3WG9A

Crystal structure of rsp, a rex-family repressor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
209
Chain Sequence
b'KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 74
structure length 209
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wg9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wg9A02
2GWRA 5CDUA 4LG0B 1E7WA 2VHXA 4AG3A 3GMSA 4BVAA 5JAZA 1R0LA 1A7KA 1LLQA 4WXCA 1Y5MA 3K2EA 4RGRA 3JQ7B 4E5MA 1E1MA 4M9ZA 2VZ9A 2DBBA 3QSGA 1KOLA 4BB5A 1E1KA 2E1CA 1H0MA 3NTOA 2QBYB 4UEOA 3KRTA 2B5VA 4BOYA 1Q2XA 5ENDA 2H6BA 4MEYF 2GZ2A 4JBAA 2PV7A 1UXHA 3SJUA 4A27A 4IJWA 4UHTA 2C7VA 1NQ5A 2E1NA 2UAGA 1SMYF 2CFXA 2QUFA 4RF3A 1PZHA 1H9BA 1LRLA 3EHEA 5IDXA 4KP7A 4M72A 5EPOA 2JFGA 2QW8A 2PH5A 2E37A 2WYUA 4Q47A 3HFSA 1QMGA 1ZXBA 1IL0A 4GX2A 1CF7A 1TT7A 4DVJA 2CSUA 4A5MA 3CE6A 4EGFA 2HK7A 2NVWA 4J16A 5IN4A 2PFBA 3JSOA 2K7LA 1I3KA 4FR5A 4CMKA 4OOFA 3FNHA 3VPXA 1C0LA 3P9KA 1GQ2A 3BHMA 4M8SA 3L00A 3FN4A 3P7NA 5BR7A 4MKXA 3S1LA 3WIDA 1K6IA 2NNNA 4CMEA 1U3EM 4XGIA 3DAGA 2OP0A 1J2XA 1SOWA 1UAGA 4LISA 4TKMA 3WFJA 4NFHA 1DC3A 2QLZA 3DV8A 2XPCA 3A06A 4G6DA 2D5CA 2Q1UA 3FX3A 3EUWA 1FPQA 4AJHA 2V6CA 3WGTA 4FSHA 1V3UA 2FR1A 4R69A 3I6IA 5E20A 4R51A 1RJWA 1JAYA 2CD9A 3TPCA 3RPQA 2XIGA 1FSHA 4FC7A 3JQFA 5JI6A 4PRKA 5HM8A 2W25A 3EK2A 3WTYC 3GFGA 3GY0A 1IPEA 2D5AA 1Z82A 5CEFA 4IQ8A 4ZA2A 1EEHA 2CDAA 2PWZA 1DC5A 2EV9A 1V6AA 2VYVD 2OORA 3J81K 3SJ7A 4WPGA 3RJ9A 2Z1NA 3GNQA 5H83A 1PWZA 4UULA 4DBZA 3WJ7A 1H93A 3FRJA 3H3FA 4RO0A 2L54A 1GEEA 3IUSA 2NADA 4NQZA 1BXGB 4HV6A 1M67A 3VTZA 3HTSB 2W85A 2AEFA 5FFFA 1VLLA 1T6SA 2AE1A 1I10A 3KE2A 3PLRA 1NASA 4HZFA 3GT0A 3CSDA 3R3JA 2X4GA 1U4SA 3FTNA 1YL6A 1FYMA 3DTTA 5ERIA 2XROA 5DN9A 3ZMVA 1FYLA 1SFEA 1Q1HA 5BPDA 3WTTC 2FPGA 4UREA 5DBGA 2HKIA 4BKRA 1QLJA 3RBXA 4HAMA 2RIRA 3C7AA 1H6DA 3TZ6A 3ADOA 4PGHA 1FF9A 1WWKA 4G5HA 4CMEC 1T4DA 4YFKF 3ECHA 1RM4A 1GUYA 2GA1A 1BVRA 4JP2A 3I5UA 1NFFA 5DV5A 2YY7A 5L3CA 1NFRA 1T25A 4DC1A 5B4UA 2CYYA 1P92A 3K2BA 2QRJA 2I5PO 2HCTA 4LRTB 1TW3A 4R79A 4IHTA 4TVOA 2I9PA 2E7XA 2X1HA 4BH9A 4JJFA 1QR6A 4R1HA 1UCRA 1LSSA 3B6ZA 3JQFC 3REOA 1K5HA 3JYQA 4Z9FA 3SC6A 1PQPA 5CFZA 2AXLA 3O2PE 3WNVA 2EJRA 3AFMA 5DOZA 2V79A 3ETDA 2BGMA 3PIIA 4LMRA 2X0LA 2P9EA 3MTJA 3ZDFA 4IF4A 4CL3A 1UXJA 1PGNA 4BL5A 3B73A 3PJEA 5HDGA 3EYWA 1LB2A 3DZJA 1X7DA 3DBRA 4GMFA 1YE3A 3OJLA 1QZZA 3GWZA 2ZB4A 4J49A 4UVAA 4LGWA 4WLUA 3WBBA 3ETGA 3OEWA 7MDHA 3WWZA 2FRDA 4G81A 1BW9B 2V1DA 2GD1O 3AUTA 1QYVA 4UNOA 3PP8A 4PCVA 5EEHA 3BIOA 4YAIA 4E21A 3T4EA 4CODB 3L6DA 1CGPA 1LDBA 1YB1A 4IZIA 3WBFA 4G9YA 1SMKA 3DO5A 4IRHA 3RPUA 3ZN0A 3JAMK 3EYIA 1EBUA 1NNUA 3I59B 3P2YA 2K4JA 1LDDA 3VVBA 3WQQA 1ZEMA 4UUVA 3HADA 3IS3A 4FB5A 5DD8A 1ZARA 3WB9A 4LK3A 1KYQA 2HMSA 2C82A 4CMIA 3RUDA 3PQKA 3GAZA 2AQ8A 1ZK3A 2PD3A 3KYDB 1IE3A 1GYQA 3E5RA 4PZJA 3FXRA 3SC4A 5E8IA 2CUKA 1GQYA 1MXHA 3LA7A 5I8WA 5BSEA 1VJTA 5FB2A 1E5QA 4GSKA 5HRUA 4G7OF 2Z5UA 2FU4A 2JCYA 3TOXA 1IZ9A 2Q46A 2NVBA 3K31A 1ENZA 4E2ZA 1JA9A 2Z3YA 4RL6A 1LLDA 4IDEA 2YJZA 1IHXA 4RPHA 4CMAA 4MHGA 1E7RA 2GGSA 2BYVE 1EH7A 2IXBA 3PHLA 2BGKA 4WXDA 2VRCA 2CG4A 3LC2O 1ZAOA 4GQAA 4XWYA 2VBXA 1UH5A 5TF4A 2FNPA 1X13A 2AE2A 1T2EA 4ONEA 1Z05A 3CINA 3MWDB 3S2GA 1X1EA 5ILOA 2O3QA 3NGLA 1TQMA 1LJ9A 1U5AA 4LCEA 5T57A 5JMPA 2ZJ2A 4CUJA 3DHYA 1QRRA 2I3GA 1IN7A 1R15A 1VE9A 4PG7A 2HJSA 1J7KA 1LU9A 3I9LA 4FFMA 1ZK0A 4XZ3A 3SX2A 4DL9A 3QOPA 5EEGA 1EUDA 4IXTA 5IG2A 4HYEA 3ZMSA 1Z7BA 2QRKA 1GVJA 3A4VA 2Y0EA 3I54A 2XVCA 1Z6RA 5BQTA 4ZU3A 1NQOA 2NU7A 3R1IA 2GQQA 3RKXA 1WNTA 4TMFA 1P1KA 2IW5A 1SD4A 4LG0A 4ZQHA 3VKUA 3RYRA 5E17F 3BMQB 5EL0A 4YR9A 1DJNA 3KVOA 4BO3A 4KNYA 3FCOA 1ZBQA 5T8KA 3WE2A 1X14A 4DGSA 1UXKA 4HXYA 4KUMA 1FY7A 4HF0A 1MC5A 2X0RA 5CPFA 3MWEB 5ENVA 5BNTA 1YW9A 1Y7TA 3NT5A 4N9HA 3RI3A 4KA4A 4J0FA 1PUEE 3BDDA 1MC4A 3U4CA 4CM6A 2NTJA 3BJ6A 1NAHA 1Z6ZA 5JFOA 3C8MA 2JCVA 1ONPA 1PJLA 3HE3A 4WEOA 4BKUA 5IDQA 3GX4X 1PJ4A 2BELA 4UUOA 1YDWA 5L4NA 1GHCA 1SD7A 1H2BA 4B7UA 1ON2A 2ZKZA 5JHUA 3I4FA 3HRTA 2JD0A 3L9XA 2ZB7A 2ZNYA 5CHEA 5CP8A 3V2UA 3M9AA 3RJPA 1PX0A 3PQDA 4PDKA 2DUUA 2FMYA 2IPQX 1P1RA 1U8FO 1V8BA 4HF2A 2G5CA 1BDBA 4ZHSA 2EFOA 1YJQA 3AI3A 4XRFA 4PFJA 5KIAA 3GFMA 4DPMA 2EP5A 1ZG5A 5C37A 1MV8A 2J3KA 2FBIA 3OV8A 3AUSA 3DQPA 1J5YA 3BMCB 1UXGA 2VHVA 5KVVA 1HYEA 1T26A 1B1BA 2GYYA 3PQEA 5B37A 5CDGA 4FS3A 1VC2A 8LDHA 3NEPX 1V3TA 4U8GA 3BMOB 3VKVA 3E5MA 4O59O 2ZNZA 3RKUA 3C7DB 3I9NA 2UV8A 1XLTA 5DP1A 5T8KC 4RLSA 4FCCA 3O03A 4JK1X 1YQDA 2KKOA 3ZU5A 1F8GA 3HNPA 1KEWA 1HSOA 4CLOB 3H3JA 4IXWA 3TZCA 3DOCA 4D0SA 3CZMA 2VC0A 2P7CB 4CM3A 4MVJI 1FXSA 3GVCA 3KP7A 3T7EA 4AJKA 2HTSA 4CQMB 1BXGA 1YONA 4OKIA 3ZWMA 4I02A 1J59A 1ZW1A 2AQHA 2DFVA 4FFLA 3DZKA 5FFZA 3DPLC 3I0TA 3IKVA 4EVIA 1JKJA 1GADO 2HYFA 2BFMA 2O3JA 3KFWX 1UP7A 4G7HF 5ILVA 4HX5A 4S04A 4RDHA 5F21A 4A03A 5C7OO 2BMAA 4PLHA 4PRLA 5BOXA 3FMSA 1O95A 3MOGA 4U0VA 4JJGA 2QRLA 1UDBA 1SC6A 3C24A 4B3IA 2UZKA 4RGXA 1E3IA 2VWPA 4ND4A 2QQ9A 5T67A 3PFFA 2ZB3A 1Q0LA 4PGFA 4NJMB 1JE8A 1J6UA 4I1IA 3V4GA 2PH3A 1Q0HA 1XMKA 3FWZA 3KOUA 4JX8A 2XXJA 5L51A 2UXNA 1MJBA 1LDNA 4BNMA 4KIGA 1DLIA 4DYVA 1JDJA 3NJ8A 2CSOA 4MVJE 5ICEA 1QGPA 2HMUA 3LF2A 4IMPA 4U7WA 5G0WA 3E6MA 1BRMA 3KP4A 3IMFA 1PTJA 5KVCA 1BG6A 1XSDA 1PL6A 2DI3A 1DIRA 2AA3A 2X7HA 3RC9A 4QQRA 5CEEA 2PTGA 3H8VA 2X0IA 1U5CA 3WTUC 4HDVA 4WCFA 4ZRMA 2PNFA 5KKAA 3UUWA 1PDNC 1VKNA 1E77A 1F06A 1I5ZA 1PR9A 4YAKA 2CVOA 4M55A 3R0AA 1NPDA 3I9OA 3ABUA 3MCVA 4R41A 3RAJA 3ZGYA 1B59A 4BV9A 2J3IA 4GH5A 4XDZA 4YQYA 4PN3A 4GO1A 1B15A 4L4XA 4P4NA 4D45A 1PR3A 4CJXA 5JDIA 1LX6A 3IQDB 2VOOA 1EFLA 5AXCA 4BMNA 2AG8A 4BO5A 2ZIZA 4A12A 1IOLA 1F5TA 2YU3A 1XGKA 4FFRA 2P9CA 5TJ9A 1T24A 1YOVB 1FP1D 3D5LA 2GXBA 3LAPA 1SO8A 4QX6A 3HSKA 1NR7A 2JFHA 4B8XA 4HFNA 4MTEA 3F6YA 3DAPA 3SBOA 4AICA 4BKPA 4M86A 5LGTA 2CFCA 4RB3C 4RPKA 5T64A 3VVCA 4EITA 3RDIA 1I3LA 2GZWA 2IP2A 4RVFA 1QQIA 5TLSA 4HLXA 4YFNF 3DWFA 1SB9A 1I1GA 3G73A 3DONA 2DQRA 2GAUA 4GVLA 2OD5A 4XLPF 5HA5A 3TQNA 3ETEA 4AJIA 3CDHA 3UCFA 1D8JA 1DPGA 3E6CC 2VC1A 3HHHA 1EUZA 1ISJA 4UVHA 4II2A 5EIOA 2J5RA 1O7LA 2KIUA 1G3YA 2A07F 2HQ1A 1YB4A 4U7BA 3FNEA 4XYEA 4BHTA 4IRIA 2G0TA 2B83A 3C7CB 2O48X 2W2LA 1P44A 3UCEA 3TOBA 1HQCA 3J80Z 3JSPA 1H9GA 2VN2A 1E6WA 3DL2A 3GLQA 5ER6A 4CM5A 4DIOA 4YT8A 5JC8A 2NU9A 4Q3AA 1YG2A 3JTMA 4IS2A 4GX1A 2WTEA 2FNAA 1CIVA 4XSZF 4WCFC 3C85A 2V7PA 4JROA 2BGLA 4F6LA 4Y98A 3ST7A 3RKYA 4KWHA 1LNQA 4A7PA 5MGBA 3RASA 2L3DA 1E6UA 5FWNA 3DHNA 2BLLA 3HB5X 1FBSA 4ALIA 2NUAA 3GDOA 5DYMA 3RFXA 2EA4A 3CUOA 5ITWA 4J6FA 5JDIC 3VZRA 3LZ6A 3AM3A 1RYDA 2DC1A 3LQFA 4R68A 4FJ2A 4AIJA 1MDMB 1NTOA 2LF7A 3DR3A 3Q6IA 3N74A 4MIEA 2VN8A 2IA0A 3F21A 2FRHA 4G94A 1HDRA 5BMZA 1VI2A 2BRUA 8ADHA 3IJRA 4WEQA 4Q9NA 1WMBA 3I52A 3BMQA 2P6TA 3JYLA 1M2WA 5CLSA 3W8FA 4P4LA 4RVSA 5D5UB 1ZJZA 5D4RA 4EM1A 3CXRA 3GNSA 1Z1DA 4N7RA 3T1BA 4G6QA 2Q99A 1GCOA 1PJCA 1E7QA 4J7UA 2GZ1A 3WIEA 2O0YA 4WLNA 2DUWA 3L6EA 4XGKA 1TVEA 2R00A 1NHAA 3AM4A 3HRSA 1PWXA 3CTMA 3Q3CA 4IDBA 4IPAA 2AEMA 4B3HA 5ADHA 3SXYA 1LRKA 5E18F 1PJ3A 2ACJA 3NDRA 4YJDA 3MWMA 3HYIA 4I9NA 5G0SA 3UGKA 1U2GA 3DXFA 4KMFA 4YAGA 5JBIA 2I76A 3RU7A 1S7OA 3LAJA 3TZQA 4BNGA 5U1PA 1P4WA 2QWWA 4W7HA 1E1LA 3PEFA 3D3WA 1HDYA 3CO7C 1E7MA 2KIMA 4J9UE 1DHRA 2DPGA 3SVTA 1A4IA 1MFZA 1P1IA 1LDMA 3F1KA 2B5WA 1N5DA 2BGCA 3F72A 3S2WA 3LT2A 4MGRA 4IM7A 2ZYDA 4PLCA 3VAZA 2NS0A 4W99A 4NHJA 3RC7A 5FEUA 1MG5A 4N5LA 5CG1A 1B8VA 1YRLA 1SD6A 3H92A 4M6XA 4XSXF 2YX7A 3OH8A 4NK5A 4AFNA 3AOGA 2EV6A 1Y1PA 3LFKA 4IVNA 4IQGA 1IRFA 1Q7CA 4QWQA 1L7DA 3G3ZA 3PDUA 1R4NB 2WE8A 4D44A 1L7EA 1LDKB 4L9RA 3EDMA 2W84A 4WX9A 3BMOA 3BA1A 4CL8A 5GZ3A 3GUDA 3GDGA 3O4RA 4CLEA 1W4ZA 4HF1A 1BDMA 2O50A 2P5KA 4HY3A 1NPYA 4LRSB 1P31A 4IJAA 5FO5A 2P91A 4J9VA 4ALKA 1W7PB 4EUHA 4R54A 4RAYA 5JAIA 4YRBA 1B8PA 3ASVA 1KBZA 4XA8A 1B26A 1HF3A 3PHHA 5IZCC 2HMWA 4P55A 1M66A 3J80K 1YW8A 1PZGA 1U3WA 1ZLKA 2OGUA 1RM3A 4IY1A 4M9XA 4PG6A 4WOKA 4BNWA 5A3JA 3V5NA 3ZWVA 2Q1TA 3TOAA 2ZO4A 1BMDA 2STWA 3UCXA 3D3EA 3Q9NA 1UUFA 3E82A 3TKYA 3VPFA 4CR8A 2EP7A 2Z9OA 1ID1A 3BTOA 1KU7A 1Y8QB 2QYSA 3DBHB 3ON5A 4ZN6A 2Y67A 2DVMA 3M7GA 1I0ZA 2A68F 1ODDA 1HDZA 1LSUA 3GPDG 3VODA 1ZGJA 3WU1B 5JLAA 1DRUA 3ZV3A 4BKQA 1G0NA 5KJEA 1BIBA 4J4BA 2DPUA 3C18A 3FM5A 1CF2O 2FWMX 3DPTA 4O63O 2DU8A 4CICA 2HKXA 3ZHYA 1JAXA 2O4CA 4B79A 5A9RA 1PZFA 3DMTA 1IXRC 4F7ZA 3HJAA 1IAWA 3NDJA 3M8FA 2A6EF 3DOJA 5F64A 5JXWA 5G2OA 2C5EA 4ND1A 3FM3A 3MZHA 3GUYA 2OP1A 1EBFA 2BD0A 1TT5A 1KY4A 1ZVMA 3INGA 4PG8A 4IRGA 1ON1A 3HUGA 1XU9A 2I6TA 3DZBA 2VHYA 1R4MB 2HQRA 3F23A 2J5OA 4JCOA 4I5DA 4WCDA 4XR9A 4ZGWA 3BP8A 2JL1A 1PGJA 4MKZA 3GHHA 4MVJD 1OYWA 3JW4A 2D8AA 2QHXA 3GEDA 4YT2A 3U09A 1ONOA 1EK5A 3BMNB 2HDCA 3KB6A 4W4TA 1XCBA 4XRRA 4NDNE 4KT5C 2I99A 2MD5A 4OOEA 2OO5A 3WTSC 1V35A 3ZMDA 2O3TA 3JQBA 3DXJF 3BAZA 3F6OA 1ZH5A 1HTBA 4R1SA 2EFNA 3EETA 3PPIA 2KIFA 3IC7A 5LHGA 1HLPA 4OIMA 4GYIA 2HOEA 2IRFG 1GFSA 1XGMA 4ZRNA 3IHUA 1ZZEA 3OETA 1GL3A 3AW9A 3WMXA 1USSA 2RNJA 3PTZA 2A61A 4A0XA 1DDOA 2QIOA 2W57A 4I2OA 5HTOA 1X0VA 3F4BA 5JVTA 3E6BA 4DIBA 3A28A 4MQ9F 3IJPA 3F5QA 5A06A 4NR0A 3KETA 3COAC 3O8QA 4YFXF 4P9UA 1IUYA 1EE9A 2MH9A 1ZMTA 3GFJA 5HDNA 5HOOA 3ERED 4FT8A 1IULA 2JKVA 1D3AA 4OXYA 4FW8A 1DXYA 4R3NA 1MB4A 2ESNA 2XV4S 1FNNA 4O0LA 2QQBA 5JCJD 4RF4A 4XX0A 4B8WA 2Q2QA 2A3SA 3NTRA 2UWMA 4JN6B 3PJGA 1IXCA 4TRJA 3GEGA 4HX8A 2JHFA 4UVGA 3SFZA 4AJLA 3IAHA 5KK1A 1RYEA 4EJOA 3B1JA 1EDOA 3JQAB 2GN6A 2ZB8A 4IJVA 4RJTA 5HS9A 1TA4A 3KZYA 4IDAA 4MVJM 2ZCVA 4BNNA 2D1HA 4CMGA 1HYGA 4FPXA 4PIVA 4BKOA 5F6FA 4E12A 4L0YB 4L0QA 2C29D 3GGOA 3ZWBA 3C1OA 5ILUA 1LDEA 1TB4A 4YCAA 3SLGA 4DLLA 4AJJA 4BHPA 1NVTA 3ML6A 3WGIA 1EVZA 5DCMA 3E1KA 4IINA 3JQBC 1E92A 1WVGA 1F8FA 1H6AA 2NSDA 4KMUX 3Q9SA 1B6AA 4L9VA 1DHTA 1SOVA 2RCYA 3I1JA 3NQOA 3QVTA 4I08A 1VRWA 4B4VA 4PLWA 1HE2A 3Q9UA 4EGYA 3L09A 4P9FA 3W6KB 4DPKA 3GA0A 2JCXA 2L4MA 4BV8A 3SXPA 4RQUA 1V3FA 1ZG1A 2EJVA 4ZQGA 1LXCA 3STHA 3HG7A 3PFWO 4ILKA 3BTUA 4OO3A 4BGIA 1WPQA 1O9BA 4CM7A 1LUAA 1WRJA 2VNSA 1TBXA 5B1YA 2PY6A 3DFUA 3LLSA 4D79A 3E8XA 1IB6A 1TQPA 2C2XA 3I23A 2LSOA 3GF2A 4FX4A 2CVZA 1FC3A 5D6FA 1JHHA 3W4KA 3OQ6A 5L9AA 1ZGAA 5E1XA 1DO8A 4QO8A 3K5PA 3ZWWA 4R01A 3PHGA 4HBLA 1S6YA 1B9MA 3WQRA 4EJUA 2DTEA 2CNBA 5COAA 5I7FA 2W24A 1A71A 1BXZA 4Q3DA 5H20A 3O38A 3GRPA 3SHFA 5BNFA 2I66A 1BTOA 4YTEA 5JMWA 3O3KA 3ZU2A 3V2GA 5KJ6A 1REPC 2JTVA 3RFVA 4INAA 4UVCA 2EWMA 2FSWA 2Q50A 3L4SO 3LSYA 3VH4A 1P9LA 4HV5A 1W0CA 2C20A 5FGMA 3I53A 1I30A 4ALLA 1R22A 1J5PA 1KEUA 1UHMA 2UUPA 4PGGA 1JKFA 1JW9B 1S7AA 2IA2A 2DAPA 3INRA 2DPHA 3LK7A 4RPGA 5AOVA 1U5TB 1LDJA 1B0AA 3OA0A 1NWCA 2IYOA 2DLDA 2Y1DA 3Q11A 2J8ZA 4RGUA 2VXZA 4LLLA 4TRNA 1LQUA 1AXEA 5IJZA 2XXBA 4DQVA 3ONEA 4XQCA 1KGSA 3MZYA 2G76A 2RV8A 4GVXA 4BO6A 5EQDA 1YJ8A 4CLDA 1BWSA 1T0FA 4OAQA 2P5YA 4JNKA 3VDRA 2XKPA 1A27A 4YAEA 3C7JA 2BF7A 1EZ4A 3FPLA 4HFJA 4NBUA 4YRDA 3KYCA 1HSJA 5ILSA 1UXIA 4BB6A 1HETA 2HUNA 3WTWC 2YHIB 2XASA 2KJBA 3KLOA 3GK3A 2ISZA 3ONFA 2XAAA 3IIEA 3TNLA 4B4WA 1QO0D 1UZMA 2CMDA 5B4TA 4Z9XA 5HS4A 4A73A 4YACA 4GMGA 2R6JA 1Q1NA 3DOOA 3FNFA 4CLHA 3V1UA 2UXXA 1A5ZA 4WGGA 5AONA 1SCUA 3P5SA 2RN7A 1T1RA 1T4BA 1U3TA 7ADHA 3F3SA 3W8EA 4BMSA 5BS6A 3I64A 3C1AA 3F46A 3EYYA 1CEQA 2LDXA 2BFOA 2PA3A 4R16A 1KVQA 3LA3A 5L3FA 1HE5A 2ZYAA 4I5EA 3L2CA 5K9ZA 1C1DB 4U6QA 1HL3A 4R4JA 1MFPA 4Q3NA 2B0LA 4G7ZF 1XSXA 4W7IA 4PCQA 5DDGA 2ZYGA 4AIHA 1I8TA 1U2DA 1QORA 2C5AA 1DDNA 1V3VA 2O2YA 2ZBKA 2EIHA 3ZV6A 4OKNA 1B9NA 3JQGB 5I7EA 1E17A 1DRVA 4MTDA 4PLTA 5JNLA 4KZPA 3GG2A 2JJYA 4Q39A 1IN5A 1XDSA 2XOXA 3KV3O 4GI2A 2H6CA 4J90A 4F6CA 5IDYA 3F4LA 4EJVA 2DM6A 3ELKA 4IGFA 3HN7A 2HMVA 4R1UA 2EJWA 1OYYA 3CMMA 3QU6A 3L0DA 5JC1A 3MJ4A 3I9KA 2CF5A 4H16A 2Y75A 1XGOA 1VSVA 3AU8A 4TRRA 2P4WA 4KFCA 4XB1A 4L9TA 4MP8A 4YT5A 3GFIA 4CDGA 4R9RA 1I33A 4A10A 4J1TA 2J5KA 2F5EA 3BMNA 1P77A 1RM5A 4DUPA 3L6OO 3NKLA 1KVSA 4MVJH 1PEDA 3F8FA 4EJMA 1GU7A 1ZN2A 4FOOA 4JGBA 2WJPA 4ENKA 3R3SA 1SAYA 1X7GA 4D3DA 5LDHA 3RUHA 4ESFA 2Q3EA 1ZO8A 4P96A 4URFA 3KP5A 1ZG3A 1GXPA 2QX7A 5FI3A 5C3MA 1E7YA 1ISFA 1YXMA 5L3BA 4PLYA 1DFHA 4J43A 3SLKA 1QG6A 2IEBA 2L01A 3PJDA 3TL2A 4NFSA 2NAZA 1R7JA 2GSDA 4UVBA 2WSBA 2ZJ1A 3QW2A 1JXSA 2ELHA 2G7HA 2YDXA 4TZKA 2Q1WA 5DULA 4IHSA 1U1IA 3PQFA 3FHLA 4OXKA 4ZYDA 4FHTA 2X23A 5L3ZA 2C6YA 1NPTO 1LQ1A 2Q45A 1HSZA 1BOAA 2M45A 2C7GA 3JYPA 1A9ZA 3ZN2A 2PD4A 2RHCA 4BGEA 4UAGA 3KP3A 3OIFA 3EMKA 4WKGA 3TFOA 2EF1A 3DDNA 2QM3A 4JIGA 1T2DA 3QAHA 1VTNC 1C1XB 3AK4A 3GZNB 1UHWA 2VCYA 5U9CA 4ALJA 1MGTA 2Y48A 4I01A 2V1UA 3QA9A 4GYGA 1C14A 3F5SA 4PG5A 4PLVA 3MEXA 4NNJA 1WZEA 1R16A 1ZSVA 2P68A 2XHKA 2H27A 3D1LA 5IXYA 3FXUA 2PMHA 2E82A 5IT3A 1YWGO 1U2WA 5LLQA 3TOZA 2VRCD 3VC7A 4HFRA 1W6UA 5E1ZB 4AIKA 3K30A 2LF8A 2OZUA 3WLEA 4YJHA 3DTYA 5HLIA 1T2FA 2DK8A 2G17A 2NU6A 3JCZA 1O3QA 5L7YA 3PIDA 1NHWA 1ULSA 4PLPA 1LVAA 3DEUA 1LRJA 2O7SA 4LCJA 3WE3A 2CZCA 2JAHA 1QSGA 4NMHA 3U4HA 1E3WB 3HDQA 4S1VA 4EYEA 1FYKA 2D4AA 3H2ZA 1O3TA 3CH6A 5LHHA 4NI5A 2PZKA 4XR4A 2AQIA 3M1EA 4GCVA 4I5GA 3H7AA 1HYHA 2P5UA 1Y8RB 2RAFA 3EVNA 4ZQFA 1R5GA 1DLJA 1HDCA 1CQJA 3DB2A 3KTDA 2W98A 5F5LA 4K26A 3NRVA 1DAOA 1FLIA 3ABIA 4NZ9A 2VBYA 5ED4A 2PQ8A 1PSDA 2WWYA 3BXXA 3FBGA 2FSVA 1QYDA 1ISIA 1HW2A 1G6NA 5HLHA 2DQ4A 3H5AA 2VNAA 3CUKA 3OFSA 4MDHA 3E3VA 3MJSA 3G1UA 3RROA 2Q4EA 4J0EA 5D6EA 1BIAA 3SQNA 1P1HA 5F1PA 2EKPA 3TWOA 3ZCXA 4ETSA 4CM8B 4CMJA 1B8UA 1K3TA 3LDHA 1D4FA 5FI5A 2GN9A 1KVTA 1PU2A 3M6IA 3JQ7A 4FDAA 1F9NA 3RCBA 4M49A 5KVRA 4D42A 2QYTA 4Y15A 2QBYA 2EW8A 2IA1A 2F2EA 3GPIA 2CVQA 3AI1A 1O94A 2HR3A 5F1RA 1YBAA 5L95A 3PWSA 2WD7B 4RGBA 4FGSA 4CMHA 1XIVA 5ICSA 2OU2A 2AQKA 1EMDA 1KS9A 3INTA 4OINF 4BMVA 3TL3A 3DZIA 1QKIA 4B4OA 2PJPA 3GQVA 4HWKA 4YT4A 4I0AA 1K0UA 4H7PA 4W9NC 4W82A 3GFBA 5KOIA 1GPJA 1W73A 3JTHA 1E3SA 3F1LA 3G17A 3CZRA 3F8NA 1E7SA 3W6JB 2VTDA 4E5YA 4BNLA 3QQPA 3UXYA 2HK9A 2JRTA 5I9NA 4ZICA 3IUPA 2VT2A 3ZH2A 1KYZA 1JGSA 1DFGA 3ICPA 2CDBA 4E13A 4Y13A 1LBEA 3IL2A 4LD5A 3X2FA 2ZTMA 2DU9A 3RTRA 4EV0A 1J4AA 3E5UA 3GW2A 2YHIA 1XCVA 1YB5A 1ZHFA 3I9MA 4WNIA 4DC0A 4F3YA 1X1TA 3DAFA 4O6JA 9LDBA 1V9LA 3CUQB 3GR6A 3H6KA 1U28A 3DHEA 4I9HA 5DCYA 4HADA 5F3RA 1MP0A 3GN2A 1UZLA 4JK3A 3HHGA 2RH8A 4I8XA 1TI7A 3F8BA 3RBZA 4U6SA 3V1YA 1HBXG 3ZU3A 5A4DA 4HX7A 4YXFA 2O03A 2MC3A 4RPLA 4IBOA 1Y81A 3H5RA 3H65A 2DK5A 4RB0A 1C1DA 1PJQA 2YV1A 3KO8A 1GYRA 1IHYA 4OIQF 4CO8A 4FFPA 1HXHA 5BQFA 3KSUA 2G82A 2X4HA 1LEHA 4BNKA 4EEZA 3NTQA 2BV6A 3B1FA 3DBVO 4WE3A 3U3XA 3K1PA 1XQ1A 3QWFA 2X6TA 4I09A 1IN4A 1F1ZA 1RM0A 1Y5RA 1HLDA 1DJQA 1ZRFA 3WQSB 1ZCJA 1ZYRF 1XD7A 2FA5A 4HDUA 3KSZO 2YR2A 3V8LA 1D5VA 3MJCA 5U4QA 1ZUD1 1ZXLA 1U5TC 3TDUC 2D1VA 4NB5A 1UFMA 3ISPA 4UVDA 1J0RA 1TQIA 2ZXJA 1ADCA 4I0BA 2D59A 3WTCA 3BJAA 1NQAO 4AVYA 4ON0A 2OXIA 5J8CA 3HTUA 1OC4A 1QLHA 1KERA 3ZNQA 3JQCA 5TNXA 3B70A 1KU2A 4I9UA 5A9TA 1Z91A 3VB2A 1Y0UA 2FPIA 2JT1A 1XHLA 2ET6A 5L45A 3GG9A 4X54A 3V1TC 3CO6C 4IPTA 1ZLJA 5TGDA 2PMUA 2VOEA 2IDZA 5G0UA 3DKWA 1K78B 5CDTA 4MP3A 4RZHA 3FWNA 4EGZA 5IT9Z 4P8RA 1BC8C 1EVYA 1SNYA 2DKNA 3C1TA 5JAQA 1NM5A 5JS6A 3U4IA 2YV3A 1NVMB 4HX4A 4GGGA 2P9GA 3L4BA 2VE8A 2RC4A 3HSFA 4GXOA 4LLGF 4CZZA 1U7TA 3FR8A 4RF5A 3UICA 5J6XA 2VWGA 3MJVA 1CETA 1MG0A 5EERA 3UH1A 4BNIA 2H1SA 3Q9VA 3DZFA 4YPOA 1XEAA 1J0XO 4Y6RA 4NHEA 2GUGA 4E31A 3KEOA 2R3SA 4KN7X 1R36A 2Y05A 4U5QA 4O5OA 4KYWA 1HW1A 5K5RA 3OHSX 5B12A 4P22A 4WWCA 3ITDA 3CJNA 1PQUA 2YSRA 1ISHA 2VYND 4UV9A 5FD5A 1OI7A 1SEVA 1BW9A 2PI0A 1X7HA 2FE3A 2WEKA 4Y17A 4BIIA 3ZN1A 2J3HA 2EXXA 2VUTA 1PJSA 3HZZA 3VPSA 3H3UA 4EJ6A 3I59A 3KLMX 1O8CA 2VYNA 2WDZA 4GL4A 1C1XA 1YL7A 1QYXA 1ORRA 3GZNA 1I01A 4J2OA 4B4UA 3H9GA 4HKTA 4BNYA 2WWRA 3S55A 3K8ZA 5A02A 1G3SA 2C0CA 3PHIA 4E30A 5EESA 1SFXA 3PQJA 1MX3A 1ZRCA 3KYDA 4M1QA 3ZNPA 1PJ2A 3E5XA 4HA8A 2D1YA 2IODA 4Q4ZF 4QO7A 2HKOA 3DBLB 3WTBA 4I7HA 2B36A 1Y6JA 2W2LD 1MUUA 1D3YA 4BHCA 1YBMA 1PL8A 1LLCA 4XQEA 1KYWA 5K5OA 1V4RA 1EK6A 2B35A 4IIVA 4LVUA 1P1FA 3HN2A 5A5FA 3P7MA 3L4BC 3TDKA 3DFZA 4D41A 1FP2A 3F6VA 4OXNA 4CR7A 4NK4A 5ICCA 3VTFA 1MKMA 1KC3A 1I2ZA 1OFGA 2X5JO 4M9SA 4A5OA 2P8TA 1BJAA 1Y9AA 1E3WA 3NX4A 4KUEA 4R5HA 3TN7A 3S8MA 3B20A 4YJGB 4U7DA 5DEQA 2IYPA 5J8FA 2W4QA 3IP1A 3KXDA 4NFYA 4BO4A 5IDWA 4M89A 4E3ZA 3DFGA 3L77A 4IGEA 3O6BB 1L0OC 2YW9A 4E2YA 4IDCA 3ZWNA 4W6ZA 3VPHA 1YO5C 2VBZA 2PZLA 2HSDA 5JDCC 5CVVA 4FIZA 4A6EA 2Z5LA 4N5MA 2ZFWA 2AS5F 3RI4A 2HEOA 1DIHA 4CM1A 4OM8A 2AMFA 2D3TA 2VODA 5FF9A 4OIRF 4Q5SF 5COQA 3WXBA 3WFIA 4D46A 1P6RA 1BI2A 4E4YA 1JWAB 3QV1A 1PL7A 1JLLA 5DDIP 4IQ0A 5FYDA 3T0YA 3ZNOA 3MQ0A 3MOIA 3E03A 4IIUA 1IY8A 2ILTA 2ZMEB 3LQQA 3V7CA 4RAZA 3GZ4A 2PEXA 4HOBA 4JQFA 3D5TA 1AXGA 2NVUB 2A35A 1RUOA 4DMMA 2YX4A 2JPCA 4GLLA 3G49A 2IZZA 3D4OA 4NBRA 2VWQA 5L4LA 1JTVA 5IZCA 1QBJA 1IF1A 3D4NA 3W4JA 1YW7A 1D1SA 2NNLD 3K9QO 3COSA 4Q3CA 5KKCA 3PDJA 4YJFB 2W2KB 3AU9A 2MBFA 3GRKA 3K0LA 1TNSA 5JYEA 3U0BA 1G1AA 4RCVA 1HSTA 1DEHA 3R60A 2JZYA 3R0JA 3A14A 3IP3A 3MTGA 1M76A 3SEFA 4AJ1A 3K6JA 2F5CA 2WE7A 3P2OA 4KIBA 2ZTVA 4LSWA 1XGSA 2K4BA 2M1BA 3KHUA 4MIYA 2RKHA 2GNAA 3WR5A 4MJLA 1OBFO 2XGXA 3JQ8B 3I71A 1WWXA 1W5TA 4G8XA 1QV7A 1RKXA 1GV1A 1UAYA 1VSUA 3EC7A 4XKJA 3WGOA 4U0WA 2PGLA 1K6OA 4LLNA 5CVIA 1KY5A 5L7TA 4BO2A 3BMCA 2WC2A 4MINA 2CF6A 4YBZA 5IN5A 2PLAA 5HS8A 2DTXA 2RGVA 4OL9A 1OPCA 1XA0A 1RI7A 4KUGA 2VZ8A 3TSCA 3ZW8A 3EZLA 2FPPA 1GEGA 1DIBA 3R4KA 2E6UX 1O6ZA 5CDSA 5DUIA 4NQWA 3TO7A 4WK6A 4FFOA 1XQ6A 4BAYA 5BPIA 4KTTE 4M54A 1FSEA 4CQMD 4D3SA 4D43A 2LKPA 1MLDA 4IJKA 5LEKA 3IKTA 3R6DA 5EINA 3ZWAA 2K02A 1NFQA 1P2FA 4WLEA 3D0OA 3OOPA 1BGVA 3ZI0A 3G1TA 4B3JA 4CLOA 4UEKA 1T2CA 3FI9A 5HLGA 5CPBA 4E6PA 4PZCA 3U49A 1EH6A 1K89A 1P4AA 3T8RA 3FMQA 4CQMA 5KJCA 2GERA 1KU3A 1CF7B 3OP4A 5B4VA 1DUXC 4Z9YA 2FN7A 3GVAA 2ZJ0A 5K6AC 2DBVO 1MA0A 4JBHA 3AWDA 5DP2A 1P4XA 4EDFA 1FDSA 5JO9A 1YQGA 3S2FA 2VHZA 4Z0TA 2OBYA 4Z2YA 1XGNA 1OZAA 1B3RA 2HAEA 5H6RA 2XAQA 4ESBA 1P0FA 1PS0A 3AY3A 4QSMA 4RF2A 2F00A 4Y8VA 1HEUA 4NU6A 5MDHA 2RBEA 4NJMA 3C3XA 1YYVA 2XKOA 2JHGA 1F0YA 1MD0A 3D5QA 1K78A 3MZ0A 2V65A 5L3DA 4E2WA 2OMEA 4FBGA 4MPDA 1KEVA 2BFAA 1EQ2A 4DLAA 3V8KA 2PFGA 2PKQO 4BNCA 1XB4A 1S8NA 1R37A 4WECA 3RWBA 3KEQA 3KCCA 3EGOA 5TJHA 5JCXA 2VQ3A 3E5QA 4A0YA 2PZJA 3ZV4A 1RWBA 3CEAA 5DBIA 2Q49A 2LNBA 1N8KA 4P38A 1KETA 2HMTA 2ZQZA 3O26A 3PXXA 4J1SA 4RVUA 4YB8A 5FLXZ 2BI7A 3MAJA 1YQXA 2NM0A 2O7QA 2YUTA 1ZRDA 3EY4A 4KMSA 4XIJA 3WTVC 2J3JA 3H2SA 3RBVA 4CUKA 4J2HA 4WASA 4RQTA 2P5LC 3H3ZA 4I98B 1DB3A 1B7GO 3JD2A 3U1DA 3EUHA 1H6BA 1AHIA 5I8ZA 2OL4A 3AM5A 2Q1SA 3FPCA 4EW6A 1BN5A 2X9NA 1U8RA 1U3VA 3ASUA 4BNJA 2EWNA 2BI8A 3BTVA 1I36A 2B4RO 2WTBA 3DZGA 1YOVA 1KQ8A 3JYNA 5THQA 4E5PA 2OHXA 2X86A 3U9LA 2YYYA 3EAGA 4E0BA 1HWYA 1BXKA 3NUGA 4HQMA 2NU8A 1GUZA 3WICA 1XN7A 3JD4A 3PYXA 3UHAA 4WK8F 2OA4A 4J7XA 4LK1F 5KVQA 4J1NA 5IFLA 4GX5A 4BNZA 2L02A 2NV6A 1NR1A 4CM4B 5IF3A 1GZ3A 5G0TA 2Y0MA 1ZK1A 3KBOA 5ILGA 1YDEA 3VPGA 5DBFA 1NXQA 1XWFA 4DQUA 3GH3A 4L5IA 4BS9A 2HYGD 1WXDA 4WF2A 4CV2A 2H63A 3P9CA 3WDSA 1N9GB 1WW8A 4DQXA 6ADHA 5TRDA 5LCXA 2QYOA 3M8EA 3ZU4A 4WJZA 1DC6A 1ZK2A 1LA2A 1BI1A 1UDAA 4QFCA 4UV8A 3D4PA 4EMSA 4OMUA 5EN4A 3WSWA 3MCZA 2RH4A 3ZWXA 5TQVA 3PGXA 3PZRA 1Q7GA 1X0XA 3DBRB 3OQ1A 1WMAA 1Q0QA 1SPXA 4XLNF 1SFUA 2EERA 4XD2A 5F1KA 5BT9A 3WG9A 1T39A 4XJTA 1N1GA 4NJOA 1A4UA 2V1XA 2D45A 1OC2A 5TIIA 3HRUA 4RLHA 1FMCA 2Z95A 3HOSA 1D8AA 3KP2A 3QLJA 3UFXA 1ONVA 1GYPA 2PLYA 2PGJA 4DPLA 3RIRA 1U3UA 4MOWA 1O3SA 5HDKA 4PZEA 4RVHA 1MDMA 3CIFA 1F17A 2A6HF 1FBUA 5T5QA 4OMZA 2GR9A 1Z7UA 2A4KA 1E3JA 2VZ0A 4CMIB 3F22A 5JO0A 2PZMA 3KLPX 3Q1LA 3RC2A 5TX7A 4A0ZA 1ULUA 1ZJYA 2TMGA 2XF8A 4QTZA 4KTVE 4R8HA 4WLFA 3FXQA 4GWGA 1KA8A 5CJ9A 2W90A 5BSFA 3W8DA 3LA2A 2AW5A 1KC1A 3VZSA 4G2NA 1F4KA 4HUJA 3ABTA 2EFPA 4RGSA 1M75A 5A9SB 2O2SA 3J81Z 1XDWA 4MVJG 4YA6A 1BC7C 2BH9A 1SZJG 2OZPA 2HZTA 4O6VA 4MEXF 1CDOA 1VL8A 1O89A 3ZWYA 1FK8A 3P19A 5LBQA 4FD3A 4F46A 3ZNNA 1PS9A 4Q3EA 2P2SA 2OOSA 1DAPA 1EE2A 2M5WA 2V9VA 1OAAA 1JVBA 3E9NA 4IJUA 5CEJA 2GA2A 3NEUA 1MGOA 1P0CA 2ZATA 3H4VA 4C7KA 2QG4A 2P5VA 1NQTA 1WZIA 2FHSA 3V7SA 5AYVA 1R23A 1EFKA 2VOPA 5DCUA 2FBHA 1IRGA 4O3MA 4LJZF 4B8ZA 4ZJUA 2PKQP 4XRGA 1HKQA 2NWQA 1PP8F 2Z1MA 3Q0EA 5L53A 2HS5A 1XSVA 1C0KA 4A5NA 3JQ8A 4CHUA 1LEBA 4GLOA 4HNHA 4DTIA 5L3EA 1D1TA 3JQ9C 3D7LA 1LJ8A 1OMOA 1JU9A 5AXAA 1YIOA 3GVXA 5TT0A 4AJPA 3V8JA 2IZ0A 2Y0DA 3L9WA 1LC3A 1HKUA 1Y9EA 1Z75A 2D2WA 3MFKA 2HLPA 3H5NA 4GAEA 3PI7A 3LSTA 1XU7A 1ULYA 1LEAA 1R4NA 2IZ1A 1OKRA 1W7PD 1TEHA 1K6XA 2GZ3A 3MEQA 2O3RA 3EVTA 5LGUA 4ROSA 4HNGA 3HDJA 4M87A 3WYEA 4CM9D 2X5OA 4J7CA 1R1TA 3BROA 4KICA 3ONDA 1KIFA 4ITUA 1XDUA 1LNWA 3ITKA 2W8ZA 1I27A 4DMLA 2OZ6A 3KUXA 1FDUA 4OHUA 5ICFA 1W7PA 4FGWA 3BPVA 4RVDA 2FBKA 1ZNQO 4CM9A 4NU5A 2PG4A 3S2IA 4OJNA 1O7FA 1CQIA 2H94A 3N4MA 3A9WA 3NAQA 2FP4A 4KIFA 3GFLA 6LDHA 1WSUA 4KDFA 4AD9A 1DC4A 4Y67A 4CXFA 3K96A 4ZZDA 3PWKA 5KVSA 1PJTA 5KJFA 5TS3A 1YS4A 2BFPA 3GGPA 1HE3A 1P74A 1HXDA 2LDUA 4NPCA 4OU0A 3KM0A 3JAMZ 1IN8A 1Y8QA 4FOSA 3DBHA 3WGZA 3QHAA 5EMHA 2MH2A 4KDPA 4AWXB 2C2YA 5GZ6A 1GZ4A 1YGYA 1U8XX 4KQWA 3JD0A 3ZW9A 2OBPA 1GTMA 3CKYA 3HOTA 3QVOA 3WGGA 2NTNA 3TQHA 2AEJA 4YWJA 3VH3A 4BGVA 1S7CA 2Y1OA 1R0SA 2ADUA 4YDRA 2PKRA 3LT4A 1YH3A 1ISGA 5JW6A 2IXAA 3EQLF 2IJLA 3JQEA 4K6CA 5HS6A 4TQGA 3IDSA 4BNXA 4I5FA 2P7VB 4CMCA 2PR2A 4NIMA 4TKLA 2FQ3A 5AIPA 2YFQA 1PP7U 4ALNA 5HVQC 3E6AA 1B16A 1R4MA 5C7LO 5JYDA 1UB9A 2D2IA 3PJFA 1R1UA 4GSLA 4ZQBA 3ZHBA 3PK0A 2YQ5A 3WSVA 4AJ2A 2VYVA 1VJ0A 2JSCA 2I67A 3KZZA 3QY9A 3G3EA 3UKOA 4WNCA 2QENA 5I9MA 1USTA 2QZZA 1YTYA 4A6DA 3PRJA 4H3VA 3HB4X 1ZFNA 4PLGA 2V6FA 3RFTA 3ZWOA 3K73O 5HS7A 1JVSA 4QLCU 1WLYA 1V0JA 1LSOA 5FD6A 1KQ0A 4E5KA 3CMCO 2D0IA 2V6MA 1BI0A 5LDGA 2FZEA 3DF8A 1E2XA 3NDIA 4AJOA 2X8LA 3WTXC 1PGOA 1BM9A 2BE5F 4NBVA 2DLLA 2O3UA 3JQDA 4Z0HO 4HQEA 5ICGA 4BO7A 4ZYGA 4EZBA 3LVFO 3G0OA 3ULKA 1ADBA 3W4IA 2NNYA 2BHLA 2ZKLA 4H15A 1ZK4A 3N58A 4CM4A 4U0JA 2PBIA 4ND3A 3RYPA 1GZ6A 2Y68A 1LTHR 3NYWA 1XELA 4DLBA 3ZP5A 2B69A 3ROMA 1R58A 2HGCA 1E3LA 3E18A 1JWBB 1Z74A 2O3SA 3JQAD 4OSOA 3I4CA 4KDEA 4XBFA 1JHFA 1A7AA 2QQ5A 1R5HA 2DT5A 1N9GA 5TT1A 1H9TA 3U5TA 1ARZA 5CVRA 3OJ0A 2H9IA 3HSEA 4LVCA 4O1MA 1T2AA 5LGNA 1HKSA 3JQAA 3GEMA 4WCFB 2UDPA 4KN4X 3JYOA 4K1LA 5GY7A 4ID9A 4FC6A 4OIPF 5K1YA 1B3BA 2ZTLA 1QNTA 2G9WA 3V7RA 1T38A 1WP4A 2Q4BA 3ENKA 3H9QA 3QE3A 3QWAA 5K5QA 3BOQA 3JQ6A 2EV0A 4EM2A 2EV5A 4BQPA 3EZYA 4WLOA 4ZZLA 1S29A 4M74A 1UR5A 1MJ9A 4L74A 3WGYA 4CV1A 1U6GA 2BBYA 3L7WA 4TSKA 1F12A 4A26A 2VONA 3LT1A 4LK0F 3ZPLA 5JR3A 2Y1CA 4OQYA 4S3MA 2OUIA 3K69A 2A5YB 1ONNA 2UUOA 2WV0A 1JQBA 2G7UA 1PGPA 1LC0A 2HJRA 2TMDA 1I3MA 3GGGA 3JV7A 2XAHA 4W9NA 4DWVA 1B14A 2WYVA 2GXGA 3JD3A 3H9EO 4QXMA 4DBVO 1NAIA 3NT2A 1PZEA 3BHJA 1DRWA 2FOIA 3GVPA 3LC1O 4BQRA 4K6FA 2PN6A 3WYCA 4MNUA 4AL4A 1O3RA 3A1NA 4GPD1 2A92A 3F47A 3BZ6A 4MP6A 1PJBA 4MIOA 3RKRA 3OMLA 5D4SA 5A9SA 3OECA 1YVEI 3ZWCA 4KUHA 4O5VA 1ENPA 3DZHA 5D5VB 2P6SA 3KP6A 2YDYA 2XRNA 4K28A 4XB2A 3RQSA 5C7IO 4PLFA 5A2QZ 2FEZA 1LQTA 2AG5A 4Y6SA 3TZKA 3ECOA 3CTAA 5L4SA 4XQ9A 1R6DA 4E2XA 2B4QA 2EKQA 2X22A 3BJOA 3I58A 5I9LA 3F8MA 3VEPA 1KVRA 5DZSA 4XIYA 1T98A 2R7DA 2VTEA 2F5FA 3TGNA 1EQUA 4WLVA 1FDTA 1XKQA 3PYMA 1C3VA 4KOAA 1H5QA 4CQLB 2J5PA 1O5IA 2YQ4A 3RVDA 4A2CA 4C7JA 3RUEA 1KVUA 2FXAA 2M87A 4OOIA 4A2UA 1FZPB 3LU1A 1HRDA 3M1AA 3EW7A 1U5TA 2DAOA 4NBTA 4L73A 1K79A 5LRRA 4DYDA 2DTRA 1HKTA 3HIFA 4DNCA 2EFWA 3GOHA 1HDOA 1TXGA 2F1KA 5D5XB 4RPJA 3DP7A 2VWHA 4J1QA 1YO6A 3GLXA 4AJNA 4J4HA 3OIGA 4HBGA 5JSFA 1AN9A 4LGVA 1HZZA 2GO1A 1RUNA 3H9JA 1ZREA 1UDCA 2E48A 5A3VA 1DP7P 2M8EA 3R0IA 1VPDA 2RDPA 1O57A 1LLUA 3QVSA 1QPMA 3ZMTA 3ADPA 3QWHA 1HDGO 4F45A 3L07A 1QXSA 4PZDA 3WYBA 3K1MA 2NACA 2VRBA 3QRFF 2VUSA 5HBRA 4D7AA 1D8KA 5A05A 4YRAA 1FJHA 4TROA 4E32A 4QT0A 3JTGA 1R12A 4IMRA 2UYYA 3E6DA 2YZ7A 1FX7A 1OOEA 3U62A 4BO0A 3WGQA 1F14A 1N2SA 2Y99A 1H0KA 3GEZA 5CVJA 1NHGA 3ANMA 3AUUA 2Z99A 3D3WB 4NBWA 3ZHXA 5BSGA 2ZCWA 4J91A 3AOEA 3KZVA 4Q48A 4RS8A 1C0IA 4FFNA 1UZNA 4ZVVA 4DA9A 1LDYA 3T5XA 4TZTA 3M2PA 1XMAA 1E1NA 3RU9A 3PYLA 3ZZNA 3PWZA 4BO1A 3LWFA 3GN1A 2LDBA 1ENOA 3LLVA 5T6BA 2Q2EA 2KJCA 4U0KA 3OM9A 1G3WA 5D8KB 1WAMA 3JD1A 4GGOA 4L8VA 4A0SA 3MJTA 3RUAA 3JQGA 4JJIA 1M6WA 2O4UX 3R61A 1T1SA 3ZQ7A 4YVFA 1KQ9A 1EDZA 2RHRA 3HFGA 4CV0A 2VE9A 3IOYA 4Z0PA 1XSEA 1SBYA 2P4HX 4N18A 3RUCA 3HWRA 1FBQA 1I32A 2OFPA 3GXOA 4ZYEA 3HRMA 1FDWA 3QJ5A 4PVDA 4XYBA 1GDHA 4CV3A 2MA3A 4XGNA 3V2HA 2PD6A 4OQZA 4LN1A 2EW2A 4OYRA 4XYMA 4NG5A 4KWIA 5A2QK 3FD8A 3OQBA 4BGUA 1N92A 1SEPA 3GYHX 1CRWG 4L9JA 4ND5A 4D3FA 3LYLA 1U9JA 4J3FA 4WOJA 3ORFA 3VDQA 4XYLA 3AY7A 3DMYA 3BPXA 4HV4A 4EUEA 4QUKA 3OA2A 4UUMA 2UVDA 2GF2A 1Z45A 2R7FA 3RKWA 3OJFA 2J5QA 1IPFA 5KJ1A 1GPDG 1KEPA 1NP3A 1R1VA 4BHBA 1HZJA 2GCGA 1VM6A 4R5MA 3QP6A 1IW7F 3FMRA 1DBVO 1A72A 3AOEC 3GUCA 2EK5A 1G3TA 2VBWA 1D7OA 3UAGA 4P5OA 2Y1EA 5GMOA 4S05A 4ND2A 2ESHA 1FWZA 1S3JA 3DC2A 3ZHZA 5EJ2A 1NWHA 3GNTA 3QWBA 4B7XA 1NBOA 3DQVC 5AXDA 3ZWPA 5JAMA 1E3EA 1ML3A 4CLXA 2OBNA 1Z7EA 3WOHA 3ICCA 1GAEO 4RORA 1AE1A 2EGGA 3OBBA 3IWZA 1YLFA 4M6YA 4QFDA 5JDCA 3GMDA 4DIFA 2NTVA 5J23A 3AFNA 3OICA 4CLRB 2CY0A 3OJOA 1TT5B 2HRBA 1ADFA 1UP4A 5G4LA 1AUPA 3T7CA 4UUPA 3LF1A 3U4DA 2L4AA 3RD5A 1BBYA 2A69F 3WU0A 4D0PA 2FMLA 2MLKA 1NX6A 2I65A 3E9QA 3O9ZA 2EB7A 4ZYHA 2DFDA 2NQ8A 2NYXA 4RZIA 2SCUA 2CWEA 3DEYX 4K2EA 3SZTA 3GZ6A 1EUCA 4P4GA 2V6BA 3QPHA 2X0JA 4R1TA 4RB2C 4GBJA 1E5LA 4XJSA 1O0SA 2CDCA 2P4QA 9LDTA 4B7CA 1T2KA 2O8XA 5LEJA 2DTDA 4GX0A 2FF4A 3TO9A 4CYDA 5AIQA 4WXHA 2VHWA 2Q8KA 1VJ1A 1DPRA 4PG4A 3X2EA 4OMYA 3PLNA 4L75A 1IXSB 3NV9A 2Q2WA 2ETHA 1VL6A 1NVGA 2CO5A 2A94A 2ZQYA 3WS7A 5KCZA 2WD8A 2X58A 2XAJA 4LMPA 4R1NA 4U88A 5LRSA 3WWYA 1L1FA 3KLNA 2ZTUA 4EBFA 1FT9A 1YFHA 1P3DA 2TDXA 4YG2F 2GLXA 4Q3BA 3O8QB 4HLYA 4TVBA 2PK3A 2FOKA 5G4KB 3M1LA 4R9SA 4Z3KA 5BNIA 2CGPA 4LB5A 3WGHA 1I24A 1QZYA 1B4AA 2RVCA 1Q7BA 2GPTA 4YEDA 1Y8RA 4BO8A 1E6EA 5A1TA 2HWVA 4UEJA 2JAPA 4ESOA 4L18B 2H6EA 4LMYA 2JD2A 5E8GA 5CG2A 4IXAA 4HW0A 1I2BA 2HFHA 3OF2A 4GGPA 5EQFA 3HQ4O 1SD5A 1BI3A 1GXQA 1QYCA 5C5IA 3VOSA 4YYZA 1OR7A 3VFZA 3IWFA 3GO5A 3QP5A 2Q0OA 2RQPA 4LFUA 3ZV5A 4OSPA 3U9GA 4C4OA 5I7SA 2HK8A 2B0JA 1DIAA 3E48A 3I4PA 4CM8A 2Y93A 3CPSA 3B1KA 5L40A 5IT9K 3ROUA 4RB1A 3AUAA 2OQGA 4XEHA 3WX0A 5TSDA 5HWSA 3U2RA 4M73A 2QVOA 4TV7A 1W4MA 1AHHA 1PIWA 3G79A 1N1EA 4QECA 1Z9CA 1TNTA 4K9DA 4LSMA 3BZUA 3FBTA 5JFRA 4CQLA 5DCMB 1GUFA 5COBA 4Y9DA 3WTZA 1SAXA 1C0WA 4LW8A 4FX0A 3UOGA 4XYGA 2WD7A 4JLWA 4IUYA 1GY8A 1X15A 2DBQA 3FF5A 3TDZC 3FWEA 4EJ0A 1TLTA 5CAEA 5K6AA 1QP8A 4XDYA 3V8BA 2H09A 2DPDA 2X9GA 3K92A 5JPIA 1MJAA 2YV2A 3MJEA 4CGZA 1HDXA 4CMBA 1GD1O 2C07A 1DPUA 4XCVA 5DF1A 1J75A 5DCWA 1RPNA 2AXQA 2YHUA 1L3LA 4N9IA 2NQTA 1N7HA 5ITVA 5TRTA 3NJ4A 4II3A 4N5NA 5A03A 2K86A 3WNQA 1GCUA 3E97A 2G1UA 1RIOH 1S6LA 2VT3A 5DUKA 4HFMA 3QVWA 1P45A 3W6UA 3SZPA 3C1DA 1CJCA 5E1WA 5IXSA 1U78A 2JPBA 2O61A 3L9FA 3FNGA 5KTKA 2IVMA 2FY8A 2I3AA 3QVXA 3CUQA 1H94A 1YL5A 5ES3A 2DFIA 1TTYA 1J9IA 4BUCA 3T4XA 2XAGA 3K2ZA 2Q2VA 4UVEA 3CLOA 3GVIA 2Z33A 3OSUA 3LQRA 4R3WA 1H6CA 4NH4A 4FN4A 1UJMA 2MLGA 4TRMA 2DBZA 4H0EA 3H9UA 4B09A 2Y0CA 5A5EA 2KRFA 1HT0A 1WDLA 5TJJA 2EGHA 2QZ9A 3ZMZA 1XR3A 4MO2A 4CR6A 1Z73A 4U0YA 1QYWA 1YKFA 1OMIA 4L0ZB 2C54A 1R66A 5TC4A 2GDZA 3ROPA 3K9TA 3FZVA 4L5JA 3QU3A 2X0NA 4PVCA 4RDIA 4MVJF 3WJAA 2IT0A 3QPTA 4ESJA 5ER9A 1QV6A 3I83A 4DXHA 2OQRA 3PFIA 1LDGA 3PZBA 3WLFA 1R00A 2HQNA 2QZ8A 1I3NA 2R2GA 1FDVA 2CW0F 3EDPA 1K2WA 2FR8A 3FTPA 3FHZA 1IZ1A 2B4TO 3RIHA 1NYTA 5G0VA 1G6KA 2YPRA 5DCFA 4BNUA 5JY1A 4QEDA 5BSHA 3J7AO 2V6GA 2DO7A 3Q2IA 2EG9A 3ROKA 3N97A 1YQAA 5K0ZA 4BNVA 2FSSA 2F5DA 6PAXA 1IYZA 1IZ0A 3KYCB 5KWEA 4HP8A 5KNLA 2ZCUA 5DNAA 4AVPA 4YIFA 4N54A 4BXUA 5H6QA 3R6SA 2YFHA 1C0PA 1PQWA 2POQX 3UN1A 3QWIA 1KU9A 3GDFA 3VHRA 1AOYA 2R00C 4WUVA 4MVJP 1ZMOA 3QP9A 4ZQEA 1WKMA 1XYGA 2C59A 4DQ2A 1AWCA 1LI4A 1ZH8A 1LSJA 4L9NA 3QRWA 3B02A 3W6ZA 3CUQC 4EQQA 1R0KA 4GKVA 2O6GE 3KSDO 4G65A 1EH8A 3I9JA 1PGQA 3TFQA 3HSRA 1J49A 3BTSA 3TJRA 1YBVA 4TWRA 3UF0A 3F3XA 1N7GA 4WCGA 2EFQA 2HTJA 1X3UA 1Z6TA 1RNLA 1IUKA 2J6IA 2X5KO 2Y1GA 3BHIA 3PHJA 3UVEA 1UP6A 1W5SA 2EEZA 5L3GA 3QIVA 5GZ1A 2Y66A 5JE8A 3UW3A 4ALMA 4ZH4F 1U4OA 2B37A 3VH2A 1XG5A 5IAAA 3I3OA 4CUZA 3HDYA 1TLHB 3F8CA 4BNHA 1TW2A 4ENJA 4ASNA 4ENNA 2JFFA 3W1VA 3HHPA 3WMWA 4IS3A 3IRRA 4AJEA 3GAFA 5F1OA 4EI2A 4BYYA 3NRCA 1PS8A 3AI2A 3RUFA 4BNFA 3TRIA 4CLRA 1ZKMA 3VZPA 2ISYA 1ENYA 3GVHA 3FF4A 2GIVA 2HRZA 4DRYA 3AAFA 2XAFA 3AJRA 3NGXA 3ROQA 4MKRA 3Q5FA 1G0OA 5D8LB 3HUDA 3RUIA 3F9IA 1SMTA 3NT4A 4DREA 2VUUA 2BKAA 3ANLA 1ZSNA 2K27A 4BQAA 1CYDA 1STZA 1I2CA 2H5LA 3TF5A 5LC1A 2CQKA 1BHSA 2DW4A 1VKOA 4L76A 2IRWA 1WI9A 3DBLA 3RC1A 4UXNA 3ULQB 1G4DA 1MXFA 3ANNA 1MZBA 1DOHA 3OIDA 1ZIDA 2Y1FA 2HDHA 4Z3DA 4MVJA 2GN8A 4E33A 1E0DA 3IRQA 2M30A 2HO5A 3RJ5A 5L7WA 1JKIA 4JBGA 3FR7A 4OGWA 4EUFA 4D0RA 5DD4A 1CWUA 4L4RA 1I6XA 3GZ5A 1WDMA 1ZSYA 2GRAA 2FZWA 4KQXA 1EVIA 4YAJA 5AXBA 5CVUA 1W8DA 1IN6A 3TZHA 2X9VA 1YS6A 2STTA 2GASA 4YJGA 5IZ4A 3RSHA 3BWGA 3TO6A 3GHYA 4JP3A 4IZHA 4EEXA 1VL0A 2IE0A 5CDYA 3DMTC 1P1JA 1BSVA 4IDFA 2DBRA 4EM0B 3JQ9A 3M2TA 3PGJA 5CYVA 3BYZA 3I6QA 4LB6B 4Z6KA 3ZMUA 2WMDA 2WM3A 5G4KA 4AJ4A 2FMUA 1CERA 4ENMA 3IC5A 2VOJA 3LT0A 4E70A 3GF4A 1AGNA 1GQQA 4YQZA 5JCJA 4BNTA 2A9FA 2NLOA 4RV9A 2COMA 4N0BA 2WYWA 2E49A 5A04A 1I5RA 2E4AA 4MQVA 2ZK7A 4RVGA 5H81A 4IDGA 3T8TA 1DFIA 2GN4A 3Q2KA 3N7UA 1A04A 4L4SA 4GWKA 2DQLA 2ZMEA 1B2LA 3ENNA 5FFXA 2JD1A 4FJ1A 2XUBA 2NVUA 3E9MA 4YIIA 4IDDA 1EV7A 3WODF 5THKA 3VH1A 4OH1A 2E7WA 5AQ1A 4BO9A 4OIOF 4YJHB 1GR0A 2EKLA 1BVUA 5F5NA 1ADGA 3OJEA 1SB8A 1K6JA 1FOKA 4ZD6A 3K1NA 1H9AA 1WQ2A 4E5NA 2FR0A 5JY6A 2PGDA 3GC6A 5I7VA 2EHDA 3KYBA 3AY6A 5LHIA 4FQ8A 4EJTA 5FLXK 3PVZA 1K7AA 3VZQA 1M6HA 1HE4A 4JQCA 2EA2A 1H2HA 4YJFA 3LC7O 2W2KA 4XQGA 2AHRA 5DT9A 5ICMA 1GV0A 3P9IA 3D0SA 3JSAA 1JN0A 1YS7A 1U7HA 2NRAC 1WDKA 4JBIA 4GKBA 4UVIA 1ZEJA 2HU2A 3I5MA 1ISMA 1DIGA 3D64A 4J4TA 3S2EA 4Y6PA 4EJWA 3VOEA 1I1SA 3BY6A 1P33A 1DSSG 2BEOA 1A9YA 3FSRA 3OEYA 4FJ0A 1RZ4A 3HDHA 4PLZA 5AVOA 2O23A 4CPDA 4M71A 2IEDA 3C3WA 1OYIA 5D5WB 1EVJA 5H82A 2QQAA 5DOVA 2O3FA 4UUNA 4JXKA 1HW5A 2OAZA
chains in the Genus database with same CATH superfamily
4LG0B 2KFDA 4BVAA 4QPQA 4TTPA 2X3YA 3QSGA 1KRHA 3SQXA 4UHEA 4HRIA 4JBAA 1XHFA 3MUNA 1NQ5A 2GBPA 5IDXA 4Y30A 1LE8B 3I9V2 4J19A 3VPRA 1E69A 4PZUA 3RK0A 1NNLA 2IYLD 5IN4A 1Z17A 3P7NA 4CMEA 1EAMA 1JXAA 3H87A 4Y0VA 1USWA 2OP0A 5GP9A 2XPCA 4IHXA 1N9ZA 1OGIA 4G6DA 4D6XA 5K8VA 2FDXA 1EGHA 5B6IA 1OSNA 4E07A 4C03A 2YN4A 3USES 4L6CA 2X5XA 3LL7A 2VYVD 3RO7A 4XORA 4MS4A 5A0FA 1S3GA 2J5BA 4QBFA 1ZA1A 1BXGB 1M67A 1XLVA 3R77A 4QEKA 2ZG6A 4LUCA 4JSYA 5B7GA 2G72A 3O9VA 4AD8A 1GUYA 3OPXA 3M49A 1EFCA 1OCZH 5EE5B 1NFRA 3T35A 3RRYA 4HAZA 2GPWA 4WA8A 3CVXA 2EIKH 2I9PA 1UCRA 2JA8J 3SC6A 3EZ6A 1NG7A 3SX4A 2E60A 4WNYA 1CUFA 4LMRA 2X0LA 1EUQA 3MLEA 3N2NA 1TLLA 2R1TB 1P62B 2HRDA 4EY6A 4F8YA 5EEHA 2FG6C 2R8XA 5CNMA 3DO5A 2ZPUA 4RMNA 2HNAA 5DHPA 2R44A 5M29A 1JFSA 2WDPA 3VYTB 3FXRA 1C4WA 1GQYA 3UGTA 2QRGA 1W6RA 1L8XA 3EVAA 3TR0A 2XGJA 1QRSA 2CNLA 2BYVE 2KRCA 4YV1A 3DWEX 1X13A 3W8RA 2PT6A 4XM3A 1LZKA 1QRRA 1OLSB 2DR0A 2FRDC 5FNVF 5AW5A 1E1RA 3S40A 3WLTA 3S6JA 2JIRA 4XDHA 4B9EA 1GM5A 4KDRA 2P8JA 4IKPA 5BWCA 4KUMA 5CPFA 4EH1A 2WU8A 2RKWA 1MC4A 4O4IA 3BTIA 2VDLB 3ZUPA 1UL1X 2C61A 4B4DA 5JD4A 1SVWA 1JPVA 1MBGA 2PSHA 5D3MA 2YY6A 4ZHSA 1ZG5A 3UJHA 4TTIA 4UM9D 1VC2A 1QCZA 3NEPX 5GVSA 5DYTA 2Q5IA 1XXHB 1CJBA 3EIUA 2LWIA 2XT0A 1FUEA 5D3QA 4JI3B 3F2VA 2TSYB 1L4BA 1D03A 4TVSA 1OTYA 4Z0NA 4G7HF 4LBWA 4FOLA 1BQEA 3NHKA 1UEJA 2PO5A 3L2WA 1UDBA 2LTPA 2A7QA 2VDNB 2UZKA 1E3IA 2VWPA 1M8JA 3V6LA 3IEVA 1Q0LA 3NBUA 1XMKA 5F2NA 1MJBA 1IVYA 1VPWA 2CSOA 4QQFA 5BUZA 4V02A 2AC2A 3HUGB 2F3TA 4AY5A 1E5VA 1M2GA 2MFZA 3LPNA 4MXDA 1FFXB 1XAGA 1DUSA 4CKCA 4GP7A 4V0LA 3LJKA 4I6JA 2J9ZB 1NR7A 3LXUX 2CJWA 1WB9A 4FGZA 3QFFA 1MEOA 1PZMA 1GGJA 2WJ3A 3LSKA 1I1GA 1DTWA 2H16A 2HQ1A 2P1ZA 2A07F 2G0TA 1E79D 2GKGA 1F43A 3R75A 4G85A 2WTEA 2L9VA 1T1IA 2W6ID 3CZ4A 3G1WA 3WNDA 2BHRA 5JSKA 4QICA 2WJJA 3PDIB 1T5SA 4NH0A 4A7PA 2QDKA 2L3DA 3C7TA 1FBSA 2O2HA 3ZE2B 1U8BA 4QIWN 2GEDA 4G63A 4KLAA 3WK5A 4EA7A 2HZ7A 1VI2A 2VS1A 4R1QA 1RXUA 3S1NJ 4MS3A 2ZIXA 1AQUA 2Q99A 5IT4A 1Y6QA 2O0YA 3IDZA 3R5SA 1TVEA 2IHNA 4EGJA 4M1EA 2VHJA 1V7QA 4I9NA 1U2GA 3TSAA 2I76A 5DEOA 1S7OA 2BP7A 5HJ5A 4C4YA 2YQZA 2I71A 1E7MA 3ZQQA 2UVQA 3KWJA 2ZSHB 3BS4A 1XTKA 4ZOLA 4C88A 5D2CA 3KELA 3NKFA 1N8SA 1Y1PA 2ECKA 3E27A 3U2QA 4DIQA 1G3UA 2W84A 3FXKA 3OJWA 1W4ZA 2YRWA 1BX0A 2P35A 3OWXA 5JAIA 3NXSA 5GAJA 3ASVA 1HX7A 3ZCUA 1FP6A 1E9SA 2WLSA 4PO3X 5A3JA 1QGOA 1MOPA 1KU7A 4LWZA 5ADVA 1FPMA 4BKQA 3CNOA 1CQZA 3FM5A 2H0RA 1IAWA 3LLMA 2BYTA 2C5EA 4U3JB 2KT0A 5DO9A 1JMKC 3SE0A 3Q3JB 2FEPA 2OCXA 1ON1A 5A1JA 3HKDA 2CXNA 4NC6A 3GHHA 4O4LA 3JW4A 1Q0TA 1BS1A 3DR5A 2EL7A 2M1XA 2P30A 3IVXA 3EETA 3H1AA 1TEZA 3OETA 5WRFA 5FL7A 3OZXA 5G4KA 5BQFA 1IULA 4DQLA 1O8BA 1GAQA 1PUFB 2VYFA 4N12A 2OAQ1 2VJIA 3QYPA 2LBPA 3RF6A 4QPJC 4U5XA 3I8OA 3ASOH 3GJ0A 3EEYA 2D1HA 3RIMA 4CMGA 2JLXA 3I4NJ 5HE9A 2I9KA 1WVGA 4L5YA 5KI6A 1GZ5A 4UNSA 2EINH 1GPYA 4X6UA 3DP9A 1V3FA 3OBIA 3PFWO 3GGCA 2JQ7A 3WLAA 2LSOA 1K7XB 4HGYA 5EE3A 1C9DB 5F4BA 1ZUIA 4LQCA 1BXZA 4Q3DA 3SHFA 1OHHA 1BTOA 1N5MA 1XAHA 4K46A 4LXXA 4Z4FA 4AUNA 4O8CA 5AESA 4JLMA 2UUPA 4Z4CA 4RPGA 1EA3A 3V1KA 1LDJA 1X2MA 3QVVA 2V0CA 1J0EA 4HEJA 5EQDA 2VSFA 5FOXA 1SVLA 1G20E 3P2KA 3D9QX 4PS1A 3GK3A 5LYJB 4YACA 4LY9A 5GV7A 4WGGA 1SCUA 5GTHC 3VISA 2DB3A 3LA3A 1WUYA 1H4SA 4GFDA 3DJFA 4W7IA 2Q2EB 2C3OA 1D09A 3S3TA 5DYNA 1SIUA 1Z2PX 1B9NA 1FTTA 5BY2A 3K70B 1ESCA 4LY3A 1U7OA 4U8HA 3LMKA 1PNTA 3B6MA 2D8MA 1MMFB 4ZEVA 4YT5A 2FK8A 1TE2A 4CDGA 4L7QA 1LVUA 1GU7A 1DT5A 5EJAA 5FI3A 3OYMA 5C3MA 1YJWI 1R3DA 2WZQA 4GDMA 4PLYA 4DEVA 1M1NA 2GSDA 4QJ3A 3BAFA 5IBQA 2M45A 3IMKA 2QNBA 3R7NA 3SK0A 5I9BA 2VSYA 1KYIA 1T2DA 5AR1A 4I01A 4M6WA 4PG5A 4E15A 3IIMA 2ONZA 4JT2A 2G4LA 2OZUA 2FA9A 421PA 1WQ3A 3U7JA 1NHWA 2BHTA 1SQSA 2V6EA 3HDQA 4S1VA 1Q3KA 3AR5A 1WZ2A 2FWAA 3M1EA 1Y8RB 2CKDA 2Z2YA 5CFPA 1JXQA 3EVNA 4DNFA 5H16A 2W98A 2B7BA 1FLIA 1ZUNB 4PXAA 2JFUA 4PHFA 1HW2A 4KPFC 2W2QA 2OYCA 3CYFA 5DGCA 5I4IA 5IVHA 1B8UA 4P1WA 4FDAA 1YQUA 1D0VA 1V41E 3GPIA 4OI1A 3ZIUA 2WKQA 4RGBA 2XDWA 3INTA 4OINF 1XXHE 5BT8A 4CEHB 3CZRA 4BAUA 5E8JA 3QA3E 1U11A 1XVVA 3FH0A 3TQRA 1QPZA 2FG5A 4RJTA 2ZTMA 3OCYA 4L15A 1YFKA 4C06A 2WF7A 4H4CA 4M3DA 1DMSA 2VJLA 1WJBA 2JJ2D 2OTLI 5DIZA 1GYRA 3QG1A 3B1FA 4FINA 2VA8A 1ZCJA 2B8NA 2AEEA 3ICOA 5JFTA 4UVDA 4NE9A 3P9SA 2HBQA 1HNZB 2HWXA 1M5RA 2H00A 3CLVA 1CBUA 3FTFA 2JA6J 3PSIA 3BGWA 5CDTA 1QIIA 4P8RA 1FU8A 2YV3A 1IU9A 2MC4A 1OJ7A 2VSQA 3ZQHA 1JSRA 2JBHA 4ER5A 2ID4A 3UKGA 5J6XA 3G0HA 5DN6D 1M1YA 2ZYTX 2DYSH 2COBA 1OD6A 5EUQB 2VUTA 4EG1A 4WA7A 4XWTA 121PA 1H5NA 2QY9A 1ZBDA 2NU8B 4HKTA 5FH9A 1U80A 4G1FA 2VSOA 4QO7A 3DKYA 3EPHA 1CJKC 2FTKE 5AD1A 3FFWA 1KYWA 5K5OA 1P1FA 3L41A 5A5FA 1XCOA 3DKKA 5C52B 4MWZA 2FSUA 1TYAE 5LR6A 5DEQA 2CLOB 1IY9A 5AHWA 3IURA 4A3IJ 2PZLA 4JASB 3ZBQA 3OT1A 5CCXA 4CM1A 4OM8A 1UBFA 3CIOA 4Q5SF 3RHZA 5I3ZA 1PL7A 5JT1A 3FHJA 2R7NA 2HU9A 2DPYA 1N6RA 1QNFA 3O91A 2AQFA 2WHXA 1ZIXA 4Q3CA 1DEAA 3GRKA 3PUIA 4RCVA 1Y5LA 4KN5A 4TV8A 3SJCA 3G02A 4F7WA 2F5CA 5M3FJ 3I34X 1XRPA 4QREA 4UNPA 4FXPA 3IB3A 3BMCA 4YBZA 1OR7C 3LXMA 3TSCA 5IUNC 1ATZA 3CKLA 2RGWA 5BPIA 3OOPA 3QNWA 2ZBUA 3KVYA 2QLMA 5KJCA 3H97A 2LGJA 1KU3A 3U4GA 5JO9A 4OTZA 2OBYA 5TGZA 2H85A 3D1JA 1D5CA 1N4DA 1S7GA 4NJMA 5HFJA 1GGMA 1J8YF 4K88A 1M6NA 4DLAA 1BOBA 5KNCH 5LM3A 3OJXA 3THYB 5DYIA 2A58A 2V59A 4EMUA 3ORYA 1DB3A 2E5NA 1KEEA 1H6BA 4IEIA 4EHNA 2JH9A 3AM5A 1BN5A 1VG8A 4RDXA 4FYJA 3IUJA 3ZY4A 5BW5A 3O8CA 2WTBA 2PCJA 1QIJA 1XN7A 3PYXA 2GLOA 1K0FA 5IFLA 1NR1A 5BSTA 3KQHA 4A2QA 3KP1A 1W0TA 2HYGD 5BWOA 4DQXA 4D3XA 4LNUA 1CW2B 4N9WA 4CEIA 1PQYA 1X0XA 2PSEA 1Q0QA 4XD2A 1SFUA 4ENVA 1M5UA 3OOJA 2BR5A 4RLHA 1O0BA 1XCMA 2FZVA 2AIRA 3O83A 3ANSA 4BEJA 4RJ2A 5C46F 1R9JA 3I55I 4WLFA 2W90A 3N7TA 2R93J 1J90A 2ZIVB 4QGGA 1SZJG 1QOPB 2XTZA 2O5VA 2QD3A 2XE4A 1XV5A 2M5WA 2XNDD 4NYJR 1WZIA 3MRSA 1R23A 1IRGA 1Y42X 3GLGB 2ZIEA 3W05A 1UKVY 4X94A 1K3FA 4AJPA 1PX2A 2RBGA 5IC4A 1A2BA 3LXRA 4F2PA 4DDTA 2GF0A 3IH5A 3O8DA 2D2FA 4LS3A 1IDN1 3GMTA 3D2BA 1FDUA 4C9YA 5AUOB 2H94A 2FP4A 3IBFA 1AV6A 4J2TA 3PWKA 5TS3A 1HE3A 1J8VA 4HXFB 2ZFUA 4OU0A 3IKMB 2XCQA 2Y69H 2MH2A 1A7JA 2BBWA 1GZ4A 3C2BA 1Z5PA 1QCCA 3AKCA 4DW6A 2NTNA 3T3EA 2YC2C 1R0SA 1EX6A 1EINA 1YFJA 4AM8A 4RIHA 1OV6A 3LW7A 1YCGA 1JDPA 1HFJA 4ER0A 4FFBB 1C3OA 3VZDA 5DGHA 4B75A 3QY9A 3G3EA 2QENA 3QI7A 1Z56C 4P5PA 2LY9A 3K73O 1JVSA 4QLCU 1V0JA 4DCCA 2JLVA 5AHOA 2V6MA 5A3SA 2IOQA 3MKWB 2CEAA 4BX9A 4QYWA 4HQEA 1Y3FE 2IEZA 1UEXC 4RA2A 1XELA 4KWEA 3ROMA 3E18A 3C45A 2O3SA 5ALGA 1A7AA 2CNDA 4O4JB 4X3OA 1ULZA 1ARZA 3EPRA 1EX1A 3KKMA 4XVQA 4K9MA 2Q4BA 3BDIA 5C4XJ 3TMYA 2X7JA 3JWIA 4C3VA 5P21A 2BBSA 2UZIR 1E2IA 2WYVA 2GXGA 3JD3A 3K6GA 3NT2A 2BFCA 1WCXA 1YMQA 3IMCA 1GG2A 3EDYA 3HS3A 1RJFA 4GPD1 3BZ6A 1ENPA 2J41A 2YDYA 3IKJA 3C16C 2P9YA 2HB6A 3LM8A 3RU3A 4J7AA 1TM4E 2WM2A 4E7ZA 5CLIA 3L0IB 4CT5A 2E2WA 3DG9A 2FDRA 4MV4A 1UWCA 4G0PA 3FVTA 1H2YA 4DDUA 2NZXA 4LECA 1HZZA 3KPWA 3D0RA 1OFHA 5EJ8A 1OT5A 1HDGO 2F3RA 2ORIA 3FDJA 4TKUA 5D86A 3M4YA 1VOTA 3WL3A 2Q0HA 4FGKA 2CXPA 4EVQA 2OCDA 3BB4A 3EAFA 2XTJA 3T5XA 1J99A 2M6KA 2VKHA 5PNTA 4PTZA 3Q8KA 3HCAA 1IQ0A 2JVIA 3H4TA 5IH7A 2L7ZA 1GDHA 3L7AA 4OQZA 3WK8A 3DMRA 1L5LA 2OT3B 3R3YA 4K9LA 3FCYA 4WOJA 4JOBA 1HLGA 3AHCA 5DGXA 4LK2A 2X0FA 3QP6A 2IHBA 1P4SA 1DBVO 4XSVA 4KQJA 1M2FA 2JLAA 5DTRA 4GRDA 3TXXA 1DX9A 4A0QA 4CLXA 1GAEO 1HUQA 1AUPA 3CMYA 1NX6A 3RLIA 1AHPA 4LXYA 4RB2C 2OBBA 4LF5B 3RM3A 2WG0A 2BM0A 1VL5A 4P7FA 3PE3A 3QLEA 4LMPA 3EUAA 4UCQA 2F1RA 4F92B 3V8NA 1RS0A 1R49A 4XX0B 2ZRAA 2Z5FA 3UTCA 3ILHA 1IM2A 2RE8A 1YASA 2EGUA 1BEUB 4MA5A 3IWFA 4C4OA 3WHBA 3C39A 2LD5A 5IT9K 4G5QA 4XEHA 2IPXA 4QECA 4Y2HA 3IEIA 5E3HA 4FHGA 4P82A 4QXOA 1AC5A 1GY8A 1X15A 3Q0TA 3CJTB 2M4KA 2H09A 1H8HA 4DT1A 1GD1O 5DWQA 5K45A 3G5UA 3S2UA 2XGOA 5E1WA 1P39A 4A93J 3QVXA 3T4XA 4ON9A 3HJEA 3G2BA 1OUMA 3DDSA 3HEFA 3IE0A 4YFVA 4NPAA 1Z73A 4YMIA 3QU3A 3NV7A 1XVIA 4XR6A 2Y4OA 3COYA 2HQNA 1C81A 5HIAA 3SDZA 2L9RA 3CCMI 5KWEA 4AVPA 3B13B 3GLTA 3DPIA 2R00C 3ROEA 3M6LA 5HKOA 3VZCA 1O0CA 4RACA 1ZH8A 2VDPB 2ATEA 2Z8YA 2BJVA 3QY0A 2HTJA 3GJYA 4OSEA 3F6EX 3VNBA 4CUZA 3ZE0B 4OHBA 4EI2A 2R7TA 1G60A 1V8OA 3WJ1A 3NWBA 1ODFA 3SKYA 4D82A 2HFJA 1EKEA 1ZOLA 2QJFA 4OP2A 4GBMA 2OZVA 3NT4A 2V03A 4G4IA 3ANNA 2V1NA 2W00A 4BKMA 2I55A 5BYBA 4D0RA 4EFNA 5FDFA 2KX7A 1N6NA 2A6PA 2FN3A 1WNFA 1YHZA 5CDYA 4W5NA 3T3DA 1P3JA 4LB6B 2IUFA 2OAGA 3HG9A 5IJ0A 1JEJA 1I5RA 4MQVA 3T8TA 4DUGD 3Q2KA 1A04A 4BN5A 3NHSA 1L4LA 4EBBA 3GLGE 1UOQA 2JD1A 3C3EA 1NBMD 1JFVA 3E9MA 3FFXA 4WUTA 2EKLA 2NU6B 2Q5EA 2EBFX 4BEHB 3OJEA 1JIVA 4JMPA 3KQYA 4JVLA 2EHDA 2Y71A 4JKIA 4DBRA 4RTLA 1H2HA 5A2GA 2NRAC 3D64A 1DIGA 1CQJB 2NO7A 3BY6A 3WLRA 3OTIA 1L7MA 1IRZA 4MS1B 3S44A 1NRWA 4OK3A 4UEOA 5K7ZA 2ZMEC 1B43A 2H6BA 1TFUA 4EA8A 4YX9A 2JFGA 5LKRA 3HFSA 1PLLA 2QX8A 4FR5A 3VC2A 2PX0A 5CJJA 4LF9B 4TWIA 3OYGA 3E53A 4N6OA 1ZC4A 2ZAYA 1D2EA 1SOWA 3ZJVA 1Z37A 5C8YF 5E20A 1JAYA 4YHBA 1CS0B 5IBPA 1Z82A 4ZGBA 2PWZA 4XKVA 2EV9A 5FQNA 3GNQA 3WZ2A 2L54A 2WF9A 3IAM1 4J0IA 3KJXA 3R9IA 5CNJA 2BC9A 3H9BA 2P90A 5KWVA 3DT9A 5ERIA 1PT8A 2B30A 3UHOA 3LUHA 4JLUA 4C2TA 5ALJA 1KIMA 1USVA 1JPNA 2HCTA 3EZGA 1EWYA 1UCFA 4LSZA 3B6ZA 5HDBB 3BZWA 4WFQA 3N0RA 3ETDA 3ZD8A 2P9EA 3LI2A 1ECJA 5HF8A 2XDVA 2ZR9A 3HDVA 4N3NA 3MKYB 4HD8A 1PP4A 1XUOA 4G81A 2W82A 4E21A 3L6DA 1YB1A 4Y1EA 1EBUA 1P5JA 1OREA 4BFCA 5EMNA 2NUPA 4UUVA 3HADA 2HMAA 3O6VA 3TW7A 4FB5A 2XKBA 2DQYA 1U3GA 1ZK3A 4CVNA 4OGGA 1Z0XA 1IDYA 1PK7A 5BSEA 4GSKA 4R8RA 4PX9A 3QELA 4WNAA 4IOAF 3K31A 1EB8A 1Y1RA 1OBCA 2FRXA 3FWHA 5G1PA 2P9ZA 2Q4TA 2BGKA 3SYKA 3AF4A 2VBXA 2PIAA 2FXVA 2P1RA 1P5HA 4GR5A 4RH3A 2PQ6A 2ZJ2A 1VE9A 2QQ8A 4ENUA 4MKHA 4EMTA 4F21A 2I54A 1Z6RA 3CVUA 2CBZA 3UA3A 5E17F 2L82A 5T8KA 1Y7TA 3NT5A 3DW3X 3EODA 2E1PA 1Y1KE 3T7IA 5EIAA 2PL5A 3DZCA 3PVSA 3U6BA 3E9EA 2JRMA 3WADA 3DMGA 3MVEA 4GT1A 3C3CA 3OLXA 1E1DA 1FTGA 3QOWA 4UD6A 3C0KA 3LWBA 4KREA 1UQUA 1OXMA 3UJ3X 1Z0AA 2XZPA 5A3QA 1TZJA 4Y2VA 1N3IA 1FMJA 4JK1X 3PENA 4OD0A 1NW9B 2X0DA 4CQMB 1J2JA 3BHNA 1MT0A 5FNVA 3BXZA 2BMAA 2O8EA 4PV7A 5TQJA 3S8EA 2PX3A 2XXJA 5HCUA 4DYVA 3FZYA 4IMPA 2R62A 4OYHA 1F2UA 4ZPJA 1XVLA 2PTGA 2YS9A 4FT4A 2PNFA 3WRVA 3B5IA 2WIJA 4L4XA 4CJXA 3CCCA 2C2ZA 1C4OA 4CZCA 1O95C 1AK9A 3O4JA 2CHVA 3VAYA 3W8NA 3GRAA 1I50J 4RPKA 1MNQA 3G73A 4AJIA 3CDHA 3U7QB 4A3LJ 1G3YA 4KOEC 1YB4A 5EF6A 1OCPA 4YT8A 4CM5A 5JC8A 5HTKA 1GV2A 3JTMA 4HLUC 4GX1A 3C85A 1XMXA 3RYHB 5CFQA 5M3MJ 3HB5X 2YWGA 1T43A 2NUAA 5DYMA 2EQAA 3AJ9A 4QKQA 1DBWA