3WG9A

Crystal structure of rsp, a rex-family repressor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
209
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 74
structure length 209
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wg9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wg9A02
1XR3A 4S05A 3ZMZA 3P19A 1IPFA 3HQ4O 2HJSA 1Z05A 2X86A 4CM9A 5BSFA 3RBZA 5A9SA 1W7PA 3JQGB 3DBRB 3ETDA 1BXGB 3BIOA 3KYDB 3LF1A 3VDRA 2X9GA 3QRWA 3L6OO 3CDHA 4P5OA 4TRMA 1PQUA 5DDIP 4ETSA 1FZPB 1NAHA 3QWIA 1ZMOA 3VTZA 3H4VA 2O3JA 1NQ5A 4GAEA 3VPHA 4CR7A 3E6CC 4MGRA 5HLHA 2O4UX 3FTNA 4ZJUA 4CM7A 2X0NA 4QEDA 4J1QA 4R41A 3ELKA 1PJLA 3J81Z 1YJ8A 5TS3A 1QO0D 5ITVA 2FQ3A 4ID9A 2EW2A 2JT1A 1C1XA 4BQAA 4R9RA 3BMCB 1WDKA 5L3EA 2FE3A 1N7GA 3F8CA 3NTQA 2CDBA 4MINA 1ZLKA 3WGZA 1XU9A 1KOLA 3DMTC 1MDMA 4RF2A 4P9FA 2X58A 2EG9A 2VZ9A 1R16A 2OQRA 1V3UA 4NFSA 3R0JA 1VLLA 4YJDA 2C0CA 4GSKA 4CLRB 5JYEA 3CXRA 2DO7A 4PZCA 2UUOA 4R1NA 4GKVA 3FHLA 3KLOA 1DFIA 1KEUA 3ROUA 2D8AA 3IL2A 2M45A 2AEMA 3F8MA 3GZNA 4MKZA 3H9GA 1B2LA 3JSOA 1WMBA 2UV8A 1I8TA 1EUZA 5JI6A 4JIGA 4RPKA 4A2CA 1FDSA 1HDGO 1D8AA 1LRLA 1PU2A 1V6AA 1E7QA 2HK7A 2Y67A 3PVZA 4W7HA 4A0SA 4EJTA 3IIEA 8LDHA 2I5PO 3RAJA 2GGSA 4MKRA 4ZQEA 1STZA 3RQSA 3QAHA 3B6ZA 2DBBA 2HRBA 1MXFA 1BVUA 2YYYA 1EMDA 2P4QA 3W4JA 3L6EA 3FD8A 3IQDB 1DC6A 3GFMA 3RFTA 3E5MA 2NTNA 1O89A 3MJSA 1UXJA 1Z6ZA 1F8GA 2W98A 4R1SA 2Q46A 4P96A 2FBHA 4Q4ZF 3GVIA 4IS2A 3ZWWA 2R6JA 5IDQA 5E1WA 1L3LA 4H7PA 4EW6A 3HZZA 1Q0LA 5E8IA 2KJBA 2CFCA 4R5MA 4JP3A 3ANLA 4A0YA 2VC1A 3IP1A 1LVAA 5JPIA 3VHRA 1ZKMA 2AQIA 1MG0A 4AVPA 2GSDA 4OJNA 1YG2A 5DT9A 4CL8A 1VSUA 4NBUA 5IXSA 2C7VA 4R1TA 1G4DA 2HLPA 3GVXA 3JQ9C 4BAYA 1GV0A 3V1TC 3PGXA 3OBBA 3QPTA 2WYWA 4OINF 3ZHXA 1ZRFA 3U4DA 4LMYA 4O3MA 2LDUA 3H9UA 1Q7GA 2VOPA 1SAYA 3C1AA 1RWBA 4IJUA 4I08A 1N92A 4RL6A 5DEQA 2RH8A 2A3SA 2LNBA 4W7IA 5I9NA 4L0QA 1R66A 2K86A 4HY3A 3K69A 4BYYA 3DFZA 3IAHA 2FR0A 1GQYA 4PDKA 4HXYA 5ICMA 5JLAA 1LA2A 4D7AA 2WSBA 1I3NA 2Y1FA 1TEHA 4J6FA 5HLIA 5J8FA 2DQRA 3AU9A 3TZ6A 3ZQ7A 3ADPA 4IQ0A 3L2CA 5G4LA 3UGKA 3B1FA 4PLZA 4C7KA 3ZNNA 4R1UA 3IMFA 1U3TA 3DTTA 3F72A 5BQTA 2HK9A 1KY4A 1PJ3A 3JQBC 5CVRA 2YW9A 1LTHR 1XQ1A 3MAJA 5TNXA 1GXQA 3FZVA 3WE2A 4XA8A 4CPDA 4YPOA 1SB9A 1OC4A 1FOKA 3HSKA 1WI9A 3KP2A 4HLXA 4Z2YA 3BMOB 1BI2A 1ZARA 1UDCA 2CY0A 3P2YA 4U6SA 3TDKA 3HUDA 4XQGA 1DHRA 3BTVA 2K4BA 1U6GA 2DTDA 5F1KA 6LDHA 1ZGAA 1DBVO 3ZGYA 4UUOA 5IDYA 1ZG5A 1R4MB 4IMRA 3AOEA 1MKMA 2VQ3A 1TT5B 1ULUA 2GZ1A 3O03A 3QY9A 4HBGA 4PLCA 4ESBA 1QLJA 4TRJA 4ZRMA 3WQRA 5L4LA 2Q99A 1WSUA 2BI7A 1MFPA 3QE3A 1ENZA 1YL7A 1QSGA 1E1MA 1XU7A 4YIIA 2K27A 1YB1A 4XR4A 1GFSA 1TVEA 1DP7P 4JNKA 5HM8A 4Q3BA 3KRTA 1NXQA 1ZUD1 4GPD1 5A4DA 5I7FA 4O63O 4MTEA 1ZFNA 3C3WA 2M5WA 2CVQA 5C5IA 4S1VA 3TL2A 1BG6A 6ADHA 1E3WB 3MJCA 2HS5A 4L4RA 3R61A 1A5ZA 2VUTA 4KOAA 1ID1A 3OH8A 5T8KA 1IRGA 1OI7A 1CQJA 1U5TA 1XDSA 1K2WA 4ROSA 3J80K 1XIVA 3BMQB 3VH3A 2RN7A 4FOSA 4RGXA 4A5NA 3KZVA 2WMDA 5F3RA 2PBIA 4NDNE 2Y99A 2PKRA 5JDCA 4N9HA 2D2IA 1ZK0A 5H20A 4UEKA 4YWJA 3VTFA 1Z75A 2P4HX 5K6AC 1GCOA 1NYTA 3E5XA 2YPRA 4CQLA 1C1DA 2CG4A 3GXOA 1LNQA 4E2XA 2OA4A 3GA0A 4PG5A 5THQA 4HDVA 1PL7A 1WXDA 3H8VA 2NQTA 4ZD6A 4L4SA 1WLYA 3D5TA 3TO9A 2DK8A 3NT5A 1V8BA 4YIFA 4W4TA 4JBAA 4BQPA 3F23A 3JW4A 5DP1A 4HQMA 3QIVA 2HKIA 1IXSB 2QZZA 1IE3A 4KQXA 3F22A 3EYWA 3R3SA 1U5CA 4YAEA 3WBBA 1XYGA 2HUNA 2QQ5A 3UAGA 4U7DA 3WJ7A 4M89A 2B4QA 4NB5A 1F0YA 4A27A 1USSA 3O8QA 4N7RA 3E5UA 4WUVA 3ZW9A 1ZIDA 3F3XA 2LDBA 2CMDA 4M9XA 3QJ5A 3C3XA 4OIQF 4JX8A 1ZH5A 3LT0A 3FF4A 4JLWA 3I9MA 4IHSA 1KVUA 3LA7A 5KJ6A 4NQWA 4MP8A 4L9VA 2WWYA 3I59B 5A05A 3L77A 4ESOA 2DK5A 1DXYA 3HB5X 3CUQA 4L4XA 3TZKA 2IPQX 3JQCA 3P9CA 1TW2A 3LC2O 5HDNA 3J7AO 4FPXA 4B4VA 5B1YA 1CF7A 3TQHA 1J6UA 1JXSA 1DRVA 4FBGA 4RQTA 4EV0A 5K5RA 1NASA 5KKAA 3NEUA 4WXHA 3ZZNA 4YT8A 2IZZA 3Q9UA 5TT0A 2ZKZA 4P4GA 1I3LA 4YEDA 5JXWA 3ZHZA 2EERA 3GDFA 3ICPA 4KYWA 1NNUA 3KETA 1X0XA 2HEOA 1NX6A 3T1BA 3WTYC 1WMAA 3K2EA 5TSDA 1YW8A 4KIBA 3E97A 3AUUA 3AY7A 3AUTA 4LGVA 3G3EA 1HE5A 4GI2A 1VJ1A 5K9ZA 3IOYA 1JAXA 4IQGA 1AHIA 2O3UA 1IZ0A 4D79A 1B16A 2TMGA 3G49A 1F06A 2AS5F 5FD5A 3VZPA 4ILKA 1EK5A 4JBHA 4CMKA 1IHYA 3J81K 2M87A 5EJ2A 1NWCA 4DMMA 1JVSA 2HKXA 4RB0A 1VC2A 2POQX 4I0AA 1SD5A 4CHUA 3P2OA 2B0LA 3F8FA 4OOIA 2VUUA 5A03A 5B4UA 1PIWA 4Q3DA 4E2WA 4PLWA 3DHEA 1Y7TA 2DBZA 2G82A 2Q49A 3NT2A 3SLGA 1T39A 3ZWPA 4RAZA 4A0ZA 3GHHA 2O3FA 4CODB 1QORA 1WP4A 5I8ZA 2IW5A 3M1AA 4WASA 3PP8A 5IZCC 1QR6A 5JBIA 2QW8A 2C59A 1VTNC 4GGGA 1B1BA 1GZ3A 1LXCA 4LJZF 1P1RA 2RC4A 3U49A 4CM8A 4RLHA 4W9NC 1NR1A 5D4SA 2Q1UA 3BZ6A 5CEJA 4QFDA 4CM3A 4F6LA 3IKVA 4ON0A 1PEDA 1YYVA 2OP0A 3OJLA 1C14A 4FHTA 1H0MA 4DYDA 2CFXA 3HUGA 2ZKLA 1I6XA 3IRQA 4I98B 4DPLA 1Z74A 4KA4A 2NVUB 2PD3A 2AG8A 1ISGA 4F7ZA 2ZATA 4OQZA 4YAKA 1A27A 3PXXA 5ITWA 5CLSA 1PTJA 2HMTA 2GZ3A 4ZHSA 2EV5A 3MZYA 2C5EA 2DPGA 2X5KO 4MQVA 4M87A 1EEHA 1N5DA 3WIEA 1GUFA 4EEXA 2EFOA 3D5QA 3K6JA 2GPTA 2PLAA 4OKIA 4BKRA 1XD7A 1P4XA 4DBVO 4R4JA 4OXYA 4UUMA 1J4AA 4XWYA 2B69A 1GVJA 2VWPA 2W2KA 3JQBA 4YJGA 3KP6A 3EVNA 5IT9K 2J5QA 2C2YA 4QX6A 4R5HA 4RQUA 3L7WA 3ZN1A 3NV9A 1PWZA 1NFQA 5D8KB 2CNBA 1VE9A 4CMIB 1JGSA 3W6ZA 4A26A 4DIFA 3HYIA 2QYTA 2WWRA 1LDJA 2QZ8A 2VBYA 5D5XB 2PR2A 3Q0EA 3RKUA 1NWHA 3KEOA 4RB2C 3GFBA 4BNXA 2CW0F 3GNQA 3JTMA 2ZTLA 3S2IA 4OSPA 5BT9A 4QTZA 3L9FA 2OUIA 2PH3A 4IS3A 2OD5A 2R3SA 1PL6A 2GYYA 1N1GA 3ECOA 2I9PA 2B4TO 2Y66A 1PS0A 3FI9A 5HDGA 4FJ2A 2ELHA 4J2OA 2FWMX 2X5OA 2JZYA 1LEAA 3KEQA 2G0TA 3OETA 1SD4A 2H63A 4FFPA 5T57A 3RUHA 5DCFA 5LEJA 2X8LA 4XX0A 2H6EA 1PGQA 4KT5C 2JFFA 4C4OA 4WNIA 1D8KA 1U3VA 5G2OA 1P2FA 1IYZA 5ICEA 1YBAA 4EJOA 2LF7A 1U28A 4CMJA 1M76A 3W6KB 3DZJA 1OYWA 1TA4A 3FPCA 3KO8A 3KYCB 3OEWA 2E49A 1CERA 3HFSA 4D3FA 4O0LA 3MTJA 3OSUA 1C3VA 1FSHA 4KDFA 4YRDA 1AE1A 3FHZA 1QLHA 1KA8A 4RZIA 4Z9FA 3F1KA 3VVCA 5I7SA 2DT5A 1MJ9A 4EMSA 2Z95A 1C1DB 2JJYA 3MZ0A 1NPTO 1KBZA 1AWCA 9LDTA 4BO2A 1T2KA 4DQUA 3OHSX 1ZGJA 1E5LA 3DZKA 4HFMA 4IDGA 1D7OA 1DAOA 4LSWA 5ER9A 3GOHA 4DWVA 5H83A 1BIAA 4Z3DA 3X2FA 2IXBA 1G0OA 4FD3A 5F5NA 5LGUA 3R4KA 3A06A 2VCYA 3EAGA 1BXZA 2NTVA 3GMDA 4XQCA 3CUQB 3VFZA 3HTUA 1GTMA 2G7HA 3K1MA 5HLGA 3JQ9A 3W8DA 3E9QA 5CHEA 4YG2F 2DFVA 2Y0EA 1QYDA 1T2FA 2GUGA 3WDSA 4AJKA 3TWOA 3AU8A 4NNJA 4YFXF 1S3JA 4CMEA 5BS6A 3DMYA 1ZLJA 1XB4A 1BXGA 1O8CA 3AFNA 2JCYA 1PZHA 1KU3A 3KP5A 2M1BA 1U9JA 3W6UA 1ADCA 5H6QA 2WEKA 3T8RA 1SMKA 2P9CA 3L4BA 4NU6A 4IMPA 2VRBA 1T98A 3ANMA 2W90A 4NHJA 2YZ7A 4YAJA 2LDXA 3ASVA 2Y0DA 4HP8A 3ZMSA 4WK6A 2O2YA 4F46A 1QRRA 3SJ7A 2FOIA 2O3QA 1VL8A 3PZRA 2V6CA 4BO1A 3ZWOA 3EETA 3FSRA 2VWHA 4AL4A 5JY6A 1YGYA 3ZN0A 5H81A 2V1DA 1WQ2A 1J7KA 1WWXA 4PCVA 4CXFA 2XAGA 4PVDA 4UREA 4GYIA 2HDCA 2Q2VA 1B3RA 3LT1A 4LN1A 4P55A 1LQTA 4HBLA 3RD5A 4BO6A 3EGOA 1NHAA 1UZLA 3I1JA 3BXXA 3T4XA 4BV8A 1GXPA 2I66A 3GX4X 1TBXA 3JQAA 1KERA 4B4OA 5IT9Z 3H7AA 5T67A 1FDUA 1LU9A 4J2HA 5CDUA 5KVVA 3JYNA 4M86A 4FW8A 2QENA 4GKBA 3VZQA 1YVEI 1M75A 3DZHA 5DBFA 1XCVA 4ND4A 1O95A 3DDNA 1KC1A 3HDHA 1CF7B 1X7GA 2O7QA 1K7AA 5KVRA 3FWNA 3JYLA 4IINA 5ED4A 1CEQA 1K6IA 4U88A 2Y1EA 3EHEA 1HSTA 4BNJA 3DQPA 1LJ8A 4QFCA 4DIOA 1QQIA 1UP7A 2X0JA 3QV1A 4JQFA 2NU7A 5U4QA 2HTSA 3O6BB 4RB3C 4R01A 2P8TA 2QZ9A 1V3FA 4GXOA 4L5IA 4BB5A 3ZW8A 4R1HA 1FJHA 3QRFF 2PMUA 4OIPF 1EH8A 2E4AA 2WM3A 5J8CA 1JKJA 2HU2A 2ZQYA 1HZZA 3RC1A 3ZWNA 1ZEJA 1OPCA 1X3UA 1O3RA 1SB8A 1HW1A 3U2RA 2NU9A 2NACA 4J4TA 3KV3O 2OBNA 3GGGA 1U3EM 2JCXA 5TQVA 2JFGA 4XRFA 3QWAA 2C6YA 1WAMA 3DONA 1F17A 4Q9NA 5DCYA 2DBVO 2AXLA 1OKRA 4LW8A 2EW8A 1HKTA 1R6DA 3UN1A 3TF5A 5DD8A 2EGGA 2ZTMA 3ICCA 2I76A 2KJCA 1NBOA 1XQ6A 4FC7A 1B4AA 3RKWA 3Q11A 1UDAA 2YFHA 5ENVA 4BKUA 2B4RO 3G3ZA 2LKPA 1PS8A 5A3VA 1EUDA 3ZMDA 2ZBKA 1YTYA 3DFGA 5TT1A 3JQAD 1X1EA 3ON5A 5L3GA 4JP2A 4M8SA 3H9QA 3RCBA 2D5CA 2Q3EA 1H6CA 3W8EA 3CH6A 3WTCA 4BO4A 5ICSA 2HMWA 2UDPA 5L3BA 1DIHA 2VT2A 2EV6A 5BSEA 3BAZA 3IWZA 3EDPA 1EE9A 3JYOA 3U5TA 4KTTE 1C0LA 5FFFA 4GH5A 2ISYA 2UWMA 1HE2A 3PJDA 2XAQA 4K6FA 5A02A 2HFHA 2OZ6A 3A4VA 1D1TA 1IL0A 3DBLB 3OICA 4GBJA 2ZYDA 1SAXA 4BKQA 5BMZA 3WU0A 4RVSA 4NK4A 3DOJA 3RROA 1R1VA 5C7LO 3ENKA 4R68A 3HTSB 1G3SA 3I53A 5JCJA 3QPHA 1E7SA 4PG8A 1WWKA 2DBQA 3JTGA 1HXDA 5DD4A 1F8FA 4YJFA 2DPDA 1YBVA 1XSDA 1LLCA 3DZFA 1Z73A 1LUAA 3N97A 2NLOA 4EEZA 1PP7U 2JSCA 5IDWA 1Z6RA 3Q5FA 2GXGA 4XGIA 1ZO8A 4CQMA 3T7EA 1DFHA 3QVTA 1XEAA 3QP9A 2RIRA 2R00A 1SPXA 1DRWA 2L4MA 1RM5A 4YJHB 3DQVC 3HOSA 1JKIA 1X14A 2CYYA 5A2QZ 2Z1NA 4IDBA 3JAMZ 4GYGA 4N5MA 2DI3A 3QA9A 3ZV6A 4Z6KA 3CMMA 4HFRA 1ZZEA 4FR5A 3W4KA 2XAJA 3CLOA 2GN9A 3WWZA 4Y13A 1QBJA 2A61A 1BI0A 5AXBA 1RM3A 1R7JA 2D3TA 2OORA 4IJAA 3LU1A 4AD9A 4M73A 4G7HF 3C1TA 5CVUA 4I2OA 3H5AA 1ZNQO 3PYXA 4JN6B 1M67A 2BFAA 4R3WA 3GYHX 3DFUA 1I3MA 3I5UA 2P91A 3GPDG 3HFGA 3EMKA 5G4KB 2WTEA 4WCFB 1PZGA 1YB4A 2PZKA 1YQAA 3GEDA 5K5OA 3QU6A 4MO2A 3ZNQA 1XGSA 4AG3A 4JXKA 4Y8VA 3PHGA 4HF2A 4ZN6A 1IN7A 3CTAA 3K96A 4TKLA 3HG7A 4MP6A 1QYWA 4HQEA 3BHIA 1U7TA 3HE3A 4CJXA 1PJSA 3AUAA 1XCBA 4DVJA 4MVJF 2FP4A 2PA3A 4PFJA 4N5NA 4IDFA 3Q2KA 4F45A 2W84A 1D5VA 5CPBA 3ZI0A 2QRLA 4DIBA 2P5LC 1NHWA 4GMGA 4RVGA 5F1PA 5IN5A 2I65A 5JAIA 3TDZC 2IA0A 4PGGA 1P1JA 2FHSA 4I5GA 1I36A 4YJGB 3I83A 4MVJI 4M9ZA 3T5XA 4HDUA 3DPLC 4YJFB 2FSVA 2FR1A 2NQ8A 2J3JA 3LA3A 3BTOA 3EC7A 2NTJA 4JQCA 2X7HA 4LMRA 3E48A 4IJVA 3BZUA 2ZQZA 3KYDA 3C1OA 3GH3A 5E1ZB 3QWBA 4FT8A 1E7WA 5AXCA 5KJCA 3MOIA 2OMEA 2IVMA 1H2HA 4BS9A 2H5LA 1U8RA 4B7CA 3WTZA 1DIBA 5L7TA 2H1SA 4U0YA 1T2CA 1V9LA 4DNCA 3GRPA 3L9WA 1SNYA 4Z0PA 1BBYA 5TJHA 2J5PA 3CINA 5L7YA 4GX2A 3E8XA 4Z9YA 4ZZLA 2VE8A 3QOPA 1G0NA 2RCYA 3JQDA 2NNYA 1E1KA 3GFGA 1AN9A 2YJZA 5GZ3A 4PLFA 1DIGA 3ORFA 3HSFA 4HX5A 2D1VA 4UNOA 5A1TA 1MDMB 1ZYRF 2HYFA 3LDHA 1MP0A 5FYDA 3L4SO 5BNIA 1K6JA 1K6XA 3C7JA 4CGZA 1CQIA 2ZB8A 3MFKA 4PG6A 1HTBA 3L00A 3BMNA 3D4OA 5CVIA 2ESHA 2VHYA 2ZYGA 2QVOA 4OKNA 3TOBA 3SC6A 1H2BA 2AMFA 4AICA 4DUPA 1UHWA 5JY1A 3M8FA 2SCUA 3GUCA 3DBLA 4PGHA 5JS6A 2HYGD 2FZWA 3O26A 4Y6SA 1J75A 4BB6A 3KP4A 4NU5A 2DBRA 1W5SA 2VOOA 1AOYA 4A03A 2DAOA 4RJTA 2WDZA 2ZNZA 1I32A 3WGGA 5FWNA 4CYDA 2J5KA 4BIIA 4YB8A 4ZQFA 4L75A 3ROMA 1FC3A 1BHSA 3I3OA 5L9AA 4CM4B 2BGKA 2FMUA 1K6OA 1IY8A 2PKQP 2NVBA 4KP7A 1JU9A 2EP5A 1F12A 2GERA 5HS4A 2CVOA 4WEQA 1D8JA 1T38A 4O6JA 3ZCXA 3W6JB 1PJTA 3RC2A 5FO5A 2TMDA 3RUDA 7ADHA 2FSSA 3RKYA 5D6FA 3M1EA 3PQFA 4XDYA 4BO5A 3FPLA 1R0LA 1ZN2A 2V6MA 1CF2O 3KVOA 3JYPA 4BNYA 1Q7BA 1UXGA 1Z7BA 3EY4A 2CO5A 5HS8A 2FBIA 4FCCA 3HN7A 2GA2A 4XIJA 4MQ9F 2O48X 4JK3A 1O7LA 4XB1A 4MTDA 4BO0A 2DFDA 2H27A 1E7MA 4HYEA 4WJZA 4WWCA 3DXJF 2CSUA 1BTOA 1YWGO 1YL5A 4PLTA 2F1KA 4YAIA 3ABTA 1QXSA 1QZYA 1RYDA 3CKYA 1JKFA 2UUPA 5HTOA 1HZJA 4OL9A 2EF1A 1M2WA 2EJVA 2X0RA 4DQ2A 5CDSA 4A12A 5U1PA 3GFJA 2W85A 3REOA 1GUYA 1Y6JA 2NUAA 4UUVA 2CF6A 1S6LA 1CIVA 4XIYA 3LSTA 4CMHA 1YS7A 2BEOA 3LC7O 4ENKA 2G1UA 5HS9A 4XJTA 3DBHB 3E03A 4DQVA 2KRFA 1D4FA 3RFXA 3R6DA 3WE3A 1PP8F 4P8RA 1R1TA 1XGKA 3M9AA 3KCCA 1JTVA 4BNWA 1H93A 1MA0A 3MWDB 1I2CA 2DM6A 1R4MA 1ZEMA 3KLPX 4UVAA 1U2GA 1Y81A 3GEMA 1E17A 3UVEA 5JCJD 2A9FA 2BMAA 2VRCD 5A5FA 3WYCA 3BMQA 3A28A 3WTUC 3FR8A 3G1UA 1VJTA 1B9MA 5L3CA 1J2XA 4MVJH 5IJZA 3K9TA 2D0IA 2FN7A 4MEYF 1K5HA 5DULA 2B37A 5IXYA 5KJ1A 3O2PE 3SVTA 4BOYA 5L3FA 4M49A 2DUWA 4WX9A 4BHBA 1KU7A 1VKOA 4PZDA 3PJGA 4EM2A 2K02A 4UV9A 2YU3A 3N4MA 4CQMB 1U2DA 3B70A 2STWA 3NDJA 2UAGA 1E0DA 4Y98A 3WFJA 1GV1A 2ZYAA 1V0JA 4H0EA 4IHTA 2DAPA 3DEUA 1S29A 1MLDA 2GXBA 2HMSA 1B6AA 1IB6A 3JD2A 4XGNA 3OQ1A 1AUPA 5CAEA 5I7VA 2Q45A 1SFUA 3HADA 2QQ9A 2BH9A 3W8FA 1RJWA 1ZBQA 3V8BA 2X9NA 3OA0A 1JLLA 1UJMA 1W7PD 5CPFA 4MNUA 4RAYA 1X0VA 5L45A 3U3XA 4BNZA 5DP2A 4QO7A 1YQGA 3D4PA 4CQMD 1T2EA 1EBUA 1T4BA 3CUQC 2UVDA 3D0SA 1B8PA 4OOEA 5IAAA 4LSMA 2PFGA 1Y5MA 1E3SA 5ERIA 3KHUA 1FYKA 1L7DA 4BNNA 3VH4A 1GUZA 4ALKA 4QECA 2YHIB 4IIVA 4A5MA 5F1OA 2IA1A 2Q2WA 4EGZA 2HDHA 2O4CA 4HV5A 1OAAA 4H15A 3U62A 4EITA 4BNKA 1U1IA 1J5PA 2HCTA 4FFNA 1JN0A 2IODA 3M8EA 3HWRA 3A1NA 1ISFA 4YVFA 3GMSA 3D7LA 3S2GA 2X5JO 3E6BA 4JBIA 3NTOA 3PYMA 3S55A 3PZBA 4AJ4A 4J43A 3KOUA 2AG5A 5IFLA 3NDIA 1XGNA 4B7UA 2C54A 1I01A 2VZ0A 3ZDFA 2CGPA 4DREA 2OXIA 4ENNA 4DLAA 4HW0A 3DAGA 1B3BA 2NU6A 5D5WB 3MEQA 2QHXA 2EEZA 1IPEA 3FMRA 4LRTB 2ESNA 1UB9A 2XASA 1I10A 5HDKA 2B0JA 5E18F 2ZB4A 3MWEB 2GRAA 3OM9A 1NVGA 4BNGA 3RJPA 3BOQA 5C7IO 2DLLA 3ZWCA 2A92A 3GLXA 3GZNB 3UXYA 2O7SA 3B73A 5ILGA 4N0BA 2DUUA 4RF3A 4E5YA 5JSFA 5LDHA 4WXDA 4IDEA 4NIMA 3W1VA 4DRYA 3U0BA 3EVTA 1IN5A 3M1LA 5FFZA 4FB5A 1T24A 1VSVA 3EK2A 3SEFA 2J8ZA 1DC5A 4UV8A 5KVCA 3KP7A 1HKUA 3ENNA 4FSHA 2W57A 2CF5A 2AE1A 2FNPA 4N9IA 1YS4A 2O3SA 5HRUA 1T4DA 4IUYA 2H9IA 3KFWX 2I6TA 1I5RA 3HSEA 5JFOA 2VYND 4RPGA 1QNTA 4KUMA 3C1DA 1GEGA 3FWEA 4YAGA 1EFKA 4K26A 3ST7A 4OHUA 5ENDA 4HFJA 4MVJG 1HDYA 2V6FA 5DCWA 3RC7A 1RIOH 2ADUA 2HSDA 4O59O 4PLYA 2X6TA 1YBMA 3B20A 1YW7A 3CZRA 4FFLA 4JGBA 5DN9A 5J6XA 3U4HA 2MH2A 1KC3A 1DPRA 2E48A 2DW4A 5JO9A 4XDZA 1ZSYA 4BNUA 4FX4A 3D4NA 3E5QA 3V2GA 3I54A 1GPJA 3DHNA 3OIGA 2PKQO 4RPLA 5EL0A 1BWSA 1B0AA 1HSJA 2FY8A 3VH1A 3N7UA 3BJAA 3NUGA 4UULA 4CUKA 4EUFA 4BGIA 4BNIA 1NVMB 2CDAA 1T2AA 5FB2A 1NM5A 3PDJA 1LRJA 3GZ5A 3JV7A 2FPIA 4H16A 5LRRA 1DIRA 2Q1TA 1DAPA 4EVIA 5A9RA 1MC4A 1IN4A 1R36A 4G7ZF 2FMLA 1H5QA 1LDGA 3GAFA 4E21A 3V1UA 4NBVA 3FWZA 3HN2A 1ISJA 4R69A 4RPHA 4M6YA 1A7KA 2JKVA 4M74A 4PG4A 1U4OA 1QV7A 4DLLA 3HDYA 1ISIA 3DZIA 4O1MA 3E9NA 2BELA 2NV6A 4E70A 2Z3YA 2UXNA 1MGOA 5TRDA 1J59A 3RFVA 3WGQA 1MJBA 3ETEA 4J1TA 3F8NA 1D3AA 2GZ2A 4BO7A 4FX0A 3GN2A 3K73O 3OEYA 1O5IA 3UF0A 1P0CA 2K4JA 1UAYA 1TLHB 4BV9A 1GYRA 1JVBA 5THKA 2Y75A 4EJWA 2QBYB 1E3EA 1HRDA 3SQNA 4WCFC 3BJ6A 4TQGA 2PGDA 1QP8A 2EJWA 1YIOA 3AOGA 5JC1A 5ICFA 4CM6A 5C37A 2OAZA 4ALNA 5CYVA 1DLJA 3JQEA 1FWZA 3GO5A 5FF9A 2RHRA 3MJVA 3VPFA 4IM7A 4B7XA 4YYZA 2QQBA 1Y8QA 1X13A 1YRLA 2CD9A 4IRHA 2ZMEA 2E37A 2EKQA 4IDCA 3VKUA 1A72A 3NJ8A 4XYMA 4A2UA 5JHUA 2CUKA 3GLQA 3QHAA 1FMCA 4PLPA 2NVUA 4ONEA 4I5FA 4RGBA 4XZ3A 2DTRA 1A4IA 4BGUA 4F6CA 2VHWA 3PQJA 4CUZA 2P5KA 2GDZA 1U8XX 2P9GA 1GDHA 2WJPA 1DEHA 3DZGA 3IJRA 3MCVA 3E6DA 4J7XA 3MWMA 4P4NA 4XCVA 4AJ2A 1AXEA 5U9CA 1O3QA 2XAAA 3MEXA 1YO5C 2VYVA 2RQPA 4Y67A 1LC3A 1PL8A 2I3GA 3ZU2A 2FMYA 4L9NA 4UXNA 4D0PA 3LAJA 3RIHA 5FFXA 1V3TA 2NSDA 1G3YA 3AUSA 3NDRA 4B3IA 5CDTA 3U09A 4CDGA 3WGIA 1OYIA 3RKRA 4J0FA 1J5YA 4ITUA 2EKPA 1KY5A 2ZB7A 4HFNA 3PIDA 4WK8F 2X1HA 3PRJA 5JNLA 5AQ1A 1WZIA 1YDWA 4NFYA 1E3LA 3WICA 2VTDA 3WTSC 1TLTA 2V6BA 1FP2A 2XAFA 1HE4A 2JHGA 1A71A 5I7EA 4HF0A 3Q9VA 1V3VA 4E13A 4AJJA 3KP3A 2VHXA 2A35A 4ZA2A 4GWKA 4LG0B 1P45A 4YRAA 2AHRA 1EBFA 3ECHA 1N7HA 1X15A 4D41A 4AVYA 2Y1GA 3PFFA 3WG9A 1E5QA 1C0KA 4K9DA 4KUHA 1HYEA 2V7PA 3FM3A 3KLNA 3NAQA 3ZV4A 5JE8A 2ZXJA 4G6QA 4FN4A 2YX4A 1U2WA 5G0TA 4CV0A 3OOPA 4XLNF 3GVPA 1KU9A 4RB1A 4CQLB 1PGNA 1XMKA 3C8MA 3DBRA 5EINA 3ZWAA 4B4WA 4ESJA 3U4CA 5AVOA 3E9MA 4BUCA 4IPAA 5K6AA 1ZSNA 2G9WA 4HWKA 2OZUA 4OH1A 5F6FA 2M8EA 4M9SA 4RGUA 4BNCA 4Y17A 5CVVA 1LLUA 3BJOA 3DHYA 1E1LA 1E7RA 2GO1A 4I1IA 3BA1A 1V35A 3AK4A 1YJQA 4R51A 1DJQA 3P9IA 5DCMA 4M55A 4FFOA 2H6BA 3V2UA 4NPCA 1ORRA 4MVJD 4Y9DA 2OU2A 3V7CA 2E82A 4LFUA 2VOEA 3AOEC 3N58A 3PYLA 3RPUA 4JCOA 5CDGA 1TQIA 1HDRA 2BGMA 3FMSA 2VNAA 5BNTA 2XAHA 3PFIA 3ASUA 1A9ZA 1HW5A 2Q2EA 3LWFA 3FTPA 3GFIA 2WV0A 1A4UA 3DOCA 5ICGA 4WLVA 4CV1A 1HDXA 1XA0A 1Y8RA 2NU8A 3CUKA 4YQYA 1NQAO 4C7JA 3L4BC 1P44A 3MJ4A 3PK0A 4L8VA 1FLIA 3INGA 5TLSA 2MA3A 1PDNC 3STHA 5A04A 2Q4BA 3IC7A 4Y15A 3JQFC 3ERED 1NQTA 2PG4A 1HYGA 3DB2A 3EW7A 3PWZA 1SBYA 3ZV3A 4UVDA 2OP1A 2BFOA 2FOKA 4IXWA 2YSRA 5A5EA 4IXTA 5GMOA 2GA1A 3ZMVA 4WECA 2ZCUA 2CQKA 3JQAB 2C29D 2I67A 3RBVA 3GVHA 4Z0HO 2C07A 3E82A 3F5QA 3H5NA 2X0IA 1ZXLA 3NJ4A 4PZJA 1SMTA 3DPTA 3RI3A 4ND3A 1XSXA 3GW2A 1GADO 1MB4A 1W73A 3GNSA 2XKOA 4MJLA 2PI0A 3Q2IA 3TQNA 2ACJA 2IRWA 1ONOA 2L01A 2Q50A 3M6IA 1MGTA 1DDNA 3M2PA 3W4IA 3WMWA 4BQRA 1JA9A 4I5EA 1MJAA 2O03A 4WOJA 4E12A 2FRDA 3GQVA 5JVTA 4XBFA 3ROQA 4D3DA 3QVXA 3PJFA 3D3EA 2ZMEB 1X7DA 2EV9A 5JC8A 5KJFA 3QW2A 1NAIA 2GN6A 1DC3A 1F1ZA 3ZU3A 3KBOA 2DQ4A 3RUCA 1EVIA 3I0TA 2RAFA 3GC6A 4GGPA 5MDHA 2G5CA 5BNFA 3I52A 4J91A 2IP2A 3VPSA 1P0FA 3F5SA 3JQFA 4G8XA 3ZWMA 5DZSA 1P1FA 1RPNA 3F47A 3G79A 4XQEA 4YA6A 4E30A 4I09A 2YHUA 3QQPA 3HRTA 5ILSA 4KDPA 1H0KA 3EUHA 1HWYA 4Z0TA 4XRGA 4AJHA 3BYZA 1I3KA 3IS3A 4KMUX 4XYEA 4E32A 4OXKA 3R0AA 3I9OA 2XKPA 3LT2A 1AHHA 1NTOA 4ND2A 1SMYF 4ALLA 1DPGA 2W4QA 2GCGA 3QWHA 2PZMA 1YOVA 1MX3A 4FGSA 4E3ZA 2BI8A 4A73A 1OZAA 2E1CA 1I24A 1TXGA 2CWEA 4A6DA 1FDVA 4O6VA 1LC0A 4FC6A 1Y8QB 1W0CA 4YCAA 3QP5A 2AQHA 1F14A 1YO6A 4IXAA 3H2SA 4IGFA 1HBXG 1TW3A 2PH5A 1A9YA 1K79A 4AIKA 3LK7A 4GL4A 1P74A 4CL3A 2RKHA 4E5NA 1PJBA 1FX7A 1ON2A 1R00A 2GN4A 2FU4A 2L54A 3F4BA 3SLKA 1YQXA 4AIJA 3SFZA 5EQDA 4LLLA 3TDUC 4P22A 4G7OF 2HZTA 4DL9A 5DYMA 4TV7A 4WLOA 3BWGA 1BMDA 3LLVA 4KDEA 1H6AA 3FXQA 3PHHA 2FEZA 4KN4X 4I9NA 2CVZA 3OMLA 5FI5A 3F1LA 2F2EA 4LLNA 2VZ8A 4LG0A 3DV8A 5LBQA 5HOOA 1QG6A 2Y1DA 1NQOA 3Q1LA 3ZMUA 3EQLF 5F64A 2OQGA 1XGMA 4WXCA 2ZTUA 4HOBA 1KVTA 1U8FO 3GZ6A 3MOGA 1ZAOA 1U3WA 4NJOA 3I58A 1B7GO 4NR0A 3CE6A 4J7CA 4A0XA 1LDYA 1J49A 1IHXA 2L3DA 1PGPA 4OMZA 3PIIA 1RYEA 4FGWA 5G0VA 3WLFA 3QP6A 2IXAA 5C3MA 4OQYA 1KEWA 4BGVA 4HNHA 1DHTA 5EMHA 5LEKA 5ILUA 1F4KA 3ITDA 3ZPLA 4KQWA 3KSZO 4PIVA 5K0ZA 1K89A 3I4CA 2H94A 2PTGA 3OECA 1H6DA 3PLRA 3KLMX 3T8TA 1IZ1A 3LA2A 4KZPA 4NH4A 4WCGA 3SXPA 3UCXA 1BSVA 2H09A 1PUEE 4IJWA 5KK1A 3IC5A 1A7AA 4Y6RA 2O50A 4ALIA 4XSZF 2W8ZA 4HA8A 5LHGA 1MG5A 5LGNA 3FNEA 1Y9AA 3NGXA 4MIEA 4OSOA 2OHXA 4N54A 4TVBA 4P9UA 3R3JA 3PQKA 4LVCA 4NZ9A 1UAGA 5EEHA 4GVLA 3VOEA 5KVQA 3WQQA 1W4ZA 1B26A 4A10A 1LLDA 4TKMA 2MBFA 2PGLA 2IZ0A 1P4AA 5L3DA 1C0PA 3NX4A 5EIOA 4XSXF 5L4NA 1MUUA 3KSUA 4DA9A 2FPPA 5KTKA 5GZ1A 3RUEA 5CFZA 3PPIA 1DJNA 1S7OA 3MZHA 4IDDA 1ULYA 2VYVD 4J0EA 2QYOA 1QMGA 4XB2A 1LQUA 2AEFA 3GUYA 2EK5A 1Z7EA 1K78B 3PWKA 4UVEA 3FXUA 3GFLA 5EERA 2IA2A 1CDOA 4J3FA 3TOXA 1W4MA 2PFBA 2IJLA 3WGHA 4FDAA 5BQFA 4G94A 2VOJA 3JQ7B 5TJ9A 1ADGA 3I23A 4GX5A 4WCDA 9LDBA 1UHMA 4KNYA 1Y8RB 3SZTA 5FD6A 2VT3A 1WVGA 4UUPA 4WLEA 5DBGA 1ENOA 2PWZA 4IDAA 1TB4A 1R0SA 4Q3EA 1YLFA 4IF4A 1I1SA 4WKGA 5G4KA 1E6WA 1P1KA 5IZ4A 3O8QB 1QYXA 1FDWA 1BW9A 1XELA 3JD3A 1FK8A 3LLSA 4BL5A 4DXHA 1B9NA 2ZFWA 2ZO4A 3PTZA 3H3ZA 4GGOA 3WYBA 1LB2A 2PY6A 1S8NA 1T25A 4HKTA 1R4NB 1TT5A 1C0WA 4ESFA 2CZCA 2IE0A 4D44A 1EH7A 4G6DA 1VKNA 3VH2A 2XROA 5L95A 1BC8C 4S3MA 5ILOA 3GG2A 4J4HA 5IN4A 3G17A 1DPUA 2AA3A 2MH9A 2A5YB 2Q1SA 4HLYA 4M54A 4J1SA 2NAZA 5AIPA 3LQFA 5T8KC 2KIFA 1VPDA 4BNTA 4ENJA 1T2DA 2AW5A 3DTYA 3JD1A 4IJKA 4Q3AA 4AJ1A 2BHLA 4Z3KA 1PJ4A 3K0LA 4LB6B 4BHCA 4IBOA 4CUJA 4K1LA 3WSVA 6PAXA 3NRCA 5CJ9A 2HWVA 1K0UA 1PWXA 2PV7A 1FT9A 1DC4A 1KETA 2Y68A 4ZRNA 4EDFA 1ZMTA 2HRZA 4D3SA 1ENPA 1WDMA 3HHHA 2DTXA 3H65A 3ULQB 3U1DA 5F1RA 3COAC 2EHDA 4BNHA 5IZCA 3I59A 4K2EA 5LLQA 2FNAA 2RBEA 3HRUA 2GASA 4OU0A 1K3TA 3PLNA 4I9HA 3WBFA 2YDXA 2XUBA 5D8LB 1ZK2A 2FBKA 1Q1NA 2YV3A 1JW9B 1KVSA 1UZMA 2GQQA 1BRMA 2DVMA 3TRIA 3RUFA 3GVAA 1ZW1A 2HK8A 2V1XA 2VN2A 1NFFA 2YUTA 1ZREA 1ISHA 4HNGA 5KOIA 4L0YB 1HLDA 2MLGA 1PQWA 2P5VA 2PQ8A 4Q3NA 3WJAA 4BNMA 4CMEC 3WS7A 1BC7C 3D5LA 3WTXC 1VM6A 5CG2A 1YS6A 1C0IA 4P38A 1ENYA 1HF3A 4XRRA 2EWNA 2PNFA 3GR6A 3RIRA 3PQEA 1MD0A 1KQ8A 1SC6A 1FBUA 5IT3A 2QM3A 1MV8A 2C7GA 5DF1A 2G17A 3ONFA 1DIAA 4QQRA 5GY7A 2E7WA 4EM0B 4JJIA 2GIVA 2VODA 5FEUA 1CRWG 2YQ4A 3UUWA 1BXKA 1XDWA 2JD0A 3PWSA 2CSOA 4MOWA 2VBWA 4HV4A 2Z9OA 2JPCA 5L3ZA 3CJNA 3G0OA 3MCZA 5B12A 2C20A 1ML3A 4II3A 3JYQA 1JE8A 5ICCA 3FBTA 3R0IA 5JDCC 2EGHA 4IPTA 1CWUA 4PRKA 3CSDA 1R12A 2YR2A 3NKLA 4E5KA 3JQ8A 1TNSA 3KYBA 1DRUA 1TNTA 3AM3A 4WLUA 5AIQA 4CR6A 1YQDA 1UXHA 1EK6A 1XSEA 3OP4A 4GQAA 4B8XA 4YJHA 1C1XB 3WGOA 5KVSA 4DPKA 1LLQA 3K92A 3KE2A 2WYUA 3BROA 2BLLA 2ZB3A 3B1JA 3JAMK 4K28A 3UH1A 2BFPA 3V5NA 2E6UX 4KTVE 4GLLA 3K5PA 2PEXA 2RHCA 3SBOA 3L09A 1EVZA 2ZJ2A 3R1IA 4NMHA 3LAPA 3VC7A 3HHGA 1H6BA 1RM4A 3AI2A 4BKPA 3DOOA 1I27A 4D45A 2D4AA 1DLIA 1GPDG 2Y1OA 2DKNA 3PHIA 3S2FA 5L7WA 1VI2A 4QLCU 5BR7A 3I71A 4N5LA 1REPC 5B37A 2D2WA 1SFXA 2GNAA 2XVCA 2VONA 2ZJ1A 4FJ1A 2X22A 4XYBA 2PLYA 1R15A 1SOVA 4I0BA 5F5LA 4HZFA 1ZG3A 5JMPA 1DDOA 2R00C 4I5DA 3FXRA 3F4LA 4YFKF 1SEVA 5JR3A 3S1LA 5DCUA 4DQXA 1NP3A 2O0YA 4DPMA 3O3KA 1IUYA 2J3KA 4G65A 5HWSA 1WDLA 2QUFA 3GF2A 4TSKA 4OIRF 2JRTA 4YT2A 2P6SA 5B4TA 3GUDA 3VODA 1LJ9A 4XJSA 3I4FA 2RH4A 3EUWA 4J1NA 3ZU4A 3P9KA 5A06A 4ZQHA 3DXFA 4UVGA 3ML6A 3GHYA 3PI7A 4DTIA 5LRSA 4L76A 2F5DA 3L9XA 1SO8A 3V7RA 1PZEA 1BDBA 4J9UE 4U8GA 3UFXA 3V2HA 4ZICA 3PHJA 2EKLA 1R5HA 1QYCA 5L53A 3TZCA 3U9GA 2X4GA 3LT4A 4UUNA 3KXDA 1BN5A 2Z1MA 4FOOA 4URFA 3GY0A 3NYWA 8ADHA 3L6DA 5JYDA 1R22A 2HOEA 1RUOA 5FI3A 2KKOA 2AQKA 4O5OA 3MJEA 3RVDA 2WTBA 4UEOA 3JQ7A 1R5GA 3TZHA 4TZTA 5DCMB 2P5YA 2Q2QA 4GLOA 5E17F 2JTVA 1DB3A 3WTTC 1HSZA 1I2ZA 2VHVA 1P33A 4ZYGA 2PN6A 4QUKA 3ETGA 4W99A 5BPDA 5A3JA 1N9GB 1GL3A 2YFQA 1WKMA 3A14A 3PDUA 4L9JA 1P6RA 2BE5F 4E33A 1RNLA 1IZ9A 2V65A 3CIFA 1MFZA 1N2SA 3GWZA 1D1SA 4NQZA 2COMA 3FM5A 3LQRA 4BVAA 3DAPA 3F6VA 4UHTA 2VUSA 1GR0A 1GQQA 2X23A 3RJ5A 2IZ1A 2VWQA 2VXZA 1ZRDA 4M1QA 1W7PB 3WODF 1KU2A 2XHKA 2NM0A 3JQGA 4XR9A 4HF1A 3ABUA 1XG5A 5KNLA 5DDGA 3RWBA 2BYVE 1QKIA 3TO6A 4R54A 3EDMA 1V4RA 2EFPA 1LDBA 3PEFA 1P92A 3RUIA 2WD7A 2OOSA 4NBTA 2LSOA 1HDCA 2EB7A 4I9UA 1XDUA 5COAA 4CLXA 4Q48A 1O3TA 2ZNYA 2YQ5A 4L9RA 3RU7A 5EEGA 4JJGA 4YACA 5D4RA 3BTSA 4CM5A 4RS8A 1F9NA 1LEHA 1GYQA 4LK1F 5JAMA 4J7UA 5IF3A 2L4AA 3WR5A 3FN4A 4BO8A 2C2XA 3P5SA 2E7XA 5TX7A 5JMWA 4R3NA 5H6RA 2BD0A 4CM8B 4YR9A 2GWRA 1JQBA 1QPMA 1PSDA 4BKOA 3AI1A 1AGNA 4K6CA 1UXIA 3E6AA 1GD1O 3D3WA 4EYEA 2D1YA 4XLPF 3G1TA 5T64A 4G5HA 4E5MA 1UR5A 4E5PA 2V1UA 2ISZA 1E1NA 4GO1A 2G76A 2GF2A 3H3JA 3WX0A 2EJRA 1XN7A 2VE9A 2ET6A 1HKQA 3I9JA 2STTA 2XPCA 4WEOA 1J0XO 1PQPA 4XEHA 3V8KA 2IDZA 5G0UA 4CV3A 5K1YA 4ALJA 2NNLD 4KIFA 3IRRA 2O2SA 4CMBA 2RVCA 1KYQA 1O57A 1Y0UA 2HMVA 2QX7A 1FYLA 1A04A 4CMAA 4R79A 3E1KA 4MVJP 5HVQC 1HETA 3K1NA 3CO6C 3HIFA 2FF4A 1XLTA 3VAZA 2Y93A 3GF4A 3R6SA 5D5UB 1UP6A 3NTRA 4U7BA 4GMFA 3I9KA 4CLEA 3AJRA 3NRVA 4E4YA 4EJ6A 1LEBA 5H82A 1IF1A 1PGOA 3ROPA 3S8MA 5K5QA 1E3IA 3I9LA 4D0SA 3INTA 5TRTA 2GZWA 1QZZA 1U5TC 2B5VA 5DUKA 4DMLA 3WNQA 1ULSA 3PQDA 1XWFA 3GZ4A 1EZ4A 2A94A 3H3FA 4J49A 3WIDA 2NRAC 2J3IA 3H6KA 1Q0QA 4GWGA 4OGWA 2BRUA 2BGLA 1GAEO 3DBHA 1UFMA 3RUAA 1EDOA 1GHCA 3BMNB 1FDTA 1B14A 3L0DA 5JDIC 3ITKA 1PZFA 3GK3A 2OZPA 2NYXA 2Y05A 2HTJA 1O9BA 1WW8A 3CMCO 3ONEA 4I01A 3WGTA 3QVOA 4PLHA 3ISPA 1BIBA 3C7CB 3ZNPA 1PX0A 4OOFA 3U4IA 1UZNA 3CO7C 1SD7A 1O6ZA 3RYRA 2O3TA 3PFWO 3QLJA 1FXSA 4KMSA 3S2EA 2C5AA 2MC3A 1CJCA 4E0BA 1ARZA 2HR3A 3D3WB 3QSGA 2PMHA 4OAQA 3HDQA 1E92A 3T4EA 1FNNA 2OBPA 5ES3A 2EA2A 1P4WA 2Q8KA 1H94A 1X1TA 1SD6A 4BMSA 5D6EA 1LDNA 1T1RA 4ASNA 2DU8A 4J4BA 4UVCA 2Z33A 4UAGA 2GAUA 4II2A 1EVJA 2P4WA 3INRA 2O6GE 1SZJG 2X0LA 1ZK3A 1LSSA 3WMXA 4AJEA 4Q39A 1H9BA 2JD2A 3GDOA 4AIHA 3GEZA 4G2NA 4B3JA 4CLRA 5I8WA 4L5JA 4ENMA 2W2KB 3GN1A 2AXQA 3ROKA 4YT5A 2NS0A 1GZ6A 1BGVA 3BPXA 3M2TA 1P9LA 4RVDA 1DO8A 4KWHA 2B83A 3UW3A 2HKOA 3WQSB 5JAZA 1HLPA 4BGEA 1IN6A 2VRCA 3GEGA 3RC9A 3ZP5A 1P31A 4IIUA 4FFMA 1D3YA 3D1LA 4NBRA 2A69F 3ZWVA 5L4SA 1G3TA 2F5EA 2FXAA 2BF7A 4CM4A 2J5RA 3RYPA 4B8WA 1LBEA 5BSHA 1TI7A 2QBYA 1M6HA 3TNLA 4L9TA 3TN7A 3E18A 2XV4S 4EJMA 2IEDA 5DNAA 1H9GA 4RVHA 1KQ9A 1LSOA 1EE2A 3V4GA 3IHUA 1ZVMA 3C24A 3FNHA 4RVUA 2PD4A 3KB6A 2FA5A 1U5AA 3UCEA 2ZCVA 4N18A 4CMIA 4RF4A 1MZBA 4MKXA 1T0FA 3D0OA 4LVUA 3DEYX 3EZYA 3QWFA 4TZKA 5COBA 3B02A 4BO9A 2F5FA 1E2XA 5LHIA 2L02A 1LQ1A 3IP3A 4P4LA 2B35A 4U7WA 2HMUA 3K1PA 2ZJ0A 4J9VA 1H9TA 3HJAA 5CEFA 4CLOA 1JHHA 4CLHA 3VZSA 3IWFA 2O61A 1FSEA 3OV8A 4GCVA 2YX7A 5ADHA 4EM1A 1LDDA 1CETA 2J6IA 5JAQA 2HGCA 3LVFO 3I64A 4CLOB 4FJ0A 3RJ9A 1LDEA 3EYYA 4IQ8A 4B3HA 4CM1A 4PN3A 4EUEA 3COSA 5HS7A 1NR7A 5A9SB 3CEAA 4IVNA 1HDZA 2FRHA 3G73A 2GLXA 1R37A 4PGFA 4LD5A 1YOVB 4PG7A 3WOHA 2IYPA 4TWRA 4U6QA 4D43A 3FX3A 2IT0A 1VL0A 5FLXZ 3HNPA 3OJOA 1B8VA 2Q1WA 2D5AA 2W2LA 5T6BA 1U3UA 1Z6TA 2NVWA 5LCXA 2DLDA 1EVYA 2NNNA 2OGUA 5LC1A 3OQ6A 4MVJE 3DKWA 1IUKA 1L0OC 3DF8A 2UXXA 1IULA 3C7AA 1YKFA 2M30A 4EGYA 1UP4A 2B5WA 3UKOA 3VPGA 3GAZA 1UDBA 1BOAA 3JSPA 5CVJA 1ZJYA 2XOXA 3KYCA 1EDZA 3R60A 1GCUA 4D46A 1AXGA 5F21A 3E6MA 1O7FA 3ZWYA 3JQ6A 5TIIA 2RGVA 4HAMA 1OR7A 3SC4A 3WFIA 1IXRC 3AI3A 3RBXA 4D0RA 1Y9EA 2BFMA 1BW9B 2P2SA 3FF5A 1EUCA 2EWMA 4LCJA 4E2ZA 3H3UA 1O3SA 2EP7A 1N1EA 3PJEA 4W82A 3Q9SA 4ZYHA 2P9EA 4TROA 4OIMA 4L18B 4BMNA 4KN7X 4UEJA 1L1FA 3BTUA 3V1YA 7MDHA 3HOTA 1USTA 3LQQA 3ONDA 2WD7B 2IYOA 4RDIA 3DC2A 1VL6A 2QIOA 3RDIA 4MP3A 4TRRA 5D5VB 5CG1A 3LF2A 2IEBA 3ZNOA 5BSGA 4ZU3A 2D45A 3BP8A 1GEEA 2GR9A 1CYDA 3FR7A 4QT0A 5AXDA 3ZWBA 1RM0A 4HUJA 2A68F 2WC2A 4M72A 1ZG1A 4XD2A 5FLXK 1Z45A 1H9AA 2NADA 3C18A 2W2LD 3OA2A 1QYVA 4MIYA 4WLFA 5I9MA 4OMYA 1TTYA 3I6IA 2V9VA 1FF9A 1OFGA 3V8LA 1KGSA 2HO5A 3E5RA 2K7LA 1BI3A 2DC1A 2VHZA 4R16A 4KFCA 4DC0A 4QSMA 4KUGA 2MD5A 4FIZA 1SEPA 3PHLA 5BOXA 4HV6A 3BDDA 4F3YA 5JCXA 3UICA 3AM5A 4CR8A 2UYYA 4H3VA 4TRNA 2R7FA 2O23A 1PR9A 3JCZA 3WYEA 4PRLA 4NBWA 1U5TB 4RCVA 2H6CA 3LFKA 2ETHA 4U5QA 3DR3A 3FNGA 4I7HA 4EZBA 2E1NA 1HDOA 1YONA 2GN8A 4PVCA 5EESA 3RTRA 2VNSA 3WTWC 4YXFA 3J80Z 2ZTVA 1K78A 3U9LA 1KIFA 4EJVA 3FBGA 4R9SA 4TMFA 5L51A 3O38A 4KWIA 4NI5A 1Y1PA 5AONA 2PK3A 1ONVA 1YW9A 4QWQA 4L73A 4PZEA 5KWEA 1XKQA 3SJUA 1LDKB 1RKXA 1KYZA 1B8UA 1Q1HA 3JQ8B 3K8ZA 4PLVA 5IDXA 1GQ2A 4DLBA 5JDIA 4OYRA 3ZHYA 4BXUA 3TOAA 5E20A 2VWGA 1QGPA 2VC0A 1T1SA 4I02A 3EYIA 3FMQA 4INAA 4LK0F 5A2QK 1XGOA 1DSSG 3A9WA 4LCEA 3VPXA 1LDMA 1GYPA 1G3WA 1LRKA 3CPSA 3TSCA 1XMAA 4YBZA 4CLDA 1I33A 2AEJA 3ADOA 3Q6IA 4UVHA 2WD8A 2DPHA 1I30A 1N8KA 3AM4A 3K2BA 3P7MA 4TVOA 3GT0A 4KIGA 2P7CB 3IUPA 2BV6A 4MHGA 4JK1X 4BNVA 1Y5RA 5I9LA 1G1AA 2J3HA 3TKYA 1NFRA 4BO3A 3RKXA 4ZYDA 1ON1A 2RV8A 4E6PA 4JJFA 3JTHA 2YV2A 1R0KA 3AFMA 2LF8A 3WB9A 1S7AA 3BY6A 1ISMA 1P3DA 3FRJA 1ZK1A 3PGJA 3NGLA 5TJJA 3FNFA 1F5TA 1LNWA 5AYVA 3DO5A 5J23A 3E3VA 3BHMA 4BHPA 1EV7A 3WU1B 2YHIA 1E77A 1W8DA 3LSYA 1HKSA 2VBZA 3S2WA 2HJRA 2QLZA 2P6TA 3L07A 1X7HA 3EZLA 4WE3A 3SXYA 3ANNA 1Q7CA 3FCOA 3GVCA 3UOGA 5FGMA 4Q3CA 4NJMB 5EPOA 1ZCJA 2JFHA 2R2GA 5DUIA 2JCVA 4ZYEA 3IUSA 3ZU5A 1YH3A 1Z91A 4D42A 1MC5A 3Q9NA 4WLNA 3QVSA 2XF8A 2Q4EA 3P7NA 4QXMA 4AJIA 5JO0A 5E8GA 4E2YA 1P1IA 4E31A 2RDPA 2AE2A 2X4HA 4IRGA 3JD0A 3MJTA 4MVJA 3MQ0A 3F9IA 2Q0OA 2WE7A 1PJ2A 4GX0A 1E7YA 1E3JA 1OC2A 3K9QO 5TC4A 3WWYA 1TT7A 2FZEA 2A4KA 1S7CA 5HA5A 1HW2A 1M6WA 2ILTA 4IRIA 5KCZA 5G0SA 4G9YA 3VVBA 1L7EA 4LGWA 3NQOA 3ABIA 2A6HF 3KZZA 3GGOA 1IN8A 4ZVVA 3VEPA 1UXKA 2J5OA 3K31A 2PJPA 2O8XA 4DYVA 4RLSA 1XHLA 5EN4A 3H9JA 5HBRA 4G81A 1P77A 3TJRA 1YXMA 4DGSA 1N9GA 1UH5A 4UVIA 2AQ8A 3HB4X 4AJLA 2P68A 3RPQA 3V7SA 1O0SA 3NEPX 4BNLA 3LC1O 4WGGA 1EQ2A 1E6EA 1PGJA 4AWXB 1YL6A 2W25A 3I5MA 3DP7A 1JWAB 4LLGF 2ZIZA 5CDYA 2F5CA 2EV0A 5MGBA 3KSDO 4NFHA 3GDGA 3AY3A 4KICA 3TPCA 1FP1D 3IDSA 4XYLA 1ZHFA 1R58A 4J90A 1ONNA 5A9TA 3OJ0A 4XGKA 3RSHA 4LB5A 3RI4A 1BI1A 1HL3A 2D59A 4ND5A 4ZQGA 1JAYA 2I99A 4NJMA 2WE8A 2A07F 4U0VA 4CM9D 1IW7F 3VZRA 3OIDA 4BNFA 3ZWXA 1GU7A 1ODDA 5E1XA 1UCRA 1PJQA 1JHFA 2GD1O 1YFHA 1T26A 1EFLA 1Q0HA 1NHGA 1R23A 3GPIA 2EIHA 1RUNA 3C85A 4XQ9A 5DOVA 5DOZA 4UVBA 3HRSA 4IZHA 5AOVA 1BDMA 4L74A 4ZQBA 4CMGA 2WYVA 3AWDA 1LX6A 1ONPA 3F6YA 2FR8A 3GRKA 1KEPA 3KZYA 2P7VB 3KM0A 2VBXA 4FQ8A 3WNVA 2DU9A 4FS3A 2ZCWA 2FPGA 1EH6A 1DUXC 5DBIA 4DBZA 1J0RA 1PS9A 1ZRCA 1NPYA 1DOHA 3M7GA 1VJ0A 3TFOA 3NT4A 1G6KA 2JPBA 2V79A 1W6UA 1SCUA 4W6ZA 3TFQA 1I5ZA 2DFIA 4PCQA 2QRKA 5LDGA 2Z99A 2QG4A 2YY7A 5TF4A 4EI2A 4RORA 1E6UA 5LHHA 1KVQA 4IZIA 4X54A 2QWWA 1IXCA 2DTEA 4KMFA 4YT4A 5T5QA 4HADA 1BJAA 4HX8A 4YFNF 5KJEA 2V6GA 3LYLA 3DMTA 4RZHA 1Z7UA 3H92A 1U78A 4CZZA 4L0ZB 2BKAA 2JD1A 1B59A 1OMIA 3H2ZA 3JD4A 1TQPA 4U0KA 3JSAA 5L40A 2PZLA 3F6OA 1KS9A 4LMPA 1MXHA 3ZV5A 1RI7A 3CTMA 3KUXA 4U0WA 1XSVA 1B15A 4KUEA 3SZPA 2I3AA 1I2BA 4RDHA 2PD6A 2HAEA 4O5VA 4MPDA 1SFEA 1LI4A 3DBVO 3F46A 2IRFG 4NK5A 4CMCA 1IRFA 2DPUA 5KKCA 1WZEA 1LSJA 1FPQA 4RGRA 2QYSA 4LK3A 1IOLA 5G0WA 5B4VA 2HQ1A 4RVFA 3OJEA 4A7PA 3QU3A 2TDXA 4ND1A 4B79A 5CEEA 2PZJA 3TGNA 1IAWA 4I8XA 3C7DB 4BHTA 1J9IA 2PGJA 3Q3CA 1ZK4A 2BBYA 4HX7A 1JWBB 3VDQA 4B4UA 4WOKA 1LSUA 3HHPA 4WNCA 4YDRA 4YTEA 3UHAA 1TQMA 2OBYA 2VTEA 4IY1A 3WGYA 5BPIA 3KTDA 4CICA 3WSWA 4YRBA 3ULKA 3VKVA 4FFRA 1CGPA 1KQ0A 2A6EF 2D1HA 2EA4A 1ADBA 1Z1DA 3H5RA 3OIFA 4GVXA 4OMUA 4XKJA 5GZ6A 4B8ZA 3GGPA 1YB5A 4MVJM 2Y48A 1GY8A 3X2EA 1FYMA 4M6XA 2R7DA 1WPQA 4QO8A 3H9EO 3DL2A 4XYGA 4Y6PA 4J16A 3SHFA 2VYNA 5JFRA 3BPVA 1P1HA 3ZHBA 2EXXA 1U4SA 2JAHA 5EQFA 1PR3A 4LISA 1PJCA 5HS6A 2EFQA 2BGCA 1YDEA 3IJPA 1E3WA 1KVRA 3F21A 5ER6A 2Y0MA 4Z9XA 3RU9A 1UUFA 4Q5SF 4GSLA 2JHFA 3K2ZA 5COQA 5JW6A 2QQAA 1S6YA 4B09A 4AFNA 3WTVC 4MDHA 1T6SA 4RGSA 2XIGA 4M71A 1ZH8A 1KYWA 3TL3A 3WLEA 1OMOA 2EFNA 3D64A 3OFSA 4JBGA 5KIAA 4NHEA 2UZKA 2YDYA 4ZGWA 3OQBA 5IG2A 1R1UA 5C7OO 3UCFA 1HQCA 3F3SA 3VB2A 1ZSVA 1BM9A 4ZH4F 2YV1A 3CZMA 3OJFA 4NG5A 3HDJA 3SX2A 4ALMA 2B36A 2Y1CA 4RV9A 3GG9A 1DFGA 3TO7A 4RF5A 2W24A 1HT0A 4Q47A 4ZZDA 2P5UA 4U0JA 3CUOA 5AXAA 2VN8A 2JAPA 2Z5LA 5TGDA 5LGTA 3WTBA 3BMOA 3BHJA 2JL1A 1HE3A 3DWFA 4LRSB 3F8BA 1OYYA 1HYHA 4EBFA 2KIMA 3OF2A 1G6NA 1QV6A 2OL4A 1NPDA 4EJ0A 1FBQA 4CV2A 1GZ4A 2X9VA 3IKTA 2F00A 3MTGA 1WRJA 3O9ZA 1HXHA 1KEVA 4DC1A 1Z82A 1OBFO 1ZXBA 4RPJA 2XXBA 3K30A 1JDJA 1FY7A 3N74A 1YE3A 2QRJA 2FSWA 4PLGA 1WNTA 1M66A 3B1KA 3T7CA 2XGXA 2Z5UA 5ILVA 4MIOA 1W5TA 3TOZA 2XRNA 3DAFA 3QVWA 4A6EA 3GNTA 1HEUA 2CDCA 2O3RA 3WXBA 2Y0CA 4IGEA 4AJOA 2NWQA 2DQLA 3TZQA 1FBSA 1R4NA 4CO8A 1O94A 3ZMTA 2HQNA 4R8HA 5CP8A 3BMCA 2OFPA 4JROA 3T0YA 4OO3A 3RASA 4AJNA 1BVRA 3AY6A 1I1GA 4YQZA 2G7UA 2XXJA 1Z9CA 4EUHA 4EJUA 2C82A 3I9NA 3O4RA 3AW9A 1ZJZA 2HQRA 2OO5A 2MLKA 3DZBA 3LZ6A 2EFWA 3I4PA 3I6QA 3ZN2A 2KIUA 4EQQA 4OIOF 4EGFA 4BH9A 2RNJA 1I0ZA 4OXNA 1VRWA 4GX1A 3HSRA 4S04A 1OOEA 1NVTA 4WPGA 1HSOA 3ZH2A 4OM8A 1U7HA 4RO0A 3VOSA 4A5OA 4MEXF 2ZK7A 3V8JA 1EQUA 4W9NA 1ADFA 1SOWA 3HRMA 5DV5A 1Q2XA 3AAFA 4BMVA 4AJPA 1RZ4A 4WCFA 4HX4A 4WF2A
chains in the Genus database with same CATH superfamily
1E6LA 3P19A 4QPQA 1BD4A 2B3DA 3S93A 1BXRA 3O5AA 1Z05A 3OUUA 4GP9A 4HAVA 4OGLA 4PTZA 4Y0NA 4TZ0A 2Z2XA 3FWKA 4L3VA 1I2MA 1TA0A 2YXBA 1C7QA 1FNBA 4A8HA 1MMDA 3ETDA 3BIOA 3OOYA 2WUEA 5FOUA 4GKKB 5EZGA 1Y6FA 1TQDA 1SULA 3C2BA 4DSTA 5IJAA 2QE7D 3PQ7A 3N59A 4TRMA 1N0IA 3TD6A 1KPHA 4MV7A 1ZMOA 3VTZA 3VVMA 5HKBA 2EG5A 2RONA 3D2BA 5FUWA 2CXRA 2UUZA 1YJNI 3M9WA 5FL7A 2ISQA 2O4UX 4HSRA 2R1TA 1THGA 2VJNA 3SSOA 4DBQA 2DZDA 4F8JA 5IJ9B 2HYIC 1DV1A 1R3UA 2FX2A 2YWXA 4ID9A 4B0PA 2JT1A 4BQAA 4MJ3A 3BMCB 1WDKA 4MDFA 3W2GA 1F2VA 4XIDA 3NTQA 2CDBA 3LVQE 5BMVB 1NULA 1W1WA 1FFYA 3MBOA 4P9FA 2CKDA 4DADA 4YJDA 4WGFA 3EXHC 2QX8A 1AM4D 4XICA 5DEOA 5JYEA 2CHQA 3CXRA 2RHJA 3E05A 3GV0A 4PAWA 4Y2GA 3TPFA 4FISA 1N9ZA 1RJGA 1QCCA 3KLOA 3CC2I 1KEUA 2D8AA 4AIIA 2AEMA 1RI2A 3T9BA 3F8MA 4BRWA 3MHTA 1LJLA 4NU0A 5E4YA 1FP7A 1SRQA 1S8AA 4CZCA 2UV8A 4FEYA 4KXYA 4EHKA 4IEIA 4RPKA 1EK0A 1HDGO 1LRLA 3MS4A 5KOYA 3HGGA 2OVFA 4X6YA 3ISVA 4A0SA 4EJTA 2WSMA 4C4YA 2A9KA 4M1MA 1OU0A 1KNQA 3WHKA 1X92A 3QAHA 4V0MA 2DBBA 2YYYA 5C35A 4BX0A 4M1YA 5FI1B 3MUOA 5IM4A 2GJSA 5F12A 5LXTB 2ODWA 3TTVA 2JUCA 1DC6A 3I34X 2CFSA 1TC2A 4NJEB 3E5MA 2HJGA 1O89A 1OA0A 2NTNA 1F8GA 1RQXA 2W98A 2DODA 3I2KA 2PRKA 2FBHA 4Q4ZF 2HMYB 4P32A 4R1SA 4CW7A 4CCKA 1S2MA 2AC7A 4IHJA 4H7KA 4EW6A 1S9DA 3A9SA 5B3KA 1JB1A 3SQMA 2VC1A 3IP1A 1LVAA 3OLQA 4JLMA 1ZKMA 3GARA 1MG0A 4AVPA 1N6HA 4CCNA 4HHEA 4XWTA 5DT9A 1CUGA 4ESVA 3HTXA 3TD2A 3D8TA 3WAKA 1K88A 2SECE 1G4DA 1JHDA 1LVUA 2HLPA 3G23A 1PJ8A 3HCNA 3JAWA 2W6OA 4FNGA 4LNAA 4MRVA 4E5VA 4OINF 4F9TA 4H2DA 4LMYA 5HFJA 3M1IA 4IRXA 4G0WA 4ZVPA 2ZRBA 3FMFA 4N4NB 2AOTA 2LNBA 3QEJA 4U2EA 4L0QA 4O2BF 4BDSA 2R8PA 1ZICA 3DFZA 4BYYA 3IAHA 2K9LA 1PEYA 1VG1A 1I3NA 3CF6R 2FQ4A 3NWSA 2M1XA 1TEHA 2PL1A 3Q3GE 4S2EA 3WMFA 4GM4A 4G4IA 2DQRA 3ADPA 5G4LA 4IQ0A 3L2CA 3PENA 4FE3A 4C7KA 2AS0A 1PHPA 5E3IA 1MV5A 2OGWA 1UWCA 3DTTA 2JLSA 5BQTA 3LG2A 2L7FP 1PDVA 4GXQA 5BQPA 5LZ7A 5DTRA 5U4XA 4D9BA 2FCAA 1JI0A 3VSLA 1FXUA 1O58A 3AF4A 1XTRA 3WIVA 3FZVA 3IQXA 3E81A 4BQEA 1X80B 3HSKA 1WI9A 3R3XA 4HLXA 2HA6A 2QY9A 4U6SA 1DDIA 2HPMA 1L8OA 1YHNA 3E0QA 1UQUA 1F1JA 2PJZA 3G9TA 3QYJA 2HVSA 1QVZA 4GU5A 4WESA 3N39C 2JFXA 4XQGA 2PJUA 1U6GA 1D6SA 2DTDA 2J4DA 4LZNA 4Q4AB 1DBVO 1Z4MA 3ZGYA 3U44A 4AF7A 1R4MB 2ZBQA 1ZONA 2FUG1 4MFEA 2VQ3A 2W0MA 1TT5B 2GZ1A 3VR4A 2CCKA 4IWNA 1C4XA 4QGBA 1QLJA 3HU2A 4G0MA 2Q99A 4QGSA 2R5NA 3KKNA 1U0FA 3PWTA 4TVKA 2C84A 1JPUA 3IQHX 4S0ZA 4OAOA 1QSGA 1E1MA 4PFSA 2GJ9A 4MQEA 4A3JJ 1YB1A 5HM8A 4LQCA 4HZUB 4ZXFA 2WWGA 3N6XA 2XB6A 4QJIA 4MIKA 1NBEA 2LY2A 3MJHA 4KXUA 3A9VA 1ZUD1 5A4DA 3QPVA 4L4YA 4FGUA 4O63O 1J8FA 3TRKA 1ZFNA 3C3WA 1GXSB 2LP4Y 3S2HJ 2CVQA 3IIKA 3D6UA 3HNOA 1AKMA 1DUSA 3LVRE 2BMEA 4UB8C 4Q12A 4A6XA 3BL6A 4WRRA 2JUGA 1A5ZA 2D1TA 3AZOA 4GOLD 1ID1A 4XB6B 1HM5A 5T8KA 4WBNA 1QZTA 2HZ7A 3CCFA 1CQJA 5LYJB 1XDSA 1K2WA 1I0IA 3BL5A 4ROSA 3J80K 2H1HA 3BMQB 3IMCA 3THXB 4FOSA 4OU4A 4A5NA 4ZAXA 4MVWA 1EM8B 1SAUA 2Y1WA 3WO0A 5B55A 2VIXA 1O08A 2Y99A 4NBLA 2DA7A 1KMIY 2RKBA 4XH9B 3T9CA 4C6TA 4YWJA 1GN9A 5K6AC 3S68A 2P4HX 1PW5A 4B2IA 4E94A 4A0QA 1SWWA 2BEVB 2JDID 2GVNA 2ZXWH 1WQ4A 4I9FA 5JZ9A 2R7QA 5AM3A 4OEHA 5GONB 2I91A 4TMTA 5DXFA 4CCYA 3D02A 4ZTZB 1HK7A 2BFCB 2NQTA 5FHRA 1VL2A 3C15C 3NANA 3D5TA 3L7MA 3LHSA 4H3KB 4HNQA 3DL4A 3S7TA 4AZ3A 2FJ1A 4Z8XA 3TR0A 1UF9A 2MMCA 2AXTC 3GTPJ 2CK3A 4JUFA 5D5PA 1VPTA 3F23A 4BQPA 4CEJA 3QIVA 2QZZA 2YXDA 1OTYA 5JATA 2ME0A 3R3SA 3K9HA 4Y18A 1RIIA 3WBBA 4IRMA 1XRPA 3WK7A 2L2OA 1NKVA 4KYUA 2X7JA 2DA4A 1RDFA 5HUQA 1USSA 2RHGB 1F2DA 4D2IA 2J46A 4OPMA 4WUVA 5ANRB 1UQRA 3F3XA 5JZSA 2RJ3A 4WINA 1P60A 3C3XA 4Y7DA 4E51A 1DWOA 1JG6A 2BGUA 4JX8A 4EY6A 2GJKA 4JV5B 2LD5A 1B8IA 1YJXA 2AVNA 4MRPA 2O8CA 4V1CI 2NO5A 3JRBA 3LP6A 1P61B 3WYFA 4AZSA 2DK5A 3BH7A 1FFSA 3HB5X 3HZOA 4L4XA 3P5JA 3A1FA 4Y2SA 4L5YA 5C7YA 1SFRA 2YVUA 2PMZN 3P9CA 1NF9A 3LC2O 3I2IA 4RK4A 1TWGJ 1M7HA 1XZ8A 2IGMA 3UYKA 4AZ3B 4BMDA 1N6RA 2MT9A 1DRVA 3R5SA 3ZQJA 1TVMA 3H1FA 2AWOA 5KKAA 3NEJA 2ZSHA 4YT8A 3Q9UA 2BBTA 4R2JA 3IR5A 1I3LA 4YEDA 2ZM6B 5KYXB 3UTDA 3ZHZA 4O2AB 5TEWA 2PS0A 4KYWA 5JCOA 3KETA 5JHFA 1OFUX 1MIJA 2RGCA 4YO8A 5TSDA 4YMWA 3E97A 4RM3A 4BKMA 2FOXA 5EP2A 3L0SA 5K9ZA 2KX7A 1JAXA 1Z7GA 1AHIA 3GAAA 2CB9A 3OT5A 4IQGA 1OH7A 5D85A 1UBRS 4ZIRB 3WWDA 1ULBA 2KWIA 3G49A 1F06A 3NP7A 5D5HA 5CIYA 1KI1A 2YJTD 1HDDC 1ZNYA 3KDAA 1EK5A 3MC1A 4JBHA 1V16B 3OKPA 3UMBA 4C89A 5D00A 2M87A 3FKQA 4JI3B 1NWCA 2R7OA 2QSHX 1JVSA 2HKXA 2JEZA 4XX1A 2GBFA 3OSFA 1KJWA 3FGNA 3UJ7A 1VC2A 1X9IA 4I0AA 1SD5A 1OLUB 2QVXX 4CHUA 1NI3A 3C45A 2HJHA 3P2OA 4OOIA 2VUUA 3AVTA 3Q7EA 4X84A 4XPIA 1GGFA 2EBFX 4FFVA 4QIWN 3DHEA 3NT2A 4HB4A 4PPNA 1VKHA 4UHBA 3TCNA 1T39A 3KAPA 4RAZA 4BJ3A 2OO5C 4MFDA 2C8JA 2X8BA 1Y1LA 2P41A 1DARA 3QLVA 1WP4A 1Z16A 2PV0A 3G5TA 4FHCA 1H5UA 4HB0A 4NAVA 4WASA 4LJ4A 3T35A 4DZZA 5IZCC 2RGDA 4ARBA 4NYIQ 2GN1A 1VTNC 1T15A 3IKLA 1TGYA 3KAQA 5G1OA 2DYKA 1LXCA 4LJZF 2ZRPA 5HG0A 3T7AA 3U49A 4RLHA 4W9NC 4B46A 4CM8A 3QVVA 2IGNA 3HI6A 3E7FA 4CM3A 3IMKA 2C2ZA 1DTEA 3F5MA 1UG0A 1YYVA 1RAFA 1YRWA 3K4KA 3OJLA 3ZIUA 1Y37A 2JJ8A 2LBFB 5D3QA 3DT8A 2ZKLA 1I6XA 4DN6A 3DHWC 1Z74A 4KA4A 4DPLA 4MR8B 4O3FA 4I1OA 3CCEI 3L7LA 3LBAA 5KQGA 3ISTA 4ER3A 2ZBFA 2QU7A 4JQSA 4OQZA 2XB2A 1V5WA 2EV5A 3MZYA 4E5UA 2H1OA 2QRHA 3LL4A 1E5TA 1WB9A 4HPXB 5AWFC 3WQBA 3WIEA 2HD4A 3W3ZB 1Z0FA 4OHKA 4EEXA 4F1KA 5IVHA 1JT0A 4ZOBA 3L8HA 3LUHA 2G6TA 4OKIA 2DFKB 1XE3A 3MM4A 4UUMA 3HM9A 2AH5A 4EW3A 4JLBA 1YNOA 2OLJA 4YJGA 3EVNA 2H2AA 2J5QA 2C2YA 3UAXA 3ZIAA 1EFUA 1R9TJ 3L7WA 1KFEB 1PWZA 4K3VA 3PD0A 3SZRA 4ER6A 4ESHA 4GI3A 4IOAF 1BC5A 3EVGA 3CXUA 2QYTA 2WWRA 1LDJA 1Y4AE 2PR2A 4D8XA 1NWHA 3KEOA 3GFBA 1EX7A 1QHNA 1UK9A 3IH4A 2R7MA 3GNQA 1P2SA 1MW9X 1E63A 5DCYA 1LZLA 4QTZA 5BT9A 3RSGA 2GYWA 2NW6A 4IS3A 1U9NA 1PL6A 2C8KA 2VSNA 3AERB 3HACA 2B4TO 2Y66A 3OKFA 1CY6A 3OC6A 3QUTA 4FJ2A 1V5GA 1WZ2A 4IYRA 4J16C 1J99A 3KEQA 4M0PA 2EKDA 1MOSA 2CCGA 2H63A 2PLRA 3C97A 1I2AA 3ZHSA 5LEJA 2X8LA 4P4TA 3QBEA 1PGQA 4KT5C 2HBRA 2XVXA 1DTWB 2XZPA 3ER6A 5BN3B 4WNIA 5G2OA 3P94A 5BVHA 4EJFA 5AHWA 5FPQA 1IYZA 2I7DA 4NG4A 3QEKA 5JD5A 4XQFA 4ETWA 1OYWA 1TA4A 4YRBA 4LDQA 2R7ZJ 5GAJA 1GL7A 3OWXA 5CYPA 4DCMA 5A7FA 4R9NA 1FSHA 4N49A 1GFZA 4KFSA 4QODA 2FUEA 3FHZA 1AKHB 1QLHA 4HVLA 3ZJVA 3F1KA 3VR6A 1YACA 4YMSA 2I03A 1BU8A 2WP8J 5I7SA 4EMSA 2Z95A 1XRNA 4HQ6A 4WVFA 2QR2A 3T0FA 3D5EA 3DOHA 2FRXA 1GLGA 5ALKA 1BQEA 2V9CA 2WIGA 1HE1C 3DVAB 4HFMA 2VPQA 4YH1A 4EVRA 2BGNA 1DAOA 5HDQA 4F11A 3K0SA 3KJIA 4TTRA 1BIAA 2JA6J 1Z35A 3L2QA 1JQ3A 1KP2A 1N2HA 3QVJA 1ZK8A 4XFDA 5EY5B 5F5NA 3R4KA 4I14A 1CUZA 1GL9B 1Z2DA 2AEEA 3CUQB 4YRPA 3FYUC 3TLCA 3AHIA 3P4YA 4E7IA 3K1MA 3IERA 3UFBA 3AVXA 4Q93A 1NVVQ 1Z6PA 5FBHA 4YG2F 1LF5A 3W8NA 1SBHA 4RSHA 3WDSA 3GMTA 1UBTS 4YFXF 1OBVA 4ZRDA 1BXGA 1XB4A 1O8CA 3O0TA 3R75A 3W06A 4MUFA 3WV5A 3KCNA 2M1BA 5TISC 1ADCA 3T8RA 1GSHA 4P83A 3VOTA 2L9SA 4D4IA 3D6JA 1XVAA 3ANMA 3O4FA 1KMNA 5A62A 5JVDA 4FNAA 4D9IA 2XRZA 4YAJA 1Z5NA 1UJ8A 2LDXA 9ABPA 3OZCA 3R5KA 5TDHA 3LL7A 3SU8A 2IS4A 5CA0B 2WAOA 3GJXC 3SJ7A 3FHCB 3EB9A 4OGFA 1JLRA 3B2NA 2V0GA 2WJWA 3FSRA 4AL4A 1JR3D 1RRMA 1Y7PA 5BSVA 2JLQA 3NG1A 5H81A 3NARA 2RKOA 4HGOA 3WGKA 5KWSA 4PCVA 1J7KA 1WWXA 2K2QB 4CXFA 2XAGA 3EUKL 3QPCA 2H7YA 2HDCA 3FFBA 5CURA 1B3RA 2UVQA 4RWEA 5IKEA 1UM9B 1O4XA 1DXOA 1T2UA 1WKVA 1XQ9A 1G55A 1VE7A 1SCDA 1IH8A 3HJEA 1FFXB 2A5LA 4JXJA 2L42A 3RD5A 4BO6A 1NHAA 2G4LA 1QQAA 3HB7A 2KRCA 1GXPA 3A2KA 1TBXA 2I66A 2JBWA 2RGEA 4KO1S 4LXIA 4Y6GB 4B4OA 5T67A 1F8YA 1FDUA 2VL8A 1AC5A 3RAPR 4M86A 4FW8A 1W1WE 2QENA 4WK2B 3BSYA 1CE8A 4LSZA 5JQWA 2XE4A 2R7WA 1GGJA 3DZHA 3WK8A 2BKUA 3HDHA 3ZKWA 5BV0A 1J8YF 4IINA 3I2YX 3AVYA 1TQHA 1GHTA 1WETA 1YF3A 4UBOA 5K8JB 4U88A 4YRLA 4MK4A 4GRIA 2QN2A 5AP9A 3RHSA 3FVVA 2PXCA 3F71A 5DB4A 2OAP1 3T3HA 4B6PA 2VA9A 1TD9A 2C4NA 1EJBA 1KFCB 3CNHA 4Y33A 2P8TA 1CY8A 1PNVA 2QZ9A 4PR0A 4GXOA 3HXMA 4BB5A 1GZDA 3LA8A 4TN5A 1FJHA 3CY6A 1NQWA 4D9GA 4P0TA 1EH8A 4Z7JA 2E4AA 2J3MA 5J8CA 2WM3A 2NUAB 3SLRA 3U39A 1CB0A 1HZZA 1KK1A 4FI3C 1R0BA 4GYWA 4E7OA 5K4HA 3GFRA 5LU9A 4QPDA 1HW1A 3SX4A 2P7IA 1YMVA 5M29A 2FPOA 2OBNA 2XUFA 3GGGA 1QFMA 4A0RA 2J9FA 4O4IA 3T7KA 1WAMA 3DONA 4P5DA 4C0SA 2L7MP 2O0JA 1CKEA 1AZWA 2TMKA 3PNOA 3ENZA 2EW8A 4Q9NA 1ZM9A 2JGKA 3UHOA 4ZYYA 3HUFA 4WSOA 4X8OA 1NBOA 1YUNA 5EWJA 3RKWA 5KPJA 1TCVA 1YZKA 1UDAA 2FV8A 2WWTA 3CGGA 1KI9A 4HQNA 3ZOBA 4PO8A 3QWLA 4FZ3A 5ENVA 5A3VA 3IEIA 1NMQA 3JQAD 4C9YA 3BDVA 4H1VA 3O8OB 1CY2A 3E53A 3K4NA 4M8SA 3LQ4A 4TLMB 5C8YB 2N9UA 2B20A 3GFPA 5JRJA 1NQVA 1SVOA 3W8EA 3CH6A 4F4CA 4BO4A 1QIEA 1MHTA 4CI0B 3MSXA 1N3BA 2PS3A 4CHTA 2VT2A 2UXDB 3BAZA 3IWZA 4KLRA 2PKEA 3GROA 4P81A 1WI3A 1GPUA 3PT9A 5HIIA 1C0LA 1Y3FE 4B5KA 3OQIB 5B7QA 1HE2A 4X1EA 4EJSA 3VBCA 5IMSA 2H2HA 3B12A 3PJDA 1MRNA 4NCXA 4Y1RA 2HFHA 1X58A 5A02A 1OLTA 2G1JA 2HPIA 2OZ6A 2X1CA 1SM4A 2G72A 3IO5A 4G56A 2Q0SA 4MMYB 4RJJA 5IVKA 1ZQ1A 1SAXA 1K6EA 4C0HA 2EZKA 3EEIA 1F6BA 3QFHA 3RROA 4C0LA 5IU6A 4QBHA 3HTSB 2F4OB 4R68A 4F3QA 1E1QD 5F0FA 1NVWQ 4AT1A 3KPVA 4PG8A 1WWKA 2B98A 3EFHA 4MWBA 1G4AE 2IJGX 3HYRA 2Q9CA 4HAIA 5FRDA 1UWVA 2QPTA 3DZFA 1LLCA 5CKTA 2ZSDA 3ZY3A 3N97A 1W34A 5A6SB 3NUZA 1WHTB 4A3GJ 5HCUA 2B92A 1ZO8A 1AU7A 2Q5EA 2QL7A 4FT4A 4MQUA 5DTQA 4CQMA 1H0HA 1XEAA 4V02A 1WD7A 1XI2A 1X8LA 1RM5A 3C98A 5J4YA 3KS9A 2X40A 4B6GA 2C7OA 2EQBA 2FETA 2Z1NA 4PS1A 4DJJA 1PLKA 3ZJYA 3CBGA 4Z6KA 2XYRA 3BWEA 3X43A 1ECGA 3V8MA 1ZZEA 2CUZA 1GNLA 2XAJA 2KP6A 1VE3A 4DV7B 3LSRA 2A61A 3PEYA 2M2EA 5AXBA 1RM3A 4UCQA 1SKMA 1E8MA 1X42A 1MJGM 3EUFA 1QFYA 4QAJA 3PB3A 2H1RA 3VYSB 4I1RA 4C20A 1L7RA 1SCAA 1ZNQO 3LVBA 1I3MA 2OAEA 2P91A 2PX6A 1TM2A 2VBCA 1MW7A 3GPDG 3KD2A 5LQDA 4R2WA 1PZGA 1YB4A 4AG3A 3PFGA 3QX7A 3NBUA 1QP4A 1XGSA 2GF0A 3CCYA 3LO8A 4G4JA 5DHFA 3UAYA 3CURA 1IN7A 3CTAA 3FYHA 4KE6A 2W22A 1T35A 3R6WA 2D6FA 5KTNA 1YR2A 1U7TA 2P1RA 4MW6A 1PJSA 3AUAA 2XADA 4TMFA 4MVJF 3UG7A 1RQNA 4PFJA 1UFQA 4N5NA 2FLWA 4F45A 2W84A 2BBSA 1D5VA 1UC9A 2ODNA 1BW6A 2QRLA 3DMFA 4DIBA 4GMGA 4RZUA 4BX9A 2I1VB 4XLAA 1C7RA 5IN5A 1VYVA 2H8GA 2XCLA 3BQMB 3HY4A 3TDZC 4PGGA 2FHSA 1P1JA 3ANXA 4PSKA 2VUMJ 3JRFA 2YZGA 4ZHQB 4V1CA 4YAUA 3R8FA 2GT1A 4W8GA 2ZOSA 5EUBA 3T5XA 3U81A 1NUUA 2C57A 2FW0A 4BEVA 3C5WP 4IG9A 3RVNA 3T99A 3BTOA 2JI9A 3EC7A 2WADA 2BOVA 1XMVA 1FDIA 1VLQA 2AX3A 2OF7A 2QSUA 4A3EJ 3FDJA 4WTOA 4KRXA 1A9XA 1NMEA 2D74A 4MITA 1P7CA 4XKCA 2ETVA 1FOXA 4B71A 5KWJA 5FP0A 3R3HA 1YQTA 2PUJA 1NJ1A 1W30A 3EHDA 3KYDA 4S2UA 3LWNA 3LPAA 2M6LA 3QWBA 1E7WA 5KJCA 1Y4UA <