCA 1GYQA 2M6LA 2DOAA 1FFWA 3WTTC 4L16A 4K9LA 3IP8A 4LJZF 2PAAA 3GYGA 4ETWA 1OQAA 5FO5A 3EYIA 5FBVB 3G73A 1KXZA 1MA0A 3DNPA 2C4UA 5JXGA 1BXGA 3X43A 3HN7A 2ISYA 4GX2A 1YZFA 2NO9A 3N75A 4YQZA 1VKOA 3NI2A 2VTKA 1AKEA 1ESZA 2XCUA 4ZI7B 4IOAF 5FFMA 2ICWG 2AI3A 2P67A 3N0RA 2KRHA 2QSGX 1VFPA 3LLMA 2REQB 5AVKA 3TQFA 3D6MA 3DD1A 3ZU6A 3BR6A 2P0YA 4UB6C 2IXEA 1Q3KA 4KQGA 4HV4A 1CZOA 4WY5A 2XUOA 4F52A 3EGVA 4ZI2A 1ZN7A 3U1KA 1TX4B 1QGED 3MSCA 2FMUA 4B2IA 1Z2EA 4Z99A 4KP7A 4RM2A 3MUEA 4P1WA 4OMYA 2VYNA 2AV6A 2D1HA 3GRCA 5T3YA 2VQDA 1OJ7A 4MRAA 4LZWA 3JQ7B 1YZLA 4UQLA 3GA7A 1GJRA 4AWAA 4WKOA 2EIJH 1MFPA 4K86A 1WNTA 4II7A 4KQEA 1RPTA 2J59A 2P4HX 2D5VA 3E3OA 1P18A 3QNMA 4JLSA 2NZ2A 5DFAA 2DFPA 4CTJA 3FBGA 3IKLA 3DH0A 4PPGA 5LJLA 2WIFA 3M9AA 2BGUA 4I3FA 4DXDA 1ZI6A 2PLYA 4ODIA 1KYTA 2MC4A 4EJTA 1I3KA 5A2QA 1WWXA 2CLFB 2OAP1 3HG7A 3TQHA 1C8KA 2LR0A 5LD2C 2Z3ZA 1MRSA 3LS2A 4JLNA 1KONA 1CULC 1W47A 4I55F 2HYGD 3FWHA 2HV9A 3GQBA 1AOXA 2BY0A 2VBWA 1R8XA 4GRIA 1ETOA 4DLYA 5HLHA 2V7GA 3G17A 5AI0A 3SM3A 2H2AA 5IM5A 5IW8A 4IO1A 3CW9A 1QRTA 2F64A 3KZNA 2QG4A 3K92A 1F7VA 1I39A 3W6OA 5CP8A 3J80K 5DHSA 2CKDA 2HK6A 2XUIA 3CESA 3LA8A 1B8VA 3PQDA 3RO7A 4EPTA 4WLEA 1OXXK 3DAOA 3T6KA 3T7RA 4KJZA 4E5UA 1U3TA 1DIAA 2I8CA 3QLTA 3JQFA 5GY7A 3MJ4A 3T9DA 4WLFA 1LZLA 3C6ZA 2PWYA 1DG9A 2G7UA 1CF7B 2YWHA 2A84A 5EE3A 1ZITA 3DTNA 4GMKA 1K88A 2QW8A 1ZCFA 5EJ6A 5ANRB 1MDFA 4AYBN 3LVRE 5DNYB 2WAQN 1JKIA 2Y0BA 3LO8A 2GUGA 2D5LA 3PUYA 2P5UA 3P19A 1FUKA 3KQNA 2GAJA 1JPUA 3FNRA 1KU0A 3H5AA 3IULA 4LBYA 3OFVA 2WRZA 1TPYA 2O1WA 1PFYA 3WKDA 1DEHA 2IGOA 1XAJA 4ZDJA 1UWLA 5LJIA 5KAIC 3DZDA 1PGQA 3GK3A 4DG5A 4JI3B 4R3NA 4E4YA 1M5UA 3WRYC 3GEDA 3U5ZB 1JP7A 3DL2A 1MDBA 1X39A 2MFZA 1KRHA 4K6GA 5IHXA 1P9WA 3OZEA 3L79A 1G6OA 4FFLA 1SY7A 3FBNB 3PA6A 3QE3A 1NHWA 3PPXA 5DD8A 3K8YA 2ZYRA 4ABZA 3NW9A 3CJNA 3OOSA 4Z54A 2M7AA 3WDKA 5BQOA 5T8KC 3PQ3A 4QXMA 2YHBA 2BEOA 4PPFA 3U7JA 4U7FA 2J33A 2NU9B 4TKUB 1HZZC 2BW0A 2E18A 3QHQA 2UZAA 4BPRA 4G1VA 3GRKA 3KP4A 1ZS9A 3AESB 2Y0PA 1MJGA 3ZQUA 4K9NA 3GJYA 3JR7A 4XM3A 3BXZA 4WK4B 1UFQA 5F2OA 3KQQA 2AMVA 2A9JA 4QBKA 5BURA 1I3MA 1IN4A 1ZD3A 2N8GA 1J2JA 3VR5A 1SC1A 1A5SB 1UM9B 4ZGGA 4L27A 4BP3A 2PMKA 3OOYA 1Z5NA 5CVIA 1GSIA 3NPAA 4TV9A 4GR9A 3F9KA 2RHRA 1DS6A 2QVBA 3P5BA 1CYDA 4X91A 4ENRA 3ETEA 1VDMA 3X2FA 1KGSA 4JKIA 2OAGA 2BBYA 2A0UA 4MUKA 1JHQA 5J1SB 2IZ7A 4OUDB 1FYMA 3NUQA 2R6AA 4RFSA 5A04A 2I4MA 1OMOA 2B9SA 4TXMA 1Q77A 2MSYA 3I3OA 4LGCA 4MQFB 1TC2A 2AI2A 5HFNA 1EWYA 1SCJA 1EM6A 2BP7A 2A1TS 2PHZA 4E88A 1FTGA 5AI5A 5EA2A 4WNAB 5AVUA 1LWNA 1BJRE 2HQAA 4QVGA 1RJWA 2CF6A 2F17A 1W2GA 3KT8A 4ACAA 5ICSA 1YR7A 3DMFA 4ZDKA 3KRTA 2AMLA 2Y9MB 1BKDR 4Q4CA 1MW8X 3I9KA 2RGNC 3WY9A 1QIEA 4ASNA 2P1RA 2I62A 2PWBA 5CB8A 2Y3IA 3JYQA 2C9OA 2H4FA 4KPUA 3OC0A 4Y2TA 2VRBA 2N0SA 2W9XA 1SC7A 2QZZA 4UNNA 4BRUA 1K6YA 2X5NA 2PZFA 1ZUHA 2DO7A 4EG3A 4JGIA 3JSOA 1EH6A 4DNFA 3P9IA 4X0EA 3QKWA 1L6IA 3E53A 3PKIA 1ZLJA 2ACJA 1W4CA 4TMWA 4E14A 3U4MA 2KFDA 3ORQA 3ZHUA 2G63A 5C1BA 4UVIA 1F9EA 2P3OA 4FZRA 1CVLA 4DM7A 2X0JA 1C5KA 4IHKA 3KJGA 4MP6A 2WAOA 4G6DA 1IWOA 3E9NA 3TEDA 3OZDA 4U7TB 5LLSA 1N6IA 1NV9A 1VSVA 5HMLA 1KDPA 4FCWA 1SD1A 1H2YA 4LB6B 5DI3B 4IDGA 1D2NA 1KI6A 2HCRA 2JAPA 2GT1A 1D1AA 4JUBA 2ZITA 5CA0B 5F1JA 2O1XA 5K6RA 4ZCPA 3I9V6 5IHPA 3A28A 1QO7A 1OR7C 1MRNA 1RPZA 4RHTA 2AVDA 6CHYA 3HACA 4KFTA 1R1VA 2JFUA 1VI0A 2ZRAA 1F5SA 3KYDA 4Q3EA 1O54A 1V8ZA 1U0OC 3QMMA 3ADCA 5FYQA 4BX2A 3KVVA 1GITA 1L1EA 4F7WA 1LSJA 1FDUA 2Q5QA 5B53A 4UU7A 3EGCA 3PQ5A 3H5VA 3MJCA 1GTSA 3L2OB 3GGJA 3T1YB 2V55B 3C8DA 1AGPA 2X4DA 3A4MA 1R88A 1JEDA 2J3JA 4OQZA 2CKMA 4DA6A 1JJ8C 5E0KB 4YQEA 2L7MP 4UPDA 3OU6A 4HB3A 2MLGA 4ZP1A 3JQAD 2ZFWA 1VMIA 5BW8A 4GLOA 3SYNA 3S2IA 4TTPA 1HDDC 4Z7JA 1QR6A 1TKAA 3KZCA 3PRHA 4R5MA 2MLKA 1Y4UA 1P75A 2XT0A 1I3LA 5B7NA 3OLQA 1UXOA 3WLLA 3SZPA 2W8BB 1J06A 4L72A 4I14A 3FLAA 1DJOA 1DUVG 4B4OA 4L8YA 1XUOA 2BHSA 1LV8A 2E7XA 5EIBC 1TJPB 2AFIA 4V19K 4R79A 4FOTA 2I8AA 1OISA 1YULA 3RREA 2FMFA 2P3QA 4TLLB 4QOIA 3RZDJ 4JB2A 1G5QA 1KMHA 2CG4A 2YVKA 5BQ3A 1WHSA 1WTAA 3H9QA 1THMA 4X8LA 4BN0A 5KBYA 1K8YB 2Q1ZB 1FP1D 1IEXA 5TV2A 5FA6A 4FONA 3VEPA 1XXHA 2UAGA 2NG1A 1H05A 2RIRA 2YV4A 1GZ4A 4EF4A 4P4LA 1ZGHA 2F3RA 5DCLA 3J7AO 2DC1A 2X2PA 3D3KA 3OUTA 3SKYA 2NNYA 4Z53A 5DVZA 1BXKA 3MNFA 3I59B 2ZDGA 5K5QA 3QOPA 5JNWA 1HV8A 2OYSA 1F0KA 1P45A 3JTMA 4HWOA 4LHVA 5DN6D 1N5KA 1ST2A 1MH4A 2GDZA 2QTFA 3PYXA 3JPWA 3HC7A 3I1IA 4L51A 2HOEA 2E85A 1RKBA 5F08A 5DHTA 3WADA 1JS1X 2W6OA 2OGZA 4XDGA 5FB2A 1TUBB 3D6JA 5GVRA 4DLXA 1ZD5A 4E1AA 1U8EA 2YVLA 2I3AA 1C30B 4ZEOA 4W82A 3MGGA 3MCWA 3OX3A 4FXPA 4HRYA 3GZNA 2AZMA 4MB2A 4UXJA 5KVCA 2P6MA 3I12A 2VPIA 4OJMX 2O0HA 1K92A 5DW3A 1IOVA 4DJTA 5FD5A 1QM5A 2BD0A 4ZCLA 4KR2A 1VHWA 3ZR8X 3V46A 2BEWA 1N5LA 5EYPB 1E9EA 5LHHA 3JRNA 2AEJA 1US8A 5L40A 1JAIA 1SZDA 5B4UA 3WFZA 1K9SA 2EFYA 3BDVA 3WJ1A 3GD5A 4JSYA 4K88A 2J5PA 2Q3LA 3PUIA 1QGZA 5FV4A 3L2RA 2QBYA 8ADHA 1XRSB 3MIZA 3U49A 5AONA 1W4BA 4GLLA 4QO8A 3N2IA 3BT7A 2ADUA 4M3BA 4WCVA 1MPTA 2NZJA 3ZGZA 4EQ6B 2ZYSA 5CBPB 1YC5A 4HAZA 3KSBC