3WG9A

Crystal structure of rsp, a rex-family repressor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
209
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 74
structure length 209
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wg9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wg9A02
1DIHA 1HYEA 1FYMA 1J9IA 2PH5A 2Y1EA 3FPCA 3NEPX 4IHSA 4MVJA 3WBBA 4PLVA 2NQTA 1QLHA 3OJFA 4GLLA 3EYIA 4L75A 3JD4A 5A5EA 3I0TA 1I0ZA 1LU9A 1Z82A 3CUQC 1ZJZA 3QWAA 4MQ9F 5L7YA 2GXGA 2XRNA 2VUTA 3TQHA 4TWRA 1HKSA 3ZNOA 4BHCA 1EDZA 4WXDA 1UH5A 5H20A 3GFBA 2J3JA 3ZMVA 1YH3A 2CG4A 3Q0EA 4BGVA 4DRYA 2JRTA 2OZ6A 3B6ZA 5TRTA 3IIEA 3K92A 3O4RA 2XF8A 3O6BB 3D64A 5ICMA 3H9EO 1H93A 2R00C 2GCGA 2W2KB 1HZZA 2OBYA 3TO6A 5CEEA 1T6SA 2ISZA 2EJWA 2DTEA 2P5UA 4JQCA 2F5DA 5LGUA 1FZPB 3ST7A 3X2EA 5CEJA 4GYGA 4EBFA 3OA0A 1U4OA 1EE9A 1Y9EA 5LRRA 4I5EA 3HRTA 5LC1A 3NTQA 4BQAA 4DGSA 1GZ3A 1YL7A 4RVUA 4WEOA 5DULA 5E18F 3GGGA 1FDUA 3GZNA 2RHRA 2X5OA 1UAGA 2AG5A 3WSVA 3GDOA 1KQ0A 3QOPA 1Z91A 3T7CA 2EFQA 1UDBA 4A2UA 4OJNA 3R0IA 4PIVA 4N5LA 3NX4A 3RYPA 3UF0A 5JVTA 1SBYA 4GAEA 1JVSA 3RFVA 3CUQB 1LSOA 4I5DA 3SZTA 5GMOA 2GWRA 1TI7A 3B1JA 4CLXA 2VRCD 1UXKA 3ICPA 1LQ1A 1Z45A 2WSBA 4XYLA 2Z1NA 4AIHA 3GFGA 4JNKA 2H9IA 3KP7A 3JAMK 2RH8A 3BA1A 5HLIA 1H2HA 1KC1A 1UHWA 1RUOA 4ZYHA 1LDMA 3H5AA 1HSOA 3WTUC 1B1BA 2PZKA 3FWNA 3GVHA 4J90A 1QPMA 3DBRB 3IC5A 1MA0A 2H1SA 2QQBA 3VZRA 4IZHA 5L3BA 4RGXA 2MLKA 1I24A 3KLOA 1LSUA 2PLAA 3EZLA 3IP1A 4I1IA 5DP2A 1N8KA 2FQ3A 3GEDA 2J6IA 3IS3A 3QQPA 4C7KA 3QVXA 2CFCA 2HRZA 4YJHB 3WICA 4GMFA 5D8LB 3WJAA 3F6VA 2Q3EA 2WEKA 1USSA 2P68A 4I0BA 2R2GA 2WYWA 2G7UA 4IBOA 4BV8A 3FSRA 1BHSA 3IJRA 4S04A 2VWGA 2X0JA 2Y75A 1I36A 1QYWA 1X1TA 3V8LA 1U5TC 3HDYA 4M9ZA 3DAPA 3K2BA 3VDRA 1MDMB 2RVCA 1YGYA 2WE8A 1HXHA 2OL4A 4ZRMA 2GQQA 4J43A 3W6UA 4DREA 4MP8A 1IRGA 3VB2A 1CQJA 4E12A 4DQXA 4BVAA 4QO7A 4U5QA 4ILKA 4LCEA 4XSXF 2LF8A 3ABTA 3COAC 4WK8F 1NQ5A 4DLBA 2M30A 4HDVA 3LU1A 2ACJA 3LF2A 3OF2A 4Y6RA 4RCVA 2NTVA 3ZW9A 1R0LA 1DHRA 1E6EA 4HWKA 1GUYA 4KUHA 4QTZA 3KEOA 3L09A 2QWWA 1OMOA 4WNIA 4B79A 4E5MA 4L9NA 1YW7A 4Z6KA 3FWEA 2DPDA 2GA2A 4MIEA 2O4CA 1P33A 3E8XA 2K02A 5JYEA 3HADA 4FFLA 4HKTA 2JJYA 2XPCA 2KKOA 4ZD6A 5JBIA 2I9PA 3T1BA 4RZIA 2Q45A 4EMSA 1YKFA 1BVUA 2W4QA 3JYOA 3TFQA 1GYQA 5JMWA 4KDEA 4BO4A 1FWZA 4ALKA 1N92A 3K1MA 3H9GA 1I2CA 3QWFA 1CQIA 4LK3A 4URFA 3RFTA 4LRSB 4RDHA 3PQDA 2A07F 2CDBA 4R79A 1OYWA 5BMZA 3VZPA 2XAHA 4DBVO 4DUPA 3JQ9C 3FM5A 4TSKA 3SLGA 3DFUA 4AJLA 4XWYA 1ZEJA 2IZ1A 1IAWA 3AY7A 5J23A 4M9SA 2OA4A 1HYGA 5G0TA 5E1WA 5D5WB 1E3LA 1LRLA 3OEYA 5L3GA 3C3XA 4A0XA 3Q5FA 2EF1A 2NU8A 3RVDA 2FHSA 3HDQA 2A92A 4IUYA 1GVJA 1SMTA 3WJ7A 3DOCA 1B4AA 3G3ZA 2F2EA 1O57A 1NPTO 2C29D 4D3DA 2Q8KA 1MJAA 1I01A 3HE3A 3U3XA 5CP8A 4QT0A 3GAZA 1R37A 1Y5MA 1ZUD1 2POQX 2ZJ2A 4Y6PA 1F9NA 2EKQA 3JD2A 3DFZA 4HBGA 4B8ZA 4Y6SA 1O3SA 1YB1A 2E48A 5DZSA 4E2XA 4NU6A 1EFLA 2GN8A 5I9MA 3PZBA 4ALLA 4KIBA 1JKJA 5E1ZB 2Y1CA 3HSFA 1WKMA 1HYHA 4FX4A 1W73A 3D4NA 1ZSVA 2OP1A 4RVFA 4BGIA 4QQRA 5BNTA 2Z3YA 2O6GE 2O8XA 1DRUA 1KY4A 3BHMA 4IJWA 1YWGO 4L4XA 4BO5A 4J4HA 4JK3A 4FFMA 4IRGA 3IOYA 3TOZA 3L77A 2NYXA 5BQTA 1T25A 2FPPA 2W90A 3RBXA 2LKPA 3ZWNA 4U0KA 5DCWA 1NR1A 2GAUA 3GVAA 4RORA 3WWZA 4YJFB 2X7HA 4RLHA 1YDEA 4EJ0A 1IN8A 3T8TA 2CF6A 2G17A 3SC4A 5K6AA 1QYXA 4NFYA 3AM4A 4RQTA 4AJEA 4EUHA 5L53A 2JPCA 1IXCA 1YOVA 5TS3A 1ZK1A 2ZCWA 3ZWAA 5IG2A 3RC1A 2FEZA 2O3RA 1SFEA 3RUIA 2W24A 5IDQA 2MH2A 1SFXA 3U62A 5HA5A 3KYDA 5ER6A 1E3WA 1AWCA 1QR6A 4HLYA 3MOGA 1DIAA 3FXUA 3IRRA 5ICCA 3JSOA 1BMDA 1XQ6A 3E5QA 2Y1FA 3DBLB 1F8GA 3NTRA 4ALIA 4AJPA 4J1QA 2GLXA 4IRHA 4ESJA 1GTMA 2I99A 4LVUA 3V4GA 2V1UA 3F4BA 1D7OA 4BNIA 1ZJYA 3BMCB 3RKWA 2GA1A 3R1IA 3WMXA 3HNPA 4A7PA 3HOTA 3GW2A 5DYMA 3O8QB 3I83A 3N74A 4CQMD 1QZZA 1GU7A 1GUZA 3F46A 1B6AA 1M75A 4QXMA 2DU9A 2EP5A 1NASA 1SCUA 2HK7A 2VNSA 1LEAA 1ENZA 4D3FA 3NYWA 2F5EA 2PR2A 1FNNA 3CINA 2BH9A 4CLHA 1SB8A 2WWYA 4B7XA 2WWRA 4RB2C 1GEGA 3L4BA 5AXBA 5C7OO 2YW9A 4HW0A 5JY6A 3RYRA 2DVMA 5BNIA 3GVIA 1Y1PA 5F5LA 1ADCA 2AE2A 5KVRA 3I9LA 3JYQA 1U28A 3KLNA 1LSJA 4NB5A 1OFGA 1SOVA 3WOHA 3DP7A 2HYFA 3E6MA 2JTVA 1VJTA 1VC2A 4H15A 4CLOA 5I7FA 3FF5A 3AUUA 1LDNA 2JCVA 5AVOA 4TVOA 4U0VA 1K6XA 3ULQB 2CYYA 1E6UA 4HFMA 5HS7A 4CM1A 1PJQA 1HXDA 4J7UA 2YV3A 3JW4A 1KVTA 1LC0A 1YL6A 2ZJ0A 4CMEA 5B4UA 1NVGA 4K2EA 3K2EA 2IYPA 2XOXA 4IM7A 1LLDA 3E6DA 1S29A 1P1JA 2ZKLA 1W4MA 3H4VA 3WLEA 3KCCA 5LDGA 1IW7F 3W1VA 4CLDA 1XDWA 3EETA 1UCRA 4UNOA 4E6PA 1EEHA 4BNXA 2FMLA 2W25A 3GRPA 1FP1D 1R22A 2LNBA 1KU7A 4ZYEA 1O8CA 4FBGA 4QUKA 3LA7A 3MJSA 4Q3CA 5IN4A 4YRAA 4GPD1 1NHWA 5EESA 4CQMB 4YFNF 3V8JA 4I5FA 1ZAOA 2W2LD 3K9TA 4G7ZF 1WSUA 2J5PA 1W7PD 3IC7A 3GR6A 3JQFC 1BSVA 3K5PA 1P4AA 4PZEA 2IZZA 2UXNA 1FXSA 3BTUA 1Z6TA 2NNNA 3BTOA 3V1TC 1U5TA 7MDHA 4KDPA 4F45A 1SC6A 3QP5A 1J7KA 2V6FA 4CV3A 1W5TA 3PYLA 5IZ4A 1F14A 4ASNA 1M6HA 1U2GA 2P9CA 2B0JA 2PKQP 4IMPA 3VODA 2JT1A 3HSRA 3H2ZA 2I67A 3MJEA 3H3FA 3VPFA 3C24A 3GNTA 1JE8A 3IDSA 2OZPA 2BEOA 4K9DA 4DVJA 3HN7A 3K6JA 4JIGA 5A04A 4L73A 4LK0F 5L4LA 2XIGA 4IJUA 5DBIA 3SJUA 3GOHA 4IPTA 2YX7A 3KLPX 3HDJA 2O4UX 1UHMA 4X54A 4CM9A 1E6WA 1DO8A 4D0RA 4PN3A 5J8CA 3R0JA 3PGXA 3W8DA 5CVIA 3WODF 3MZHA 2B4TO 3LQRA 3N4MA 3JD0A 3MZ0A 2JSCA 3VTZA 3I9OA 1TNSA 3ZN2A 2NU9A 2BI8A 3RC9A 5JXWA 1MLDA 5BPDA 1KS9A 4ENMA 2YHIB 4BNUA 1EH8A 4FCCA 4EZBA 1ADGA 3MJTA 1XG5A 5ITWA 4DLAA 5JCJA 1ZW1A 1N1EA 1XQ1A 1XWFA 3KTDA 3TOXA 5D6FA 2PJPA 5F1RA 5BNFA 3VOEA 5BOXA 2GZ2A 1QMGA 3PJDA 1ZK0A 4RPHA 4MHGA 3U4IA 4ENNA 2C7GA 1SPXA 1M6WA 4O0LA 4W82A 5TSDA 3DV8A 1FYKA 3ZMTA 5LGNA 4D0SA 1DIBA 3QJ5A 1GZ6A 5HTOA 2VHYA 3ZNQA 1XGSA 1ZK3A 3K2ZA 1DC4A 3LC1O 2ZB4A 4AJIA 2EXXA 2VXZA 1K6JA 3J7AO 3F3SA 1XIVA 4DQUA 4HNHA 2NUAA 1FY7A 4JBGA 2QZ9A 2X0RA 4PRLA 4Z3KA 5B12A 4K6CA 1HKQA 4GI2A 4NPCA 1PEDA 3BYZA 3WS7A 2DT5A 3ETGA 3CE6A 3JQAA 1NWCA 1UXGA 4CM5A 3ANMA 1P4XA 1KU2A 4AFNA 2PTGA 4P96A 1DC5A 1VTNC 2EV0A 4CM3A 3FMSA 4UVEA 2G76A 3ZHBA 5C3MA 4C7JA 4NQZA 5HDGA 4Z0PA 4B4WA 1YS6A 2HGCA 2JD2A 3CKYA 1UP7A 2DFDA 5AXAA 6LDHA 1P0FA 3WQRA 2HTSA 1D8KA 2EV9A 1MGTA 3HZZA 3WYEA 3NJ8A 3MEXA 3OFSA 1R16A 4ZQBA 3UH1A 1MJBA 4PLPA 4U7BA 1QRRA 2COMA 1GADO 5CPFA 1CERA 5HLHA 1D5VA 1VM6A 3DZGA 2DLLA 1V3UA 3KYBA 2O2YA 4IQ8A 1T38A 4XIJA 3UCXA 3CO7C 3EDPA 3FNHA 3JQ6A 1J6UA 1R4MB 2NU6A 2O7SA 3L9XA 2I65A 1KVQA 1QQIA 1R58A 3BMNA 3I6QA 3DBHA 4RLSA 5IZCC 2ZKZA 1IPFA 4PRKA 2ZQZA 4YACA 4CUZA 1X3UA 3D4PA 1IULA 3HJAA 4EJVA 2DTRA 3EUHA 1G6KA 3PEFA 4DWVA 2AE1A 3OETA 2YYYA 5JCJD 1TT7A 2A68F 3H2SA 3PZRA 4RB0A 4MPDA 3P2YA 4GSKA 4RO0A 1R36A 3I5UA 1ZGAA 1H94A 4HV5A 1V6AA 4U0JA 4M54A 2C2YA 4OKIA 4D79A 4RGUA 1N9GA 4R8HA 1E3EA 2OUIA 2FBHA 5EEHA 5DCMB 1AHIA 4AJ2A 4PFJA 1EV7A 5MDHA 1DB3A 1BXZA 2FZEA 4WLUA 3JQ7B 4FFNA 4R9SA 4UVBA 2Y1DA 2NADA 3E1KA 2Q49A 3WG9A 2FF4A 1H6DA 3A9WA 4PLTA 3AI3A 4BMVA 2E1CA 3ZN0A 5DD4A 2RBEA 4EGYA 2WYVA 3HG7A 3WTYC 1SOWA 3L9FA 3OHSX 4UVGA 4YA6A 1WZEA 2WYUA 4J16A 2IRWA 1TEHA 2HMUA 4E70A 2FPIA 5KVQA 1DDNA 3PI7A 2HWVA 4GLOA 2K7LA 1AN9A 4NBUA 1JU9A 3I52A 4CLOB 3OQBA 3WNVA 2HAEA 3GLXA 3HHHA 5LGTA 3KP5A 3NQOA 2FOIA 4BO6A 4EEXA 2G9WA 4A2CA 2EFOA 4CMHA 1ZG3A 3LAJA 3LC2O 5FYDA 2STTA 4TZKA 5TJ9A 4ZN6A 1ZO8A 3ON5A 3H65A 3B73A 1DIGA 2BE5F 5KK1A 2Q4EA 4PLHA 4BB5A 4PG6A 2HMVA 4PLWA 3OEWA 5BQFA 4RGBA 3DO5A 3ROKA 4MGRA 5CVJA 3J80K 3GDFA 3V1YA 1BW9B 2HMWA 3E6CC 1ENOA 4RDIA 5MGBA 1JVBA 1M66A 4HA8A 1EBFA 1G3WA 4J4TA 4TROA 2C0CA 4BNVA 1A27A 1UP4A 1PQPA 1V3TA 3I71A 1GQQA 4GCVA 5A9SB 2L4MA 4QECA 1LNQA 2VYND 2H6BA 3KBOA 4NQWA 4JJIA 2V79A 3DAFA 3QY9A 1J59A 5JS6A 2J5RA 3CMCO 4FR5A 4Z9XA 8LDHA 1SB9A 2OAZA 1PWZA 4MIYA 2OP0A 1IF1A 4I01A 4MOWA 1B7GO 5CEFA 5T8KA 1C14A 2H5LA 2X5KO 5A9TA 3DHEA 5E8GA 5CDSA 2Y99A 3EHEA 4YT5A 2A9FA 1D4FA 3L00A 5JSFA 3F6OA 4PGHA 3AOEC 2HKXA 2DTXA 3FR7A 4P5OA 4AICA 1C0KA 2ZFWA 2AMFA 4GKBA 5FB2A 2L02A 2DBQA 3FNFA 4P8RA 4BKUA 4BNWA 3MAJA 3KEQA 1T4BA 3W6JB 2F1KA 2YJZA 3ZHZA 4YXFA 4R1SA 2D5AA 3I1JA 1YQXA 1VKOA 2QRKA 2E49A 2M5WA 4IDEA 5TT0A 3F8CA 4PVCA 1HRDA 1ZNQO 3WTWC 3TDZC 4E30A 1XB4A 4WCGA 2F00A 3DONA 1XYGA 2RC4A 1R5HA 4JJGA 1CF7A 1PX0A 5AONA 1BIAA 4PZJA 3FBTA 3QVSA 4XA8A 2P5VA 2UWMA 1P4WA 2BFAA 4IDAA 4KFCA 1ISHA 4I9UA 5G4KA 1PP8F 2YZ7A 2OXIA 2YQ5A 1E1LA 3H5RA 1FJHA 1MG5A 4NZ9A 1T1SA 3I4FA 4TKMA 2D3TA 4D3SA 3V8KA 1U3UA 4LSMA 2CO5A 5CVUA 1B3BA 1IN4A 2D8AA 4BKQA 4YAKA 4EJWA 2X1HA 3BHIA 3T7EA 3C3WA 3ONFA 4A73A 3VAZA 3T4XA 4G8XA 1KYWA 4AIKA 1B8PA 2OQGA 4YWJA 2PZLA 3LSTA 2IYOA 2Q99A 2UVDA 1CIVA 4ND1A 2VYNA 4NBVA 4RF2A 3OIFA 4YVFA 1VL8A 1P9LA 3PHIA 1FBQA 3ZWXA 5G4LA 3S8MA 4AJHA 1KYQA 3MQ0A 3WTVC 1GHCA 4II2A 3D7LA 4MIOA 3E9NA 4FJ2A 1LJ9A 2PK3A 1W0CA 4UEOA 4XYGA 2QM3A 3P7MA 5JAQA 4ZA2A 1U5AA 4JQFA 3RKXA 1RIOH 3C7JA 4IY1A 3LLSA 4OQYA 4P4LA 4R01A 5JE8A 2A6HF 1K6IA 3G79A 2FU4A 2RHCA 1C1DA 2QRJA 3HRMA 1QYDA 3AU9A 2G5CA 4OMZA 3LVFO 5KVCA 1RJWA 3PJGA 2AS5F 4D44A 2DUWA 3N7UA 3PP8A 5D4RA 1H0KA 2A3SA 2MC3A 4IGEA 2XAQA 4W99A 4YT2A 2X6TA 3JTMA 4S1VA 2HLPA 4KICA 4RGSA 3FXQA 3R60A 5G0WA 1KGSA 3QHAA 4OIPF 2JAPA 3Q11A 3RASA 5CG2A 1GZ4A 4EJMA 5DCMA 3GFIA 1KETA 2VWQA 3I23A 4NMHA 2H09A 4B8XA 2BKAA 2A5YB 3EAGA 1SFUA 4OH1A 1OYYA 4XGNA 1CRWG 3VFZA 3DQVC 3A06A 1HQCA 1MB4A 1MXFA 1BWSA 1OMIA 4XQEA 3LT0A 3UAGA 4BMSA 2GR9A 2FSWA 4HX4A 1DEHA 4NHJA 2AXLA 1ZREA 2ZB7A 3M1LA 4BNKA 2V65A 2BHLA 4PLCA 3PDJA 1BXGB 3OIGA 1PSDA 4GGOA 4MKXA 4YQZA 1I6XA 1YBVA 3MWMA 5IZCA 2P5LC 1IYZA 2JHGA 3AU8A 2L54A 5DD8A 3DBVO 1EFKA 3NT4A 1ZSNA 1P1FA 5T64A 3FD8A 3QSGA 1KQ9A 4I0AA 4M49A 3ZV6A 4PZCA 4CL3A 3DHNA 4IIUA 1K0UA 4HX8A 4RVHA 1HSZA 1JAYA 1YRLA 3GZNB 4ZYDA 4IVNA 1W8DA 3DKWA 3AFMA 4LB6B 1FC3A 4FX0A 3ZV5A 4EYEA 1GCUA 3E5RA 2VOEA 5CFZA 2XAAA 5ERIA 5BSGA 3TDUC 1LRJA 1E7SA 1YYVA 5JDCC 3VZQA 3NT5A 4WECA 2QBYB 1Z6RA 2AEMA 2WM3A 4FC7A 1JDJA 4LMRA 4CV2A 3BTVA 4Y15A 3AM3A 3DZJA 5L7WA 3I6IA 1ID1A 1V8BA 3R6DA 1NBOA 4U8GA 4W6ZA 3ZV3A 2EFWA 5DOZA 3FCOA 1ZEMA 4XR4A 4BNYA 5E8IA 3X2FA 2QZ8A 1DFHA 3LSYA 4R69A 3UN1A 3V5NA 4CUJA 3FF4A 1Z7BA 4E33A 4CMJA 4G6QA 1LDDA 3BZ6A 1PWXA 2FA5A 3TOAA 3HRSA 3PPIA 2IPQX 3WLFA 1ZRCA 3HHGA 1Y8QB 1D1TA 2NWQA 4IRIA 1E7MA 3DMTC 3DZHA 1WQ2A 2VTDA 3AY3A 3O8QA 1LDEA 3WWYA 1XSEA 2CNBA 2JKVA 4E4YA 1LDKB 3WIEA 2YV2A 2LSOA 4IF4A 3Q1LA 3OJLA 2V1XA 3WGYA 1XDUA 4TKLA 4A5MA 1T26A 3OJ0A 3ZQ7A 4EI2A 2Y0EA 4R1UA 3PDUA 3KVOA 1Y5RA 2V6CA 3G17A 1ZFNA 3GNQA 4LGVA 2ESNA 2NNLD 4W4TA 2HCTA 4EM1A 3CPSA 3FNGA 1FPQA 1HW5A 1HBXG 3H9UA 1GDHA 1PGJA 5F64A 3UW3A 2XAFA 5GZ1A 4BHBA 1DSSG 4CMIA 3KZVA 4CYDA 1NVMB 4JXKA 1O3TA 3NJ4A 1AGNA 2P9EA 4NI5A 2WMDA 1C0IA 2ZCUA 2AQHA 3NGLA 2CDAA 2Y66A 5EEGA 3I9MA 4XQGA 2Z33A 3WTCA 4OKNA 3GH3A 2G1UA 6ADHA 1TB4A 3IRQA 3WGQA 3RTRA 2RGVA 3LAPA 1ISJA 2C5AA 5CDYA 4XDZA 1AXEA 4FC6A 1ZGJA 1PQUA 1P0CA 3C8MA 1XSDA 4GGPA 4E21A 1PU2A 3LT2A 4GQAA 2JL1A 3RKUA 1FMCA 1QNTA 1BOAA 1YB5A 2A4KA 3VH3A 1PUEE 2O7QA 3ABUA 3LT1A 4CM7A 3EYWA 4DPLA 1WXDA 3GZ6A 3I59B 4J1TA 4YDRA 1H0MA 2FR0A 3VPGA 4DXHA 5A9SA 2YHUA 2HUNA 2Y93A 4OIMA 1HE5A 4I9NA 5H6RA 5DCYA 3SLKA 1IB6A 2FRHA 1XCVA 1QP8A 4A6DA 2HMTA 2QYTA 3P19A 5H83A 1GXPA 4AG3A 1DPGA 3GMSA 3V7RA 1ZRFA 5A02A 4A0ZA 3E6AA 1LRKA 1ZH8A 2B35A 3GFMA 1XGOA 5JPIA 3IWFA 1IPEA 3W4JA 3RKRA 3DBHB 1C0LA 3M8FA 1Q7BA 5L3EA 2DC1A 2Z1MA 4J3FA 5ENVA 1B9NA 3PHJA 4IZIA 5I7VA 4YR9A 1Q7CA 1ADBA 4BNJA 1YO6A 1LSSA 1E3JA 1N9GB 4OOIA 1EVZA 2PMHA 1PS0A 1HE3A 4KNYA 1EK5A 4DA9A 1PL6A 1PZFA 2DBZA 1XR3A 4GXOA 4YJHA 4BNGA 3JQ8B 4UXNA 1FX7A 1DLIA 3L0DA 2ELHA 2JCYA 1O7FA 2Z9OA 1N7HA 1R7JA 2OGUA 4RPGA 3GEZA 5HBRA 1NFFA 2PD6A 2RIRA 4KWHA 4J91A 2O3JA 2PKRA 1LXCA 1EQ2A 4NFSA 4XJSA 3F47A 1XSVA 3W6KB 2DKNA 3ANNA 3KZZA 1IOLA 4I08A 1YTYA 4L5JA 3MFKA 1MFZA 4LLLA 1NXQA 2V7PA 1C1DB 1HDGO 1NQTA 4O59O 3PRJA 3GHYA 3RC2A 3D5QA 3SQNA 1LQTA 2FOKA 2WTBA 3DEUA 3SXYA 5H6QA 5D4SA 2C82A 2FBKA 3DZIA 3I9NA 4FS3A 1E77A 1Y9AA 2DFVA 1TNTA 3ZV4A 4J0EA 5KJCA 4E32A 1KOLA 1ZARA 4R54A 4YCAA 4RS8A 2QENA 2NV6A 1F12A 3GDGA 1A9YA 3D5LA 5TX7A 4CDGA 2EHDA 4MTEA 4TZTA 2FXAA 3GFJA 3I59A 3C7DB 4XB1A 2VQ3A 4FHTA 5G4KB 3D0SA 3KP2A 2QQAA 1OC4A 4Q3DA 3IL2A 1F0YA 3ZP5A 5B1YA 2CVOA 3DBLA 4BUCA 4WASA 4E2ZA 3TOBA 2D59A 3STHA 3UICA 4MP3A 4LVCA 4LMPA 1J49A 1MZBA 1NVTA 2O0YA 5FO5A 3GPDG 1IXRC 3WTXC 1IY8A 1WRJA 4NBRA 4H3VA 4RJTA 1YQGA 1R1TA 3GFLA 3LZ6A 3WU0A 2BGLA 5H82A 4H0EA 3F23A 1T2KA 2E1NA 1NX6A 4BNLA 3BWGA 4HYEA 2VBZA 5D6EA 3JTHA 1TBXA 4O5VA 2BD0A 2HSDA 2O23A 3M9AA 3HWRA 3LDHA 5TF4A 1TW3A 2W85A 4XBFA 1YBAA 4XB2A 5C37A 4HFJA 5GY7A 4ZQGA 4GSLA 4UV9A 5DNAA 3WYCA 3INRA 1QO0D 4WLVA 4GX0A 1NYTA 3AI1A 2DW4A 1BG6A 3WGTA 4BMNA 5BSFA 3ZHYA 1TVEA 2UV8A 4TQGA 3T5XA 1W4ZA 4KDFA 4IMRA 2NAZA 5KKAA 2VE9A 2GERA 4PG5A 3UCEA 2O2SA 2EIHA 3M2PA 2UZKA 4DYDA 4DQ2A 8ADHA 2RKHA 1FLIA 3ORFA 4QFCA 3O9ZA 1L3LA 1B15A 1Q7GA 4IHTA 1TT5B 3ZMZA 4LD5A 4RVDA 4UAGA 1TT5A 1R5GA 3FR8A 1EH6A 3L4BC 2EW2A 3BHJA 3PIDA 2X8LA 4L0ZB 4ND3A 4RV9A 3Q9UA 3IKTA 1NAHA 1Z05A 5JLAA 5L3ZA 3IWZA 1DAPA 2BRUA 2ILTA 1WMAA 3SJ7A 3Q9VA 4R9RA 4MO2A 3LQQA 4I7HA 2C07A 4CO8A 2WJPA 3DFGA 3GEMA 5A1TA 2Y0MA 2X5JO 4IDDA 3TFOA 3NV9A 2IODA 3U4HA 2J3KA 3ROQA 3EGOA 1K3TA 1SO8A 1JHFA 1JAXA 3RUDA 4EGFA 1XMAA 1HDRA 3Q2IA 4R1TA 5A2QZ 1G0OA 2NQ8A 1PL8A 4XDYA 1WW8A 4E31A 3EVTA 3QWHA 3K30A 3GF2A 5D5VB 4HFNA 4M8SA 2JHFA 5DN9A 4ZVVA 1ZHFA 4MDHA 2EKLA 2LDXA 5JC1A 2IDZA 4WJZA 3GUDA 2IRFG 4WWCA 3I4PA 3EYYA 4PG7A 4D46A 3FMQA 2Y0CA 2YFHA 5DUIA 1O3QA 2PFGA 5IFLA 1ZN2A 1KC3A 1TQIA 1FP2A 3REOA 4GL4A 3GN1A 5G0UA 3WTZA 1RYEA 4HV6A 1ENYA 4YPOA 1LVAA 1AUPA 4AWXB 1U8XX 3KYCB 3OP4A 5AXCA 2EK5A 3M1EA 1R1VA 1PJ4A 4MKRA 1OI7A 1R4NA 1T0FA 1EBUA 1HKUA 3OOPA 4NR0A 3ZWYA 4YAIA 2GIVA 2DK8A 3V7SA 3GZ5A 4NFHA 5FI3A 1ZBQA 1CETA 2OFPA 4IDCA 3FMRA 4WOKA 2VOOA 3TZCA 3VVBA 2A6EF 4KYWA 4U88A 5BR7A 5I7SA 1PGPA 1U3VA 2JFFA 4Q39A 3ZMUA 4N9HA 2VC1A 2C5EA 5I7EA 2Q1WA 3GNSA 4NH4A 1AHHA 1KEVA 3JQ7A 1BW9A 3OBBA 4CJXA 3KE2A 2ETHA 3ISPA 1P6RA 3P7NA 2J3IA 2RV8A 3AJRA 3U4CA 1A71A 4EJ6A 5ER9A 2FMUA 4L9JA 5HLGA 1MDMA 4RL6A 4EGZA 5DP1A 1SMKA 1SNYA 4MP6A 4HBLA 3RAJA 2K27A 3QPHA 2MH9A 4YEDA 2C20A 2GZ1A 4L4RA 4AJ1A 5DT9A 3ZU2A 4BV9A 1PS9A 4UVDA 4PG4A 1P31A 3GN2A 3F1LA 4XLNF 3DF8A 4OHUA 3RSHA 2NNYA 1IZ0A 2VCYA 4OAQA 3TWOA 1HDCA 2WV0A 4OMUA 4UVAA 2RN7A 1CYDA 1HW2A 2KRFA 5FGMA 3AUSA 3MEQA 1WLYA 4OQZA 2IXBA 4BQPA 3GC6A 3P2OA 4EW6A 3FI9A 3HDHA 1J5YA 1BBYA 2Q2EA 2L01A 1S8NA 3PFIA 1I8TA 5HS9A 4BAYA 3EK2A 3NDIA 4NJOA 1VI2A 4OIOF 4E0BA 1ZK4A 1RKXA 2B69A 3LYLA 4HV4A 5I9NA 3JQEA 4GBJA 3S55A 2O61A 3JQ9A 2QQ9A 4A5NA 2VHXA 2XXJA 3KB6A 1PIWA 3WGZA 1MG0A 1P74A 1IUKA 4Q48A 3KSDO 3G3EA 2XVCA 3AOEA 5L4NA 4G2NA 2MA3A 5F5NA 3VH1A 5I8WA 5KIAA 5C7IO 2YR2A 1FDTA 1MV8A 1A7AA 2BBYA 4UV8A 4IGFA 1U5TB 3PQKA 2H94A 5LEKA 2AG8A 1EUZA 2GASA 2PD3A 4ZQEA 1KA8A 4J9UE 1YL5A 2J5QA 3CSDA 5COAA 3HB4X 1BRMA 1JWAB 2OZUA 3DPTA 1XGNA 1IUYA 1PZGA 2H63A 2G82A 4N18A 1BC7C 1S3JA 3IAHA 1X7GA 3ABIA 3NGXA 1GY8A 3ENKA 3KLMX 2PZMA 1V35A 3O03A 2WD7A 4S3MA 1ULUA 4JCOA 4P9UA 4OYRA 3RUAA 1J2XA 3BJAA 1F8FA 3E6BA 3H6KA 4NNJA 4QO8A 3TNLA 3F8FA 1UFMA 1CF2O 4HF1A 2Q4BA 3ADOA 3ZDFA 3DC2A 3W4IA 3QVTA 2X9GA 3UKOA 3B1KA 3W8FA 5I9LA 1NTOA 3UGKA 2PNFA 4A10A 4TRJA 2KIMA 2OBNA 3BAZA 1BXKA 3PGJA 1RM4A 2WD7B 1PJTA 2Y48A 3AW9A 1BJAA 1GYRA 3FZVA 4CMIB 4RQUA 2YUTA 5CDGA 3GVXA 4DC1A 2DU8A 3WYBA 3IKVA 2UYYA 3QWBA 4IINA 4Q3EA 3QAHA 1RUNA 1HETA 1KERA 4XEHA 1IZ9A 1U4SA 2HU2A 1DXYA 3HB5X 4YT4A 4PDKA 3U1DA 4CZZA 4XRFA 3W4KA 2OOSA 3CH6A 1SD5A 1S6LA 4A03A 2Z99A 4A26A 1BI2A 1ENPA 1YS7A 1OAAA 3JTGA 2YDXA 4Q3AA 2J3HA 5B4VA 4FJ1A 3AK4A 1H9BA 2W57A 4Q4ZF 3HOSA 1WP4A 3PQFA 4R68A 3B20A 5HS6A 1GEEA 3R61A 3CO6C 3QLJA 2M45A 1F4KA 3LFKA 1F06A 1ZZEA 2UUPA 4PG8A 2E7XA 4UUNA 4BL5A 2OBPA 2P7VB 4B09A 2HRBA 2SCUA 5F1OA 5AIQA 1HDXA 2P6TA 1E1KA 1PQWA 2EERA 4G81A 3GPIA 4CMAA 2KIUA 5HWSA 1KYZA 5JDIC 4MTDA 5U9CA 2V1DA 2DLDA 5TQVA 4IDGA 2CDCA 2ZTVA 1W5SA 1KVRA 2FMYA 5JFRA 4ZZDA 1R4NB 1X14A 4UUVA 3ZWBA 3ICCA 2CSUA 4XX0A 1M2WA 2VYVA 1U6GA 1I2ZA 3CMMA 3TPCA 5K5RA 1UDCA 2BFPA 3CZRA 3WBFA 2GRAA 3P5SA 5IJZA 5KOIA 4U0WA 5FLXK 2A94A 2AXQA 3CXRA 4NBWA 3TO9A 3GYHX 4R41A 3TL3A 3WGGA 1VRWA 2EWMA 3CUKA 3ETEA 1Y8RB 2J5OA 4MJLA 1GPDG 4BHTA 3BOQA 4IIVA 2ZMEA 5ILGA 1QG6A 4YYZA 2PD4A 3JQGA 3L7WA 1XGKA 4XR9A 1AXGA 2PH3A 3ZWPA 2IA2A 1H6BA 1W7PB 1E5QA 2CVZA 2PGLA 3IJPA 4FQ8A 3GEGA 4ZQHA 5TC4A 5JW6A 2ZYDA 5FD5A 5DF1A 1J0RA 1G1AA 3EUWA 5C7LO 4A5OA 1EVYA 4HOBA 2RH4A 1OR7A 4P4NA 3UUWA 1NQOA 3SVTA 1CJCA 3GY0A 1TQPA 1XDSA 4A0SA 3FWZA 4IJKA 4RZHA 3RCBA 3ROPA 4WCFC 2DK5A 1DHTA 5LHHA 3ZWMA 2E37A 2HJSA 3A28A 3F3XA 3G73A 4PGGA 2ZO4A 5L51A 2Q50A 1LC3A 1MGOA 2D1VA 2VZ9A 2Q2WA 4ZHSA 2X0LA 2NTNA 1NNUA 2TMDA 1FOKA 4WGGA 3CLOA 3C7AA 5EQFA 2EFNA 1RWBA 2IEBA 4JGBA 4NHEA 1EH7A 4OIRF 2VBWA 3FHZA 2GD1O 2XAGA 3M2TA 4CM8B 1CF7B 2Y0DA 1ON1A 3D0OA 2WTEA 4CM8A 1YE3A 2P91A 3GVCA 5K5OA 1ZLKA 4HAMA 2PGJA 4B4OA 2XXBA 1GR0A 3HFSA 2IXAA 3DZKA 5ES3A 2RDPA 3F72A 1OBFO 1JN0A 2VE8A 1R1UA 3ERED 1DUXC 1QV6A 2GGSA 3DAGA 2JAHA 5BPIA 3C85A 1E7QA 2BFOA 5AQ1A 3QRWA 4CV1A 2IVMA 1E7YA 1ARZA 3INTA 2PN6A 5EIOA 5TJJA 1FDSA 1CDOA 4E5KA 1WWKA 2OMEA 3HHPA 3ONDA 1BN5A 1KU3A 4RB1A 3KXDA 4ROSA 4DBZA 3DB2A 4PCVA 3PHLA 1LBEA 4YAJA 5JNLA 3JQAB 4Y8VA 5L3CA 1DBVO 4WOJA 4BO7A 4TMFA 3PJEA 2EA4A 4BNCA 2H6EA 1W6UA 3GQVA 3OICA 4UVIA 1T4DA 3HTSB 3WGHA 2FNAA 2OD5A 3C18A 1R66A 5D5XB 4MEXF 1EZ4A 1P77A 3AY6A 3MWDB 4YJGA 1I10A 4Z0TA 3L6OO 1I30A 2HYGD 1B3RA 3VHRA 1I1SA 1EK6A 4BKPA 3RFXA 1E5LA 1B8VA 1C0PA 4LRTB 2BGCA 1WI9A 3EQLF 1L1FA 4DPKA 4C4OA 3AM5A 1EUCA 1K7AA 3FTPA 4MVJH 3K1PA 4P4GA 1XN7A 5T8KC 2HJRA 2VHWA 1WZIA 2FZWA 5B4TA 2JZYA 3H8VA 1MKMA 4JK1X 4LN1A 5A3VA 2VT2A 4EJUA 5LHGA 1KEPA 2Q0OA 4N0BA 2H27A 1XU7A 4ZRNA 4L4SA 2ZQYA 4UVCA 1CWUA 2V6BA 4JP3A 3UXYA 1E3SA 2VWHA 3S2EA 2W2KA 3PLNA 2GN9A 4HADA 3I53A 1J5PA 5J6XA 4FFRA 1ZSYA 3FHLA 3C1AA 1BC8C 4MQVA 2HEOA 2DTDA 1MX3A 4P22A 4HX5A 2QW8A 4BXUA 5A2QK 2D2IA 4BO1A 1FBUA 4CM4A 1U7TA 1EUDA 1R0SA 1XA0A 4GX5A 4XYBA 2VYVD 1U3EM 2FSSA 1LLCA 3OIDA 4KTVE 4LISA 4QWQA 5KWEA 4UHTA 1BI0A 3NRVA 1REPC 2X22A 1F5TA 1KBZA 1U8FO 3BMQA 3G49A 5T57A 1A4UA 4MVJP 1A4IA 1DOHA 4CL8A 5A5FA 2CUKA 4ZQFA 3HTUA 1DJQA 3F6YA 3QW2A 3VPSA 4LK1F 3TGNA 3IP3A 3P9IA 4KMUX 1T1RA 3IMFA 4N54A 3KOUA 1SZJG 2NU7A 4GX1A 2NVUA 3TZQA 4P55A 3EC7A 2PMUA 3RU9A 1P1KA 3KUXA 1R23A 4N5NA 3ZH2A 1YQAA 1YJ8A 5E1XA 5JDCA 4CLRB 1B0AA 5K9ZA 3I3OA 3HFGA 2QBYA 4E5PA 1Z7UA 4M72A 4BGEA 1ZYRF 3QP9A 1BDBA 2IJLA 4L9TA 2Q2VA 2ZCVA 2E6UX 3F5SA 1NHAA 2BYVE 4U6SA 3DOOA 1ONOA 5K5QA 3S2WA 2VODA 4YJDA 3VZSA 2Y1OA 3Q9NA 4AJKA 2BI7A 1Y81A 5AXDA 6PAXA 4AJOA 4ZYGA 5CVVA 3CUQA 2FWMX 2D2WA 2W98A 4PLGA 1DPRA 1HSJA 4IJVA 3MJCA 3TRIA 3VDQA 1KEWA 4R1HA 3HUGA 5F3RA 5COQA 3LLVA 1U7HA 5BSEA 1X1EA 3ZWCA 4HX7A 2XV4S 2VUUA 3QA9A 4JP2A 5IDYA 4BO0A 5KCZA 3ZMDA 4CMEC 1LQUA 1R4MA 1L7DA 3MTJA 1O94A 5A06A 3PYMA 1LLUA 3KV3O 4U0YA 1O89A 1D8JA 1E7RA 1OOEA 1PJSA 2ZYGA 1LNWA 2FNPA 1ZIDA 3PLRA 1JXSA 4DC0A 4L18B 4P38A 4JROA 1KVUA 1IN7A 1HZJA 1P1IA 2HQ1A 3DEYX 1G3TA 3HQ4O 5EINA 3GMDA 4ZZLA 2D45A 1K6OA 3PK0A 4O3MA 3AOGA 3D3WA 3OM9A 4J4BA 3TDKA 4XRGA 1G3SA 1B2LA 3AI2A 4NDNE 3L6DA 2NVUB 3DMTA 1T24A 5CJ9A 1PR3A 2QYOA 4LGWA 2DM6A 1P92A 2QUFA 1PJCA 4D43A 1BTOA 3BMQB 4AL4A 5HM8A 2PBIA 4O63O 4FGWA 4BS9A 1V3FA 3HUDA 3MCZA 3U4DA 3ASVA 1XD7A 4RVGA 3SZPA 5BT9A 3VPHA 4OL9A 3KHUA 2LDUA 4PVDA 3BY6A 4KUGA 3FNEA 4GKVA 4PGFA 4JJFA 1E1MA 2CY0A 3ZU5A 2YX4A 1OZAA 1LUAA 1PTJA 1UUFA 2HKIA 3BIOA 3G1TA 3ZW8A 3OV8A 4MVJM 5A9RA 3KETA 3E18A 3ITKA 4DIBA 4U7DA 2HOEA 1P1RA 4PLZA 3CZMA 3VVCA 2RAFA 1FK8A 3DPLC 1ORRA 5IT9K 1S7AA 3DWFA 2QZZA 1YLFA 4HF2A 3C1OA 4CQMA 2I76A 2HFHA 2JD1A 3FTNA 5DEQA 1GQ2A 1N5DA 4KTTE 2I3GA 4INAA 3WFIA 3V8BA 3BJOA 4WKGA 4N7RA 1GD1O 2GSDA 3S2FA 4MKZA 3BMNB 4DYVA 3EDMA 1MC4A 5COBA 2V9VA 4OXYA 2OO5A 2YFQA 5IAAA 4S05A 4ND4A 3OQ6A 3JQBC 4LFUA 4E5YA 2VC0A 2J8ZA 4BIIA 2HQNA 2JFHA 2XASA 1I2BA 3C1TA 3OJEA 4YRBA 2BFMA 1VPDA 1LA2A 1LLQA 3AFNA 3RUEA 4G65A 2FY8A 4EJOA 5LRSA 2X9VA 2GNAA 4J9VA 3DXFA 3JSPA 1VLLA 1U2DA 4CM6A 3HRUA 4B7UA 2P4QA 1HWYA 1ML3A 2GO1A 1E3IA 1Q0LA 3DL2A 3GZ4A 4E2WA 3JSAA 3F8MA 5JR3A 2IEDA 3U49A 2C6YA 2Y67A 5TJHA 1TXGA 1I3KA 4J1NA 4B3HA 3GT0A 3COSA 3K69A 5DCFA 4AVYA 3LC7O 4K28A 2A35A 4DPMA 1GCOA 1NPYA 4HY3A 2IE0A 4EM2A 3PWKA 4MVJG 3RJPA 3QP6A 3LA3A 1NPDA 3QU3A 2QX7A 5IN5A 1IZ1A 2BELA 5D5UB 2PI0A 2EJRA 3MTGA 4RPLA 5EN4A 4BO2A 4YJFA 3P9KA 1GQYA 5F21A 5K1YA 1T39A 4CM9D 3BP8A 1KIFA 2PKQO 3F21A 4L0YB 4N9IA 5ADHA 2Q1SA 1DAOA 1HF3A 2VBXA 2ZBKA 4RPJA 3K73O 1HTBA 3RPQA 2QIOA 4XYMA 3WXBA 1XSXA 4CR7A 4J49A 3G1UA 3C7CB 4YT8A 2YQ4A 4OINF 2P5KA 1NFQA 2DBRA 2O3SA 4MVJE 4BKOA 4F46A 2B4QA 4BO3A 4I02A 3BMOB 2JFGA 5LEJA 3VOSA 1HLPA 4R1NA 5T5QA 5TGDA 4TV7A 2O3QA 5ICEA 2BMAA 1DC3A 4DIOA 4ZH4F 4KN7X 1D3YA 3PHHA 4CUKA 9LDBA 5HS4A 1IHXA 2NTJA 3K96A 3QVOA 2EWNA 1EMDA 4CLRA 2QHXA 4NJMA 1C1XB 1B59A 3FBGA 4ONEA 2QLZA 4ENJA 3AUAA 1QXSA 4J6FA 1Q2XA 2VHVA 4UUMA 1YS4A 3GG9A 4QFDA 2ISYA 1Q1HA 2BLLA 4LSWA 2AQKA 5DCUA 4RAYA 3L2CA 4ESFA 1GFSA 3PXXA 1JA9A 2YY7A 1PJLA 4FDAA 3DMYA 4YIIA 1YDWA 3J80Z 1V0JA 1H9TA 2OHXA 3WE2A 3VKVA 1FSEA 3QU6A 2IT0A 3V7CA 1O6ZA 3QIVA 5DDIP 4AD9A 1FF9A 1YB4A 1KEUA 3AUTA 5ED4A 4M89A 4KQXA 3WB9A 2PG4A 1P3DA 4KOAA 3PVZA 1ZLJA 1S7CA 3WTSC 2HK8A 3OMLA 1XEAA 4U6QA 4BOYA 3ZCXA 3PIIA 2WE7A 1LDYA 4A27A 4NG5A 1ONPA 1U3WA 4YIFA 1H6AA 1N1GA 2LF7A 3R6SA 2BF7A 2O3UA 4KUMA 1JKIA 3O26A 3I58A 4JBAA 3E82A 4CODB 2KJBA 1HKTA 2K86A 2XUBA 3SHFA 5K0ZA 4Z0HO 4A6EA 5DDGA 2YSRA 3BMCA 4R51A 3KP3A 1PL7A 1TTYA 1I5RA 2B0LA 4WF2A 3QWIA 1HDOA 3L07A 5TT1A 3VTFA 5G0SA 1XGMA 3E5MA 2JPBA 5CYVA 3PYXA 1P2FA 4W9NC 1LB2A 1CEQA 1MUUA 5CDUA 2XROA 4WEQA 4RGRA 1SMYF 5F6FA 2ZNZA 3N97A 1CGPA 1EDOA 3GK3A 4UVHA 4R3NA 4J7XA 3OQ1A 4XGKA 1FT9A 1G4DA 3DTYA 5KKCA 3TN7A 4Y9DA 3HYIA 2PA3A 2VN8A 1VKNA 1U2WA 1NR7A 1RNLA 1YVEI 3PWZA 1ZCJA 4KMFA 3LA2A 4RF5A 5ENDA 4CQLB 2Y1GA 4PCQA 2VNAA 1UP6A 2DAPA 4XZ3A 3INGA 2P6SA 1N7GA 1O9BA 1ZK2A 4L9VA 1GL3A 3U0BA 3B02A 3BJ6A 7ADHA 1DC6A 3S2IA 3OA2A 4LG0B 5JDIA 2L3DA 3WR5A 2HR3A 3PTZA 2DUUA 1TA4A 3L9WA 3K9QO 4FB5A 3ZGYA 1USTA 4EEZA 5L4SA 5AIPA 3CTAA 5DUKA 1Y7TA 2XAJA 3T8RA 4O1MA 4D41A 2ESHA 4WUVA 4E5NA 1HL3A 1YIOA 4FFPA 4J7CA 2C54A 4EV0A 2X86A 1QORA 5JYDA 1FDVA 2VN2A 1AOYA 1LX6A 3WDSA 2VOPA 2P9GA 2C59A 4OOFA 5GZ3A 1I3MA 2EV5A 3S2GA 1Q0QA 1PR9A 1BI3A 3ECHA 3S1LA 4CV0A 3GHHA 1Z74A 1HT0A 4YAGA 4LLNA 1Z1DA 4OU0A 1XLTA 4FD3A 4Z9YA 3LK7A 4ON0A 5KTKA 4XSZF 2D1HA 3C1DA 4TRRA 2I3AA 1D3AA 1E92A 4IJAA 3ANLA 4GX2A 1HW1A 2I5PO 4R5MA 4WLEA 5IT9Z 2RCYA 1R6DA 3EY4A 4YQYA 1F17A 3RJ5A 1GAEO 1PS8A 1YW9A 4ALNA 2IA0A 4MVJF 4F7ZA 3NTOA 1X7HA 2XHKA 3H3JA 4A12A 1BGVA 3DHYA 4II3A 2UAGA 4DTIA 1ULYA 2XKPA 1K78A 1HSTA 2ZTUA 4G5HA 1NFRA 4ZICA 1ISGA 4O5OA 3ASUA 3E3VA 2P7CB 2AQ8A 3TL2A 1K78B 1NHGA 2NLOA 3PJFA 4PZDA 3V2UA 1FYLA 3JQGB 1LDBA 2G0TA 1J0XO 3QE3A 2EEZA 1T2CA 5EJ2A 2D5CA 5CDTA 4CMKA 1Z75A 2VWPA 1PDNC 3T0YA 2H6CA 2JCXA 2BV6A 4ESBA 4G9YA 1B16A 4XQ9A 4UEJA 1H9GA 3BMOA 4WX9A 3H7AA 3WE3A 4YFKF 4M87A 2C2XA 4CM4B 1ISFA 2ZATA 3I54A 4Y13A 4NIMA 1QSGA 1YFHA 4XGIA 5A03A 1UZMA 3TF5A 2J5KA 1HLDA 1X15A 3Q6IA 1DFIA 4TRNA 3WNQA 3ZU3A 1WMBA 3WX0A 2NRAC 5HDKA 1UZLA 4IXAA 2VONA 4YAEA 1ONNA 1UJMA 4AIJA 4M86A 3Q3CA 1DRVA 1PJ3A 2A61A 2B37A 4QSMA 3UFXA 4RAZA 1VL0A 1E7WA 1E2XA 3ROMA 3J81K 1LDJA 2IZ0A 2V6MA 2EJVA 5D8KB 4L9RA 2CW0F 1FBSA 4M71A 3QRFF 1ZXLA 3CUOA 3EMKA 1I5ZA 2PWZA 2FBIA 1Y8QA 5THQA 1WDMA 3NT2A 2ZXJA 4M74A 3QV1A 1IN6A 2PGDA 4PLYA 2DFIA 1ISMA 5JO9A 1RM0A 3F5QA 4WXCA 3H9JA 4J2HA 4TVBA 4XCVA 2DBBA 2F5FA 2GZWA 1ZH5A 1QV7A 2C7VA 3GUCA 1ODDA 3RKYA 2Z5UA 4NBTA 1UB9A 3KP6A 1JQBA 3E5XA 2FRDA 4HXYA 3U2RA 1TLHB 1K79A 2CD9A 1YO5C 3WIDA 3TKYA 4ZJUA 2CMDA 3H92A 1KY5A 1ULSA 4WK6A 2D4AA 2FP4A 4GGGA 2CVQA 4AJ4A 4RF4A 4MEYF 3WGIA 4HUJA 4Q3NA 1E0DA 4FIZA 5FI5A 4NU5A 3K0LA 3RUHA 2AW5A 4B4UA 4XRRA 1TLTA 5FD6A 4QEDA 5J8FA 2ZB8A 3KM0A 4W9NA 2WC2A 2QG4A 2Z95A 2DO7A 4FPXA 1UXHA 4K26A 2K4JA 2PQ8A 1RI7A 1ZKMA 3IQDB 3O38A 1C0WA 5CPBA 5JO0A 5JAMA 3DBRA 3WQSB 5E17F 1W7PA 2A69F 1JWBB 2Y68A 5U1PA 4L76A 5ITVA 3K8ZA 1NAIA 2ZB3A 5JC8A 4G7HF 3I64A 3KP4A 3RBVA 3ULKA 2Q1UA 2VT3A 1PP7U 4O6VA 5HRUA 2EFPA 2V6GA 1DPUA 1A7KA 4BNFA 4CXFA 1MP0A 3F22A 5HS8A 1U8RA 1BXGA 4WLFA 2ADUA 4H7PA 3M6IA 5DOVA 3TSCA 3CJNA 1NQAO 4XD2A 2KJCA 4G7OF 2DQRA 2O48X 4YB8A 2FN7A 2VTEA 4F6CA 4HFRA 3WTTC 5JFOA 3GXOA 3ETDA 2PY6A 3PFWO 3VPXA 3RIHA 1QZYA 1T2DA 2R7DA 3BZUA 2R6JA 5G0VA 4Y17A 1EVJA 3MZYA 3E5UA 1BM9A 2YHIA 3ZHXA 1V9LA 2EKPA 4FT8A 4IS3A 1WVGA 1VSVA 2P4HX 2WD8A 4DL9A 4G94A 3TJRA 3GLQA 5IXYA 1P44A 2JD0A 1E3WB 4EITA 1QYCA 3KFWX 3U9GA 3F4LA 3KYDB 1BVRA 5EQDA 3R0AA 3WQQA 4DQVA 2L4AA 1RM3A 2UUOA 2MD5A 5IT3A 3BTSA 3LF1A 5CVRA 4CMCA 4M1QA 4CQLA 1HE2A 4Z2YA 3D3WB 3VH4A 4ALJA 4YFXF 4BO8A 1ADFA 1PGOA 1X13A 2ZJ1A 1YG2A 4CGZA 1YOVB 3OECA 4HP8A 4IQ0A 3K1NA 3RI4A 4EVIA 5F1PA 3SC6A 4CR6A 4BQRA 2IA1A 1ZMOA 3WTBA 1MJ9A 2W2LA 4B4VA 2KIFA 3JYNA 4A0YA 4MNUA 4B7CA 4BNTA 4DIFA 4EUFA 2VHZA 3VEPA 2AQIA 3I9KA 1SEVA 4IXWA 1DRWA 4LJZF 4FOSA 4BNZA 1G6NA 1I3NA 3GX4X 5ILSA 1D1SA 3E9MA 3M1AA 3ONEA 4WCFB 1DDOA 3BDDA 3SX2A 2CFXA 2HDCA 4ZU3A 1LEHA 1YXMA 4DNCA 1I1GA 4WXHA 3ZWVA 2HS5A 5EL0A 3OJOA 4FN4A 1WNTA 3K31A 4FSHA 1O7LA 3NAQA 3KRTA 2YU3A 1UXIA 4FOOA 5BS6A 4MINA 1NM5A 4LW8A 3VC7A 1WWXA 4KA4A 4ENKA 4Y67A 3RU7A 5TNXA 4YJGB 1RM5A 4GO1A 2HDHA 1P45A 4OOEA 3ROUA 2Q46A 1DP7P 2P5YA 4ETSA 2X23A 5JY1A 4OXKA 5B37A 5KVVA 4IXTA 3UHAA 3UCFA 5FFFA 3GVPA 5JI6A 1XMKA 1B9MA 2RNJA 3M8EA 1EVIA 2GDZA 4CR8A 3J81Z 3JQDA 3RWBA 3F1KA 5KNLA 3NUGA 1ZRDA 3EVNA 4EJTA 2G7HA 2IP2A 4D7AA 5L7TA 4IDFA 5U4QA 4O6JA 4QX6A 1DFGA 2LDBA 5G2OA 2HZTA 2EV6A 4IPAA 4LG0A 4EQQA 2W84A 1JW9B 2OQRA 2FR1A 3D1LA 3B1FA 4GH5A 4GVLA 4KUEA 4G6DA 2DI3A 2P4WA 2QVOA 4L5IA 1G0NA 2HO5A 3JYLA 1U1IA 4BO9A 3NRCA 2DPUA 1BI1A 3G0OA 1F1ZA 4CMGA 4WPGA 1I27A 3MOIA 2F5CA 3I5MA 3TZKA 4BGUA 4M9XA 4MVJI 4M55A 3ML6A 1IXSB 1P1HA 2M1BA 3V1UA 5IDWA 1H6CA 3CEAA 5JAZA 1B14A 3ITDA 1I32A 4JLWA 4Q3BA 1Y0UA 2VOJA 3FRJA 3M7GA 4LLGF 2PZJA 5THKA 2B36A 3ZNNA 1YW8A 5H81A 4EDFA 3DZBA 4M6YA 2NVBA 1PJ2A 1VSUA 1IRFA 2O03A 4JBIA 1OYIA 5GZ6A 5LLQA 1Z9CA 3UVEA 4CMBA 1M76A 2HKOA 4YG2F 3GF4A 3Q2KA 4J1SA 4M6XA 5FLXZ 5KJ6A 2CGPA 4E13A 1FSHA 4HQMA 3L4SO 4B8WA 4CLEA 1T2EA 2GXBA 5T6BA 5T67A 3EW7A 1V3VA 3U9LA 4ZGWA 3ZPLA 5ILVA 1RYDA 1VJ0A 3DOJA 3H9QA 3JCZA 3R3JA 3HIFA 5KJ1A 1WAMA 4J0FA 2EGHA 4KIFA 3H3UA 4BNNA 4WLNA 1PZHA 4KIGA 2X0NA 3PQEA 3H3ZA 4KT5C 4I8XA 5FFZA 2FR8A 2DPHA 3NEUA 3E48A 2R3SA 4HNGA 3MJVA 1R15A 4XKJA 1KU9A 1SD7A 1A72A 4D45A 5C5IA 2GPTA 1UXJA 1I3LA 1JLLA 1HE4A 3JD1A 5L3DA 3DZFA 5I8ZA 3TQNA 1H2BA 2D1YA 3DR3A 1KVSA 4DLLA 4I09A 1LTHR 3KYCA 1S7OA 4H16A 3GWZA 3CTMA 4IS2A 1K2WA 1XHLA 2CWEA 4WE3A 5LBQA 5K6AC 2X0IA 5JMPA 3O3KA 5CLSA 1U3TA 2XKOA 3H5NA 3LT4A 4FJ0A 3RPUA 1J4AA 1U78A 4I9HA 2B5VA 2I6TA 4RVSA 5TLSA 1VE9A 1ON2A 2QRLA 1Z73A 5BSHA 3W8EA 5FFXA 4W7IA 1S6YA 3ZU4A 3NKLA 3KSUA 1PGNA 2UXXA 2I66A 3GAFA 1OC2A 4JN6B 4YBZA 4FFOA 3ZN1A 1KQ8A 1O0SA 4L8VA 3BPVA 4P9FA 5FF9A 3RBZA 3RC7A 3BPXA 3ZNPA 4B3IA 2E4AA 2EA2A 2O50A 2VZ0A 4UUPA 2CZCA 3DTTA 3L6EA 3FPLA 4Q9NA 2E7WA 5L3FA 1Z7EA 4B3JA 4XIYA 4MVJD 2XGXA 2GUGA 1LEBA 3RJ9A 1A9ZA 5DV5A 1BIBA 5KJEA 1L7EA 2ET6A 1OPCA 1JKFA 2NVWA 3IUSA 1IL0A 4LB5A 4UULA 2TMGA 2CF5A 3ENNA 5ILUA 5IDXA 3RQSA 3RI3A 1LDGA 5TRDA 1X0XA 3GGOA 3RD5A 3ELKA 4KN4X 5JHUA 1JTVA 1C1XA 1JGSA 1E1NA 1Z6ZA 2FPGA 2B5WA 4EM0B 2ZIZA 3KSZO 2PV7A 3O2PE 1ZG1A 3LQFA 3PHGA 1GYPA 4AVPA 1ISIA 2EP7A 3NDRA 3PWSA 4Q5SF 2ZK7A 4ND5A 3QPTA 4DMLA 2WDZA 1RPNA 4RF3A 4XLPF 4OO3A 1FDWA 3MWEB 4KWIA 2NM0A 4FW8A 4K1LA 2AEJA 1IE3A 5L9AA 3DQPA 3HSKA 3ECOA 5ICGA 2CQKA 4DMMA 4BYYA 1VL6A 1JHHA 3B70A 4LCJA 4R16A 1QYVA 3RDIA 2HK9A 4ALMA 2UDPA 2QYSA 3WSWA 3BROA 1V4RA 4YRDA 3RROA 1OKRA 2DAOA 1XU9A 4WCFA 2MBFA 1H5QA 4OMYA 4KP7A 2P8TA 1ZG5A 1Y6JA 2EW8A 1TQMA 4BH9A 1N2SA 1U5CA 3FN4A 3OSUA 2Y05A 1ONVA 3FX3A 2E82A 2O3TA 3DXJF 2DQ4A 5EPOA 1YBMA 3CDHA 4BB6A 1STZA 4Y98A 4GYIA 1ZXBA 2RQPA 1O95A 4R3WA 4U7WA 1YONA 2YDYA 3CIFA 3PQJA 5CG1A 3A1NA 2GN6A 4KMSA 3AWDA 3ZI0A 3QVWA 3TZ6A 3E9QA 4I98B 3U09A 4R4JA 1NWHA 1DLJA 3IHUA 3JQFA 2BGMA 2Q1TA 5FEUA 4LMYA 2O3FA 1R00A 1IHYA 4OSOA 4KQWA 3KZYA 4GMGA 4F3YA 4IDBA 4WNCA 1HDYA 1T98A 5IF3A 4GVXA 5AOVA 3Q9SA 4ID9A 4YTEA 2AEFA 2FE3A 3JQBA 2DQLA 2YV1A 3OH8A 2VBYA 5HOOA 1D8AA 4BNHA 3MCVA 4FGSA 1X7DA 5DBGA 3SXPA 1TW2A 1R0KA 3F9IA 1A5ZA 4NK5A 1LJ8A 1B8UA 1UDAA 2W8ZA 4NK4A 2X4GA 4M73A 1XELA 2DPGA 4HLXA 4RPKA 3VH2A 1GUFA 2BGKA 2CSOA 1IN5A 1K89A 1G3YA 1SD6A 1PGQA 1QLJA 1Q0HA 1Q1NA 2DBVO 3WU1B 2EGGA 3I9JA 3RUCA 2PEXA 2ZNYA 4E2YA 4NJMB 1GPJA 3GA0A 1B26A 2ZMEB 1MXHA 1WDKA 3SEFA 1GXQA 1GV1A 4KZPA 9LDTA 4D42A 4GWKA 4OSPA 2X9NA 1SAYA 4HF0A 3GG2A 4R5HA 4XYEA 3JYPA 5ILOA 1WPQA 1QGPA 3R4KA 2MLGA 2B83A 3BXXA 3GGPA 1E17A 1HEUA 3SFZA 4I5GA 4J2OA 3A14A 2K4BA 5DBFA 1I33A 1X0VA 3JQ8A 4CPDA 1LI4A 4K6FA 3N58A 4ESOA 4HQEA 3F8BA 1DJNA 1K5HA 3KO8A 4F6LA 4D0PA 5FWNA 2YPRA 4Q47A 5HDNA 2STWA 1PJBA 1T2FA 1UZNA 5EERA 3JQAD 1ZMTA 1MFPA 3F8NA 2X58A 1SAXA 2Z5LA 2HTJA 3EZYA 1PZEA 2GZ3A 3GUYA 1MC5A 2X4HA 4UUOA 5JCXA 1EQUA 2NACA 3ZZNA 5IXSA 1O5IA 3D3EA 5HVQC 3W6ZA 4L74A 1L0OC 3D5TA 3AAFA 2PFBA 1SD4A 4Z9FA 3RUFA 5JAIA 5LHIA 5L45A 3MJ4A 5A4DA 4AJNA 3ADPA 3R3SA 4TRMA 3WGOA 2GF2A 1T2AA 1UR5A 4OGWA 1J75A 1U9JA 3V2GA 1A04A 3ZWOA 2OORA 1R12A 1QBJA 5TIIA 5L95A 4XJTA 3FXRA 3GRKA 4AJJA 2EG9A 1XCBA 3DDNA 3JV7A 3I4CA 1BDMA 4GWGA 2VRBA 1GV0A 2M8EA 4UEKA 5KJFA 4I2OA 3U5TA 4ITUA 1QKIA 4QLCU 1M67A 2HMSA 4HZFA 2QQ5A 2R7FA 3TO7A 1YQDA 2ZTLA 3HSEA 4Z3DA 1MD0A 4XQCA 2VUSA 2NSDA 4IQGA 2AA3A 3T4EA 3RIRA 3WFJA 1SEPA 2ZTMA 3NDJA 3HN2A 1EE2A 1UAYA 1DIRA 2VZ8A 3TZHA 4JX8A 4BNMA 5CAEA 4CICA 2GN4A 3E97A 1XKQA 1C3VA 4L0QA 3IUPA 5KVSA 3GO5A 2ZYAA 5A05A 5LDHA 3VKUA 3ZWWA 2HQRA 4OIQF 2P2SA 5EMHA 2M87A 5E20A 1RZ4A 1Y8RA 3JQCA 1VJ1A 3V2HA 3E03A 4WLOA 4ND2A 3LWFA 1O3RA 4JBHA 3SBOA 2PLYA 2FSVA 4OM8A 3JAMZ 5AYVA 2GYYA 4PLFA 5F1KA 5A3JA 3ZMSA 2Q2QA 1AE1A 1YJQA 2B4RO 2TDXA 2R00A 4W7HA 2NS0A 1ZVMA 4E3ZA 3UOGA 4HDUA 5ICFA 2VRCA 2D0IA 1H9AA 1HDZA 4WCDA 1NP3A 4RB3C 1WDLA 2AHRA 2EB7A 5CHEA 3JD3A 5L40A 3A4VA 3D4OA 4BHPA 2OU2A 5ICSA 4BKRA 4OXNA 3WMWA 4UREA 2IW5A 3P9CA 3PFFA 4EUEA 3FM3A 5LCXA 4N5MA 4CHUA
chains in the Genus database with same CATH superfamily
1TADA 3RAFC 4MVJA 1P3JA 3FPCA 3PD1A 2UZIR 1ZUHA 4IHSA 5C1PA 1N4AA 5LQMA 2ZG6A 3NALA 3ZWKA 5J4VA 3L06A 3QXGA 3I0TA 4JT2A 3NNSA 1Q1GA 2P1ZA 4ND7A 1D5CA 1ZJZA 4Q7EA 4MQ9F 3N7TA 2XRNA 3TQHA 2VUTA 4BP9A 4RDXA 1HKSA 4OSEA 2XZTA 3Q8MA 5H20A 2HSZA 5CA0B 5KHOC 4UE6A 2CG4A 5ILQA 4DRYA 1WULS 4ZJZA 1XI2A 2ISCA 3B6ZA 4IXMA 4OQ4A 4QLAA 4B3XA 4RKWA 2XF8A 1IY1A 1LBIA 4PTZA 4LBVA 2VPQA 3WOVA 5ICMA 3GLIE 2X8AA 3KP1A 2DFFA 4O4IA 2UZ1B 4JMPA 3ZBUA 1FJXA 5AJHA 4JJKA 2DY0A 3Q3GE 5E3NA 3LDAA 4JU9A 5KAPA 2Z6VA 4S1TA 2Z3ZA 5LGUA 3C2BA 2IYYA 5CEJA 4ZYXA 4GYGA 2ECOA 3IVCA 4EBFA 5DO9A 5K7FA 5JHHB 3CEHA 4I5EA 2W4MA 5E2IA 3DYVA 2EX4A 3FRIA 2XDQA 3NTQA 5LC1A 4DGSA 1GZ3A 4H7KA 4RVUA 3DH0A 1Z33A 1H2AS 3E0JB 5DULA 4AG5A 5JNWA 3LD9A 1FDUA 1OBOA 3GZNA 2SCUB 4ITRC 4UD2A 2PMEA 5KDOA 4MX8A 1AIPA 3CE9A 3QKTA 2G1JA 2RCNA 3BSWA 1FU8A 3R3ZA 5JQWA 1C9KA 4OJNA 1R6BX 1HMPA 1QZUA 4URZR 2PLNA 3KBBA 4XWTA 1NDHA 1SBYA 4CYMA 4DQDA 1KJIA 1U3CA 3HZJA 1LSOA 3A32A 4I5DA 1YJNI 2AOWA 1GUBA 3B1JA 3BK7A 2VRCD 1UXKA 2R65A 1FUEA 2Z1NA 2H9IA 3JAMK 3RRMA 4U00A 4BFTA 3BA1A 1H2HA 4EWLA 4DUYB 3K70B 3QKRA 3H5AA 5JS8A 2K3FA 4MLOA 1ECPA 2GPNA 3GVHA 4J90A 2X9QA 1EGVB 2W70A 3TIXB 3HEFA 1MA0A 2H1SA 4MA4A 2QQBA 4MULA 4PZUA 4B5LA 5L3BA 4MV3A 2V9PA 3B85A 3KLOA 4AWXA 3NIFB 3UJNA 5B1IA 2J6IA 3IS3A 3WICA 2HRZA 3O7WA 2CLOB 3MUEA 4OI4A 4YJHB 5C8DA 5CB4F 5H9WA 4MJXA 5D8LB 3GLGE 2FG5A 4I55A 1USSA 2ZUBA 4FGJA 1MNQA 3C7TA 4I0BA 1JFVA 4IBOA 4KE8A 3WDLA 1ABBA 1M7HA 2X0JA 5HRCA 1QTQA 3K09A 4OLJA 2ZB2A 3E27A 2J0SA 1H2YA 1MDMB 4M1SA 1S8AA 3THWA 5EJ5A 2DLNA 4C14A 1N32B 1QGED 3TTVA 3A1WA 1EUDB 4FGLA 4JI1B 1JP7A 4E11A 2QN6A 3HRIA 4M36A 1F2UB 2FWNA 3FUUA 4YRVA 3VU0A 1CQJA 4AP6A 1QO9A 1DAIA 4Y0AA 2ZRMA 5JS1A 1CVRA 2RFLA 1U0NA 2VQ6A 4AUNA 4ZRDA 3BTCA 4IGIA 3ABTA 4YALA 2J5BA 5KC9A 3HL2A 1EP3B 3VO8A 4HDVA 5GOZA 4BDTA 2G25A 3LF2A 1NV8A 1Z06A 3OF2A 4IIXA 4IR7A 4BLSA 4BU0A 4NULA 3ZW9A 1W4LA 4EKYA 1DEXA 3DM5A 2XVAA 1GUYA 4HWKA 4JJ4A 3KEOA 2EIMH 2PT6A 2QWWA 4WNIA 4MYTA 4TOIA 1N6IA 1UT6A 4Z6KA 3JVVA 2GA2A 5HKBA 4ZVUA 1W4BA 4JSTA 1SBCA 1JEEA 1HLGA 3QFHA 3ANTA 2V7FA 1ZONA 3CX3A 4I81A 5C2JB 5JBIA 2I9PA 1G8PA 3F3MA 4WKPA 5J4YA 2R5ZA 2Q45A 3T34A 1BVUA 3JYOA 5BSWA 1NP7A 2DR3A 1GA1A 2FZ5A 3EQ6A 3OC6A 4KDEA 3OOUA 2WMYA 3PFGA 1FWZA 4BO4A 4EKEA 3CLSD 3H9GA 3K1MA 1N92A 3CISA 4URFA 1CQIA 3RFTA 1OWPA 2DXIA 1TTPB 4FNGA 4B40A 2CDBA 3KJNA 4M7PA 5FWXA 1GT6A 1OYWA 1O6CA 2WHPA 2M4GA 3QA3E 3VZPA 5GP9A 2L7KA 1JSLA 1WQ1R 3AINA 4BQSA 4XWYA 3GJYA 1KMHA 3ZDXB 3GTPJ 1FW8A 1PNTA 1X80A 4LHYA 4MI9A 2OA4A 4U2FA 2FJUA 4XVRA 3K9LA 5D5WB 5G0TA 4YPFA 2ZJBA 2C98A 3OCYA 5L3GA 3C3XA 1OJ7A 2K3PA 1Z34A 1TO1E 1XT6A 2FHSA 3HDQA 4NHOA 1YFJA 1RR7A 4HTAA 1MQAA 3HDTA 4YUYA 5CP8A 4C3JJ 4BQIA 2IH2A 1WXHA 1SD2A 4LOIA 2JQ7A 5FT9A 3V1NA 2ZS7A 4XWGA 1F9NA 2AC7A 4JZKA 4H1HA 3LRPA 3WRYA 5C5CA 1K4TA 2XRYA 2VF7A 4HEA6 5CRIA 3UAOA 5ERXA 4OLBA 3F8TA 1MTZA 2E48A 2BJWA 2HWXA 2ROQA 5DZSA 2WLTA 1J99A 3SXJA 3W34A 5IHPA 1CR1A 5E3IA 3VR4A 4L22A 4NAUA 5LFAA 4KIBA 5LZ5A 4BGDA 3M89A 1W73A 3D4NA 5C8VA 2A30A 2OP1A 1K88A 5IT0A 3DUFB 4M1ZA 3EG9A 4F8JA 2O6GE 2C0PA 1DELA 5TXGA 3QMPA 3F9CA 4O4JB 3IEKA 2PWYA 4HMPA 5LA6B 2REBA 3T3MB 3AEQB 2JLZA 4EG8A 3BHNA 3K72B 3H1FA 1ORKA 3AUXA 2PGOA 4J4HA 1SQFA 3IOYA 4JK3A 3RSOA 5BQTA 3TMAA 3TOZA 5IRCD 3DEIA 4IOMA 2LKPA 1X3WB 2LTPA 3A03A 1ICEA 1ZL0A 3ZWNA 1JHZA 1MDBA 3O2JA 3GVAA 2V9KA 1P4SA 1T3SA 2QK4A 1XZQA 1A8QA 4RORA 4BDSA 5HHTA 1X6VA 1DBWA 4EJ0A 3IPRA 4P36A 3T8TA 1UK9A 2D0DA 2G17A 5JXJA 5K6AA 1LBQA 5LMZA 3PUVA 1J7JA 2WAOA 3NPMA 2JPCA 2N47A 4OX9B 1CE8B 3KUUA 1TQHA 5JARA 3ZWAA 3RC1A 3WLNA 1SFEA 1AUOA 1EGQA 1FLVA 3OT1B 3RUIA 2VQDA 4CF6A 1OH5A 1QVTA 4ODIA 3WA6A 1V54H 5IDQA 5JPDA 1N2XA 3OU6A 2O2CA 4EA8A 3TX6A 1Z0DA 2XA1A 5KTYA 3R9XA 3L2QA 1A9SA 1XKLA 2CFSA 4E88A 3E5QA 2WVAA 5IYZB 1F8GA 4G8DA 5E95A 4DV5B 3CV3A 1CRLA 1IUFA 5CQGA 4IRHA 4N9QA 3ZOKA 2WWWA 2JHPA 3FLMA 5JI3E 2DWQA 4ERXA 2Z2IA 3YASA 4JNCA 3MOSA 1D7AA 5BPFA 4BNIA 3TW7A 1F5NA 2GA1A 3RVLA 1X4PA 4ABTA 3WMXA 1SULA 3B3AA 3N74A 3A6KA 2JKYA 1M75A 1I51A 2FSGA 2DU9A 3ZXSA 4BE0A 5AHXA 3B60A 1L4YA 3T3DA 3ZVLA 1QF6A 1SCUA 3JRCA 2HK7A 1OWLA 2F5EA 4MYCA 4EYSA 3O8OA 3ZY2A 4ENPA 5IPAA 1PFYA 2BH9A 2P2ZA 1MA3A 2WFLB 3FYDA 3I0MA 5AD1A 2WWRA 4MA5A 3PL1A 4RB2C 1C81A 2YW9A 4HW0A 3HXTA 2D13A 3IOBA 3OX4A 4IP0A 3LTEA 1RSZA 2IYLD 4S35A 3RYTC 3W5UA 1B8NA 3ZV4A 2MU1A 3I9LA 3JYQA 3WOHA 3KLNA 1ERDA 4NB5A 3CUSA 1JJFA 2R8PA 3A0UA 3QYJA 3DP7A 4P58A 5LNK1 3STXA 2BMWA 4OQMA 4BMZA 3F9KA 3S2SA 2AKEA 3QX9A 2VPXA 4DLXA 3LX6A 3IH3A 5IJAA 4TVOA 5HNHA 1BMQA 3ULQB 1K6XA 3D54D 4HFMA 3U61B 1Z7WA 1PJQA 3I9V2 1CEXA 1TQDA 1F1JA 1CIPA 3FOCA 4W5WA 3UB4A 4J7UA 8AT1A 2PM8A 1KJZA 5EJAA 1XZJA 4CMEA 2ETVA 1DXOA 4XUEA 2R7UA 4CR6A 1LLDA 3E6DA 1JI3A 1NT2A 3EYAA 4J3JA 1H4SA 5BR4A 2GCPA 3W1VA 3ACCA 3KWJA 1AGYA 1FFXA 3IHKA 4HUQB 3THYB 1DIOB 4B83A 3V8PA 3F0TA 2PU5A 2VSFA 3BXFA 3LQ4A 3B5EA 4O4JF 4GPD1 4YRAA 3VR3D 2V5VA 4YFNF 1RKQA 5CH8A 4JYZA 4OHFA 3FYTA 8ATCA 1GPBA 2H2AA 1WSUA 3IC7A 1W7PD 5HNFA 4NEQA 3JQFC 1C3OB 3OYDA 2P6NA 3BD9A 3MS2A 5JNSA 3K9FC 2IZZA 2UXNA 4R2IA 1FXSA 3BTUA 1RZ3A 3QI7A 4JJ6A 4TV9F 1P80A 5CVCA 5TPZA 4Q9LA 4PICA 3NXKA 3UW1A 5B6JA 3HKBB 4Y2VA 5BV8A 1BCRA 1XQYA 2PKQP 1CZLA 1XVUA 1U81A 2WHEA 1CY1A 3HSRA 1XMOB 5IAJA 1WUKS 1UJ6A 2I67A 3WYNA 1ECFA 4EA6A 4GS5A 3IIJA 2QLLA 1I4WA 3GNTA 3QKIA 4QELA 2OZPA 4K9DA 3HN7A 3MAGA 4FX2A 1YB6A 4L73A 4NS4A 4CTJA 2XIGA 1VHJA 4IJUA 5L4LA 2QXUA 1O4WA 2WI8A 1U0SY 2XE4A 3A31A 2J7PA 5DBIA 3SJUA 3KLPX 2W58A 2JZNA 1MF7A 4ND8A 1RRMA 3EC1A 1DO8A 1PR5A 4Z7QB 3GTQJ 3PGXA 3W8DA 4F9GA 2B4TO 2V6IA 3LQRA 2ZE5A 3HLKA 4BFUA 4UOEA 1V8ZA 3A7EA 3B13B 3I9OA 3JRGA 1JFRA 2FOWA 2FZ4A 1O4XA 4ECAA 4RC9A 2PMFA 4OKSA 2RHJA 4LHXA 4MUJA 3VI4B 1EH8A 3AF0A 5ITWA 1QZTA 1CVIA 2NZJA 3CZ9A 2FUG1 3IV9A 4ZO4A 5JCJA 1VPLA 4PR0A 2R85A 4G5RA 3K16A 3TOXA 1L1EA 4Y9SA 2OC4A 5F1RA 5CLJA 5FV4A 2GZ2A 3K3PA 4RPHA 4WN9A 2E4XA 5ARDA 3DLHA 4C7BA 5TSDA 3OCUA 2XA2A 1FYKA 1MAVA 2JH3A 4Y2XA 4NXNB 2G71A 1UJCA 3P45A 3QJ5A 1GZ6A 5JAIA 2BVMA 3ZNQA 4WKOA 3CUUA 1CJUC 2YMPA 1F0PA 2EXXA 2QKMB 2DJNA 1K6JA 3IO5A 3L7DA 3QQ5A 1IIRA 1XIVA 2R8OA 2W6MA 1L8QA 4LYYA 4YO7A 3AW8A 5BRNA 4HNHA 4DQUA 4E6EA 3LECA 3G71I 1FRZA 3SJCA 4DCTA 2GXQA 4NPCA 2M7AA 5C3EJ 2IOYA 4XWWA 2WVJA 4B75A 1LPMA 3VRHA 4I0WB 4BMOB 5CK4A 2LY9A 1KU2A 1SC3A 2IV3A 3I2JA 4K03A 2PTGA 4P96A 1W1WA 1VTNC 5CTJA 4CGYA 4CM3A 2PUHA 4RK6A 5TARA 1NMQA 2C8VA 4C7JA 5C3MA 4NQZA 3H3XA 5HJEA 4Z0PA 1YS6A 3CKYA 2QGUA 2OHFA 2DFDA 4B46A 3NAMA 1V8OA 1RRCA 5HK9A 3RE1A 3WYEA 3B6EA 3AIKA 5M5WJ 1Q1ZA 4FFBA 1A9QA 4PLPA 4TTAA 5CTAA 3C3KA 5INTA 1D1AA 1E2LA 4ZJUA 5HLHA 1VM6A 1X9GA 3DZGA 4KXFB 4N8DA 2XBLA 4PQYA 1LS1A 4I1OA 1Z62A 2FPMA 4IDPA 1C2YA 1YZUA 3K0BA 3JQ6A 5D1HA 3V33A 1EBBA 4KO8A 2ZM6B 1QQIA 2WNIA 3BMNA 3I6QA 3LDGA 3OKPA 4RLSA 1EDEA 4YX9A 2ZKZA 1IPFA 3LI2A 1FQKA 2ZQZA 3CCBA 4CUZA 1T5LA 5EHQA 4GXTA 1GKLA 1QYRA 4EJSC 4DWVA 3E22A 1ZGCA 3GP3A 2VR1A 5HDQA 2CFIA 2IT1A 1Q91A 3B3GA 3LRTA 4RB0A 1L5WA 3PZRA 3QITA 2FJ1A 4MPDA 4UBKA 3D0KA 5AM5A 3G2LA 4GSKA 1RBQA 1H94A 2O57A 5GONA 4BU2A 3V8MA 5AW3A 2HHHB 4D3YA 2GXAA 4M54A 1UFKA 3LQ2A 3NVKI 2FDXA 3CCRI 3LUAA 1JILA 3AETA 3I2HA 4R8HA 3L93A 1CTQA 2CH0A 2H2WA 2H7VA 4LHEA 1NJSA 4HVLA 5DCMB 4EJ2A 2XNHA 1P0QA 3ZCRA 3LUJA 4X44A 2IH4A 1E3QA 3CRQA 3QEJA 2EPFA 5HIAA 1PSZA 2A0XA 5LYYA 3ZPXA 1W88A 4AZSA 4RFVA 4R9SA 2LWIA 4UXIA 3E1KA 2VJCA 2Q49A 1EFRD 2FF4A 1M54A 2FP4B 2HPIA 1PFUA 1MAUA 1X7YA 3FCEA 3FVRA 1E2HA 1A7JA 2E1CA 1R6TA 2EFEB 2FW1A 2RBEA 4JQOA 5DISB 4DA6A 1JAHA 3OSZA 3AG5A 1SXIA 1EFVB 3MJRA 4DCPA 1P7CA 2JA6J 5ALHA 3CCVI 1YQQA 5CM2Z 3OHSX 2HTFA 4HF7A 2WYUA 4J16A 1U1CA 3H1CA 1PT5A 4HGOA 5H8WA 2P9QA 4TKUB 2YWDA 2LE0A 3EGXB 1DRJA 3OQBA 4LYFA 3CCLI 4C0LA 4C9BA 4OA8A 2EH3A 2G9WA 1ANKA 3G82C 3KQPA 1IH8A 4PINA 4AZ3B 4BJHB 3LAJA 3AR3A 5FYDA 3IAFA 5TJ9A 4E7LA 1FSGA 2G3YA 3PR3A 1ZO8A 4ZN6A 2QZ4A 3ER9A 2O54A 2Q4EA 1WOMA 4PG6A 5AI4A 3P9YA 2IKSA 2MDTA 3VTKA 1ZESA 1KDTA 2QXTA 1XDZA 4NC7A 1BN7A 1XXHB 2ACWA 3JATA 3VKGA 3E6CC 3BF7A 3G02A 4GPBA 4O29A 3WO0A 4YUZA 4E1AA 3PHCA 5I7AA 4P7FA 2OCKA 3HVJA 4NV1A 5SV2A 2BEWB 2DPXA 3CRNA 3RVRA 4F7DA 5MFZA 3T3OA 1FZTA 2KT0A 4QOEA 1PQPA 4X65B 3I71A 4UUSA 1GQQA 4PNEA 2L4MA 4QECA 4X60A 4AO6A 2VYND 2VXCA 3OZUA 4TKZA 1QU2A 4RTOA 2IYSA 2V79A 1DBRA 2B6HA 2JRCA 2WFAA 3AIIA 1Z0ZA 2V26A 2J5RA 3QY9A 1C5KA 3BEDA 4FR5A 2DTZA 4XARA 3KT0A 4QDJA 4PFKA 3KQSA 3EFBA 4ZVRA 4D82A 1IF1A 3O84A 4I01A 3FZQA 4EZEA 3NYRA 4GPTA 1DKNA 5EJEA 3TE7A 4UHCA 3QJYA 2H5LA 3DHEA 3EHEA 1DKQA 3QLEA 1QYIA 2P9TA 3RODA 3WZMA 2F3RA 4WOBA 4K5QA 1IWOA 3F6OA 5G53C 3FR7A 2HKXA 2H85A 1QCCA 2JK0A 1V7CA 4GKBA 2AMFA 2D0PB 5FB2A 2L02A 2ZIXA 3QTBA 4N4OB 2VZEA 4FEEA 5A7GA 3TLKA 2JF0A 3V6LA 4BKUA 4YXFA 3ZHZA 5KOYA 1TJNA 3P2EA 5FTMA 3W5HA 4BVJA 1BHJA 4ASUA 3R40A 2COKA 3QZUA 2QRKA 4KO4S 2DWCA 2E49A 2MT9A 5TT0A 5E3MA 5FPHA 5CB6A 4RYLA 2OTLI 4NESA 4RA6B 2GD6A 3BDIA 4WCGA 3EXEA 4I46A 3RS0A 3DONA 1XYGA 1J22A 2VB6A 2Z83A 5DW0A 4JJGA 1CF7A 1G18A 1IJBA 1ONBA 1PX0A 4PZJA 2GSWA 3AEKB 3AP2A 3OCWA 3QVSA 4GVPA 3WVNA 4NZMA 3L8DA 4KFCA 3QHPA 1FIPA 4PZ0A 2OXIA 2VTBA 1FYDA 4NZ9A 4PPNA 5KO2A 2GLUA 4LYAA 5FTKA 1T1SA 3IIMA 3IEVA 1YRBA 1ATZA 5C5EA 4LSMA 3LXRA 2BGRA 4LPSA 4YAKA 3I3LA 2YXBA 1FMLA 1AUQA 2FWAA 3THXA 3BHIA 1WJBA 4NOKA 5EJFA 4D0LB 4QTUB 2BVLA 3C3WA 2F8TA 4IUCS 1EB9A 4AIKA 1T5HX 4UUQA 1AKNA 3OIWA 5DTDA 5LQUA 1N7JA 2PT9A 1UC8A 2Q99A 4B3GA 1GGHA 3PPXA 1VL1A 3RSFA 1VL8A 3KOMA 3JPYA 1FBQA 2E6KA 1COZA 2IITA 3OLCX 3PHIA 2JRMA 4M8KA 4X3OA 2W2NA 1KYQA 5BR8B 4BXFA 2ZRHA 4KR7A 1P9NA 5JCOA 3PUKA 4BBZA 4II2A 3D7LA 4BFVA 2PK3A 2QM3A 2HWKA 1PV1A 2AJ8A 2WD9A 2A6HF 5E79C 1K6IA 3DE3X 3L0BA 4NYJR 4LQ4A 2RHCA 4RKFA 2EKDA 5KWSA 2XGDA 1DQYA 1JSZA 1EFVA 3FCYA 3AG6A 3RAPR 2O5EA 2GLOA 1QYDA 1IQRA 3F7OA 5A6SA 2CYAA 1FE8A 2IYFA 5CXQA 2DUWA 3TECE 1GTRA 4C21A 1C4OA 1Z7GA 2JB9A 4AJLA 1U2SA 3H1GA 4V3CA 4PHTA 3AONB 1RRPA 3SFTA 4Q9HA 4WFKA 5J5CA 5KOHA 4RGSA 1WU7A 3QEMA 1KGSA 1VZ2A 4OIPF 2JAPA 1AQUA 3QHAA 3C3DA 3EF1A 4P08A 5CG2A 2UYHA 1OV4A 1KETA 3GFIA 3I23A 1TMKA 1RJEA 3U3MA 2M8GX 2A5YB 3HA5A 5CDFE 1H1LA 4OH1A 1SUFA 2CXTA 3DQVC 1MB4A 4ZU1X 4BMSA 4H9GA 1OMIA 3I55I 1N2CA 1CB0A 2HM7A 3UK6A 1M6NA 1ZGZA 2GR9A 4QL3A 2RD2A 4TTTS 4NHJA 1XUOA 2OFOA 2RHHA 2YBEA 3M1LA 4CCAA 3AJAA 4YQZA 3SM3A 4YPVA 4OJQA 2OF7A 3MWMA 1OWNA 1UMBB 3K05A 3K9CA 4MLCA 4YP7A 4W5RA 3HVUA 2JHGA 5ALXA 4DQ0A 3PIRA 3DBVO 4N6GA 3V1LA 1BDIA 2C9MA 1ZSNA 5IOYA 2QQEA 2GHRA 3IH5A 4PZCA 4CL3A 2ZJ3A 5ALLA 3OQIA 4IIUA 2L9SA 1FRNA <