3WG9A

Crystal structure of rsp, a rex-family repressor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
209
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 74
structure length 209
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wg9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wg9A02
1VE9A 3I9JA 2VNSA 1SCUA 5L3GA 1TTYA 3ZW8A 1QQIA 2AQKA 2R6JA 3HNPA 4AJ4A 3RCBA 3DWFA 2H27A 4GGGA 5DZSA 2BEOA 3DFGA 3K8ZA 4BNGA 3H9QA 1RIOH 2H09A 3LA2A 1EQ2A 2UUPA 1WRJA 5F1KA 4KDEA 4HF0A 3ZN0A 4N54A 2QIOA 4H0EA 4TMFA 3LC2O 2NLOA 1VC2A 4O5OA 5F21A 5TT0A 3WYEA 3K5PA 2IRFG 5DCWA 4AVPA 1JKIA 4W7IA 3Q1LA 4JP3A 3RIRA 1MGOA 2EP7A 4BO2A 4KFCA 1P45A 3WTZA 3DKWA 3F21A 1UHWA 1BMDA 1LLUA 5BNFA 1E7RA 5TRDA 4A5MA 1LEHA 2RGVA 3C18A 4UV8A 3GMSA 5LHGA 5EMHA 1RNLA 1PGJA 4OXKA 3HRSA 2O3FA 2DPUA 1LSJA 1NX6A 1CF7A 3ASVA 4D0SA 4L9TA 1P1FA 4PVDA 3FSRA 5EEGA 4BNLA 4NQWA 5DV5A 1OBFO 1IN6A 4TRMA 3DQVC 4CM7A 1B15A 3ETGA 1J75A 4I9NA 2FPGA 1BG6A 3GN2A 3KYCA 2FBKA 2XPCA 2GGSA 4XQEA 1WW8A 1NNUA 3SJUA 3NGXA 4CICA 4I02A 3I54A 2C29D 3V8LA 3SLGA 2BV6A 4BNKA 1GEEA 3NEPX 4YTEA 1ZK4A 4P55A 2UVDA 3C7DB 4DIOA 1MC4A 2XAAA 4IDGA 4QTZA 3WIDA 4MVJM 5ILVA 4CLXA 2HQ1A 3PJDA 2FWMX 1I1SA 1ZCJA 2DFVA 2A69F 2DQ4A 4XB2A 3HUGA 4EGZA 4L4XA 4EJMA 3DEUA 3GK3A 1BWSA 2GCGA 3EC7A 4RO0A 4FC6A 3EZLA 4R01A 2EP5A 2GN8A 1XSEA 1G6NA 4J9VA 4U5QA 1PL8A 1FT9A 1A4IA 4DQUA 1MG5A 1C1XA 1KEUA 1N2SA 5JC1A 4S04A 5DULA 1JLLA 1PJ4A 3W6KB 1U5TC 3VH2A 1MD0A 3FWEA 3WTTC 4RGXA 3R60A 2X9NA 3DAFA 3EYYA 1GEGA 2JFHA 2Y1CA 4FDAA 4KDFA 1ZMOA 2K4BA 2D8AA 4U6QA 5H83A 1QG6A 1QYXA 4NU6A 2NTNA 1N92A 3BZUA 4A7PA 4M73A 1BXGB 4HX8A 1IF1A 4W82A 4U7WA 4Z9YA 1ZSYA 2EV0A 5A3VA 1YQDA 2KKOA 3E8XA 4RGUA 1ZJYA 1YB4A 2VYVD 4YJFA 5JFOA 3C1TA 1B8PA 1KC3A 3LF1A 3RC9A 3C85A 1E1NA 2RKHA 4EUEA 5BPDA 1E7SA 2JRTA 5LBQA 4X54A 4GYGA 1HL3A 2D2IA 2W4QA 3VPSA 1O3TA 3CXRA 2W57A 1YBAA 3E6DA 2RQPA 2IZ1A 3O8QA 4Z9XA 1VL8A 3CTAA 1J4AA 4RLSA 3ZMUA 3NTQA 2MLGA 1Z6RA 4IXTA 1CIVA 4XR4A 1HRDA 4GLLA 1JKFA 3AUTA 4MKZA 5LRSA 4M72A 2X5KO 3LT0A 1ON2A 1FSEA 1V8BA 1N8KA 4W9NC 2JHGA 3IMFA 2EV6A 3ZHXA 1NASA 1R23A 2FP4A 1ULSA 4WKGA 1QMGA 1HDOA 2MH9A 3M8EA 1WQ2A 4OKNA 2VZ8A 4NK4A 2HGCA 3PK0A 4TRJA 5CDUA 5CDGA 4CMEC 1H0MA 2AA3A 3K2BA 2YHUA 4IDCA 3KVOA 4CM6A 2L4MA 3HHPA 2J5PA 3PVZA 5E1ZB 1KVTA 5KKAA 3W8FA 3S8MA 4PRKA 5HDGA 1B4AA 1Z1DA 3FRJA 1QLHA 4PLFA 3ON5A 3ML6A 4HA8A 5CEFA 2NVWA 3VZQA 4ND3A 2J3JA 2O3TA 1P1HA 3E5XA 3L9FA 2VOJA 1YIOA 2ZB7A 4J1TA 4P4GA 1OFGA 2PR2A 2BF7A 5IN5A 4IIUA 5KNLA 4FC7A 5KKCA 5COBA 1FDUA 1UH5A 2NM0A 3AY3A 3Q0EA 4A10A 3PJFA 3DFZA 1R00A 4A12A 1H2BA 1PR9A 4A0ZA 1EDZA 4E70A 1ZEJA 3GT0A 3NTOA 4E13A 1LDKB 1OI7A 3OFSA 2HEOA 3AOEC 2C7GA 1EVZA 3HE3A 1VL0A 4OM8A 3ABUA 3TOZA 3VPHA 2PD6A 5DOVA 2O0YA 4CLEA 1DIGA 4CJXA 3BMQB 2JAPA 4DLBA 4JNKA 1CQIA 1HF3A 1PIWA 2Z5UA 2JPBA 3DOCA 2X6TA 2NVBA 3WTBA 3ZHBA 2VT3A 3DR3A 5JMPA 3LQFA 2J3HA 4Q3BA 1PS8A 4HZFA 1G0OA 1KS9A 5JYDA 4AJ2A 2C59A 4GBJA 3F6OA 4DQVA 4Y17A 3FNFA 1L1FA 5D5XB 4IGFA 3WYBA 5ICMA 2GXBA 1QZZA 3VC7A 3FHLA 2Y0DA 1USSA 3GO5A 2DLLA 2QVOA 1H6DA 3CUQC 1I5RA 3AU8A 1EH6A 4OO3A 2IPQX 4MGRA 1S7OA 2XUBA 2AQIA 2EA2A 3I64A 3T0YA 2GPTA 3IWZA 3A9WA 5LEJA 3IUSA 4KNYA 2NADA 2I65A 5BQFA 1PEDA 4MIYA 5FF9A 3PQJA 1AXEA 1ZW1A 2D5CA 1EVYA 1E6EA 4YJGB 1JTVA 3H5AA 2ZTUA 5IDWA 3K0LA 3HFSA 1BI2A 4UUVA 1RM4A 4KP7A 3GAZA 2XOXA 3ZHYA 4BO7A 4BYYA 4XRGA 4EQQA 1PQWA 4CODB 1BXZA 1F12A 1Q0HA 3KP5A 3ZWNA 1S7AA 4GKBA 1PGOA 4FFNA 3JW4A 4K26A 4UUMA 2P5LC 1Z6ZA 2EF1A 3F1LA 1HBXG 4R9RA 4MVJE 3O3KA 1B8VA 3S1LA 1HSZA 1XU9A 3INGA 2HFHA 2QYTA 2EWMA 4L0YB 1ZH8A 4J0EA 5G0TA 1NFQA 4II2A 2NYXA 4E31A 1XQ6A 4QO8A 1O94A 2O3UA 3EYWA 4J9UE 4OIRF 3ABIA 3QRFF 1SFUA 1EBUA 3T4EA 3GFMA 3JAMZ 2D2WA 3U4IA 1YBMA 5CPBA 4XBFA 2F2EA 2W2LD 2XIGA 4HXYA 1TLTA 3IHUA 4XEHA 4U88A 3NDRA 1BI1A 3A1NA 1Y9AA 2LSOA 1KYWA 1NWHA 3H9UA 1HYGA 4CM9D 3WBFA 3SC4A 1R6DA 5TSDA 2K4JA 3ANLA 1HW5A 1EH8A 2RVCA 4HV5A 3ZU5A 1GU7A 1WSUA 2QRJA 3ONDA 3ZWCA 3RPQA 1XSDA 1ZEMA 4RVFA 4B79A 2QM3A 4IDFA 5KJFA 5H6QA 4QO7A 4RZHA 4XB1A 3M8FA 1KOLA 1ZARA 2OP0A 2NU8A 3MWDB 4BO8A 4I5EA 2CYYA 3PQEA 2CO5A 2FEZA 1ZG1A 2B83A 1A9ZA 2GZ3A 2O4UX 1GADO 1ZNQO 3E48A 4YEDA 5JNLA 4HY3A 1DXYA 2FU4A 5DDGA 1G3YA 4DLLA 3ZWWA 3TDKA 1BI3A 2QLZA 3FZVA 1W7PB 5FLXZ 1UP7A 4P38A 3ZV4A 4EZBA 4GGPA 4EJ0A 4B8WA 4BGVA 4TRRA 4R1NA 5K5QA 2VZ0A 3L07A 1LEAA 1GUYA 3V2HA 1EUDA 1TW2A 1KU2A 2PFBA 1KVSA 3O6BB 1HSJA 1W4ZA 1SAXA 5LLQA 1NP3A 2R00C 4Z9FA 4JBHA 4D7AA 2VHZA 5TF4A 2NACA 3DHEA 3SZPA 3FX3A 2JKVA 4LK0F 3KP7A 1SB9A 3E9MA 3UKOA 1XDSA 1T2FA 3I71A 2W84A 4LW8A 1MGTA 1U2DA 2NQ8A 3PQFA 5EINA 4WLVA 3FBGA 3HRMA 3AM4A 3GC6A 4CL8A 2DVMA 2QZZA 1LRKA 3Q3CA 2ZBKA 2A92A 3UAGA 4O59O 5ITVA 4WLEA 1K6OA 1JHFA 1WMAA 2GASA 5IAAA 2M8EA 3RFTA 2DUUA 1ZN2A 3BJ6A 1TT5A 4CLRB 4L9VA 4CDGA 3OH8A 4D44A 1QYVA 2HKXA 2C54A 2GZ1A 2ADUA 5AYVA 3ELKA 3F4LA 5L9AA 1FF9A 1A7KA 4EYEA 1HT0A 2PD4A 2A6EF 1T4BA 4B8ZA 2ZXJA 5JVTA 5CVUA 3WTSC 3UHAA 3FMSA 5JS6A 3B1JA 1HE4A 4ALLA 2VRCD 4WF2A 4NIMA 3RAJA 1EVJA 2Q4EA 4ZA2A 4A03A 5KIAA 3V5NA 2P9CA 1Q7GA 3Q5FA 3W1VA 4IZHA 2F5FA 2OAZA 2E4AA 3JQAB 2AMFA 4EGFA 2R3SA 2H6CA 4MEXF 1GYRA 3QWFA 2FRHA 3BTUA 3RWBA 4KMSA 1FC3A 1VRWA 4CPDA 1EH7A 4KDPA 1VJ1A 3DONA 4UULA 5ENDA 1Q0QA 3H65A 3H4VA 1Z45A 3K1PA 3VZSA 4D41A 4PCQA 2QWWA 2EIHA 2BHLA 1DAOA 3PFIA 4M86A 2EA4A 2IA0A 1Y81A 3H9JA 3HB4X 3WTWC 4I8XA 3BIOA 4ZQBA 4PN3A 5ICSA 2BGCA 5CG1A 3F46A 2V6MA 1BC8C 1SB8A 1DFIA 1E3EA 2RNJA 5DDIP 5G0WA 5G0VA 1BDMA 4WX9A 3WBBA 1FK8A 3I1JA 5G4LA 4RVUA 4CUKA 4EUHA 2HAEA 3WLEA 3RYPA 1P4XA 3IQDB 4GKVA 1HLDA 2K02A 3GN1A 3VH3A 1OMOA 1C1DB 2IEBA 5IZCA 1IHYA 3MZYA 3OJLA 3VPGA 1K78A 3V2UA 1U4OA 3AJRA 3LLVA 4AG3A 1O3QA 1SFXA 1E5QA 3M9AA 4N9HA 2HQRA 1K89A 3NTRA 3JSPA 2VBXA 4Q3AA 4YFXF 4KT5C 3T8TA 4BO0A 2DBVO 2QBYB 3WGZA 4Y6PA 1T25A 5E1XA 4I5DA 5J23A 1HE3A 3D5QA 3P5SA 1FP2A 1HW2A 4IJUA 3H5RA 4L5JA 4J1SA 5AXDA 5MGBA 5JAMA 4R1HA 1S3JA 3AI2A 3ROMA 3F47A 4YWJA 1HLPA 3E3VA 3GUDA 3G0OA 1ZRCA 4L9NA 5HS7A 1C1XB 1VLLA 1UZMA 4G81A 1XMAA 2PZMA 3R0AA 3OOPA 3GAFA 3S2EA 1IN4A 5CG2A 1LVAA 1JHHA 2L01A 8LDHA 4XCVA 3BROA 3D0SA 1VL6A 3ITDA 3L6EA 4RDHA 5A5FA 1E6WA 2Q2VA 1UP4A 1H6AA 5FI5A 3PTZA 5JCJD 5B4TA 1C1DA 4L4RA 4OSOA 4R3NA 3NYWA 4J1NA 1C0LA 5IN4A 1X15A 3JD0A 3M1EA 2R7DA 4RS8A 4QWQA 1DC6A 4Z3DA 4FT8A 1Q1NA 3QP5A 4RB0A 1C0IA 5G0UA 4IGEA 4XKJA 1IRGA 4PRLA 4MQ9F 4NG5A 4RGBA 4Q39A 2DQLA 3ZWYA 4I0BA 5CVIA 1X1TA 3BMNA 2V6CA 1RUNA 1Y5RA 2HMSA 1K3TA 2GAUA 3E18A 3HYIA 1GXQA 3Q9VA 4IRIA 2EERA 2H63A 1HYHA 3RUIA 3VDQA 2I99A 4D3SA 4UHTA 3IIEA 1V3FA 2FSSA 1JVBA 1TW3A 1NXQA 3JQ7A 3QVXA 5A3JA 3CMMA 1F9NA 1RJWA 2DC1A 4XYLA 2CGPA 3H3ZA 2VBYA 2PN6A 4OIMA 4R3WA 3F22A 2EK5A 1VSUA 1NAIA 3G17A 3T5XA 4Q4ZF 3G1TA 3WFJA 3JQ6A 5JMWA 1FLIA 1ZK3A 1WKMA 4R51A 4ENNA 2XF8A 2RH4A 5KVRA 3F5SA 5JCXA 5BPIA 4IRGA 4GCVA 2QQ5A 4DNCA 2O3QA 1RM0A 2AEMA 3VTFA 5AIQA 3GF4A 3V4GA 1P4WA 3NGLA 3B73A 2PNFA 1QBJA 3JD4A 3HQ4O 3MAJA 2OU2A 4U0WA 3RASA 4IINA 3WX0A 1BJAA 3V8JA 3RIHA 5MDHA 2YV1A 1QORA 1R12A 4I98B 2XKPA 2STTA 4D45A 1I30A 5JO9A 3Q9UA 4CV2A 3L77A 3DMYA 1USTA 2B69A 3R3JA 3RKYA 2OD5A 1O3SA 2YYYA 3RKWA 4WEQA 2X0LA 3JYQA 1PZEA 4JQFA 1N7HA 3I6QA 3O26A 5BSGA 1R0KA 2G7UA 3D3WA 2AEFA 4HP8A 3OA0A 1WWXA 4FN4A 5L95A 3WU1B 1BOAA 4A6DA 1NWCA 2PGDA 3WTVC 1DPUA 2MD5A 4BMVA 1SMTA 4EM0B 4DMMA 1ZAOA 4KTVE 4Q3DA 3IRQA 4R69A 1ENPA 5LHHA 1UAGA 3KXDA 2WD7B 5H6RA 1IUYA 1SD6A 1IZ9A 2PMHA 4GH5A 4MINA 5EERA 4Z3KA 2P7VB 3AM5A 3DTYA 4CGZA 2YHIB 1H9BA 3KLOA 4BHPA 3E03A 3F4BA 1SZJG 3KSDO 3OICA 3TZ6A 1GQYA 1WAMA 2NWQA 1GCUA 2P5YA 4UAGA 1I32A 4UVBA 3CE6A 3FPCA 3MZ0A 1OC2A 5I7FA 2O3SA 3UCFA 5BR7A 3HOTA 1A5ZA 2IYPA 1FBSA 4IXAA 1MDMA 1KIFA 5D6EA 4G5HA 1FDWA 1UXJA 3ICPA 2FE3A 3OF2A 4I08A 4ZYEA 4GX1A 4NBVA 3SC6A 4MHGA 3ETEA 4AJEA 1V35A 2A68F 4PLTA 5CVRA 3KEQA 2P4WA 5AXBA 1PP8F 1B14A 1HDZA 5K6AA 4URFA 1ZGJA 1D7OA 1E92A 1DC5A 1Y8QA 2HRZA 2OORA 1G3TA 1KY4A 4NI5A 1NHAA 2G0TA 3SX2A 3F8FA 3VVBA 4KUGA 1WPQA 3FI9A 1XGKA 4GQAA 3L6DA 2HDHA 3TO9A 1R16A 2YJZA 4GGOA 4PLZA 1YE3A 2VC0A 2K27A 3ETDA 4E5YA 2PEXA 2H9IA 1BDBA 4FOSA 4MOWA 4FOOA 3TRIA 2RAFA 2ZKZA 3C3WA 3VH1A 3BOQA 4OIQF 3LU1A 3PDUA 4MO2A 5KCZA 3PEFA 1H0KA 1ZMTA 2ESHA 2CY0A 3DZBA 1Z73A 4RPGA 1A72A 1Z7UA 1NVMB 3QWHA 5E18F 4HNGA 1FDVA 1W0CA 4A0SA 3JYNA 3KYCB 2POQX 2UXXA 3WGGA 1J49A 1GV0A 2V1UA 2W85A 4HLXA 1B8UA 3WG9A 3JQ9A 3UVEA 5J6XA 1MFZA 3CDHA 2HK7A 3KZVA 3LT1A 1DRVA 1ULYA 1VKOA 2ZJ0A 5DP1A 3V7CA 5DN9A 4IJKA 4L0QA 4ND1A 3NUGA 5HS6A 1NPYA 1AWCA 2O8XA 4JP2A 4OL9A 4GO1A 5DUIA 1BI0A 1D5VA 3DV8A 4UNOA 1D1SA 1LX6A 1RPNA 4YDRA 5K0ZA 4DLAA 3VTZA 1DFGA 2YX4A 4UUPA 1PJQA 2D59A 2LNBA 2NNLD 5DCYA 3I3OA 3VKVA 4S1VA 1KEWA 3JYLA 3BMQA 5JFRA 3PYXA 4XA8A 4E3ZA 2VOOA 3KUXA 4J2HA 3H9EO 3ZNNA 3LYLA 2FQ3A 2G5CA 4FR5A 5D8KB 4R5MA 5CEJA 1EUZA 1YVEI 3JSAA 1AOYA 4FSHA 4LMRA 3ROQA 2NSDA 4ITUA 5DT9A 4ID9A 3STHA 4UVDA 4CMEA 3H3FA 4P9UA 1Y1PA 4F6CA 5HS8A 2EGHA 4K2EA 1ZXLA 3LLSA 3SHFA 4TKMA 2XHKA 4RAZA 4Z0PA 2FRDA 2QG4A 1LJ9A 3GEDA 3TNLA 3FHZA 4IIVA 5A1TA 4PLHA 1FBUA 3E6BA 2HYGD 4AIKA 2WEKA 3NAQA 3SFZA 2IDZA 5A06A 4ON0A 4ENKA 1HQCA 2VOEA 4ZQHA 3PYMA 2V6GA 2XKOA 4FBGA 5BSFA 1ML3A 4BNXA 2AE2A 3Q6IA 1IULA 1YJQA 1PR3A 4MVJH 2CWEA 4CZZA 3I83A 2EKLA 3CPSA 3QSGA 4J7XA 4L73A 4QEDA 1VPDA 4IUYA 4ESOA 1YOVB 4P9FA 1T1RA 5D8LB 3E6AA 2ISZA 1B0AA 5IDQA 4TZTA 3MJVA 5L51A 4QLCU 1P77A 3GDOA 5EQFA 1B9MA 3U1DA 4GX2A 4BNTA 4BO1A 2Q2QA 4J1QA 1JA9A 1MC5A 2QYSA 4YAEA 1NFRA 3QRWA 4ALIA 4E33A 3IP3A 4NJOA 1EFKA 2ZTMA 2XAGA 5DD4A 4CV1A 3D4NA 2Q2EA 2HKOA 1ULUA 1DIBA 3WJ7A 4KMUX 3MEXA 1OZAA 5ICFA 1V4RA 3HSFA 4RPJA 2GWRA 3W6JB 4YR9A 4HV4A 4OAQA 3OHSX 4NFSA 1SO8A 4NBWA 2XASA 1E3WA 2BBYA 3TDZC 3WGYA 3F72A 4HADA 4CR7A 2KRFA 1YTYA 3U9LA 1DC3A 3I6IA 5BNIA 4GYIA 4NR0A 4CM5A 2B37A 3WMWA 4EGYA 3GUCA 3PYLA 3WE2A 4J4TA 4WCFB 3U3XA 3WGQA 4B7CA 3LFKA 4B3IA 4CMKA 2FBIA 3QA9A 4HFJA 4O3MA 3FTNA 5CPFA 3ZNOA 3NX4A 4S3MA 3U9GA 3EUWA 4OMZA 2MLKA 1R7JA 2EFNA 4YT8A 2WSBA 5DBGA 1HKQA 3WTUC 2D3TA 4J4HA 5LDHA 1WZEA 1MXFA 2FA5A 2W98A 2UXNA 3E5UA 2NS0A 2GSDA 2HLPA 4RL6A 1I3MA 3RD5A 3EYIA 2FZWA 4AFNA 3ENNA 3ZWBA 4EI2A 4RAYA 2O48X 2PKQO 2D5AA 4G7HF 1Y8RA 2HCTA 3DXJF 5L3EA 3F6YA 3OM9A 4MVJI 3K69A 4U0KA 4CQMA 1O7LA 1PZGA 1PUEE 1GFSA 3E1KA 4RLHA 1LLCA 4RB1A 2R7FA 1T38A 1IXRC 3GYHX 2V79A 5DD8A 4U7DA 2HMTA 3UICA 4DMLA 2WYWA 1J5PA 4NH4A 3U4DA 3ZV3A 4BNIA 1DDOA 4PFJA 1PJCA 4IPAA 2IYOA 2QQAA 4ILKA 4YJFB 1NHGA 3RQSA 1G3WA 2OBPA 2VWPA 4HWKA 3SVTA 1SD4A 4JBAA 3MJTA 3OIFA 2BYVE 5JR3A 1GPDG 1I10A 4A2CA 3WE3A 4DRYA 1VKNA 3AI1A 4CR6A 5A2QZ 3GOHA 3CH6A 1J0XO 4F7ZA 1E5LA 3LA3A 1S6LA 1IXSB 2YUTA 1QSGA 4OIOF 3I59A 3IP1A 3LVFO 3LWFA 2YQ5A 2VN8A 3JQFA 1GYPA 4MVJP 4U0VA 1R66A 4CUZA 4HFRA 3K9QO 5U1PA 2M1BA 1U1IA 4RZIA 1PX0A 1PTJA 3W6UA 2KIMA 4WOJA 1C0PA 4J49A 2CG4A 3ENKA 3E5RA 3GLXA 1YDWA 1W73A 1YQGA 3DXFA 1YQXA 3TQHA 4OSPA 4XYBA 1H9AA 3WMXA 4AJLA 3C24A 1P9LA 4CM9A 1PJSA 3DHNA 2AW5A 2UDPA 1DOHA 1E3JA 3QHAA 3IRRA 5J8FA 2VONA 4KQWA 5G2OA 1J5YA 5IDYA 4KIFA 1GCOA 1XGOA 4G6DA 1HSTA 3J81Z 1I6XA 4PLGA 4XQGA 1KU3A 3H8VA 4LGVA 1BW9B 1UDBA 2BGLA 4FD3A 5DP2A 4I09A 4JCOA 3QW2A 1FMCA 4UREA 2YZ7A 1YW7A 3VZPA 4FB5A 3P9IA 3QPHA 2BKAA 3BP8A 4NJMA 4C4OA 3WODF 4OKIA 5T8KA 2JD0A 1ID1A 4JXKA 2HS5A 4R41A 2GN6A 2WWYA 1F14A 1NM5A 2F00A 3B6ZA 2D4AA 2J3KA 3F9IA 3BMCB 3ROKA 1ON1A 2DTRA 1KC1A 3GVIA 4H3VA 1S6YA 3PHIA 4P4NA 5LHIA 3W8EA 1HZJA 1MUUA 2CSOA 3EETA 1CGPA 2ZYDA 2PI0A 3ONEA 4YJGA 5KOIA 4U0JA 3QU6A 4CLRA 1A4UA 3VHRA 1A7AA 2E1NA 2PA3A 4OOEA 1Q1HA 2DBBA 3PPIA 2HOEA 1LNWA 3I9KA 1YW8A 2C2YA 3ZWXA 3D3EA 4K28A 2VHXA 4DYDA 2TDXA 1NFFA 2DPGA 2Z1NA 1O8CA 3DZIA 3DZJA 2JL1A 4HAMA 4EEZA 5A03A 3R3SA 2GQQA 4LJZF 1UXIA 3BJOA 5JY6A 2P6TA 2HUNA 2Y1OA 3SJ7A 5COAA 4M87A 1F5TA 5FFFA 1IXCA 5JBIA 2NTJA 3CLOA 1QV7A 3PRJA 1GTMA 3EVNA 4YJHB 5A02A 1NPTO 1V9LA 1TNSA 1QKIA 3JQGA 4WCFA 1E1LA 1LQTA 3QJ5A 3HHGA 5AXCA 3T8RA 2DO7A 1FYMA 2NU6A 1ZKMA 2J5KA 4CMIB 4ND5A 4CO8A 4PLCA 3ZMVA 1D8KA 1Q2XA 1T1SA 4EM2A 2J5RA 2PK3A 2FPIA 4WLFA 4Y15A 1ONPA 2X58A 3P2YA 1W4MA 5CAEA 5KVSA 4Q47A 3U09A 3JAMK 4IZIA 2HK9A 4QSMA 2ZKLA 1LSSA 4PG4A 1M76A 2EG9A 1UP6A 1YLFA 1XHLA 3RBZA 1T2AA 2FR8A 4N7RA 3ZNPA 2XAHA 1XGMA 4M8SA 4ZYHA 3I59B 4Y6RA 5L7TA 2F5CA 4YA6A 2V1XA 5LDGA 2IW5A 1DHRA 4KN4X 1PSDA 3HB5X 4KWIA 5JE8A 4G9YA 5CDTA 1P1JA 4J7UA 1GAEO 1SOWA 3EQLF 2Q99A 3BA1A 2PG4A 4DBZA 1B59A 4EJ6A 5TIIA 1ARZA 5BQTA 2OZPA 2WD7A 1E2XA 3CUOA 3W4JA 1ZSNA 4BKPA 2LDBA 2HMWA 2Z33A 1ONNA 3GFIA 1FOKA 1IB6A 3KYDA 4J0FA 2W8ZA 3VFZA 4H7PA 2GDZA 4GX5A 2YR2A 1K2WA 3H6KA 4M1QA 1QRRA 1F8FA 1K5HA 2BD0A 3K2ZA 2STWA 1HKTA 3SLKA 2O23A 1VTNC 4LLLA 4Q48A 2FXAA 1ZG5A 3OEWA 5A5EA 1VJ0A 4J3FA 2FMYA 5A04A 1XELA 4YVFA 1Z7BA 4J43A 5DCUA 2WC2A 2W2KA 5C7IO 2NUAA 2G17A 3M1AA 3OIDA 3V2GA 1UXGA 2FMLA 3Q2IA 5HS9A 1U5CA 4PZCA 5I8ZA 2EXXA 4HOBA 3RJPA 5FEUA 3INTA 3GVXA 3BMCA 2RCYA 4GVXA 3BHMA 4FHTA 2P9EA 1ISMA 4G65A 2ZNZA 4UVHA 3RUCA 2AQHA 3CINA 1F06A 3TF5A 4ZZLA 5KVCA 5B4VA 3WB9A 1P74A 4XIYA 5L3DA 1GY8A 1ZK0A 5TJJA 4MVJA 1C3VA 4DXHA 5JDIC 4KZPA 1S7CA 3GR6A 1YS6A 1HKUA 2EFOA 3FM3A 2NTVA 3I52A 1X7GA 3TL2A 4M49A 2LF7A 1QLJA 1Z74A 1VM6A 4XWYA 4O0LA 5JDCC 4OOFA 5D6FA 2E48A 3ZN1A 1K6IA 5AONA 2QZ9A 3EW7A 4HUJA 1LDDA 4CM8A 3HRUA 4BNJA 5EEHA 2F5DA 2X4GA 2A07F 2DUWA 1PQUA 4IQ8A 3JQAD 1VSVA 4BNNA 3P2OA 1XSVA 2Y93A 3QWAA 5C37A 4FFRA 5JYEA 1I3NA 4NQZA 3H2ZA 4PZJA 3WTYC 1SFEA 3ZP5A 4R4JA 4E32A 4E2YA 1GYQA 2ZFWA 2XV4S 1PQPA 3NKLA 1UXHA 4E4YA 3LC1O 3T1BA 2ZK7A 4OXNA 2DBZA 1EK6A 5F3RA 5DBFA 4ZD6A 1HW1A 2Y66A 5E20A 4IMRA 3GPDG 1PU2A 4K6FA 4A73A 5GZ6A 5TC4A 3T7CA 2ZQZA 4BNYA 1VI2A 3QE3A 2CVOA 5THKA 1QGPA 3I9NA 2DTXA 3SBOA 1Z9CA 1XQ1A 2C07A 3UH1A 3K9TA 4OJNA 4XLNF 4ASNA 4HLYA 2A35A 2CZCA 4YBZA 5FFZA 2Q3EA 2GO1A 4IHSA 2YHIA 4L74A 5ILUA 4UUOA 1LDEA 2XXBA 2Q0OA 4ONEA 4J6FA 4TQGA 1X13A 4W9NA 2HMVA 4BO6A 4R1SA 1LRJA 3D7LA 1FXSA 1UDAA 4PDKA 2CF6A 3HDYA 5EIOA 2VUSA 1IN7A 4AIJA 1Z82A 4G94A 1MA0A 5AIPA 5DCMA 4JIGA 2DU9A 3VODA 4HQEA 1N1EA 3HTSB 4RF3A 2P8TA 1ISFA 4W4TA 4DYVA 5FWNA 4M89A 1R58A 1R5GA 2ZYAA 1YKFA 3FMRA 2QBYA 1XLTA 2IXBA 4IPTA 3HSRA 2V6FA 2P9GA 4RVGA 2I5PO 4YRAA 4BNMA 2HSDA 1FY7A 1MFPA 3GG2A 2CQKA 3DMTC 3QP9A 3WR5A 4Y9DA 2WD8A 2KJCA 1I33A 1X7HA 4XGNA 3AFMA 3I4CA 4MTDA 4TKLA 3VB2A 2VQ3A 4XGIA 4BO4A 4BV8A 5I8WA 5L45A 3WTCA 1R4NA 3PJGA 3EK2A 1KU7A 3ITKA 3S55A 3KCCA 3D0OA 3OQBA 3CZRA 4HBLA 1U9JA 2NQTA 1ZO8A 4R79A 4NHEA 3GZ5A 5B37A 1MXHA 4FS3A 3B02A 4E30A 3E97A 3MJSA 4XDYA 1S29A 1YYVA 2QYOA 1E1MA 1QPMA 3ZMSA 3Q11A 4RJTA 4LMYA 4WWCA 5DUKA 3WGIA 1ADBA 1SOVA 1E3SA 4P5OA 2BFPA 2O2SA 1W8DA 2AS5F 2HTSA 3CKYA 1TBXA 3C1DA 4WCGA 4EM1A 1IW7F 4OQZA 3JQDA 2Q49A 3JTMA 1ZHFA 4U7BA 3WGTA 5KJ6A 2GD1O 4B7XA 4LB5A 3WGHA 1I2BA 2DM6A 2IODA 3WLFA 4DBVO 3C7CB 4YIIA 4FFMA 1K78B 2CMDA 2GIVA 2RHRA 3ST7A 3DBLB 4ESBA 4AICA 3R61A 5EJ2A 2W24A 4JBGA 2V6BA 1EBFA 4Q3NA 5H81A 1NYTA 2J6IA 3GF2A 1VJTA 5JAQA 4M71A 4BHCA 4PG7A 3GNTA 2CFCA 1KY5A 1U8XX 3RU7A 1E3WB 5K1YA 4ZH4F 1YL5A 3AW9A 4PG5A 1PJ3A 3WFIA 3H9GA 1U3UA 1V3VA 4Q9NA 4LG0B 4GMGA 2VRBA 4OU0A 1IRFA 5L3BA 3DOJA 2X0RA 4L8VA 1DJNA 1RI7A 2YPRA 2PKRA 3TZCA 1HZZA 1BIAA 3IUPA 5C7OO 2M87A 1ODDA 2OUIA 3OSUA 1F17A 3T7EA 3PQKA 1DDNA 2ACJA 2J3IA 3KP3A 5JDIA 4WK8F 4ALMA 1P0FA 1DLJA 1FSHA 4HX4A 4L9RA 4ND4A 1BSVA 3HSEA 3E5MA 3HDHA 3C1AA 1DP7P 1OC4A 3BTSA 5IJZA 1BGVA 4UVEA 4BOYA 1T0FA 2ZJ2A 4CLOB 3F23A 3EUHA 3ZWMA 2IZZA 3AU9A 4LSMA 4KOAA 4FX0A 2I66A 2PQ8A 3AAFA 3CO7C 2AEJA 3NJ8A 1PZHA 3TSCA 1JW9B 3H92A 4RVSA 2Q2WA 4LLGF 2FZEA 4XLPF 3CMCO 3GHHA 3V1TC 3X2EA 3NT4A 4GSLA 3WNQA 3ZGYA 4BQPA 4F46A 3DC2A 4GLOA 4CUJA 3QVTA 1EE9A 2XAJA 2WM3A 4PGFA 4YRDA 3K92A 3WGOA 1QV6A 2Y0CA 4J4BA 3TWOA 1I2ZA 3FR8A 3J7AO 1UR5A 1UUFA 3O9ZA 2YY7A 4IQ0A 3TPCA 4E6PA 3ZWPA 3RDIA 2X7HA 3P9CA 1N5DA 3EDPA 4JJFA 2O50A 2CD9A 7MDHA 3JSOA 2WWRA 1KQ9A 5G0SA 1U4SA 4OQYA 1KEPA 3COAC 5LGNA 3FNGA 4BO5A 3QAHA 3MJ4A 4LGWA 3NDIA 4KUMA 2DFIA 3TO6A 2JFGA 4LB6B 1LLDA 3ASUA 1EVIA 2G82A 1J7KA 3FPLA 3C7AA 4IF4A 1ISHA 3OMLA 3M2PA 2YU3A 3SEFA 3PXXA 4XRFA 2DPDA 3DBRA 5IXSA 4CV3A 2BI8A 2I3GA 1D3AA 4I01A 2VT2A 2FF4A 2PZKA 5D5UB 2C5EA 1IPFA 4JN6B 2Y75A 3DMTA 2A61A 4WJZA 4YJDA 4DPKA 1JQBA 5TQVA 3FTPA 4G2NA 9LDTA 1PZFA 5L7WA 4ALJA 3WQQA 1NPDA 3GX4X 1Q7CA 5B4UA 1OYYA 3MWEB 5IDXA 4RPLA 4IHTA 1XIVA 2V7PA 3PDJA 5C5IA 3U5TA 3NT2A 4R1TA 2QW8A 3M1LA 4YAGA 3AY7A 2VOPA 2P5UA 4D42A 2JD2A 4OYRA 3BPXA 3GEGA 3N74A 4LCJA 3H3UA 4YFNF 2PLAA 1U7TA 1F8GA 2Z95A 3WTXC 3L0DA 4I0AA 1L7DA 4XJSA 3TZQA 5CEEA 2JJYA 1PWXA 5BT9A 1A27A 1DPGA 3FMQA 3P19A 1O95A 3SQNA 4A5OA 4BB6A 1T2KA 2X8LA 4M74A 1SD5A 1UCRA 3JQBC 1DIHA 1BN5A 4PGGA 3DL2A 3HIFA 1YB5A 1C14A 1L0OC 1TQIA 3VOEA 4WUVA 4YAKA 5IXYA 3LC7O 4DVJA 2BFOA 1V3TA 4GPD1 1Y5MA 1ZK1A 2W25A 3IC5A 4IRHA 5H20A 5HDKA 4J7CA 3FN4A 1FNNA 3NDJA 4L76A 3RUHA 3U62A 3WICA 4O63O 3KHUA 3I4PA 4UV9A 1F1ZA 5ICGA 3FWZA 1G3SA 1N7GA 3OJEA 5KTKA 3LAPA 4E12A 4PGHA 1FWZA 2OZUA 1K6JA 3F6VA 1CJCA 1DRWA 1ZLKA 1WNTA 3W4IA 4BL5A 5BSEA 3WDSA 5IF3A 3KZZA 2Q1WA 3ORFA 3C7JA 1I01A 2RIRA 3AOEA 3MOGA 1IUKA 1Y6JA 4DGSA 1XCBA 2O61A 2CW0F 4ZICA 2PH3A 1JN0A 3WWYA 4BMSA 3UUWA 2X0NA 1Y7TA 3LT2A 1RKXA 2HQNA 2XROA 4U0YA 2VTEA 3IJRA 4OIPF 5I9NA 3VH4A 4WASA 2JT1A 3GXOA 1LDBA 4PLYA 5EQDA 2Z1MA 4BIIA 1Q0LA 2ET6A 1MDMB 4CMBA 4ZQEA 3IC7A 3ECHA 2NV6A 1X14A 4XQ9A 5TJ9A 5EN4A 1JWBB 1DBVO 1TVEA 1XMKA 4KIBA 1R4NB 1HXHA 2FMUA 3B20A 4RCVA 2UAGA 2RC4A 3CZMA 3MQ0A 1ZZEA 4FJ1A 5AOVA 1L7EA 3RSHA 4NBRA 1ZFNA 1J9IA 4BKQA 3PHJA 3GVCA 1R0SA 2ZB3A 5TT1A 2IVMA 4B4VA 4CMAA 1MLDA 4DUPA 2IJLA 5DEQA 4MIEA 4EBFA 4KN7X 3GFJA 2WMDA 1B16A 4OMUA 3Q2KA 1BXGA 1BM9A 5CDYA 1JAXA 4Z0TA 5L4SA 2ILTA 4B4OA 3HHHA 2QQBA 2VTDA 3DZFA 4PG6A 4YPOA 2Y68A 4BS9A 4CLHA 2V9VA 1X3UA 1H5QA 3JQCA 2VXZA 3V7RA 1EZ4A 5C7LO 4HDUA 2O6GE 2QENA 3FD8A 3LQQA 2C20A 2JCYA 3IKVA 3LSTA 2OP1A 3RUEA 4S05A 4F45A 4YT2A 4N18A 2I6TA 3RKUA 1XWFA 1RYEA 2PD3A 4MKXA 4GL4A 3JQBA 1ZK2A 3QVOA 4FFLA 4EMSA 1MG0A 5CLSA 4OOIA 4IDEA 1MV8A 2B5VA 2I67A 2OBYA 4YB8A 4GVLA 1P0CA 4WLNA 1Q7BA 2KIFA 1PJTA 5DNAA 2YQ4A 1XGNA 1EEHA 1NQ5A 4NNJA 4C7JA 1QO0D 1SD7A 1GVJA 5CDSA 2AQ8A 1U3EM 5KVVA 4IDDA 3GH3A 1XB4A 4BUCA 2JZYA 3RU9A 3GRPA 2Q1TA 1IZ0A 3HADA 4R9SA 3GRKA 5JO0A 3JQEA 3AWDA 3PFWO 2P2SA 4IBOA 1LTHR 5LEKA 2WE8A 2FR0A 1O7FA 5T57A 3HN7A 1B2LA 3JQ8A 3QY9A 3KETA 1E6UA 5KK1A 1G6KA 2L4AA 1NAHA 3ADOA 4GWKA 2E7XA 1DSSG 4CL3A 1CF2O 3VOSA 4ZZDA 1EV7A 2ZMEA 3DP7A 1WP4A 5FYDA 4E21A 4EJTA 3ZWAA 1TI7A 3RROA 2E7WA 2BE5F 1I3LA 4P96A 2I76A 2ZYGA 2BELA 4WNIA 4BGEA 2PGJA 5DCFA 4E2XA 1SNYA 1YS4A 3BMOA 2HDCA 4Z0HO 2EFPA 4BGIA 2Q45A 2UYYA 1X0XA 4WCFC 4BO3A 5BS6A 3JTHA 1EDOA 2L54A 2HRBA 3U49A 1QXSA 3BWGA 5ERIA 3IL2A 2DTEA 2WDZA 2X5JO 3GLQA 1TEHA 1P2FA 3BY6A 5G4KA 3TKYA 2EJVA 3GVHA 5U4QA 2PFGA 5JI6A 4LVUA 3HWRA 5FD5A 4DPMA 3NRCA 4KQXA 5I7SA 4AJIA 5A2QK 3KZYA 5BOXA 1U2GA 1K79A 3KSZO 1LBEA 5T8KC 1TLHB 1YS7A 1STZA 4B8XA 1PS9A 2OOSA 3OETA 5TGDA 5JY1A 1CEQA 2PKQP 5ADHA 3UFXA 3ZHZA 3VAZA 2DT5A 4JK1X 1XN7A 4CMHA 2Y1GA 3I5MA 4IDBA 4DC1A 1OYIA 5DYMA 2E6UX 1W7PD 2RV8A 3ADPA 3C1OA 4K6CA 3PWZA 1NTOA 3GY0A 3OEYA 3QU3A 5ILSA 1SEVA 3E9NA 1FZPB 1OMIA 1O3RA 1I3KA 2A6HF 4J90A 4JJIA 2JHFA 4PG8A 1QZYA 3JQAA 5KJCA 2LKPA 4GX0A 3GDGA 2PBIA 5CP8A 5H82A 1BBYA 4XX0A 1MJAA 1YW9A 2COMA 5D5WB 1XR3A 5A9TA 1AUPA 3JQ8B 3CIFA 1CETA 3UXYA 2FPPA 1I2CA 3GUYA 2ZATA 2Q4BA 1IY8A 3OECA 5FO5A 3SZTA 1T4DA 3Q9SA 3K6JA 1JE8A 2OHXA 2ETHA 1DO8A 3PLRA 3PGXA 5E8IA 2HWVA 2NU7A 2ISYA 2DU8A 1GZ6A 3EDMA 2RN7A 4Y67A 3PFFA 2C82A 4C7KA 1HDCA 2O7QA 3V8BA 3VPXA 3TOBA 4B7UA 5GZ3A 3GW2A 1T26A 3PI7A 1Y8RB 4CMIA 4E0BA 3K31A 4BNWA 4BKOA 4YCAA 2CDCA 2QQ9A 2JSCA 1DUXC 5JLAA 3WQSB 1R22A 2NRAC 5HLIA 3G79A 3A28A 1LC3A 3BHIA 3ZV6A 2MH2A 1Z05A 4UEKA 3V1UA 1PS0A 2HYFA 2JCXA 3KM0A 1LLQA 3E6MA 4UEOA 2GRAA 4BHTA 4LN1A 3DZGA 3WWZA 4ZN6A 2GA1A 3IJPA 5DBIA 3ECOA 4ESJA 1XEAA 3GEMA 1IAWA 2WV0A 1PWZA 2O4CA 1CF7B 4EJUA 2VYNA 4GSKA 4DC0A 4LRTB 5COQA 1YBVA 2XAFA 1BVUA 4HDVA 3WJAA 1M67A 3RBVA 1R5HA 4XGKA 3KTDA 2EFQA 3KP2A 1RM3A 1FP1D 2DK5A 1XGSA 2P6SA 1KU9A 4YG2F 1J59A 1K7AA 4CMGA 5I9MA 3PZRA 4W7HA 4DREA 5ER6A 3ZDFA 4NPCA 4F6LA 2PZJA 1TB4A 3VDRA 3VZRA 4ZYGA 3ZU3A 3DBRB 2OXIA 2Y48A 4CLOA 4MDHA 3L4BC 1E1KA 4M9ZA 2RH8A 3GQVA 2EW2A 3GWZA 1O9BA 2CUKA 3O8QB 1V3UA 4QX6A 1RM5A 2O2YA 4R1UA 5T6BA 1P33A 4Y6SA 5KJEA 3PGJA 3S2IA 3FBTA 2EJRA 1CRWG 4TRNA 1HDYA 1BW9A 1SC6A 4Y8VA 2YFHA 1YOVA 3E6CC 2IXAA 5CHEA 2JFFA 4I7HA 4TZKA 4CM1A 3TFQA 2JTVA 2O7SA 3K96A 4GI2A 4R16A 4BNVA 4EW6A 2UWMA 3C8MA 8ADHA 3UGKA 4DIBA 4EV0A 1W6UA 3MEQA 1GQ2A 3DPTA 3WXBA 3QP6A 3JTGA 1W5TA 3W6ZA 2PV7A 3FNHA 5AXAA 5ILGA 5E1WA 1DHTA 1BXKA 3I9LA 3RPUA 4K1LA 4ENJA 2BFMA 3JQ9C 1ONVA 2B0LA 2ZQYA 1E7YA 4Y13A 1P31A 4EEXA 1DAPA 4Z6KA 3MZHA 1P1KA 4Y98A 3VEPA 4BH9A 2CVQA 3T4XA 4E5PA 5JDCA 4ZHSA 3J81K 4EJVA 3R6DA 5TNXA 2E82A 2EWNA 1U5TA 4DWVA 2OA4A 4BAYA 3KYDB 4CM4A 1H9GA 3ZWVA 3LK7A 3KO8A 3QVWA 2R2GA 3BAZA 2VRCA 2VWQA 1ENZA 1KA8A 1E7QA 3BDDA 2VC1A 1H6BA 3RKXA 3TGNA 1X7DA 2P5VA 1JKJA 2PGLA 2Y0EA 2ZTLA 2A9FA 4ALNA 5CFZA 3CTMA 2ZCUA 2M30A 4PZDA 4B3JA 3GEZA 4I5FA 3D5TA 2BFAA 3PQDA 3L6OO 1MJBA 5IZ4A 2XRNA 1MJ9A 4UEJA 4DTIA 1CQJA 1XSXA 5ED4A 1F0YA 1UZNA 2GZWA 1I0ZA 3E9QA 3O03A 4XSZF 1NVGA 1LSOA 2PZLA 4RQTA 4YT4A 3GVAA 1XYGA 4A6EA 3DO5A 4O5VA 1ISJA 3DPLC 3RJ5A 4XSXF 1B3RA 1PGQA 5A9SB 3ZQ7A 3LF2A 3LZ6A 4B09A 4GXOA 1LDGA 2P7CB 3V8KA 2JD1A 2WTBA 2V1DA 3FR7A 3HSKA 4BNFA 3I53A 1NQTA 4NFHA 2Y1EA 2YFQA 3ZZNA 4XD2A 3BPVA 1PJBA 1WI9A 3G73A 1I1GA 3F1KA 1MZBA 4IJWA 3FXQA 3GZNA 3I58A 1X1EA 4KWHA 4P8RA 3U0BA 5IFLA 3ZNQA 3J80K 4QQRA 2DLDA 3MCVA 3D5LA 1LA2A 4N5MA 1NR1A 3AFNA 5F64A 5BNTA 4OMYA 2WJPA 2HZTA 2F1KA 1H2HA 3PIDA 7ADHA 4PCVA 1KQ8A 1HXDA 1Z75A 3ZU4A 3R4KA 4TVOA 1XU7A 2DBQA 2NAZA 2Y99A 1E3IA 3GGOA 1HTBA 4LVCA 2X86A 1GD1O 4RQUA 4XZ3A 2ZCVA 3G3EA 2B4RO 1FJHA 1T2DA 4OGWA 4CMCA 2D1YA 4ZRMA 4BNUA 4AJJA 2FSVA 2OMEA 1KEVA 2LDXA 3A4VA 4FQ8A 2BLLA 3REOA 5GMOA 4HF2A 3JYOA 2VNAA 3IAHA 1YJ8A 4XDZA 2TMDA 2FHSA 4EJWA 5L40A 4IM7A 1HEUA 2AHRA 3KYBA 4RB3C 1YDEA 3PHHA 4WCDA 3H5NA 3QWBA 4Z2YA 2L3DA 1UXKA 3NV9A 4GMFA 4CQMD 1GHCA 3ISPA 3HOSA 4P4LA 2AG5A 2MA3A 3OJ0A 1IN5A 2CNBA 3GHYA 3QOPA 4MNUA 3DOOA 4KUEA 3BMOB 5FGMA 2GN9A 2WE7A 5TX7A 2H5LA 1DFHA 1JDJA 3M6IA 1OKRA 4D43A 1G1AA 5ICCA 2NVUB 5F1PA 4RVDA 5JCJA 4YACA 4ESFA 1LEBA 4BV9A 2IP2A 2F5EA 3RYRA 2XGXA 4MP8A 3ZCXA 2G76A 3RUAA 4WPGA 4UXNA 2ZNYA 3UF0A 1FYLA 3BJAA 4NBUA 3RFXA 1REPC 5K9ZA 1T98A 3L4SO 5U9CA 3DF8A 4HX7A 2BGKA 4U8GA 4AD9A 1GPJA 2UZKA 2H6EA 2C2XA 2R00A 1O57A 4TV7A 4KICA 4PVCA 3DAGA 1CDOA 1YFHA 2JAHA 1UDCA 4KTTE 5I9LA 1UZLA 2ZB4A 1WWKA 3RBXA 3IKTA 3ZV5A 3FXRA 1NBOA 1YB1A 2Y1FA 3ZH2A 2ESNA 2LF8A 1GL3A 3I0TA 1ZYRF 4NHJA 5JPIA 1LDMA 1YXMA 1FBQA 5ER9A 4A27A 4CQLB 1U5TB 1M6WA 1P3DA 2VUUA 2H94A 4RPKA 1H9TA 3B1KA 1R37A 3DDNA 3HN2A 4BB5A 2H6BA 2OGUA 2C6YA 1TT5B 3U4HA 5FI3A 5ILOA 5F5LA 1O0SA 1E0DA 1DJQA 3P7MA 3GFLA 3MTJA 2Y67A 3ANNA 4ZRNA 3ULQB 5K6AC 4FGSA 1E3LA 4FIZA 1IYZA 4JROA 4N5LA 4BKUA 2RDPA 5K5OA 2LDUA 2IRWA 3H3JA 4BQRA 3V7SA 4DQXA 1OPCA 1HE2A 1LXCA 1M2WA 4HW0A 3CEAA 3JQFC 1LQUA 4IY1A 4ZQFA 1YONA 3R0IA 1JAYA 1G0NA 2J5QA 4MVJF 3HZZA 1EK5A 2FN7A 4EVIA 3GNQA 4BGUA 5JC8A 1YQAA 2GA2A 3DBLA 4FX4A 2QX7A 4AVYA 3FNEA 4TVBA 1B3BA 1NQAO 2IE0A 2FBHA 4HV6A 1ZRDA 4AL4A 5F6FA 1V0JA 3CUQB 3S2GA 2HR3A 1ZREA 5KVQA 5B12A 3GGPA 3NRVA 5F1RA 1IZ1A 2ZMEB 3M7GA 3R1IA 4WXHA 4CYDA 5B1YA 4M9SA 4HBGA 2XAQA 1RWBA 2M5WA 3GNSA 4IXWA 2CDAA 3WSWA 2EV9A 2Y0MA 1TA4A 1EFLA 1AXGA 1PJ2A 3BMNB 4HKTA 4PZEA 2ZCWA 2VYND 4GAEA 1W5SA 3JCZA 4AIHA 3ONFA 4QXMA 3L9WA 3L00A 1JVSA 3QWIA 1U3WA 1EE2A 2EW8A 4TSKA 1GUZA 5BSHA 4DQ2A 2SCUA 2IT0A 4CM3A 1PDNC 4J16A 1AHIA 1FDTA 2FOIA 2FY8A 4CV0A 2MC3A 1FPQA 4WXCA 1KBZA 1MX3A 1JWAB 5ES3A 2OL4A 3DBHA 3WSVA 2QHXA 1YH3A 3H2SA 1U5AA 1B26A 3AOGA 3X2FA 3O38A 4WGGA 1NR7A 2UV8A 1UFMA 4MKRA 1ENYA 2QRLA 3DZKA 2AE1A 3DBVO 1TNTA 2AXLA 1BHSA 3UW3A 2G7HA 1HETA 4RGSA 2EHDA 2VZ9A 3MCZA 4UVCA 4FFOA 3LQRA 1LRLA 1I36A 1MB4A 1SPXA 1XKQA 1T2EA 3F8MA 4RVHA 9LDBA 2ELHA 3A14A 2J8ZA 2OFPA 1H94A 5THQA 4G6QA 4E2WA 1XCVA 1LC0A 1YRLA 2DBRA 3FCOA 1DIRA 5HA5A 3SXPA 4CMJA 3L9XA 4H15A 3TL3A 2K86A 4KMFA 2VE8A 5FB2A 1GZ4A 2W90A 4UVIA 1U3TA 3ZMDA 1EQUA 4I9UA 1Z6TA 3F8CA 1KGSA 3M2TA 1B9NA 2DPHA 1J0RA 2WTEA 3OA2A 4MVJG 5L7YA 5HM8A 3EGOA 2DAOA 2O03A 4HQMA 2Y1DA 1U7HA 1GXPA 4WK6A 1R36A 3ZPLA 5KWEA 5HLHA 3QVSA 1XDUA 3J80Z 3GFGA 1Y0UA 4A0YA 3GVPA 3L4BA 2B36A 4CM4B 3KV3O 3IS3A 4XYMA 5GY7A 1R1VA 4RV9A 4Q5SF 4LFUA 2B5WA 2NNYA 3K73O 2RHCA 3CSDA 4OH1A 1D8AA 3Q9NA 1O5IA 2VBWA 2X4HA 2W2LA 3H7AA 5IZCC 2YW9A 2QZ8A 3KEOA 2A3SA 1HYEA 4EITA 3DTTA 3BTVA 5HBRA 4YIFA 1AE1A 3K30A 1N9GA 4KYWA 2VHWA 4FFPA 3FF5A 4L75A 2FNAA 3QQPA 4AJHA 4PLPA 4AJOA 1OAAA 3F3XA 5JAIA 1UHMA 3EVTA 5CVVA 3FXUA 2YV2A 2OO5A 1IE3A 1PGPA 3JD3A 3OQ1A 1XDWA 4LCEA 1LSUA 1Z91A 4BO9A 3QPTA 4NBTA 1TT7A 2VWGA 4IS2A 3GFBA 4HFNA 1J2XA 4XRRA 1KVQA 1C0KA 2YDYA 1OOEA 3EZYA 4AJ1A 4D46A 3CUKA 2FSWA 3RI3A 1LJ8A 1XG5A 4JGBA 4LRSB 5TRTA 5FFXA 1WLYA 3L09A 3E5QA 4RORA 4R54A 2HJRA 4JJGA 3RJ9A 3BZ6A 4WECA 1ZJZA 1FDSA 2VBZA 4G7ZF 4D0RA 1ZBQA 4A26A 4CLDA 2H1SA 2X23A 2RBEA 3IDSA 2W2KB 2A5YB 1LQ1A 4ETSA 4FJ0A 1PL7A 6PAXA 2WYVA 1R1TA 2O3JA 3BHJA 3W4KA 4HYEA 2QRKA 3TN7A 1UB9A 5L4NA 2Z5LA 1P1IA 2VYVA 4WLUA 1G4DA 2VE9A 4M6XA 1YWGO 2X22A 3HTUA 3D4OA 2YSRA 1LDJA 2E37A 3COSA 4U6SA 1DC4A 2GZ2A 4XQCA 3OP4A 2K7LA 3RUFA 1C0WA 3OIGA 5JXWA 2CFXA 4LD5A 2X1HA 1P92A 5LCXA 1IHXA 2FR1A 2XXJA 3ZMTA 3RC7A 1UAYA 1WVGA 4L5IA 1M66A 3AY6A 4NZ9A 3JQGB 3UCXA 3VPFA 4B3HA 1M6HA 1I5ZA 2Q50A 4GWGA 3GDFA 3MFKA 3ZN2A 4N9IA 3DBHB 4M55A 4YAJA 4MIOA 5IG2A 5HS4A 2GUGA 1GUFA 2YV3A 2IEDA 5TS3A 2BI7A 1T24A 2YDXA 2ZIZA 4HFMA 4BQAA 3WOHA 4UUNA 2UUOA 1LU9A 3VVCA 4F3YA 2BRUA 3D1LA 5L4LA 3WS7A 4LG0A 5K5RA 1B7GO 1NQOA 4BMNA 2IA2A 1N1GA 2AG8A 1AGNA 2Y05A 1ISIA 4ND2A 2B35A 3AM3A 2C0CA 4WLOA 3IOYA 3N58A 4I9HA 1QYWA 5HVQC 1JU9A 1YL6A 2PY6A 3EY4A 4RF2A 3HDQA 4YQZA 2G1UA 4EJOA 2C5AA 1RUOA 2DW4A 3B70A 4FW8A 1B6AA 3IWFA 1XA0A 3AUUA 2D45A 4MTEA 2IZ0A 3F3SA 1M75A 5ENVA 4CXFA 4D3DA 2EFWA 3TOXA 2Q8KA 3KLNA 4JQCA 4YQYA 3F5QA 3KE2A 1SMYF 1E17A 1OR7A 3L7WA 4ENMA 1EMDA 3I4FA 4O1MA 5HDNA 5CYVA 4DL9A 5HRUA 3I9OA 5L53A 2VODA 3KB6A 1V6AA 5DCMB 5FLXK 2Z9OA 3NT5A 1YL7A 4A0XA 3AI3A 3OQ6A 5HOOA 2CDBA 3ICCA 1E77A 1P6RA 3G3ZA 4BHBA 2HKIA 4CQMB 4HF1A 1A9YA 3DB2A 5D4RA 3HUDA 4IS3A 5ITWA 4Q3CA 4G7OF 1TXGA 1H6CA 3QV1A 2X9GA 3RI4A 3I5UA 5HWSA 5L3ZA 1U8FO 1YGYA 4BXUA 1ZUD1 4E5MA 5LC1A 4M54A 4AJKA 3KLMX 2VHVA 1WDLA 4HNHA 4J2OA 1UJMA 3AK4A 3UOGA 2QUFA 1BVRA 2Q46A 3U2RA 2HU2A 3PZBA 5DOZA 4N5NA 4OINF 4LLNA 3NEUA 1PGNA 4BNCA 1QYDA 4YT5A 5KJ1A 1W7PA 3TQNA 1IPEA 4YRBA 2HMUA 4NMHA 1LNQA 4QFDA 3TO7A 1H93A 2DI3A 2VHYA 1CERA 1QNTA 1PL6A 3MWMA 3KRTA 4UVAA 1KYQA 2D0IA 3I23A 5HLGA 2PH5A 4OXYA 5TLSA 4RF4A 1I8TA 5E17F 2EKPA 4J91A 1BC7C 5JW6A 3P9KA 2P68A 3KBOA 4I5GA 5IT9Z 1JGSA 2EGGA 2PWZA 4KUHA 4MVJD 4BNZA 3V1YA 3C3XA 4NK5A 3WNVA 2Q1UA 4P22A 2GLXA 4XR9A 2E1CA 3WU0A 1FYKA 1ZRFA 3N97A 2L02A 1JXSA 1DLIA 2B4QA 1HKSA 3A06A 4JLWA 4XIJA 4ZU3A 3WIEA 1KQ0A 2EB7A 4UVGA 3BTOA 3OBBA 4WOKA 2EV5A 3AUAA 2YX7A 1MKMA 3KP4A 1ZGAA 3MJEA 4IVNA 1D8JA 4R5HA 4AWXB 1WDMA 2DAPA 5I7VA 1WZIA 1ZIDA 1S8NA 4PIVA 4MP6A 4QT0A 1DPRA 4MEYF 1ZG3A 3JD2A 4MJLA 2AXQA 1YG2A 3TJRA 2ZTVA 5L3CA 3G49A 2BH9A 2OZ6A 3UN1A 4I1IA 3RC1A 1DIAA 4BVAA 1E7MA 1PP7U 2I3AA 2ZJ1A 4ZJUA 3RKRA 2X0IA 4YFKF 5LGTA 4IJAA 2EJWA 3QLJA 3TZHA 2HTJA 1WMBA 2CF5A 3OJOA 3CUQA 3ZI0A 4CR8A 3DAPA 1O89A 2OQRA 1YO5C 3N7UA 4LMPA 4O6JA 4LSWA 2HJSA 1D4FA 5LRRA 3R6SA 3ZW9A 1R0LA 5J8CA 2CVZA 4ALKA 4QUKA 1R4MB 4B4UA 1LUAA 3DFUA 1NHWA 5EL0A 2GN4A 1QYCA 5HTOA 3GZNB 2C7VA 4XYGA 4R8HA 1ADFA 3NQOA 3PLNA 1T2CA 3ABTA 3INRA 3KFWX 4W6ZA 3WQRA 1F4KA 2OBNA 3KOUA 4YJHA 1XD7A 4FGWA 4LK3A 5DF1A 1U78A 2WYUA 3RVDA 2NNNA 4NB5A 1GDHA 4RGRA 3EHEA 2Q1SA 1QP8A 5JHUA 1KETA 4AJPA 4M9XA 5C3MA 4BKRA 4YAIA 2XVCA 3HRTA 3D3WB 2MBFA 4ROSA 4IDAA 1GZ3A 3G1UA 4JBIA 2A94A 4KA4A 5JSFA 3RC2A 4L0ZB 1J6UA 2P4HX 5EPOA 1ZSVA 2BGMA 3S2WA 4CHUA 1R15A 1IL0A 4DPLA 5G4KB 3S2FA 3UCEA 1R1UA 3ZWOA 4W99A 4D3FA 4E5NA 3O4RA 3CJNA 2PTGA 2M45A 3FM5A 3CO6C 4BNHA 5L3FA 5IT9K 4O6VA 2X9VA 4JK3A 2GR9A 3GGGA 3K1NA 1LB2A 4QECA 4CQLA 3ZMZA 1P1RA 1U2WA 2A4KA 3N4MA 4FCCA 4HX5A 2CSUA 3ULKA 1TQMA 3TDUC 4LK1F 1KVRA 4LISA 4L18B 1KERA 2DQRA 3O2PE 3EMKA 5FD6A 1ISGA 3ZU2A 3HDJA 3MOIA 2DFDA 3PJEA 4TROA 1KYZA 4M6YA 1Y8QB 1LI4A 1D3YA 3B1FA 2DTDA 4TWRA 1YO6A 3TZKA 1T39A 4RPHA 6LDHA 4WEOA 1P4AA 4NDNE 1QR6A 4RB2C 3L2CA 4INAA 4KIGA 4YXFA 5GZ1A 5JAZA 3TOAA 3ERED 2PJPA 3VKUA 1ADGA 1DB3A 3K2EA 4A5NA 1Y9EA 3LA7A 3PWSA 4OHUA 1I24A 4MP3A 3BXXA 1SMKA 2P91A 2P5KA 3I9MA 4DIFA 2D1HA 4EUFA 3AUSA 2GERA 4NFYA 3OV8A 4CM8B 2J5OA 1BIBA 4ZQGA 1HDGO 5F1OA 4L9JA 1MP0A 1ZH5A 4B4WA 3ROUA 4G8XA 3SXYA 5CJ9A 1D1TA 4DA9A 4E5KA 1HDRA 2D1VA 2GXGA 4N0BA 4D0PA 1DEHA 1SAYA 2ZB8A 2JPCA 2P4QA 2VUTA 3PP8A 2PLYA 4IQGA 4IMPA 1T6SA 4K9DA 1ZLJA 5A9SA 2VN2A 3KP6A 4D79A 5A4DA 3BYZA 2IA1A 1ZVMA 1AN9A 1EUCA 3JYPA 1L3LA 3WYCA 2ZO4A 4EDFA 1OYWA 5A9RA 4FPXA 1BTOA 4MPDA 2DK8A 3GG9A 3GZ4A 3JV7A 3W8DA 3HG7A 3K1MA 2O3RA 5EESA 2X0JA 4RDIA 2JCVA 1LDYA 1GR0A 2EKQA 1DRUA 1GQQA 1ZXBA 4JX8A 2FOKA 1CYDA 4QFCA 1ADCA 3JQ7B 4YYZA 3MTGA 1RYDA 4ZVVA 3LSYA 3R0JA 3GA0A 2NVUA 3D4PA 4Q3EA 5AQ1A 3HFGA 3HJAA 4I2OA 3JD1A 3KSUA 1R4MA 3GPIA 3GMDA 4PLWA 2GNAA 3PWKA 4L4SA 1U8RA 3LDHA 1IN8A 1E7WA 4MQVA 3PHLA 1X0VA 2TMGA 2G9WA 4WXDA 1HSOA 1O6ZA 3DQPA 5ICEA 1U3VA 3FF4A 4FJ2A 1ORRA 4NJMB 4PLVA 4WNCA 5I7EA 1LDNA 3NJ4A 2PMUA 1AHHA 3QIVA 5T67A 2V65A 1Z7EA 1BRMA 3F8BA 1NVTA 3GZ6A 2B4TO 3TFOA 5D5VB 3U4CA 2Z99A 3RFVA 2EEZA 3MJCA 5BMZA 3LT4A 4RF5A 2Z3YA 1SBYA 3F8NA 3ANMA 3DHYA 3P7NA 1ENOA 4II3A 3PIIA 1N9GB 1CWUA 1HDXA 1P44A 5LGUA 5T5QA 1GV1A 1SEPA 4XJTA 3ROPA 5T64A 1HWYA 2HO5A 2KJBA 1A04A 2DKNA 5IT3A 1U6GA 1K0UA 1ONOA 2HK8A 4XYEA 1IOLA 2X5OA 5CVJA 1PJLA 2B0JA 1FX7A 1I27A 4R68A 4AJNA 4A2UA 3RUDA 2GF2A 2VCYA 3KLPX 4H16A 5TJHA 1KVUA 5A05A 2OQGA 2VWHA 5E8GA 3LAJA 3OJFA 1RZ4A 3DEYX 5F5NA 6ADHA 2KIUA 5AVOA 3DZHA 3PHGA 2GYYA 3D64A 1A71A 1WDKA 4IJVA 1K6XA 1WXDA 3EAGA 1B1BA 2BMAA 2I9PA 4E2ZA 4ZGWA 4WE3A 4NU5A 4ZYDA 2FNPA 1TQPA 3FWNA 2E49A 3RTRA 1HE5A 1U28A 5D4SA 3E82A 2NU9A
chains in the Genus database with same CATH superfamily
1BAPA 3I9JA 1IEQA 4XD7D 3TBIA 5L3GA 2YV4A 5BVHB 5IKXA 4TLCA 1E2BA 3A1TA 2R6JA 2Y1KA 5EDNA 1JDSA 2O5RA 4BWGA 4GGGA 1KMNA 3CRMA 4BNGA 4JXZA 2UUPA 2V55B 1U3CA 3H13A 4G0MA 4KDEA 2JGFA 3B1WA 2QIOA 4N54A 4XX1A 5LKAA 2YFYA 3I6MA 4TMFA 3NI2A 5ECDA 3WYEA 2WT9A 3OPNA 3IEMA 2I4LA 5LQDA 4DM3A 4FUTA 3CLSC 4WSOA 1HEYA 2FX3A 1GLGA 2LH9A 1U0RA 2I4RA 5E9AA 4DC9A 3OYKA 4K40A 3RIRA 2WWWA 3WTZA 3DKWA 1ERDA 2WWHA 3GU3A 4RK4A 5A6VA 1E7RA 5TRDA 4HLNA 1LEHA 3IAXA 4M9QA 1F8UA 4F56A 5F7JA 1XROA 1G4UR 2E2JJ 1G21B 1NX6A 3ASVA 2RB4A 4XWAA 4LDNA 3TEJA 1H0RA 1RXVA 5EEGA 1V1RB 3B1ZA 3N1UA 2VTBA 1IN6A 3DQVC 1RRGA 2OYRA 4GR4A 1N33B 1AQIA 3AR2A 3OTOB 2IHKA 1BG6A 3R4CA 2HFJA 4Z1OA 2ZDQA 4XQEA 2W4MA 3WK5A 1NNUA 1K6EA 4U2FA 4B7AA 4RA2A 5TMDA 3OQJA 2HOTA 4CKCA 1L7PA 1OI2A 2ZI4A 3OZWA 4P55A 4DIOA 4FHEA 1UKVY 2H65A 2ZXFA 3CZQA 3T7AA 4D74A 5FOQA 4UPEA 4EPYA 4Z4IA 5BR1A 4HNAA 4TXNA 2ZIGA 1I1SA 1I6HJ 1ZCJA 1VDZA 3KJEA 4GNKA 5J2TB 3H9CA 2W4IA 3HUGA 5CJJA 1LV7A 2VEDA 1GAQA 2ODEA 3GK3A 3EC7A 1FW8A 2F55A 3S3NA 3E7LA 1ZN8A 2ZT5A 4A0GA 1VQNI 2GN8A 2JQ7A 1XSEA 1OWLA 3E53A 3HVHA 3NHMA 4J9VA 5DKFA 1MG5A 2PV0A 2WKPA 3HR4A 5JC1A 1E58A 4AMUA 1U5TC 3HKCA 3WTTC 4MWOA 2OILA 1VBKA 4MR7B 1GEGA 5H83A 1R74A 1Z16A 2K4BA 2WKSA 3HGMA 4U6QA 5DHTA 1QG6A 1QYXA 4XLCA 2Y1WA 4M1SA 4NU6A 4ZZ3A 1YR9A 3ZOKA 3OEHA 5C3UA 2DF8A 2YJTD 4A7PA 1ESMA 1Y3IA 3VNQA 2C4MA 4LF6B 1ZSYA 3TECE 1YJNI 1F2DA 3E8XA 2KKOA 1EWVA 2W11A 2WJ4A 2WFLA 3DGEC 3NBQA 1RRKA 4OJYA 4QUAA 4RJIA 4ZO4A 4Z54A 1C2YA 2H4ZA 1KTIA 3RC9A 1UBJS 3C85A 3CW8X 1KRWA 4G8BA 5HF8A 4C29A 3DEHA 2RJNA 1ZL0A 2HQ5A 5SYAA 2FG6C 3KKQA 3M3DA 1E7SA 4EUEA 1OZFA 4JS0A 1YOBA 2HGSA 3TBKA 5E79C 1F3OA 1HL3A 2O9LA 1M2KA 2ORYA 2W6OA 2I71A 4LS3A 1RZ3A 2QRNA 1T3ZA 5E3JA 3U3RA 3CZ9A 4CEHB 3E6DA 1AKUA 2I4NA 3O8QA 4YJ3A 3ODPA 4ARZA 1ZP6A 4WFJA 3G2OA 3ZMUA 3NTQA 1AKEA 3S93A 4IXTA 2JDID 2OQVA 3V1UA 1JKFA 4AC9A 5LRSA 1UWKA 3LT0A 4Y7DA 1ON2A 1SKAA 5I9BA 3SYNA 3ZV7A 1KI6B 3SOPA 1NASA 3HZJA 3TJMA 5M7EA 1JEQA 1XCLA 1QMGA 2MSCB 1HDOA 4WKGA 2MH9A 2WWFA 3BXPA 4OKNA 1YX5A 4NK4A 1RKUA 1M2VA 3A6EA 1JA1A 4I3HA 4DCSA 3AG5A 3ENVA 2DY0A 5GPCA 1DNPA 1K92A 2AA3A 4JVMA 5AKHA 2FLVA 2Y9YA 3FDJA 3O75A 5D3QA 4X9XA 3ER9A 2J5PA 4IJ6A 3IURA 5TMEA 2LCQA 3I2HA 5EWLB 5EY5B 2KPOA 3CRW1 1XLUA 1LGYA 4BFZA 2XB5A 1D7AA 1VDMA 1LVGA 3FRJA 2BBOA 2PZGA 3DO6A 3GCZA 3ML6A 4CETA 1O97C 5CEFA 3B6IA 4FX2A 1L5YA 1LBTA 1ZQ9A 3TRJA 2DUMA 1XZGA 1P1HA 4GKAA 4K1XA 2ZB7A 4H0CA 4J1TA 4P4GA 3GBVA 1W1WA 1T8WA 1F7VA 2QV0A 5IN5A 3HDDA 4PFOA 3Q0WA 4NTZA 5KNBH 1I4TD 1FDUA 1UH5A 1Z6XA 3QEMA 4K0RA 2XSZD 4B3CA 3HA2A 4RHCA 3FM9A 3V48A 4A10A 3OQIB 4KR3A 1H2BA 1JZSA 3DKXA 4QLOA 4E70A 3DC7A 3GT0A 3NTOA 3SMQA 1LDKB 2YR0A 4F91B 4V02A 3KQVA 5FBWB 3V7UA 2C7GA 4AAYA 4MVWA 2YBDA 4ZYTA 1VJRA 3VPHA 3T0GA 5JATA 2O0YA 3NHAA 1O87A 4P6VF 4PHGA 3K8OE 1YDMA 4L3WA 4CJXA 2HXGA 2ZI7A 4F85A 4AF6A 3C1UA 3FUTA 4OHCA 3QVUA 2Z5UA 3ZE1B 3ZXIA 1OIWA 1MW9X 4GC9A 3UV3A 5CCXA 4ZEXA 3HXTA 3LQFA 4XX0B 4G5SA 5J4LA 4EI9A 1AA7A 2WJ3A 1KS9A 4AJ2A 5BT8A 1WBJB 3KAQA 5FPTA 2MSDB 1GL7A 1PWYE 2VA8A 4G0NA 4D99A 3BQZA 2F8MA 3WYBA 1C2TA 4NC8A 4Z5XA 3DCIA 4HEHA 5GJBA 2VJAA 2IZ6A 1AKTA 3EWSA 2Y0DA 3FHLA 3TW6A 4QDXA 5CJ2A 1P9WA 2QVOA 2GX6A 3CUQC 3W5UA 4KXXA 1A0OA 1JR6A 5LXTF 1MB3A 3IOEA 2K4MA 2R7NA 1IEVA 3EBLA 2H5EA 4YEJA 5KNBD 3I64A 2CYBA 3IUSA 1J9GA 5LEJA 2I65A 4MW0A 2IP1A 1YGPA 4MIYA 5FF9A 5FBQB 4I6GA 5EEAA 4P93A 1ZW1A 3NOVA 1KYIA 3S15J 2D5CA 3O4IA 3JRGA 5H70A 4CFSA 4AM8A 3H5AA 2ZC2A 1SKYE 1YT5A 3ZIAA 2QEXI 1BI2A 4UUVA 3OFJA 3B6EA 3GAZA 4KP7A 4W5HA 3ZHYA 3Q7PA 5IKOA 5JCPA 3SSAA 2OQIA 2WAOA 4XRGA 5JQGF 2J9XB 1LFBA 3OLYA 1BH6A 4CCOA 3F6CA 1BXZA 2MR6A 3IUMA 3PHBE 4OQMA 1YRNB 3HSYA 3Q5DA 2I33A 2WR8A 4UUMA 2CC2A 2P5LC 4TMZA 1HDPA 2ECCA 2OD2A 4NE7A 3QEJA 4OHVA 3A32A 3WFZA 1FTWA 1EXNA 1HSZA 2D06A 3IERA 1HQDA 1WS6A 3INGA 4TXHA 3ETCA 3GCXA 5G0TA 1M6YA 2YIVX 4ZVLA 1SG6A 4II2A 3QI7A 1XQ6A 3RYFA 4G07A 4TT3A 2PVCA 3OQVA 3QRFF 1EBUA 2QSJA 3BSWA 3AVUA 2D2WA 4HN2A 1YBMA 1M2OB 2ZSIB 4L50A 4ZZIA 3NARA 4XBFA 1QYIA 2ANCA 2F2EA 2W2LD 4R0NA 4RGVA 2UYOA 3OIOA 4YAFA 4OHWA 1GN8A 4XEHA 4PW0A 1E8NA 3VPAA 4E7PA 4RGQA 2CQXA 1GITA 1PLJA 2A78A 2LSOA 1NWHA 3H9UA 1HYGA 3EA0A 1I2MA 4NJEA 4GDFA 1R6DA 2VJBA 3SC4A 6AT1A 2R7XA 3ANLA 3QYFA 1UMCA 4C1BA 3AF6A 4QIWN 3T9DA 1WSUA 4JI0B 2HCBA 2QRJA 4GXTA 3RPQA 5FOUA 3SFVA 3NG1A 5AFSA 2K7FA 2QM3A 2LCFA 5GADJ 3NM5A 5KJFA 5H6QA 2UVPA 4RZHA 1Z21A 3L0OA 1MX1A 2OP0A 4BO8A 4I5EA 4GEGA 5IJXA 3IPAA 3BULA 1DC7A 2FEZA 3CR3C 3G9XA 3BQNB 4UBOA 1A9ZA 2GZ3A 4V0OA 1GADO 3ETLA 1ZUNB 1NF2A 1GZDA 5HGJA 3G8YA 4H1HA 2H8RA 1Q14A 2ZWOA 1SVKA 3W2GA 1G3YA 1J1IA 2QA5A 3T5CA 4CBVA 4P38A 3IKJA 4LXUA 4RIFA 3HOZJ 5EIEA 1MR3F 4GGPA 2R7VA 2QTGA 3MTBA 1XZAA 3A3YA 2W2NA 3KYIB 4N1AA 2VZ0A 5JT1A 1MSEC 3L07A 1HQYE 3PSFA 2LVBA 1Z3XA 3N6RA 4UFNA 4UUQA 5LA6F 4EYSA 5FKKA 1ECFA 2PFBA 2OWEA 4LY0A 3KUDA 3MS4A 5GJVC 3V3TA 5EMLA 4O29A 1MMGA 1ZNZA 2ACVA 3L7LA 4KB5A 3ISJA 3Q8KA 2NACA 3SJCA 1DEAA 1K5GA 4OWRB 2WWVD 2H18A 3HBAA 4LK0F 3SGLA 1Q16A 4X24A 3EAQA 2EZ4A 1ODIA 3EQ6A 3HBMA 3BLYA 4ID3A 1MGTA 2CW5A 2FW7A 1EFCA 2JAOA 3HKDA 3PQFA 4RD6A 4WLVA 3ZGVA 3HRMA 1T4CA 3UV7A 2DVMA 3LYHA 3U7FB 2QZZA 1BL0A 1YIDA 2ZBKA 4W5NA 4O59O 1Z6YA 3MINA 2WF5A 5FJ8J 3NZEA 4EPWA 1SUAA 3T54A 3S2UA 1Z7GA 1JJAA 2KZGA 2DUUA 4FSXA 3BPSA 5F1KA 4L9VA 3ZQLA 3M3PA 2OQ2A 1NW8A 2HKXA 1WJGA 4DLUA 3FZNA 1E1YA 5BNZA 5L9AA 3ELKA 1A7KA 3QFFA 5EIBC 2EJCA 4EYEA 1L4MA 2PD4A 5TGZA 1T4BA 4B8ZA 1GT0C 2ZXJA 5DHRA 3KBBA 3SQMA 4YV7A 3FMSA 1HE4A 2XGGA 5DBEX 2ONYA 1EVJA 2Q4EA 2BFBB 3HCAA 4I2NA 4ZA2A 3RT1A 4X3PA 2P9CA 3Q3HA 3V5NA 5DM60 4MULA 4Q1AA 3GCDA 4IZHA 4B8YA 1GYRA 1EHYA 2FRHA 4OI0A 4CKBA 4M2LA 1BRTA 1ORTA 3H1TA 1B2RA 3BD6A 2PBZA 2WJAA 2NUBA 1QGUB 1ECGA 2NVXJ 3V8RA 1RWVA 2Y71A 3H4VA 3NHFA 2GCPA 1SQ6A 3VZSA 1I4WA 2EIHA 2BHLA 2AFVA 1DUSA 2QLNA 4DMFA 1GA1A 1L0BA 1X1CA 2EA4A 2IA0A 2F4IA 2OCAA 3HB4X 4Z86A 1TYBE 5ICSA 4X97A 2BGCA 4TVSA 2IYQA 1ZVKA 3FETA 4HLUA 3C4JA 1BC8C 1GU0A 1T9KA 1W87A 1JJFA 1SB8A 1DFIA 1E3EA 1Z3CA 3COPA 3QF7A 4KR0A 1BDMA 4WX9A 5DDIP 5ERYA 1FK8A 2W82A 5G4LA 5CA0A 2JUGA 3BORA 1K83J 3QOXA 1K8ZB 3WLEA 1POGA 1PZMA 1S3IA 5AJWA 3IQDB 4GKVA 4C0SA 3CP2A 3ETJA 3NBUA 2BJVA 4RCZA 1C1DB 3OOHA 4MPJA 5HKKD 1QS0B 2ZP1A 1U4OA 3Q3SA 1NULA 2GDJA 3LW8A 4P5EA 5EJ8A 1QRUA 3WI7A 4N9HA 2Z5FA 4DTCA 3EARA 1VQ7I 2HJWA 3S7TA 3ZGOA 4YFXF 4KT5C 1BA2A 3NAUA 1F5NA 2QBYB 2BVNA 3OZXA 4I5DA 3GIWA 3WGZA 2Q8QA 1DELA 1HE3A 1JQ5A 3AQ4A 3D5QA 3P5SA 4IJUA 4L5JA 4LHWA 2X4LA 5FLYA 5AXDA 3W2EA 3F47A 4YK7A 1K4TA 2VO1A 1COZA 1IBSA 2F2TA 4JKYA 1PNQA 2B8EA 3C2QA 4UDXX 1C1XB 4X8MA 2H17A 5EKUA 1KH2A 4WBNF 1YDGA 2G63A 3AIMA 4LXTA 3MERA 3R0AA 2R92J 3OOPA 2V0CA 4LJ6A 3E9RA 3S29A 2FP3A 3TLBA 1IN4A 5AIBA 4PRYA 1LVAA 4CIYA 4FX5A 3TOVA 1E5XA 4XSGA 2FSPA 1KE2A 1NQXA 4W8GA 2VK8A 3BROA 3WAJA 3L6EA 1OV4A 1P5JA 2V96A 3RYCB 3L7CA 2QRQA 1ZIPA 2JFZA 2XCOA 1J8FA 1JQJC 1C1DA 5GQSA 4NYIQ 1KF0A 5JNSA 1KBOA 1ZD9A 5D5HA 4AQDA 1UT5A 5DLYA 4H3SA 1Q92A 4HRXA 1YCGA 2R7DA 4RS8A 1TZMA 4KBGA 9ABPA 1U2EA 1UMDB 1C0IA 2VLIA 1CF9A 4FGUA 4IGEA 3IIKA 1IRGA 1V7PC 4XM2A 1J8MF 4LBZA 3SG0A 3OMYA 4RGBA 3UWMA 1LBQA 1X1TA 4JIMA 1Y5RA 5IRCD 2GAUA 2DRIA 3GBPA 3P9ZA 4D25A 1EGAA 2EERA 2H63A 3VDQA 3CQZJ 5CVEA 4E3WA 1VG0B 4M99A 2FSSA 2PCLA 3P0FA 4MQEA 3VHLB 1G19A 3MVPA 2V0NA 3AETA 4HVAA 3H3ZA 3I5AA 1YHNA 1FMTA 1SU8A 2A86A 1P0PA 1VSUA 2RGCA 2ST1A 1NAIA 1CUFA 3DDSA 2R47A 3G17A 1RXIA 3G1TA 3I2KA 4LNAA 3F6BX 4M0DA 1L5VA 1T6XA 4QDZA 2WMOB 2QW0X 1GNVA 1WKMA 4R51A 1P18A 3Q0IA 1XDDA 1XZFA 2R6DA 3DPIA 2RH4A 3ZGZA 4BP9A 3K6GA 5JCXA 1A8SA 1E96A 4GCVA 4GR9A 2NUTA 5E7JA 4BU1A 3O1LA 2AEMA 3BX1A 5TDHA 3GW8A 5FQOA 2OHOA 2ECQA 3GF4A 3GJQA 3NC4A 4X93A 1XB2A 3B73A 2KM1A 3AERA 2G6BA 4PXYA 5HR5A 4K9SA 1J5XA 5JJBA 2NS8A 2OU2A 1IBKB 3RASA 5KWSA 4CF4A 1XTIA 3LFHA 3A10A 3RIHA 4F55A 3TUIC 5CT5A 1U8TA 1ZOIA 4I98B 2A5WA 4QLAA 2E5ZA 1C3LA 4CV2A 4P83A 3G2QA 4XORA 3ZHOA 3P9XA 2Y6UA 1F4LA 2YYYA 4FGLA 2CUFA 1KH3A 2OO7A 2QN8A 1Z25A 5JZOA 3CGWA 2HXOA 2OCGA 2QTFA 3KQSA 2M8GX 3DNPA 3BIXA 2G7UA 2W43A 3FMGA 4PCLA 1IIBA 4BZWA 4HVTA 1WWXA 4NHOA 2QM0A 4CT4B 4EFNA 3WU1B 1BOBA 1N3IA 1NWCA 1S96A 1UK7A 3VR5D 5J1YA 1DPUA 3CG4A 1RYHA 4LCBA 2OPHA 3E2PA 3IRQA 5THKA 4P7BA 5JS8A 2WD7B 2QVXX 5DTMA 1IZ9A 4AY3A 1U63A 2PMHA 4GH5A 3IAM6 3LK6A 4F2DA 1WULS 4Z3KA 3FLEA 3TQCA 1F6WA 3DTYA 1AU7A 1H9BA 3TVYA 2PKWA 2H1OA 5KMGA 1GKLA 1ZY2A 2F59A 3S17J 3M3HA 3QYBA 1FIAA 4RKRA 2X0FA 3TZ6A 3BCBA 1NOJA 3PRKE 1SWWA 4UAGA 1LFUP 1POWA 3MZ0A 1KE1A 3V4FA 1TK9A 4MKIA 2O3SA 1O08A 4L08A 2PHZA 1XZ8A 2EG5A 4M3FA 2GCNA 2R9VA 4IXAA 1MDMA 1KIFA 3EGCA 3G9ZA 2QD2A 4G5HA 3REGA 3FJYA 3X2SA 1P60A 5F7XA 1Z28A 3ICPA 3BXZA 1MH1A 4ZYEA 4FYKA 1Q57A 4NBVA 5D87A 2Q8NA 3UKGA 4BY1J 1DTSA 2XUFA 3ETEA 5JAOA 3A6JA 5LVAA 2P7IA 2IYWA 2ZRDA 4P80A 4YREA 1HZZC 1B14A 1IGNA 5L3VA 1OXTA 3BJIC 4FMBB 1D7OA 4DQDA 2HRZA 4PC6A 2F6RA 2XT6A 3SX2A 3SXJA 3VVBA 4KUGA 4TGLA 5BV0A 3OE5A 3FYHA 2HDHA 4GQAA 3TLJA 2YJZA 1R16A 2GF9A 4HZGA 3MWKA 4GGOA 3UEOA 1NUUA 1R7RA 4PLZA 5JEDA 3OEHD 4E5YA 1U7WA 2XB8A 3T4PA 2GO7A 3LM8A 5CT8A 1QNLA 4HGYA 2FEOA 4FOSA 1S4QA 5EXDA 1GM5A 4B4CA 1G20A 4FOOA 1YZUA 3ICEA 3A11A 4IF6A 4RIEA 5KQSA 4YHBA 1DOAA 1KK3A 3C3WA 4C21A 4Q7QA 1N3LA 1OHHA 1WPKA 4OIQF 3HCFA 4C2MJ 4CYCA 4KZKA 2EKZA 2WF6A 3PEFA 4JUCA 5SZIA 1Z73A 1GCGA 4EY3A 4ITVA 1ORIA 2H2FA 2BM8A 4ND8A 4BN5A 3B82A 1H8AC 5E18F 4HNGA 5LP6B 1EJ0A 2QN2A 2IPAB 4P4TA 3WGGA 3H17A 5BN1A 4HLXA 2FMTA 3WK7A 1B8UA 3K9FC 1H3FA 1S3SA 3J7AY 1MA3A 3LT1A 1AKHB 1WQ1R 2HDOA 1DRVA 2UZIR 4BBJA 7GPBA 1ODTC 3PLAE 1C4XA 1P7YA 1X1SA 3V7CA 1NBMA 2Y2UA 4L0QA 4MUHA 5DN9A 4D3XA 2YU9J 1NLMA 3PDCA 4MV4A 5HS6A 4PZYA 2P75A 2FCAA 4DWOA 1UBGA 3BB4A 1WXHA 1SC3A 1IVNA 2PIDA 4L9SA 2TECE 3VTZA 3TSYA 1QB7A 3DP9A 4CKBB 3E5HA 3MIIA 1PJQA 1Y6ZA 2LNBA 2NNLD 1ICIA 3NGMA 3I3OA 3V46A 3X1JA 3VKVA 4S1VA 3BMQA 5JFRA 2Z2JA 2RGBA 4XA8A 5CTAA 3AHJA 3H9EO 3CJTB 5DWVA 1FUEA 2DH6A 1EUZA 1WUTA 4DIKA 1YVEI 1K8RA 3BSSA 4NXNB 1AOYA 1TF5A 4FSHA 3QEOA 4ITUA 4KV9A 1H85A 1MMAA 5F08A 1PRYA 3IO5A 1AM4D 3STHA 3H3FA 4P9UA 3ACCA 5A0VA 4FW9A 4OXXA 1EBBA 3F78A 4XUDA 3ZDXB 3K72B 6REQA 4KBYA 3DTKA 4G6ZA 4R05A 2XHKA 2FPRA 2VP9A 1RXUA 2O8EA 2ZRKA 2XODA 2QG4A 4Z0PA 1UPBA 2VIXA 5AKZA 3HU5A 1OXKB 4YRTA 4IIVA 5A1TA 4FDMA 3QE9Y 3E6BA 1BHQ1 2HYGD 2V9KA 4AIKA 3CEJA 3QE4A 5AKKA 5IVKA 2IDZA 4ON0A 2VOEA 4BVJA 2BFCB 4L5BA 2FEMA 4GYKA 1T9BA 1CLUA 1JIVA 3IXLA 3PYMA 3PQ7A 4EUKA 2OR3A 5M3BA 2JIQA 1PAUA 1Q0TA 1LPOA 1YJQA 2ZGVA 1RKBA 3I83A 4CZZA 3IA7A 1PKEA 2EKLA <