3WG9A

Crystal structure of rsp, a rex-family repressor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
209
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 74
structure length 209
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wg9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wg9A02
4XR4A 2CYYA 3VOEA 4NBTA 1QXSA 5HS6A 1O8CA 3V7SA 3GK3A 4UEJA 2ZO4A 4IRGA 2E7XA 4ZYEA 3NTOA 1G0NA 4YACA 5A1TA 4I0BA 1I30A 4CGZA 2ZQYA 4ZQBA 1MG0A 2R7DA 1A7KA 2X1HA 3WLFA 5JY1A 4UUMA 1D8JA 1OYWA 1Y6JA 1WWXA 3HHPA 4RCVA 4TRMA 2ZKZA 2E82A 3GVIA 3I5UA 3PTZA 3EETA 1AN9A 5F3RA 3JQCA 4BO8A 4MP6A 5MGBA 2Z1NA 1EFLA 1YQXA 1XHLA 1O7FA 1PDNC 3AFNA 3PHIA 4DC0A 4LFUA 3O3KA 4OIPF 1IHYA 2LNBA 1KVSA 2QYTA 1XU9A 3BMNB 3QWFA 1T4DA 4J1SA 5E8GA 5E8IA 4CMEC 4EGFA 4KWHA 4PRKA 1P1JA 2A94A 2K02A 1NPDA 4MIEA 3OEYA 5DN9A 2XKOA 1LDGA 1P74A 3ANMA 5K5RA 3N58A 5LHGA 3JQGB 4GQAA 1GTMA 1EUCA 2YW9A 2PZLA 3IOYA 2FHSA 4XGIA 4WCGA 1M6HA 4Y98A 3GXOA 3MOGA 4KOAA 1U6GA 1I2CA 3ZHXA 3RASA 1TTYA 1S8NA 3DMTC 3EDPA 4L0QA 3M2TA 5TC4A 5JO9A 1KQ0A 2X5KO 3VPSA 1TT5A 1BOAA 1BBYA 3DPLC 4LLGF 1I5ZA 1PS0A 3PFIA 1XN7A 4PG5A 4NR0A 1V8BA 4Q3CA 2Q2QA 1J5YA 4DNCA 2R6JA 4R1HA 4YYZA 2HMVA 2LDXA 4UVBA 3QSGA 4MQ9F 1PWZA 4RLSA 5IDYA 3ERED 3KYCA 3CUQA 4EDFA 5HTOA 2XAFA 3IUPA 1ISHA 5I9MA 1JDJA 3IHUA 3IC5A 5EQDA 2Y05A 1E7RA 2FP4A 1U5TC 4EMSA 4XYEA 3V8JA 5FEUA 4L73A 5DBIA 3NTRA 1I3MA 3BTVA 5D5UB 4KTVE 1GFSA 2JFHA 3U3XA 3ETDA 3OJEA 2ZBKA 3DR3A 4YRDA 1CRWG 3ZZNA 4DREA 4E21A 2DKNA 5DCMA 2O4UX 3PHJA 3DPTA 2Y48A 5BSFA 1S29A 1CIVA 2C54A 4BB6A 4AJ4A 2H94A 5D6FA 1T2DA 1QYVA 3FMRA 2RGVA 3ZHYA 3FWNA 3H92A 3GUCA 2CGPA 4R5HA 5JFOA 2I9PA 3OQBA 3RIRA 3RAJA 1A5ZA 2VWQA 1GU7A 3E9MA 2BGKA 4BHCA 4GSKA 4BQPA 4XSZF 5DDIP 1U2DA 3V1UA 3GMDA 1MXHA 5JY6A 8ADHA 1HKUA 2O23A 2P4HX 2P5YA 4XRRA 2WD7B 3ONEA 2B5WA 3AUSA 1T1SA 4IRHA 2ZTVA 4P38A 2RAFA 1K89A 5G4LA 2W98A 3PJEA 3RC7A 2JCXA 2CVZA 5CDSA 1EBFA 3MJ4A 3NJ4A 4EUFA 1HTBA 3TWOA 4WWCA 3I23A 3PYLA 4DQXA 5JNLA 3OMLA 3RKYA 1DSSG 5DP1A 1Q0QA 5T67A 4A27A 3FM3A 4QLCU 3TOZA 1XDUA 5HS7A 1WRJA 2GD1O 5G2OA 4FFOA 4JJGA 4F3YA 4KUHA 3TFQA 1LRJA 2DPHA 3B02A 4BH9A 2CMDA 2P5UA 3HTSB 4CQLB 1PEDA 1QPMA 1N7GA 1LDNA 1YOVB 2PV7A 4OOEA 4Z0HO 4BGIA 3ZMVA 4BNHA 2EP7A 4J7XA 3ZNPA 3FMSA 3KLPX 4MJLA 4PLCA 4LMYA 1IN5A 3ICPA 4LMPA 4RZHA 1U7TA 1ADFA 5TJJA 3RU9A 1O57A 2FSVA 2AQHA 2JCYA 4YFNF 3ENKA 2PLYA 1OMOA 2JD0A 1WMBA 2X9NA 4FR5A 4CM6A 1JU9A 3LQFA 2ISYA 3EC7A 4BYYA 1C0WA 3VVBA 3VHRA 2Q0OA 3CTMA 1KGSA 5ICMA 3PDUA 2A69F 1ZKMA 3KRTA 3LSTA 4OSPA 3ZHBA 2FU4A 3I1JA 1NFQA 3FX3A 1C0LA 1TA4A 2GLXA 2AXLA 4MOWA 3DEUA 4BMVA 4FSHA 4LW8A 4D3DA 3ECHA 4ZA2A 1DBVO 1ZRFA 4IY1A 4ND3A 1VJ1A 3JSOA 2IP2A 3WTYC 3VKUA 3ZWVA 3GZNA 2PNFA 2PY6A 4R68A 1GD1O 4Z0TA 5AXAA 2L02A 4NHEA 1IN8A 2PFBA 3Q9SA 3OH8A 4NDNE 1XD7A 1O7LA 2X9GA 4L74A 2KIFA 4ZYDA 1XMKA 4HQEA 3JQ7A 4FFRA 3ONDA 3UICA 1HYGA 2DU9A 4AJNA 4EM2A 1E3LA 2PZKA 2RH8A 5CFZA 3NUGA 2AW5A 3FNGA 1LJ9A 2B0LA 5ERIA 2HK7A 1HSOA 2Y1GA 2E48A 3AY3A 5L3FA 2VBXA 4ND5A 4M74A 1PJ4A 1SO8A 3BMQB 4G7HF 3OV8A 4NIMA 2VHVA 4NK4A 3NT4A 4HKTA 3ROMA 2QQ9A 3ZU3A 1EEHA 5JAMA 2ZJ2A 4IJAA 2YFQA 5I8WA 4K6FA 4LLNA 1XQ6A 4CUJA 2K4BA 3MFKA 4GYGA 1H6DA 2IEBA 4DBZA 3RUAA 3I53A 3PYMA 1LSJA 4GLLA 3HRMA 1VE9A 3Q5FA 2V6BA 3QW2A 3WBBA 4DMMA 1E3JA 2ZNZA 2L4MA 1MJ9A 4ZJUA 1EFKA 2O4CA 2P5VA 3O2PE 3F5QA 5A3JA 2PG4A 1U5TB 5E17F 2E1NA 1PX0A 2J6IA 1R7JA 5G0UA 1IPFA 1MGTA 1W5TA 4G65A 1YBMA 3JQBC 4C7JA 4RVHA 1ZMOA 4OH1A 4NPCA 1VJTA 5DEQA 3QOPA 2B35A 1OYIA 2OU2A 1LDEA 2ESHA 4KDFA 3D5TA 3ZPLA 1ZG5A 4HV4A 2VN2A 5THKA 3DZGA 2OOSA 1Z7BA 4DVJA 4CUZA 1PJCA 3FNEA 4HWKA 4BQRA 3MAJA 1VKOA 2OP0A 1ZARA 5C37A 3H9JA 4KN7X 3A4VA 1BXKA 4UUOA 1LRKA 3AUTA 4AJ2A 4ENJA 1BIBA 1HW1A 1GY8A 1Y8QA 4TROA 3TDKA 3ZN1A 3TNLA 1LC3A 2K27A 5AVOA 2ZTLA 2YV1A 3I3OA 3D64A 1DIAA 4A2CA 3K92A 4MVJI 5HLIA 3GDGA 4FX0A 2H6BA 2J5KA 1HLDA 2OORA 3WB9A 4YAIA 5A2QZ 1A72A 1FC3A 2YX7A 4OOIA 3TOAA 1BMDA 3PGJA 3F8MA 3ZGYA 4GX0A 5A5EA 5AIQA 4E5NA 4QFCA 4BOYA 2JCVA 4WOJA 3CTAA 3RUIA 4GO1A 5IT9K 2ZQZA 3SLKA 4EM0B 2GPTA 2NVBA 2W24A 3GAZA 3LT1A 1IN6A 1KC3A 2WV0A 3KZYA 1DRWA 3H2ZA 1NPYA 2RQPA 4LG0A 1ZSNA 2CDCA 5D8LB 2PZJA 2P5LC 4K28A 3WE2A 4RVFA 4ESJA 2MLKA 1GUFA 4HADA 4E31A 3QU6A 3C7CB 2FWMX 4UREA 1WKMA 3WOHA 3H3UA 3GEDA 2WTEA 1DLJA 3LZ6A 3WLEA 2A4KA 4DLAA 9LDTA 1G0OA 5CEFA 2O50A 4LK0F 4U7DA 1SB9A 2X0LA 5D4SA 3J7AO 3GT0A 3ADOA 3IP3A 4I5EA 2C6YA 2PKRA 2FMLA 3OP4A 4ALNA 1C1XA 3E03A 3WJ7A 2P4WA 3S2WA 2DBZA 5EESA 3IJPA 2BEOA 1U3VA 2FMYA 3I9OA 3NAQA 4GX2A 3V1YA 3N97A 4RZIA 3WWZA 4F6CA 5KNLA 1T25A 4HBLA 1OMIA 4XLNF 1IULA 4QFDA 2MBFA 3G79A 2W90A 3JSAA 4U0YA 2E1CA 4BGEA 4PLTA 1JHHA 1SD7A 5D4RA 1KY5A 3GGPA 4OL9A 1UAGA 4JK1X 4R01A 3GLQA 1W73A 3LA3A 3GN2A 1ZLKA 1AXGA 1CEQA 4IINA 4F46A 1K78A 1B3BA 3GEGA 2VUUA 4L9VA 2YY7A 3GFJA 2K4JA 2X6TA 3HJAA 4YR9A 4YT2A 2XIGA 5HOOA 1MV8A 2KJBA 3TKYA 1QG6A 4HDUA 2Z99A 3D5LA 2EERA 2POQX 3O8QB 1PQUA 2EFNA 4G5HA 4CLEA 1NASA 2IXAA 4ZZLA 2ZJ1A 1H9BA 4MVJF 4LB5A 4PLVA 2YU3A 5HDGA 4J0FA 3V7CA 4RS8A 5H83A 3TZHA 3WGYA 3L2CA 4QQRA 2W2LA 4J49A 1PJ2A 3L4BC 4D43A 3FNFA 6LDHA 2TMGA 4BNMA 2DTXA 2IYOA 2I3GA 3S2FA 3CZRA 3OJFA 4BB5A 2O8XA 1E17A 4EEXA 1B8UA 2J5RA 2BD0A 4XYGA 2P7VB 1HDZA 1QQIA 4E5KA 3VC7A 3T5XA 4AJLA 1ON2A 2WSBA 3WGZA 3L0DA 1DC5A 3WTWC 2NUAA 2FA5A 5D5XB 1X7GA 4OGWA 3ZW9A 1U78A 2KIMA 4B4WA 1K5HA 4AVPA 1MLDA 5DT9A 1PJ3A 1B1BA 1P1KA 1H9TA 4DGSA 4EJTA 2A92A 5C7LO 5DCFA 3G73A 1HSTA 5KOIA 2B4RO 3WBFA 1HDXA 4OQZA 1P77A 3I9KA 4FT8A 1B15A 2R00A 4J2HA 1ENPA 1F8GA 4IS3A 4HUJA 4TV7A 1HF3A 5L7TA 1NBOA 1PIWA 3JTHA 4DPKA 2OXIA 3QU3A 2HO5A 5TF4A 2A07F 2OBNA 4IMPA 3CKYA 3AI2A 4LGWA 4LCJA 2A68F 1D3AA 1FBSA 2V1DA 4TVBA 4OHUA 5BSHA 3V8KA 1HEUA 4IXTA 2DQ4A 1BG6A 2ELHA 2PR2A 1EH7A 2RDPA 5BS6A 5JLAA 3QRWA 4WEQA 3R0AA 4BO1A 2O3TA 3H9UA 4DXHA 3HN2A 9LDBA 1NNUA 1JN0A 5D6EA 2JHFA 3NX4A 4AIKA 3BY6A 3GHHA 4R1UA 1ULYA 4JK3A 2PN6A 1E3WA 2AE1A 2DT5A 3E3VA 4ENNA 1W6UA 1HT0A 3GWZA 4MVJM 4XDYA 1I1SA 5FLXZ 1ZK2A 4YJGB 3D4NA 1QLJA 1SNYA 4N5NA 4IDDA 3E5UA 1U7HA 5FYDA 2VHYA 4EI2A 4F45A 3BHMA 3O26A 1H2BA 3HFGA 1I2ZA 2RN7A 4J7UA 5COQA 1Z75A 1ZMTA 4EZBA 2LF7A 3N7UA 4LK1F 1YW9A 4M72A 1FYKA 3ASUA 2ACJA 4HBGA 2DQRA 4W7IA 3RBZA 1R4MA 3NJ8A 1UP4A 2PKQP 1FDTA 2QYOA 1D1TA 4P4NA 2XXBA 2ETHA 3NT5A 4FGSA 1ONVA 4Z3DA 3HIFA 2NWQA 4NQWA 1IXCA 3UUWA 5FB2A 3STHA 1ZFNA 1E3SA 2IEDA 4OSOA 4B09A 3DB2A 2C5AA 4A5MA 2NSDA 3DHYA 2Q4BA 4PZJA 2DBRA 2AG5A 2Q46A 3ETEA 4M55A 5COBA 4PDKA 1S3JA 3COAC 1FDSA 3ZN0A 1HDYA 3JQAB 4YJDA 1Z9CA 4UV8A 1J0XO 3ORFA 4NBWA 3E6AA 4CICA 4IDGA 1R22A 1GZ4A 5E18F 4CMBA 2FXAA 1USTA 4CDGA 5FFFA 3LDHA 1ZK1A 2Q1UA 3QVSA 4RB3C 4FX4A 1O3SA 3W4JA 3LLVA 3L9FA 5L95A 2YDXA 3PI7A 2WEKA 3F3XA 4KMSA 3M9AA 4WGGA 5T8KA 1H9AA 1OAAA 2GR9A 4FHTA 1CWUA 1UZLA 2L01A 3AM4A 3GRKA 4WOKA 4M87A 1B2LA 2VWGA 3HB5X 4ZRMA 5G4KB 1AHIA 3GQVA 3DZBA 1PUEE 2HLPA 2VC0A 4WLVA 1ZEMA 5G0WA 3MZHA 3U2RA 3F8BA 3TQNA 1GV1A 1NM5A 1ZO8A 4JNKA 3SXPA 2DBVO 2DBBA 3BP8A 2QG4A 3LFKA 3BTUA 4FJ1A 5CEJA 2PI0A 2H27A 3WU0A 2B4TO 1T1RA 3SC4A 3SX2A 4R79A 2J3KA 4K6CA 4OOFA 5ER9A 3CJNA 1XR3A 5LDHA 1E1MA 1VRWA 5AYVA 4GH5A 4CV0A 2Y1FA 3E5QA 2XUBA 1T2EA 4E33A 4OMUA 1T39A 2XF8A 2YV2A 2XAQA 3MJSA 4J3FA 5FD6A 1E6WA 3MJVA 1N2SA 4YWJA 2WDZA 2NTNA 3QP5A 3RBXA 5CVVA 2BLLA 3KVOA 3I58A 5HS8A 4YT5A 2G7HA 1OFGA 4L4XA 1T26A 3JQAD 4CM5A 4UUNA 2DO7A 5IXSA 1AUPA 1U4SA 3KUXA 3DFZA 4RF4A 2NU8A 2VBYA 4ZQFA 1B26A 1FJHA 3JQEA 2FSWA 2H6CA 2HDHA 4A0ZA 3PHLA 5J8FA 3AAFA 2W4QA 1DDNA 4XYMA 3SJ7A 3ZWNA 4B4VA 4WKGA 4CLXA 1U3EM 3WODF 4JP2A 1Z05A 4YVFA 2C20A 1LLUA 4E5PA 4XBFA 4D41A 2OQRA 4OXNA 3I9LA 2Y75A 2GRAA 4BNTA 1F06A 2D4AA 4PZCA 4BUCA 5TRDA 3WSVA 5A2QK 3BIOA 4B7UA 5IN4A 1ZH5A 3F6VA 5DBGA 1HYHA 5L3GA 3MCZA 4N5MA 4BXUA 2VRCA 4XDZA 4S3MA 4WEOA 3NQOA 4YQZA 5FGMA 3ABUA 1ZXLA 4AICA 5I9LA 1O5IA 1KVRA 3AY7A 1LUAA 4OIRF 3JTMA 4JXKA 5KVVA 1ZK0A 4DPMA 1IUYA 1LQTA 2NV6A 1J5PA 3Q2IA 5TX7A 3ZV3A 5L45A 4J0EA 2CWEA 5TS3A 4GI2A 1NWHA 2Z1MA 2E7WA 2HJRA 4RAYA 3S55A 3V2GA 1XLTA 3DF8A 4L9NA 1FK8A 1G4DA 3BTSA 3D5QA 3I6QA 4BNKA 1VL0A 1SC6A 1K2WA 3OHSX 3S2GA 1LXCA 3EVTA 1IRGA 3F5SA 4NNJA 3VDRA 4HV6A 1FMCA 2CDBA 3KEQA 2HGCA 1E7QA 1FOKA 4Q48A 3NT2A 3FF5A 4O63O 4B8WA 3KSDO 4YT4A 2OL4A 1HW5A 3AY6A 3FBGA 1XGNA 1PS9A 3ZV5A 5L3DA 2XKPA 2HCTA 4F7ZA 4OQYA 5DCWA 1PGOA 3KZZA 1GV0A 2VWHA 2Y67A 4NU5A 2EKQA 4U8GA 4UULA 5CP8A 3U4CA 2VYNA 3JD1A 2FBKA 3IMFA 5TQVA 1FY7A 1EH8A 2O3FA 4EM1A 1NP3A 3DBHB 2FRDA 3LK7A 3ULQB 4LK3A 4M71A 4ZU3A 5A3VA 3HFSA 3U4DA 5BOXA 1BDBA 3K1MA 1LC0A 2HKXA 2BFOA 3Q2KA 5A05A 5CVIA 3GYHX 2C59A 3JYLA 4XYLA 5FFXA 5CPBA 2HEOA 4ONEA 1X0XA 3GVPA 3R3JA 5H20A 3CMCO 1R4MB 3LC7O 2VOJA 3LAPA 5A5FA 1LSOA 3PJGA 1P45A 3WNVA 4RF2A 2ZATA 4CLRA 3IAHA 4I9UA 4DIOA 4BNIA 1PQWA 1R6DA 3VFZA 1HE5A 2FN7A 3WQQA 5FF9A 3F4BA 5GZ3A 2WYVA 3BMOB 3RTRA 2DTRA 1MDMA 1I33A 2FNAA 2UAGA 3BJAA 1DLIA 1OI7A 2VHXA 2DTDA 2PFGA 1E7YA 1UP7A 2O2YA 3FWZA 3RC2A 5LRSA 8LDHA 5J8CA 5JVTA 4NQZA 3FXUA 3KLOA 1LLQA 2FSSA 1DB3A 3BROA 1LSSA 1U8XX 1W8DA 4KMUX 1NFRA 5TGDA 4BO4A 3DWFA 1ZSVA 2PH3A 3IJRA 3QVWA 3L9WA 3LT2A 1K6OA 1JVSA 1ML3A 3PVZA 4XQEA 4DQ2A 4L9JA 2HMTA 4WCFC 3PHHA 1XIVA 1OC2A 5CDTA 3I9NA 4Y6SA 4JLWA 3C7JA 1DDOA 3R4KA 1R36A 3B20A 3IS3A 2X4HA 3RQSA 3DAGA 2FQ3A 2CW0F 4ROSA 4XA8A 1MC5A 4AJOA 3QA9A 3LC2O 1FLIA 3AK4A 3G17A 3JD3A 2HQRA 3T8TA 1HXHA 2CVOA 2PH5A 1A04A 3A28A 2D8AA 3K5PA 1P31A 3TL2A 4WXDA 1PJLA 2E49A 3C3XA 4UVDA 2AA3A 3KYDA 4NK5A 1LRLA 2NRAC 1HYEA 3QP6A 1C0PA 1IB6A 5BT9A 4ND4A 3RYPA 4O59O 3AUUA 2RIRA 3I5MA 1RYDA 1NVMB 3HG7A 3FBTA 4OIOF 2NTJA 1R1TA 1IL0A 4B79A 3FWEA 3E8XA 1IW7F 2J3IA 3FRJA 4YA6A 1BJAA 4AFNA 4O0LA 2QRLA 4LGVA 1I10A 1E5LA 4DC1A 3RKRA 1GQ2A 4PG4A 4Z2YA 1FSEA 2IW5A 2K86A 1E5QA 1SD4A 1D8AA 2HQNA 1XYGA 3DBRA 3WTTC 3PYXA 1J9IA 4FFLA 4TRNA 2IVMA 3D1LA 2MA3A 5HWSA 1L7DA 2BE5F 3GUDA 3U4IA 4BNLA 4IGEA 4IDCA 1JE8A 4M1QA 4GWKA 2GXGA 1M75A 4HF1A 5FLXK 1PS8A 2HRBA 3JYNA 1C1DB 3K96A 5ITWA 1YB1A 3WTUC 4E2XA 3UW3A 3GFBA 1XSXA 4GGGA 3R6DA 1P0FA 1UDBA 1YQGA 4XX0A 4JGBA 5A9RA 4D0PA 5JMWA 2EA2A 1UAYA 3G1TA 4E2ZA 3KO8A 1NPTO 1P4WA 1YW7A 1LQ1A 1TQIA 1XCBA 1GYRA 4HX8A 2JAHA 3DTYA 5MDHA 3F22A 3DZHA 3GNSA 2XHKA 1LU9A 1XDWA 4LRSB 2NAZA 4U5QA 2FNPA 4CM9D 3TF5A 5BPIA 1Z6TA 3H5RA 1HSJA 1R1UA 1Y5MA 3AI3A 4RV9A 4DIFA 1LDKB 1R00A 3D3EA 4K2EA 2NQ8A 3UOGA 2O7QA 1PZHA 2Y1EA 2UXNA 4H16A 2PZMA 1GCOA 4PZEA 4IJKA 4QEDA 4RF5A 4HQMA 1SFXA 1N5DA 4XSXF 5L7YA 4OU0A 1FZPB 4J16A 1YL5A 3E5RA 2D1VA 3DZFA 3LT4A 4JN6B 4BNWA 5KJFA 1N1GA 2STWA 1RWBA 2GN6A 3RFTA 5DOZA 4CM7A 1FT9A 4D42A 4FDAA 3RI4A 4J1QA 1KA8A 2DC1A 3U9LA 2Q1SA 4Y17A 2VE9A 1GXPA 4R8HA 4CMIA 2EV5A 2C29D 2ZYGA 3BWGA 3ZWXA 2ZYAA 2ZMEA 1XGSA 1SEPA 1GQYA 3NTQA 2NADA 1DFGA 1MC4A 1EDZA 4I9NA 4NI5A 2WE8A 3EAGA 5FI5A 3IUSA 1Q7CA 4D79A 1ZEJA 4HF0A 1QORA 3O03A 4OAQA 3WMXA 3ZNQA 5CEEA 5I7SA 1PSDA 3KP3A 3WE3A 1DAPA 3OJLA 4FFPA 4MPDA 3RBVA 3MTGA 5TLSA 2CDAA 1XA0A 1MJBA 3K1PA 1YDWA 3K31A 1U2WA 1T2CA 2PLAA 2EWNA 2VNAA 3O4RA 1YL7A 1IXRC 3PZBA 5G0VA 2GNAA 5JE8A 2O03A 3BMCB 1G6KA 3Q3CA 2VQ3A 4WK8F 3SFZA 1X13A 2LKPA 4L0ZB 4CYDA 3OIGA 2DFVA 2P7CB 4J6FA 3HOSA 2YZ7A 4HNGA 2O7SA 1QRRA 1EK6A 2PD6A 4GSLA 4XWYA 3RUCA 1PTJA 3WICA 3FTNA 3CXRA 1WDMA 3INGA 2JSCA 2WTBA 4I2OA 3TDUC 4E6PA 3GDFA 3NGXA 5HDNA 3M7GA 1ADBA 3JCZA 3OIDA 4WCFB 1WDLA 1R12A 2AEMA 5FI3A 3RUFA 3BA1A 5KIAA 1P92A 1HQCA 5L53A 3L7WA 1ORRA 3IKVA 3P19A 2VZ0A 1ZREA 5JCJA 1N92A 4M89A 1M2WA 3C8MA 2BYVE 4Q3NA 1K0UA 4MO2A 1Q0LA 1XGOA 4M73A 5F1PA 2D2WA 1S7CA 4IXWA 4EV0A 3WGQA 2EFWA 1J0RA 1Y9AA 3E18A 7MDHA 1UHWA 2XVCA 3HYIA 2I67A 2DFIA 3LT0A 3OICA 3DBLA 3F47A 3VB2A 5ILOA 3LQQA 4O5VA 1OPCA 3NGLA 4ND2A 1UJMA 1WZEA 3VPGA 1RI7A 2IA1A 3CUQC 3ETGA 2B4QA 4S05A 1DHTA 3W8FA 4XKJA 2HR3A 1E3EA 1GR0A 2FPIA 1G3TA 1SMTA 1B7GO 1OC4A 3EZLA 1ON1A 3G1UA 3JQ8A 4ZICA 5BNIA 3TSCA 2PKQO 1CQIA 1PQPA 2FY8A 3NDIA 1JHFA 4CM4B 4NH4A 4YAGA 2V6CA 3WGGA 4BMSA 2G76A 2BBYA 3UGKA 3UKOA 4HA8A 3W6KB 2VZ9A 5CPFA 2MH2A 4NJOA 3P9IA 4ENMA 4W4TA 2V65A 1LB2A 4ASNA 4L4RA 1RNLA 4DMLA 4PLWA 3H4VA 3K2BA 4KWIA 4UEOA 3FR7A 3OA0A 3FHLA 4OIMA 1Y0UA 2C7VA 2VE8A 3PFFA 5DZSA 3U4HA 1YVEI 1I36A 2FR1A 2IZ1A 1V35A 3ZNNA 5I7FA 1OZAA 4JX8A 2MLGA 4RGSA 1I0ZA 2NVUA 3JQ9A 2D1HA 1M66A 1OBFO 1XKQA 4P55A 4RVGA 5IDXA 3A1NA 1Z91A 2BFAA 1QV6A 2X0IA 1T2KA 4B7CA 1Z45A 5HM8A 5KTKA 4KQXA 4Q39A 3TO6A 1QO0D 1BTOA 5GZ6A 3DXJF 1Y8RB 1PP7U 1U5CA 2BGCA 4YRAA 4E5YA 2DLLA 4CQMB 1YBAA 3EUWA 1UZNA 1BXGB 3LF1A 2JD1A 4XLPF 4DQVA 4E4YA 1OYYA 3HZZA 3UFXA 4ALLA 1I3KA 1IRFA 4XEHA 1PWXA 4RVSA 2RV8A 4P9UA 1XG5A 3JYQA 4J4TA 4XR9A 1U3UA 1V3VA 3JQ6A 1IAWA 4M9ZA 3I52A 3U9GA 3GY0A 5C7OO 4LSWA 4MQVA 1MD0A 1NHAA 3E97A 3AOEA 4FOOA 3ELKA 1UXKA 4XD2A 1JXSA 3HB4X 1U8RA 2FRHA 4HDVA 3U0BA 1ZH8A 1PL8A 2JFFA 3D4PA 2I99A 4UUPA 1K6IA 3WWYA 3HN7A 1K6XA 3PWKA 3ULKA 1LLDA 4PN3A 2NNLD 4EVIA 1E6UA 1LQUA 1J2XA 2Q99A 2IA2A 2ZTUA 1U2GA 1R0KA 2YPRA 1RPNA 2HMWA 1GVJA 2BV6A 4ILKA 1R4NA 3COSA 4PCVA 3K9TA 4Q4ZF 3WTSC 5CLSA 1UUFA 4D46A 1NQAO 3AOEC 5IAAA 2EEZA 4TWRA 7ADHA 4RGRA 3HQ4O 4UV9A 1X1EA 1U1IA 3SLGA 3FXQA 2W57A 3MCVA 4INAA 3GEMA 3IQDB 1WLYA 4RJTA 1IXSB 4U0WA 2HU2A 1OKRA 1T38A 1MB4A 3CINA 4CQMD 1MZBA 3GAFA 5CVJA 1KU7A 4RPKA 3E6BA 3RD5A 4E70A 3AU9A 2RH4A 4GLOA 2SCUA 4KFCA 1MX3A 4ZZDA 2GA2A 2D2IA 3INTA 1KYWA 3F6OA 2GXBA 2VOOA 1E6EA 1EQ2A 1Y9EA 1EH6A 2EV0A 3GRPA 3O9ZA 4LN1A 1YWGO 2NYXA 2JTVA 3BPXA 1LEHA 4YIFA 1NR1A 3FCOA 4KUEA 3L77A 4LVUA 4CM3A 3R6SA 5DD4A 3K2EA 4CMAA 1WP4A 4JQFA 4LVCA 4W6ZA 3ZU4A 3K1NA 3DP7A 3MQ0A 1HE4A 3MJEA 5KVCA 3DC2A 3AM5A 4AD9A 3ASVA 1XSVA 5KK1A 4QO7A 4WLFA 3JTGA 3BPVA 3I0TA 1IN4A 3F8NA 5DUIA 1BHSA 1TT5B 2G17A 1O0SA 3KOUA 1I5RA 3D0SA 4LD5A 2J5QA 3FN4A 4I1IA 1EE2A 4KTTE 2I65A 2GAUA 5DD8A 3SC6A 3ST7A 4R9SA 1XDSA 5EN4A 3BOQA 2ZB7A 4N9HA 2FZEA 2CZCA 4YFXF 3ZWMA 3GG2A 2HAEA 3CUQB 3KYCB 4CM8A 1AWCA 5IF3A 3KXDA 5C5IA 1Z7UA 4K26A 3DBVO 4JQCA 4YQYA 3V1TC 3WFIA 3U49A 1CF2O 1GDHA 1KBZA 3DQPA 3U5TA 3LYLA 5IZCA 1DFHA 1FBQA 1YE3A 4IQGA 1MXFA 1O94A 4UVAA 1EUZA 2F5DA 3AFMA 1HLPA 3DBLB 5GY7A 5I8ZA 3VVCA 1BW9A 5DCMB 1PZFA 3KP5A 2QQBA 3CO7C 2L54A 1R15A 4Y6RA 3HOTA 4YJFA 1FWZA 4YFKF 1ZNQO 4MVJA 1LDDA 1DJQA 1F17A 2M30A 4NFSA 5E1ZB 1ODDA 4UVCA 3MZ0A 2DAPA 2HTJA 1JA9A 4YJHA 4PVCA 3DEYX 1YS4A 1U5AA 4UVHA 4CLOA 2GIVA 4BNYA 4RGUA 5H6RA 5F1RA 1BM9A 2E37A 1FX7A 2HK8A 2HRZA 1O95A 1X0VA 1ISIA 2J8ZA 1B9MA 5H81A 3CDHA 3EMKA 5KJEA 3NRCA 3AW9A 1IZ9A 5CJ9A 3FR8A 3P9KA 2VNSA 4YIIA 4N0BA 3W8EA 4EJ6A 5THQA 4YCAA 2VN8A 4OMZA 1BWSA 1BN5A 3HSRA 1NHGA 2DVMA 4AJKA 1F1ZA 1ENZA 5IJZA 2FEZA 1P33A 3NDJA 1I3NA 1W5SA 2HWVA 1JTVA 4U7BA 2Y99A 5I7EA 3W6ZA 1YTYA 2TDXA 4L75A 4WPGA 3WGIA 3K2ZA 2OP1A 3H2SA 4KNYA 2HSDA 2Q4EA 4FS3A 4GKBA 1ZK4A 3OA2A 2O3RA 4WX9A 1M6WA 3OBBA 3JW4A 3E5MA 4XZ3A 4E12A 1DIBA 3KLNA 2JRTA 4N9IA 1SEVA 1VSVA 1WW8A 4RL6A 4L4SA 3MTJA 2GO1A 5TT1A 1HZZA 4HLXA 1USSA 3BTOA 3M1AA 2G5CA 3PJFA 1YIOA 1ZRDA 1SFUA 1SFEA 3WU1B 1HL3A 3ML6A 2UV8A 3B6ZA 2JAPA 4IDEA 3V8BA 4Z3KA 4GBJA 1XGKA 1XSDA 3GVCA 1B0AA 1JVBA 3GF4A 3RCBA 1YS7A 1P0CA 3K0LA 3CE6A 4XIYA 4RAZA 1A7AA 2YDYA 1D7OA 4NJMA 4YAEA 2OMEA 5EERA 4BL5A 4I0AA 1P2FA 2OGUA 3D3WA 1XU7A 4BIIA 4E3ZA 2H63A 1SD5A 1BI2A 1YQDA 1IOLA 4IIUA 1HXDA 1LDBA 1GZ6A 2NTVA 3JD0A 4B3HA 5JDCA 1YDEA 5TNXA 2IZZA 3PIIA 1JGSA 5BMZA 1YJQA 3GZNB 5TRTA 5JBIA 1ZXBA 5IFLA 2EIHA 1R4NB 2V6FA 5JXWA 2C07A 3L09A 2RC4A 3VPXA 4J1NA 4L9TA 4MNUA 4A0SA 2FBHA 4B8ZA 1LVAA 2F5EA 1VL6A 3JQ7B 4I5DA 3DV8A 3WJAA 4C4OA 2G7UA 2HYGD 2DFDA 3Q0EA 3ANNA 4CLHA 2AEFA 3GMSA 4ALIA 2O0YA 2EGGA 1TW2A 3I6IA 3B1KA 3D7LA 3ISPA 2NU7A 3VZPA 3GVXA 1FP1D 2VRBA 5ER6A 4BO6A 1ADGA 3ITKA 2QHXA 2AQKA 5EPOA 1YG2A 3HTUA 2HYFA 1STZA 1KETA 1LTHR 3C7AA 3GG9A 4IPTA 4DQUA 1ZGJA 4KUGA 4FJ0A 3JSPA 1V3TA 1KU9A 2HTSA 3IDSA 4CR6A 3BDDA 2Z33A 4WK6A 2BELA 5IT3A 4AIJA 2YJZA 5A04A 2I76A 3HUDA 4CUKA 2B69A 4ENKA 1D1SA 2IXBA 5EEHA 2X4GA 3NEPX 3CMMA 2G1UA 3FXRA 1PL7A 4FN4A 3PIDA 5LGTA 4EITA 1LA2A 4RGXA 1UB9A 1N9GA 4WLUA 2D5AA 4AJHA 1ZUD1 5A06A 2GQQA 3U1DA 2KKOA 4EJVA 1WSUA 1Z74A 4OO3A 4B7XA 5COAA 4Y15A 3RJ9A 3QIVA 5KJ6A 2R00C 3GFMA 4OINF 1LJ8A 1LEBA 4AG3A 2VODA 5C3MA 5BSGA 5L40A 2WWYA 3GO5A 3GPDG 4R54A 3UHAA 4Z9YA 3ZN2A 5A9SA 3GR6A 5LRRA 5L4LA 3SZTA 5JR3A 1F5TA 4LMRA 4NFHA 2E6UX 6ADHA 1KEWA 4G81A 2OAZA 1YBVA 1KC1A 2DUUA 4EYEA 1H94A 1D5VA 1Y8QB 4R69A 4JBAA 5CDYA 3DMYA 3MZYA 4M6XA 1TI7A 2WYUA 2EFPA 4B8XA 4CL8A 4RPJA 1V6AA 3DL2A 3DDNA 3LC1O 1KVTA 5KWEA 1O6ZA 2X22A 4BGUA 2UZKA 4E2WA 3RC9A 2FPPA 4TVOA 5EQFA 3DFGA 2IYPA 1H9GA 4YJHB 1SMKA 1B16A 2GASA 4G6DA 3SHFA 1XGMA 2EJRA 1Q0HA 2X7HA 3KHUA 3LLSA 3QWAA 4HY3A 4NG5A 5HRUA 2Q8KA 2AQIA 5JYEA 1BI3A 3OQ6A 2F1KA 5U1PA 2E4AA 3UCEA 3L6DA 2EKPA 3T8RA 3UF0A 1I6XA 1KYZA 2XASA 5K5OA 4RB2C 2GZ1A 3TDZC 3WDSA 1ZRCA 1DJNA 2P5KA 2CUKA 5HVQC 2IT0A 3RUHA 4A6EA 5L51A 4CMCA 1WPQA 2JFGA 2VHZA 4IS2A 4LG0B 1AGNA 2I66A 4U0KA 3IWFA 1ID1A 4GX5A 1JKIA 3VH4A 1VJ0A 2AS5F 2VONA 3DOJA 3S1LA 1F9NA 2BGLA 3MEXA 3B70A 1EVJA 3MWEB 4PIVA 4Y6PA 5EMHA 5FFZA 3IKTA 4RVUA 1AHHA 3ZU2A 4M9XA 3HHGA 4N54A 1GUYA 3BJOA 2C5EA 4EBFA 5AOVA 1ONNA 2DK8A 1C1XB 4Y9DA 5DBFA 3RJ5A 3WTBA 4J91A 2Q2EA 3W6JB 2BGMA 5K9ZA 4Q5SF 3UCXA 3V2UA 2VUSA 2OZPA 3WTXC 4D0SA 3DZJA 3Q9NA 2YX4A 3MWMA 1J75A 3DAPA 4MVJD 1BDMA 5HLGA 1NQ5A 1KQ9A 3WG9A 3P2OA 2W2KA 3WS7A 3AI1A 1G3WA 1MGOA 5DP2A 2O61A 4GGOA 4BNUA 5DYMA 5T8KC 1BGVA 2O48X 2ESNA 1X7HA 1SCUA 4LLLA 4MKRA 1P4AA 2CVQA 2EWMA 5LBQA 4KIGA 2B36A 3HWRA 5JAQA 1K78B 4EEZA 1ZG1A 1HBXG 2P6SA 1NQOA 1VKNA 2IPQX 2VHWA 3OM9A 2IJLA 4L76A 3A9WA 2BMAA 4QECA 5JDIA 5D5VB 4NU6A 3D3WB 1LDYA 1MFZA 2GGSA 4XGKA 2PTGA 3I9JA 3I64A 4BO2A 2Y66A 1ISJA 1IE3A 2VYVA 4L18B 2G82A 4MVJP 3OJOA 1UCRA 1SAXA 1ZN2A 2RCYA 2F00A 5ENDA 4M8SA 3PQEA 3M8FA 1T2AA 1C14A 1YGYA 2IA0A 3C85A 5B4UA 4WECA 4WUVA 3ZW8A 2ZTMA 3SEFA 2C2XA 5LHHA 2PGLA 1IZ1A 4I98B 3F21A 2QBYA 1FYLA 5K6AA 2PBIA 3RPQA 3TOBA 1DC4A 3H3ZA 3I59A 3DZIA 1XELA 3N74A 1TVEA 1E3IA 4QTZA 3KB6A 5HDKA 2DI3A 5ILUA 1ONPA 2X8LA 2P91A 4ZGWA 1QNTA 2JKVA 2YHIA 3JQFA 3MWDB 2RKHA 4A6DA 1KEVA 1KVUA 4GGPA 3L6EA 1G1AA 5FD5A 2W25A 4IQ8A 2XRNA 2Q2WA 1MG5A 3QQPA 2FR0A 2YSRA 1R0LA 1WI9A 3HDJA 4A03A 4HX4A 4CV2A 1V4RA 2EXXA 3DAFA 2HZTA 1TT7A 4PLHA 2MC3A 4X54A 5LGUA 4G8XA 4H3VA 1T4BA 4KZPA 2DUWA 3BJ6A 3E9NA 3J81Z 1SAYA 4UEKA 4NMHA 1DHRA 1EVIA 1UHMA 1YQAA 2V6MA 3M2PA 5TSDA 1N9GB 4XQGA 3ZP5A 1JWAB 1GADO 1UDCA 1FDVA 2NQTA 4CMKA 2UWMA 1TXGA 4OMYA 2FOIA 1VLLA 4IDAA 4QO8A 4D3SA 2O2SA 4DA9A 2M45A 3PFWO 2HK9A 4ZH4F 2M8EA 3H9EO 5DCUA 2ILTA 1CJCA 4P9FA 1TNSA 1E77A 4I08A 4Y67A 2ZFWA 5FWNA 2RBEA 2W2LD 4MDHA 2ZB3A 5B12A 2YV3A 4ZYGA 1B3RA 5T57A 3ROKA 3WYEA 3R61A 1D8KA 4H0EA 1E3WB 4ALJA 4IPAA 1WDKA 2OQGA 1EK5A 1HSZA 2X23A 5EINA 5KVQA 3JAMZ 1X7DA 3D4OA 4DUPA 4MKXA 4R3WA 3I9MA 3NKLA 2QENA 2YR2A 3DOOA 1T2FA 2O3UA 2WE7A 3QAHA 3PLNA 4U0VA 1IZ0A 2ZYDA 3MJCA 2GDZA 1NWCA 1Q1NA 5IZ4A 3TRIA 4A0XA 1ZVMA 5JAIA 2JPCA 4P96A 1J7KA 2DPGA 2EG9A 5KJCA 1YW8A 4DWVA 4PGGA 1HETA 2YUTA 1CETA 2DPUA 2Q2VA 2DU8A 5JMPA 2VTEA 2OA4A 3F1LA 1JKJA 4HNHA 4HXYA 1B9NA 3JQGA 3E6MA 4FIZA 4IJUA 3ZU5A 2FE3A 2W84A 4Q3AA 3QVTA 5DNAA 4ON0A 2QQAA 1XQ1A 4BNGA 2HKIA 3ZQ7A 4DIBA 3ZCXA 5B4VA 1JW9B 4TMFA 1MUUA 4PG6A 4BGVA 3I54A 4QSMA 1Z82A 5HS4A 1EDOA 4CHUA 3MEQA 4KP7A 4CXFA 2CO5A 1HKSA 3P5SA 3OF2A 1RM0A 3RKXA 4OYRA 5ILVA 1KY4A 1MFPA 3ITDA 4CL3A 2H1SA 4P22A 4IZHA 4MVJH 3M1LA 4LSMA 5IG2A 2R7FA 4HF2A 4YRBA 1ZHFA 3E48A 1UXIA 1TQMA 4XRGA 2H9IA 2Y68A 3F9IA 3H9QA 5AIPA 1N8KA 3K8ZA 1EMDA 2Q50A 4BS9A 5KVSA 1K6JA 2HMUA 3RFXA 3H6KA 5E1WA 3FPLA 4NZ9A 3UVEA 3GH3A 3SZPA 1BC8C 3FSRA 4JP3A 2FBIA 3I4PA 1UDAA 4CR7A 1UFMA 1DIHA 4PCQA 4MVJG 4NFYA 1R5HA 4PG7A 4M54A 1PJTA 4RDIA 2ZIZA 4MTDA 1UH5A 3FF4A 4IDFA 4ZVVA 4YB8A 2ADUA 4W9NA 1DO8A 1ZIDA 1CDOA 3VKVA 1DC6A 3F72A 1EZ4A 1MA0A 3G3ZA 1Q7GA 2ZB4A 4JJIA 2AG8A 3SVTA 2Z3YA 2CFXA 1PP8F 2WD7A 1GPJA 3R0IA 1JLLA 4Q3BA 1FF9A 2ZCWA 2VWPA 1HKTA 4I02A 5AXDA 1AOYA 2LDUA 3QPTA 3B1FA 3C1AA 4URFA 3TZKA 1W7PA 2OZ6A 3CUKA 1FDWA 2GYYA 2QRKA 3PGXA 3WXBA 4A10A 4B4UA 4YAKA 4I7HA 2CQKA 4BQAA 4XQCA 3W8DA 3ZWCA 1C3VA 2HUNA 3DHNA 2BHLA 5KCZA 3L4SO 4YEDA 3ZH2A 2V1XA 2L4AA 4I01A 4TZKA 1QZYA 3GUYA 3ONFA 1FDUA 4BNCA 2AXQA 3QWBA 1IN7A 4J4BA 3WYBA 4CQLA 3K69A 2ZJ0A 1YOVA 3QWIA 4JROA 2DQLA 3HRSA 5F5LA 2RHRA 4IZIA 3QP9A 1H6CA 4J1TA 3CO6C 3HNPA 4C7KA 4BV8A 1R58A 2Y93A 3OJ0A 1IYZA 4J90A 1HWYA 1YRLA 2GCGA 5DOVA 2J5PA 2OHXA 3QVOA 2Y1CA 2A35A 2XPCA 3PEFA 1P1HA 2P6TA 3INRA 4BKPA 4CMJA 4RVDA 4RO0A 1LX6A 1U3WA 2P8TA 3IP1A 4WE3A 1QP8A 3QRFF 3M6IA 1QSGA 1FPQA 3BZ6A 4BV9A 1NQTA 4E0BA 2QX7A 1LDMA 2EP5A 2AHRA 4Q9NA 2DTEA 3ABIA 1R66A 1SPXA 1L7EA 3AJRA 4N18A 3UXYA 2EB7A 1OOEA 3ECOA 1PJQA 3RUDA 5K1YA 3SQNA 1FBUA 3J80Z 3IRQA 3TOXA 3CPSA 3GA0A 4OJNA 2GZWA 1I2BA 4WXCA 1NVGA 4RPGA 5JCXA 4IHTA 1S7OA 2BH9A 2Z5LA 5A4DA 5L7WA 1KVQA 4U7WA 2GA1A 1UXGA 2CFCA 4CMEA 3I71A 4RB0A 1E7WA 1TLTA 1YH3A 1VM6A 2JL1A 4UVGA 3EW7A 4UAGA 2QWWA 5BR7A 3Q9VA 5IT9Z 3BHIA 2JPBA 5J6XA 1DC3A 3E1KA 4CLDA 5A9TA 2EFQA 1FXSA 2VRCD 3TL3A 4KIBA 4II3A 4E32A 3NDRA 4S04A 1ARZA 2Y0CA 4IJWA 1CERA 4CLRB 4I9HA 1F0YA 5LEKA 4S1VA 5IN5A 4EJUA 2MH9A 3DMTA 3P2YA 5ILSA 2DPDA 2J3JA 2LSOA 2VOEA 3BMQA 2TMDA 2HDCA 3GZ6A 2IRFG 5DULA 3VZRA 1YB4A 5B4TA 2B83A 1ENOA 2NM0A 5J23A 1MDMB 4IRIA 1NX6A 1W4ZA 5EIOA 5B37A 4CMHA 4XIJA 5CDUA 3QVXA 3GFGA 1KU2A 5A03A 3NV9A 3QLJA 4UUVA 3GW2A 3SBOA 1XCVA 1NTOA 4TKLA 1V3UA 3GLXA 3KFWX 3WTVC 4I5FA 3EUHA 1P3DA 4RF3A 3NEUA 3WIDA 1R37A 3UH1A 4IM7A 1U5TA 5D8KB 4IMRA 3WTZA 5LGNA 3FMQA 1I1GA 3E82A 4NB5A 3PQDA 3PP8A 4FW8A 4H15A 5L4SA 4B3IA 3RYRA 5H6QA 2YYYA 2VYND 4HOBA 4A0YA 3A06A 1RM3A 3LQRA 2EK5A 2WC2A 2OUIA 4ZYHA 2JD2A 3PRJA 4GAEA 4TRRA 3C3WA 4PVDA 4KMFA 2CY0A 2P68A 1Q1HA 1BC7C 3WGTA 2HQ1A 2CD9A 1YL6A 1ZZEA 4EJWA 3PQKA 3CUOA 4YDRA 4D3FA 3FM5A 3KYDB 4XJSA 2EA4A 3HDYA 1EVYA 4ZN6A 3J81K 2CNBA 1ULUA 4DBVO 3DHEA 4ALMA 2M5WA 2GZ3A 2P4QA 4PLPA 4Y8VA 3PPIA 1TLHB 2GWRA 4G6QA 3ZMTA 1DXYA 3W1VA 2FR8A 4HYEA 3CEAA 1DAOA 1JAXA 2V1UA 3Q9UA 3H3FA 1Y81A 2IODA 3H65A 4DRYA 6PAXA 1EQUA 3DBRB 4OXKA 4CM1A 1D4FA 1F14A 2A9FA 4BO9A 4YT8A 4GVXA 1P4XA 5ENVA 3VH3A 1X1TA 1L0OC 4GMFA 1EVZA 1PZEA 2X5OA 3WSWA 5HA5A 4ALKA 3L6OO 3BHJA 1PZGA 1BVUA 1ONOA 2B37A 3JAMK 1J59A 2DLDA 2WWRA 3PDJA 5C7IO 2NACA 2NLOA 2Q45A 5G0TA 1P1IA 2GUGA 4H7PA 3GC6A 5JYDA 1ZGAA 4FD3A 4U6SA 5LLQA 4BO7A 1HE3A 1W7PB 4BNVA 3E9QA 2HS5A 2OO5A 4TRJA 3GHYA 3JQ9C 5L3ZA 4AL4A 2OBPA 3GZ4A 1S6LA 2Q49A 3EY4A 5G0SA 1RKXA 3EVNA 1LNQA 3Q6IA 3GGGA 3CIFA 4ZHSA 3UCFA 5ICCA 4R51A 5TJ9A 3ON5A 1GHCA 5I7VA 4J4HA 4ESBA 5K5QA 1ZJYA 2KJCA 1RUNA 1P44A 2QZZA 2GSDA 3FI9A 4ITUA 1GEGA 4P8RA 4MTEA 1W4MA 1UXHA 3I4FA 4FPXA 4EJMA 1V9LA 4WLNA 4D44A 4L9RA 4U6QA 1O3TA 4R1SA 4WF2A 3CSDA 4TZTA 4GVLA 4BO5A 5LDGA 3EQLF 1KEUA 3D0OA 3KP7A 3EK2A 1ZYRF 3LAJA 4OIQF 1YYVA 5KVRA 1DOHA 3DO5A 3K6JA 4IGFA 4A5NA 2EW2A 2VC1A 4R41A 4CMIB 2D59A 4D0RA 2A6HF 3C1OA 2UDPA 1LNWA 2ZMEB 1PGQA 2Z9OA 1HKQA 3O6BB 5L3BA 4JJFA 3OETA 4NBVA 2CF6A 3V8LA 2BKAA 1I01A 3LSYA 2JZYA 4JBGA 2B0JA 3O8QA 1IHXA 4FFNA 4MP8A 3HSKA 1IF1A 3AOGA 4GKVA 1W7PD 1XWFA 2ISZA 4FQ8A 2DAOA 2WM3A 4XGNA 1DIGA 4P4LA 4GMGA 4O3MA 1O89A 4J2OA 5TIIA 4CR8A 2CG4A 4EGZA 3ANLA 3ENNA 1FSHA 2F2EA 2B5VA 4CJXA 1L3LA 1DP7P 4KUMA 3RSHA 1SD6A 3NYWA 1PJSA 3DONA 4RGBA 2EHDA 3VPFA 4KA4A 5L9AA 1XEAA 2VUTA 3K9QO 2DBQA 4A5OA 5A02A 2OZUA 5BQTA 3RJPA 4IQ0A 4UVEA 3TN7A 3CZMA 3L07A 4P5OA 2HFHA 5BQFA 2NU6A 2IE0A 4RB1A 5JHUA 2VBWA 1H93A 3T4EA 1R16A 3ZDFA 2XAAA 2YQ5A 1BRMA 2OD5A 3JQBA 1F12A 3EDMA 4JBHA 3REOA 4OKNA 4YTEA 3T7EA 3PLRA 3T0YA 1Z7EA 1O3RA 3KSUA 3RC1A 1IPEA 3DXFA 3KP6A 1C0KA 1WNTA 2W85A 3AUAA 3F3SA 2Y0MA 5K0ZA 2X5JO 4EGYA 1LLCA 5EL0A 3W4IA 4M9SA 2OBYA 5CVRA 1E7SA 4BHTA 3QY9A 1RM4A 4LRTB 3WGHA 3ZMZA 3WR5A 1T6SA 2G0TA 4E13A 3ZMUA 1VC2A 1E0DA 4WNIA 1GAEO 4E30A 4ZQHA 3V5NA 3ZMDA 4WJZA 4AJIA 1O3QA 2IRWA 3GNTA 3C1TA 1RYEA 1QR6A 3GVHA 3N4MA 4QT0A 3V2HA 5IZCC 1ADCA 1BXZA 3H5AA 1HDRA 3WTCA 5JC8A 4AJJA 4HV5A 4MP3A 1SOVA 3RROA 3TGNA 2YQ4A 1ZCJA 1NHWA 4YJGA 3CH6A 3KTDA 2A6EF 1B14A 2R2GA 3RKUA 1KYQA 2LDBA 1E1NA 2X58A 4U0JA 3DOCA 1W0CA 2CSUA 4FGWA 1I27A 2OFPA 4QWQA 4PLGA 4EJOA 4R5MA 5H82A 4E5MA 5ITVA 1ZW1A 2VTDA 4GX1A 1X15A 3W4KA 3J80K 3Q1LA 4WNCA 5JCJD 4HX7A 5TJHA 2NVUB 1U28A 3VH2A 4G7ZF 4GYIA 1S6YA 2ZCUA 3ZV6A 5U9CA 4NBRA 4BNJA 3X2FA 1E92A 2ZXJA 5HLHA 3KZVA 2QLZA 4FOSA 4L0YB 3F8FA 1RUOA 1T98A 3KM0A 1ZJZA 1RZ4A 3IWZA 1EV7A 1VI2A 5LC1A 1XMAA 3MJTA 3RUEA 1CGPA 1P1RA 4L8VA 3FTPA 1NVTA 5EEGA 5JI6A 3JQAA 4IVNA 2FOKA 4MIOA 2D45A 2GZ2A 4M6YA 2QZ8A 3EZYA 2F5FA 2EGHA 3K73O 2O3QA 2VCYA 5LHIA 3A14A 4WLOA 2HJSA 2Y0DA 1DUXC 2X9VA 3ZWOA 4BNXA 1QYWA 4J9VA 3ROPA 4GXOA 5L4NA 4MVJE 3RFVA 1BI1A 3HUGA 1WMAA 2PQ8A 3F4LA 2ZCVA 1SMYF 2XAGA 4PG8A 2Z95A 3VODA 1Q7BA 2YFHA 3KLMX 3WGOA 1QGPA 2XV4S 5G4KA 4O5OA 1N7HA 3B1JA 1U3TA 1NR7A 2Y1DA 4RORA 4A26A 1UXJA 1XSEA 2P9EA 3U09A 1EE9A 3VOSA 2Z5UA 4B3JA 2IZ0A 3KE2A 4YBZA 5GZ1A 2UVDA 4AWXB 3EHEA 5CVUA 2ZNYA 2L3DA 3R3SA 1P6RA 3SXYA 1Z6ZA 4QXMA 4ZD6A 4KYWA 2A3SA 1VSUA 4IBOA 1F8FA 4RDHA 5CG1A 3QJ5A 4I8XA 1B4AA 1ZG3A 3RVDA 2LF8A 4FCCA 4W99A 2A5YB 2GERA 4MEYF 1WVGA 3ZWWA 3L00A 2QZ9A 3L4BA 4JIGA 4RPLA 5JDCC 5IXYA 4MHGA 2EKLA 3LWFA 1WQ2A 4RQUA 3ZWPA 4WCDA 2PD3A 2QYSA 4ETSA 2XOXA 3GGOA 1GEEA 3P9CA 1FP2A 4PRLA 4BHPA 1R0SA 4ZRNA 1YJ8A 3LA7A 5AONA 1SZJG 2JJYA 3JQ8B 2C0CA 1YB5A 4M49A 5GMOA 2RHCA 1WWKA 3HE3A 3KP4A 2EV6A 4UHTA 5DV5A 3V4GA 3SJUA 3LA2A 4GCVA 4OXYA 2JT1A 4IJVA 3JD2A 4LISA 5ADHA 3PHGA 4J9UE 4N7RA 3GX4X 3F6YA 3PWSA 3LF2A 4R16A 4R9RA 3DKWA 2H09A 4KDPA 3WIEA 3ZWBA 3OOPA 3HRUA 1ISFA 3JV7A 3WNQA 3R60A 3OEWA 1DRUA 1V0JA 3H5NA 4PGFA 5ILGA 2PEXA 5ED4A 4XJTA 4EJ0A 2J5OA 2IDZA 4QUKA 2DK5A 3PQFA 1Y7TA 2UUPA 4Z9FA 1QZZA 4O1MA 4CM8B 2FMUA 1KIFA 4A2UA 2XXJA 5AXCA 2C2YA 4Q47A 3W6UA 3RI3A 3PQJA 1BI0A 3AU8A 1OR7A 3I83A 2BRUA 1PL6A 1PR3A 3EYWA 1CF7A 2EJVA 4ID9A 2BFMA 1HZJA 2Q1WA 1A4UA 3MOIA 1ZAOA 4YXFA 1KERA 5ICGA 3BZUA 3O38A 2XGXA 2AE2A 4K1LA 4KQWA 3HSFA 1BW9B 5JPIA 4YJFB 3I4CA 1M76A 1HDOA 3GFLA 1SB8A 1X3UA 4P4GA 5JW6A 1K79A 1B59A 3ROQA 3TO7A 3RDIA 2XAHA 4PLFA 3T7CA 4XB2A 2X86A 5AQ1A 3PJDA 4CLOB 3T4XA 2NNNA 4WXHA 1TBXA 1DRVA 1YKFA 3G3EA 3P7NA 4J43A 2EF1A 5BNTA 2EJWA 1P1FA 4Q3EA 2ZK7A 5F21A 5E1XA 3VEPA 3F1KA 3DBHA 4RQTA 3TZCA 3UAGA 3ZHZA 5CDGA 5JC1A 5CG2A 4JCOA 3WQRA 4EUEA 3G49A 3GPIA 4CZZA 3JYPA 2I5PO 1I24A 1LBEA 3GEZA 2H6EA 2V7PA 1U9JA 1PGJA 5FO5A 3JQDA 3IRRA 4IIVA 4I09A 5HS9A 3ZMSA 2PGDA 2WMDA 3GN1A 3S8MA 1M67A 3VTZA 3E5XA 1KEPA 1RJWA 2GN9A 1S7AA 4IF4A 3E6CC 1U8FO 1D3YA 1DPUA 3KEOA 5CHEA 3M8EA 1H5QA 3KBOA 1KU3A 1QYDA 2F5CA 1B6AA 3BMOA 3K30A 1H0KA 4ESFA 3GF2A 4LB6B 1CQJA 1DFIA 3EYYA 1TB4A 4N5LA 4XCVA 4G9YA 3ZWAA 2X0RA 2ZKLA 3GDOA 3KCCA 4WLEA 4FBGA 2AMFA 5T6BA 1NYTA 1H0MA 2EFOA 5CYVA 5TT0A 3WYCA 4EW6A 2COMA 1J4AA 2AEJA 1Q2XA 2VZ8A 1VPDA 1AE1A 3TJRA 3RWBA 1G6NA 1FNNA 3BXXA 5KKAA 4O6JA 2YHUA 3DZKA 4GWGA 5DF1A 2HMSA 3R0JA 2PJPA 4GL4A 1DEHA 4XB1A 5EJ2A 3ROUA 2XAJA 3E6DA 3VTFA 4LCEA 3VPHA 5I9NA 4BVAA 2RVCA 4IHSA 2QVOA 1E1LA 3KSZO 4Z9XA 4PFJA 2D1YA 4NJMB 3TZ6A 4BNNA 4RLHA 4HAMA 3C24A 4DPLA 4G7OF 4NBUA 2WJPA 4MEXF 1UP6A 2UUOA 3Q11A 2ET6A 1JKFA 2STTA 1CYDA 1T24A 2NU9A 2Q3EA 3VZQA 4CM9A 5B1YA 5KKCA 1JQBA 3ZV4A 3LU1A 5E20A 5F6FA 5DCYA 5JO0A 4YPOA 3VAZA 1J49A 4BKQA 2O3SA 3P7MA 1R23A 2V9VA 1SBYA 3FZVA 1YO5C 1R5GA 3C18A 4BAYA 1DPGA 3EGOA 3B73A 5ICSA 1V3FA 5JDIC 1I3LA 5T64A 2X0NA 5BPDA 4NHJA 3QV1A 4BMNA 1X14A 1DPRA 1GCUA 3TZQA 1NAIA 4YG2F 2FF4A 4FC7A 4DLLA 4O6VA 1A27A 1ZSYA 4AJPA 4ESOA 3IC7A 3ADPA 1B8PA 4AJEA 1JAYA 1HW2A 4L5IA 3OECA 1C1DA 3WX0A 2V6GA 3RPUA 4BHBA 5BNFA 3H8VA 4Q3DA 3VZSA 3S2EA 3GOHA 3HADA 5K6AC 5KJ1A 1GL3A 2MD5A 3FHZA 1B8VA 4XQ9A 2QUFA 4DYVA 5F64A 5DDGA 2BI7A 5JFRA 3HDHA 3WMWA 4HFMA 2M1BA 4MIYA 2BF7A 3V7RA 1IY8A 4MINA 4PGHA 5D5WB 2EW8A 3JQFC 1SOWA 3C1DA 3OQ1A 4MKZA 2VT3A 4Y13A 4XYBA 3RIHA 4D45A 4UNOA 2Q1TA 2M87A 4UXNA 3T1BA 1A4IA 1ISMA 2BFPA 1MJAA 2O6GE 3PK0A 4AVYA 4KT5C 2D0IA 5ES3A 4AJ1A 1O9BA 3KV3O 4ZQGA 3IL2A 3CLOA 1Z6RA 1FYMA 1NFFA 2EV9A 1QYCA 2W8ZA 3R1IA 1RIOH 3QWHA 1WAMA 5A9SB 1G3YA 4KN4X 1R1VA 4HFRA 2R3SA 1HDCA 4CODB 1CF7B 4EUHA 2VBZA 3HHHA 1JWBB 4CV3A 2DW4A 4U88A 1YO6A 2I3AA 1GQQA 3BYZA 4IUYA 3ZNOA 3HDQA 2QQ5A 4BKOA 1QBJA 5F1KA 1KS9A 3F23A 2NS0A 4BKRA 4R4JA 2KRFA 1EBUA 3TFOA 5F1OA 3FPCA 2VXZA 5DUKA 2RNJA 5LEJA 3G0OA 2VOPA 4J7CA 3S2IA 1Z1DA 3TQHA 4DLBA 2J3HA 3F8CA 1YFHA 2X0JA 3BMNA 4BO0A 1TEHA 4HFJA 4KDEA 1UZMA 2PK3A 3KETA 1VL8A 4A73A 1NAHA 3PXXA 1REPC 1G3SA 3H7AA 4HFNA 2QIOA 3KYBA 4HP8A 3QPHA 1AXEA 1ZLJA 3QE3A 3U62A 3AM3A 3BMCA 2XROA 5CAEA 5LCXA 2A61A 1YLFA 2UXXA 2P2SA 1LI4A 4HZFA 1QYXA 4CPDA 2P9GA 4I5GA 3BAZA 4R1TA 1E1KA 4R3NA 4YAJA 5T5QA 4KICA 3JYOA 1PR9A 4CMGA 3QHAA 1TW3A 4II2A 2NNYA 4TQGA 1RM5A 3DFUA 2C82A 3JD4A 4Z0PA 4Z6KA 1A9YA 1LSUA 3GNQA 2H5LA 4OKIA 4BNZA 1Y5RA 1PU2A 3OIFA 4JBIA 4DL9A 4PZDA 4WCFA 1XB4A 1BSVA 1VTNC 5AXBA 3WFJA 4GPD1 1WXDA 1T0FA 1K7AA 3H9GA 1MKMA 2DM6A 4FJ2A 1HE2A 2FZWA 3UN1A 1E7MA 5JS6A 3ABTA 2WYWA 3RU7A 2V79A 2W2KB 4DYDA 4M86A 3GZ5A 1QMGA 5IDWA 1KOLA 4TKMA 1LEAA 2FPGA 4OM8A 2PMUA 1GYPA 1PJBA 2QM3A 3VDQA 4AIHA 1GXQA 1ZBQA 4FC6A 1PGPA 3X2EA 4G94A 2GN8A 2Y1OA 3RKWA 2PMHA 2VT2A 1K3TA 2PA3A 3PZRA 1QV7A 2Y0EA 1ISGA 4ZQEA 4E2YA 4TSKA 4CO8A 4MGRA 5F5NA 2WD8A 2PGJA 3FNHA 3HRTA 4CM4A 2UYYA 1GUZA 4R1NA 4PLYA 4UVIA 4B4OA 5L3CA 4W7HA 2JHGA 5IDQA 1GYQA 4BO3A 3TPCA 4DTIA 4L5JA 5L3EA 1HRDA 1WZIA 2KIUA 2HKOA 4EQQA 2D3TA 2PWZA 3ICCA 3FD8A 3NRVA 1YONA 1L1FA 4HLYA 2GF2A 2CSOA 1ZK3A 4A7PA 3EYIA 2HOEA 4CV1A 1DIRA 1J6UA 1ENYA 4W9NC 1QLHA 2QBYB 2BI8A 1GPDG 3AWDA 2PD4A 2ZB8A 1A71A 1N1EA 3IIEA 3OFSA 4ND1A 1LDJA 3I59B 1TNTA 1P9LA 4IXAA 1I8TA 4D7AA 2C7GA 5U4QA 4RPHA 4KIFA 4QX6A 4XRFA 4W82A 3PWZA 4HX5A 1BIAA 3ZI0A 2QW8A 1C0IA 2YHIB 4WASA 4A12A 3L9XA 5JSFA 1NXQA 1HDGO 3DQVC 1H6BA 3DTTA 4K9DA 2CF5A 3GVAA 1GZ3A 3OSUA 1EUDA 1PGNA 4PLZA 1H2HA 1KQ8A 3M1EA 1Y8RA 1Y1PA 4FFMA 1H6AA 4CQMA 1I32A 1TQPA 4LJZF 1BXGA 2NVWA 3VH1A 2K7LA 5ICFA 5JAZA 2G9WA 4FB5A 1U4OA 2O3JA 3H3JA 3ZWYA 4BNFA 2QRJA 3GFIA 1BVRA 3F46A 3LVFO 1F4KA 4BKUA 1ULSA 3HSEA 1MP0A 2D5CA 1YS6A 5ICEA 2P9CA 1IUKA 3C7DB 2VYVD 4F6LA 5BSEA 3WQSB 1A9ZA 2GN4A 4HW0A 1YXMA 2AQ8A 1QKIA 1Z73A 1E2XA 4G2NA 3TO9A 5HBRA 4IDBA 2I6TA 1UR5A 3KP2A
chains in the Genus database with same CATH superfamily
4F1JA 1PLKA 2VAWA 2OOKA 4EECA 4ZYEA 1MAHA 4TGLA 3OS1A 3NTXA 4N6GA 1X38A 4V0KA 5IC5A 4X00A 3GVIA 2AJBA 3CNOA 2QZSA 4YUAA 3CF5F 2O8EB 4CCWA 3FSJX 1MJ5A 3G2MA 4I4TF 4CHGA 4ESVA 2OCDA 3G7UA 3N58A 3K4LA 4AP9A 4XTRA 3IOMA 4YRZA 4Y98A 1U6GA 4L8FA 5HM6A 2RK6A 1WQ4A 2AUMA 2XDWA 4PG5A 3NG1A 4NR0A 3QSGA 2YJGA 5I8PA 4D8VA 1YZLA 1TZCA 3U4MA 2W4SA 2XUQA 4E11A 3TJMA 4QFMA 5ALWA 4ZYZA 1I3MA 1CRWG 4N3BA 3VGPA 3OTOB 1HA8A 3EVFA 4KR0A 1QYVA 3FMRA 1VYTA 4KQMA 4XB6B 5IRCD 1KONA 4LY3A 1VPLA 2P4HX 3BFXA 1L4LA 1KI9A 5D2CA 5JNLA 2I4OA 2Z2ZA 1EP9A 1NA5A 1FRFS 3RDPA 5HQ3B 5ALVA 2EP7A 1F9EA 5E7IA 4M37A 5ETJA 3FCUB 4LGCA 4RFSA 1KEEA 2GCIA 1UL1X 2F9FA 2VO1A 1BEUB 2WIJA 1HT3A 2F6CA 1AHNA 2HU8A 1XZJA 2GLXA 4WV3A 2OCCH 1GUAA 4W63A 1GZUA 1VIMA 2ILVA 2XXAB 2L02A 4NHEA 4ANFA 3OYHA 3G6WA 4GM1A 2X9GA 1RVDA 2XQKA 1X70A 4UBJA 3OUUA 1EB9A 1FXUA 1SHTX 1QMPA 3OZCA 5C4GB 5EHIA 5FL7D 5CLHA 3BK7A 1XQ6A 2E19A 5JFTA 2AI2A 2L4MA 4ZJUA 2ZIGA 4LKOA 4MQ4A 2WJZB 1RWQA 2VQSA 3QOPA 3CR7A 3IEPA 2ZZNA 1Z12A 4PSCA 4DVJA 5F3WB 2Q3BA 4JI2B 1UBEA 2IXDA 3TNLA 1L5QA 2W6ID 1AZTA 2K27A 5FBHA 1TC3C 1JEOA 4LF4B 2VJMB 5AI0A 4MVJI 2J5KA 4AKEA 4DLVA 1R2QA 3AXSA 2H8GA 4E5NA 2AZTA 2XKAA 4L5CA 4EM0B 2I71A 3SP1A 2PZJA 1LBTA 2XNJA 4ESJA 1AA9A 1RRFA 4K6HA 3WLEA 4ETIA 2VT7A 1XPUA 3N6RA 3VDNB 2PKRA 3QU7A 2I8AA 1QG2A 1VLJA 2BY1A 3ZJUA 5LD2C 3N97A 1S5PA 2ZU6A 3H1GA 2MTBA 3K6SA 4EY6A 2A5FA 2IYNA 3LVBA 1QG6A 4YAOA 1IJBA 4US2R 1V3QE 4M21A 3E3OA 2VKQA 2R93J 3C6BA 1GU0A 1SKAA 2W2LA 3G9QA 4BNMA 4EEXA 2O9JA 3CRZA 4OI0A 3T5XA 4ESEA 3TMOA 3P0JA 5D5XB 3ZW9A 3G9UA 2KIMA 3HABA 2XRFA 1ZMRA 3R09A 3PD1A 4OHPA 1NIJA 1HDXA 5K09A 1JYEA 5A6SB 1ENPA 2HO5A 4NENA 4LDPA 3BH7A 1ZOIA 2DPMA 5AI8A 4BMDA 3I56I 3H9UA 4YRFA 3M6VA 3I0MA 5LOVB 1KDTA 1EP2B 1E3WA 1CHNA 1ZLYA 2O0JA 5K03A 5GM2A 1ABBA 2HGZA 2WFLB 3V8QA 1I6LA 1MNDA 1YW9A 2JJ7A 2ME0A 2CE7A 1GKYA 1HKHA 3U5ZB 5FB2A 2NSDA 4P54A 3KVYA 1FDSA 4V0ME 3ORFA 5E18F 1Q5PA 4WW0A 3H2BA 1NR5A 2PMZN 1QH8B 3F3XA 1JT0A 1MCZA 1UZLA 4H3SA 2UZ3A 4WOKA 2OCXA 3DZBA 2VJ4A 4Z3OA 3U2RA 1VA5A 4INZA 3R3XA 4YUVA 3CBQA 1JHYA 3L1UA 2UUBB 3D7RA 1Q1GA 2PX5A 4GKJB 1VFNA 3HV2A 2XT0A 1XZAA 2TECE 2WJ6A 4ZARA 2HDHA 3UJ3X 4A0ZA 4OJQA 3CD6I 4WKGA 4JP2A 3F6RA 2D4AA 1SZDA 3IBTA 3PDIA 5IN4A 2QM8A 2VRCA 1JEYA 3TQOA 5I9BA 1G8YA 3W77A 3MQFA 1G4DA 4U2DA 3RRNA 1K97A 2C9MA 1J8MF 5F2NA 4A2WA 5AP9A 5D6OA 3BS4A 2OL4A 4Q7LA 3AY6A 3EEIA 1XGNA 2QLLA 4JB3A 5ADHA 1M8FA 1TQ6A 1VHDA 1YZQA 4XYLA 4L15A 5L3RA 1CEXA 1YX3A 4POOA 4Y9RA 3A1VA 4ADSG 5F0CA 1U0EA 1U8XX 1DCTA 1ZSVA 2QI9C 1UC4B 2E2JJ 1DDOA 1QVRA 3K0FA 2O14A 3LC2O 2J31A 1H89C 5A4MS 3K5PA 5JRJA 2GN0A 2C3MA 2LGJA 4RWEA 4OH7A 4AVZA 2FAXA 3FNQA 3FPGA 3FBTA 3ZS9A 4ZDKA 3FWEA 3LNCA 4UTRA 1AKUA 4Z2YA 2K86A 2C7PA 1O4XA 5ICMA 4B3AA 2NOAA 1R0CA 3W5DA 4JYMA 3GFBA 1AF4A 1SY7A 4KRYA 3JWPA 3U3OA 3G1TA 3DU5A 1E61A 2LP0A 3CT6A 3M8KA 1GYRA 1JTEA 4B6FA 1FX0B 3B6AA 1E2FA 4PC7A 4MR8A 4RV9A 4JUAA 1K4SA 3D3EA 5CBPB 3NMUF 3VYVA 5LYJA 3E5RA 1RWBA 4GOXA 2H18A 4D42A 3KZIC 1H3FA 3PUWA 2WD9A 3B82A 2HHJA 3GLSA 2GNOA 1JB9A 3SEAA 2ZRIA 2PLAA 5G0VA 4Q7KA 4QLOA 4BDZA 4PGMA 1NI5A 5HRAA 4I2OA 3ZHVA 2QRNA 4CF3A 2AEMA 1BQ4A 4C6TB 3GZJA 2I62A 2KE5A 4Q1EA 1OWPA 3JALA 1R9TJ 4N5IX 1Y9AA 3E18A 3PWTA 3LQQA 4H77A 3KHSA 4JLDA 4P34A 2WV7A 3ETGA 3H9CA 2PA0A 2QTWB 1XX6A 1ZRSA 2RONA 2G76A 3UMRA 2JDIA 4B0OA 1A8HA 3C4VA 4PLWA 3PO2J 2J46A 4M8IA 1ORDA 3JQ9A 2D1HA 1JHOA 1XL0A 2GJAA 1T2KA 4RKYA 3WISA 5KREA 3H04A 3LF1A 4E4YA 5DHTA 2LY1A 4MI9A 1DUIA 1J42A 4ZAYA 1UXKA 5HP4A 4FYHA 3VR2D 4PN3A 2Q99A 4ILKA 1BHO1 3CDLA 1RQGA 4RGRA 4ZQCB 4BYGA 3LX5A 4JC4A 4UATA 1JU3A 3RD5A 4E70A 2R5YB 2I55A 1EQ2A 1BE8A 1ILEA 2H4WA 3O9ZA 3D31A 4LGMA 1BWRA 4PZ0A 4R9SA 1IQRA 4CM8A 1L4UA 1ETUA 3U49A 1GDHA 1O94A 4OXRA 2F5DA 3VVCA 3Q15C 3GAMA 1FWZA 4YFKF 4DNFA 2ZJPF 3LW7A 1T36A 3AFHA 1YS4A 4UVHA 3GEBA 1LVHA 4H27A 1UZAA 5BYBA 4LXTA 2PX0A 3R9WA 1O87A 5C4JJ 3RHFA 4LRWA 1ZYUA 1I50J 1A8IA 5KHLB 3DQZA 1Y9ZA 2A59A 5D7NA 5B55A 1WMFA 4YAFA 2ORWA 1CCWA 1UPXA 5FI3A 2Q4EA 4XE5A 2R8YA 2JRTA 1KI6B 1Q11A 1H4TA 3MTJA 1YFZA 3HYRA 5FULA 5CQGA 1YV9A 3B6ZA 4PFQA 1Y98A 4YAEA 1M1EB 2DR0A 1HZZC 5GONA 1YQDA 4Y2XA 1OWNA 4BRSA 1W96A 3OU2A 2ODBA 2V6FA 3ZIDA 1ORTA 2XQGA 4L9TA 5BV7A 1FU8A 3AP3A 2Y6UA 4DYCA 2HYGD 2M7AA 3E53A 5AVKA 4JMLA 4RA6A 1FP1D 3SQOA 3TO5A 3DEKA 5HNHA 3MD2A 4KUGA 3IDSA 5AH0A 4BMYA 5HKKA 1QQAA 2I76A 1O4WA 3I01M 1JG6A 2WKRA 1BE6A 2IXBA 5EJMA 2G1UA 1PL7A 2R66A 1EGMB 1M0SA 4MFEA 2KHZA 5J4YA 1ETYA 1ZD1A 4FCTA 3W79A 4HAVA 1RZUA 1RJ9B 4Z9YA 1X1BA 2E6UX 2X42A 2AR7A 4TS3A 3DE3X 4R69A 4PQFA 3LC1O 1KVTA 1TL7C 5EMJA 3VX3A 2H0AA 3SHFA 2X7HA 1W36B 2ZUTA 4G0UA 4OJMX 1DJNA 2WHPB 3AR8A 4U0KA 3QBDA 3S1LA 3MEXA 1R49A 4KE8A 4R1PA 5BUCA 2C4WA 1FOEB 4GL2A 5GGXA 2YX4A 1W5BA 4KFRA 3HCNA 4HDAA 3TW7A 2QQ0A 4KLCA 1CIPA 2ESNA 4UHEA 4EEZA 1Z6GA 2VHWA 4L76A 3D3WB 1S7GA 2GGSA 4PZYA 3KEYA 3HCRA 5K7ZA 1Y0BA 3DMHA 4RELA 2RGAA 4BLWA 1YGYA 4DIKA 5LHHA 1VE5A 5HMMA 4TVKA 4WACA 1N3YA 5DH9A 1T5OA 4O8CA 2X8LA 4ZOBA 1PW5A 3ZJTA 1Z26A 2Q9CA 2LP4Y 1WI9A 3L0YA 3KOZA 5JVDF 3DYVA 1T4BA 2D1SA 4KX5A 3BJ6A 1BKDR 3E9NA 5EWLA 3EXG1 5HOEA 2N8GA 2HK9A 2M8EA 5DCUA 4RLFA 3H17A 3KQYA 4DCNA 1KDPA 3ACBA 1WDKA 2OQGA 5FNVA 3DDUA 2PX6A 1B76A 2HGSA 1L5NA 5C44J 2GUWA 3SC2B 4EG8A 5KJCA 4KQGA 4DWVA 2DPUA 4IMJB 2ZDQA 4HXYA 2EYUA 5JJ5A 2HH9A 3NARA 5CA0F 1VP9A 3ZCXA 1HFWA 1OT3A 3SFIA 4ZJZA 1BHQ1 4TMFA 1JBKA 1G98A 1HKSA 3OF2A 4C07A 1BQEA 4NE9A 2YYAA 2WU8A 3RFXA 4JWTA 3FPLA 1V9CA 3IKLA 5C3EJ 2QRGA 4RDIA 2JWTA 2GBCA 4URZR 4D9KA 4JJIA 2ZB4A 2Z3YA 4RJKA 1GPJA 3MT0A 1CUAA 3F0CA 3C3CA 2GYYA 4ARAA 1JX6A 4C2AA 3DFKA 2HK6A 4TZKA 2IBSA 1E98A 3C7KA 4IZIA 2VNKA 5EZ5A 3RYIA 4B5LA 1LX6A 3PUVA 4MITA 5KAFC 3THXB 3FNIA 4X71A 3WL8A 1M73E 5EEAA 3LQ1A 4OJNA 2MJLA 1NVGA 1MW9X 4NBLA 5L7WA 4C4SA 3FSGA 2JPBA 1RHJA 4CLDA 3CLUC 3I92A 4EJUA 1QU3A 3K09C 2ZSKA 2GI4A 4O4JF 3VNRA 4YP0A 3SBOA 4KXNA 1Z4KA 3ZGZA 4I5FA 1X7WA 1Q1AA 2DFNA 1U5TA 4NAVA 3GGSA 3AB7A 4F21A 3E82A 3PP8A 4H15A 2DP4E 3LPMA 1PNTA 3PRJA 4ZYHA 1ZIOA 3C3WA 4PXAA 4KMFA 2P68A 4RIHA 2DA5A 4U4AA 3KE8A 5BNWA 1YB6A 1TZBA 2CNBA 3DHEA 3SNKA 4YLEA 5B64A 3JRBA 2VP9A 3CEAA 3X43A 1H66A 5EQTA 4DRYA 1UBCA 3OFND 4OXKA 1GJRA 4AMBA 2IBTA 2BGTA 1Q0UA 2NSHA 2X5OA 2AK3A 3PDJA 5C7IO 1Y42X 4Q00A 1UPCA 4GXTA 1A5SB 2H1WA 4U6SA 4C1BA 2A9OA 5C81A 4DIUA 1CD5A 1C30A 4B3DA 4H59A 1GL9B 3CG4A 4KW7A 1X7XB 1XTQA 4C2MJ 5DRTA 3EQ7A 4C89A 1W4MA 1RLJA 3Q7QA 3W0LB 2BY4A 3ZHRA 5JYBA 4Y2VA 2O9LA 4I55F 2H2WA 2VLBA 5FFNA 4RY2A 3O6BB 2ONYA 3DKYA 5F77A 2R7UA 3HJCA 1TJ4A 2LYCA 5TIIA 1VSTA 1P7CA 1XO1A 2F2EA 2QY6A 3LHIA 3Q3IA 1L5KA 3M9LA 1HMYA 3DONA 1JSRA 2DBQA 1AK1A 4RIIA 4FLEA 4WOCA 3AESA 4Q1AA 3ZOZA 1TX4B 3IIJA 2AMJA 3R3VA 2ST1A 3B38A 3EGIA 4BHTA 3GRFA 3ZMZA 5DHRA 2G0TA 4XD7A 1A95A 5EIAA 4GPAA 3PDHA 1JPNA 3EZ2A 2VK1A 4NPHA 3OPYB 2FFRA 2PZGA 4C4TA 3A6KA 1HDRA 4YXWA 1DQSA 1XAIA 3QM1A 3T7TA 2XB8A 3U7QB 1E1NA 1THZA 2EFJA 1G4HA 4GX1A 1AZLA 4DDUA 1AN0A 4R1MA 3LYUA 4PYKA 5AJVB 4GYIA 4BNJA 3LSJA 2QLZA 3SJMA 4OYYA 2EIXA 3RARA 3VTAA 4HZGA 4UCWA 3UFXB 3K73O 1F0PA 5LHIA 3JS5A 2Y0DA 5CW2A 4J9VA 3W6PA 4A8JB 2NAFA 3AJ8A 2DECA 3C70A 1U3TA 2Z2JA 4UTOA 1BDJA 1VIDA 2Z5UA 4KR7A 1V8FA 1XD9A 5EYRA 4UNPA 1GZDA 2EJCA 3R7FA 5G41A 2EKLA 2YWCA 1EQAA 1Z13A 1ZJ5A 1GEEA 1Y1LA 1AKYA 1WPXA 3U3JA 3GUZA 3HE3A 1M6VB 5DV5A 4PJNA 4RGQA 3Q3HA 3M49A 5D6NA 4TYQA 3OOPA 5T4HA 2C1EA 1FMVA 5ILGA 4EJ0A 3I4MJ 3BWDD 2C2YA 4X1OA 3PQJA 3QVJA 2QPLA 3AU8A 4IOAF 1E3MA 2EJVA 2JBHA 3KTAB 2ZANA 4OB8A 2V3VA 2DFFA 3C3PA 1SB8A 4B6GA 4O1IA 4P4GA 5HKLA 3GCXA 1YKFA 5JJKA 2AV6A 3SF8A 4LF9B 4JI4B 5JC1A 2D1FA 4H08A 3E9YA 4DMUB 1UBUS 3D54D 3V8EA 1BA3A 1Z6QA 3TSZA 5CHEA 4IF4A 1U8FO 1CQJA 3EYYA 1UMKA 3PNVA 1GAQA 3KQTA 2DOAA 1YQTA 3QW4B 2AMFA 4IL5A 1TQDA 4TXNA 4XB1A 1JT9A 3LI2A 4I1YA 4BNNA 3C43A 1UODA 1NDUA 4MEXF 1AKEA 4TWAA 1J49A 1PFYA 3A58B 4ZVMA 3WKCA 3X1MA 1E20A 2G9UA 1MN6A 2B4AA 4YIHA 1F4LA 3DM9B 3A6FA 1HFJA 2OKCA 3MJRA 4Q3DA 4H31A 1G8PA 3LP8A 3S2EA 5JAOA 2B9SA 1GL3A 4PQRA 5TV2A 4D0GA 4EHFA 1QIEA 2ZTHA 1NMEA 1KDRA 1L2TA 1MQAA 1UPAA 4IGIA 4Y13A 2YUIA 3STUA 2VJPA 1USWA 3Q87B 3OJWA 3LFTA 1AGXA 3GJ5A 3R1IA 1WAMA 3H75A 3UMMA 2DW4A 1N2CE 5BQ5A 4BY1J 4R4JA 4LQLA 3HSSA 3DDSA 1WXWA 4NLLA 2QN3A 3ND9A 3H7AA 2NZVG 4IW3B 4URUR 3C8UA 1ZLJA 3CISA 3CEPB 4G6ZA 4GU5A 1ABFA 1E1KA 4GW3A 5T5QA 1B72A 3N2KA 2M7BA 4YQFA 1Z88A 2ZQ5A 4KMOA 5TISC 5HGXA 5JARA 4RKFA 3ZDQA 3ABOB 3UIEA 1GYPA 5CYPA 5EG0A 4XWKA 1X1RA 3A31A 5EOVA 1Z21A 1Q3HA 1W52X 4DC9A 3UJ6A 1GV2A 3TPCA 1W9HA 1L1FA 3IHLA 3BL5A 4M7PA 4XK4A 4DGQA 3LXUX 2IIQA 3EPRA 1Z5VA 2DHCA 3TB6A 5AUOB 3ZI0A 2Y1WA 4WASA 4M1EA 1H6BA 3GVAA 1GZ3A 5AI4A 4MW4A 4FMBB 5EGSA 4J75A 5ICFA 4P0TA 3P9ZA 3K0SA 5BSEA 2PBZA 3WQSB 3W06A 3L0BA 1OXBB 1KU6A 5DHAA 2XUAA 2XPWA 4DQ0A 1L7BA 4CGZA 1NL3A 2R7DA 3PTZA 3F7MA 4MP6A 4NIMA 3RJTA 3S17J 4BY9E 2K02A 1XJQA 3MQ2A 1GTMA 4KQCA 4EMUA 2R7MA 1M6YA 2W4MA 4QZVA 2BBSA 3GZTB 4CU2A 4D9HA 4DNCA 4FOPA 4ZYVA 3ERED 3DVAB 4PBSA 2W22A 3EUHC 1NV8A 4WGFA 2Y05A 1KJ8A 2FP4A 4AWBA 3ZZNA 2Q6OA 1ND6A 3PHJA 5EJFA 4OM7A 3U3DA 1T2DA 4EI8A 2HPMA 1CY7A 4XLFA 5E3IA 2WD7B 5JXJA 2EFEB 2ZTVA 2BY2A 5DP1A 1QFXA 3KJHA 5C8ZA 1LRJA 2P5UA 4CQLB 4BGIA 1BOBA 2J7PA 3FMSA 3GTJJ 4HRYA 2JJMA 3FF1A 2AQHA 4M83A 2EZIA 3DA8A 4PNHA 1JU9A 4EO4A 4G9GA 2VB6A 4BCBA 3Q3JB 3ER9A 2FSVC 5K6TA 3TW6A 4OREX 3V4LA 4ZA2A 4ND3A 3QVGB 4PTLA 1JT6A 5EVCA 3RU3A 3Q9SA 5K3BA 3SGLA 1G3UA 2RC6A 1ESEA 3U48A 4DSNA 3JQ7A 4LVOA 1FP6A 2C96A 2RH8A 1K9VF 3WK7A 2Y1GA 1E66A 4RMIA 1YD7A 1NU6A 2PUJA 5SYMA 3FYSA 1GO2A 4LLNA 5EE1A 2I9KA 2O5CA 3I53A 4YJ2F 4EY5A 2QLTA 2BSXA 1XEFA 2VASA 4RW0A 5DJ5A 4N65A 3H3VK 4RVHA 4TQAA 3PGA1 2B35A 2IT1A 2ESHA 1JL3A 1WU7A 3CDIA 5E7MA 4EB0A 4DOMA 2LRHA 3MMSA 1MC1A 3NNDA 4GICA 4QHSA 2ZIWB 1DIAA 2W83A 5C8XA 3IE2A 1A72A 3V3TA 3ZCSA 3MF4A 3FLBA 3S28A 3REQA 1ETKA 3Q5DA 2QZ4A 2ZCJA 4GBGA 3H3UA 2OTLI 3GEDA 3OLXA 2JZNA 1SC7A 2NSYA 2C6YA 2VHJA 2C8VA 2EIKH 1D6MA 4URWR 2DDAA 4CU5A 4CT5A 2GEBA 1IULA 2R8RA 2P2NA 1JHHA 3A9UA 1SD7A 2Q41A 3DYBA 3LA3A 4EHJA 4IINA 1K78A 1KZ6A 1RZVA 2WWGA 5DIFA 5LP6F 1RE1A 1NASA 3HXOA 1HTWA 1NMYA 2HTFA 5K0LA 4PLVA 5CQEA 1KP9A 4JJ7A 4K46A 5I7HA 4GPBA 2W2QA 3LQ2A 4I99A 4ZCRA 1OISA 3B5JA 2YRFA 1E2DA 1JP7A 2P7VB 2X7JA 1FUEA 2FOLA 4I8DA 3WB2A 3WGZA 3WTWC 2B1RA 4A15A 2GJ4A 2RHTA 3NHJA 4OQZA 1X4PA 3NETA 1VBFA 4NONA 5AHXA 3CKYA 1LGYA 4TVBA 2QD3A 4IXTA 5D8DA 2ELHA 5JLAA 5EHZA 5BXYA 3TAHA 1MHTA 4AIKA 2QL5A 4X1YA 3QXGA 3EXAA 5COQA 2RN7A 3N7UA 4HBGA 3L18A 4RTSA 4FMPA 4MUBA 3K35A 4QTTB 1IAQA 4QEZA