3WGBA

Crystal structure of aeromonas jandaei l-allo-threonine aldolase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
334
structure length
324
Chain Sequence
YIDLRSDTVTQPTDAMRQCMLHAEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQDGSLALADVRAAIADDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALGIRLDLAQVQTNMVFLQLTSAPLLAFMKARGILFSLRLVTHLQIHDDDIEEVIDAFTEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-allo-threonine aldolase
publication title L-allo-Threonine aldolase with an H128Y/S292R mutation from Aeromonas jandaei DK-39 reveals the structural basis of changes in substrate stereoselectivity.
pubmed doi rcsb
source organism Aeromonas jandaei
molecule tags Lyase
total genus 105
structure length 324
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.49: L-allo-threonine aldolase.
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01212 Beta_elim_lyase Beta-eliminating lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3wgbA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3wgbA02
1BT4A 4ADCA 4F5FA 4KYOA 1XEYA 2BI9A 2CINA 3LVJA 4PFFA 3ELEA 1CZCA 3E2ZA 4U1TA 3NTJA 3RCHB 3USFA 4ZDPA 3NUBA 1LS3A 3JWAA 4OBUA 4AO4A 2HUFA 1UU1A 2HUIA 4BHDA 1ARIA 1ARSA 1P3WA 3MAFA 1I43A 4WLHA 1WYUA 1IX7A 2D65A 3DXVA 2W7IA 2HORA 4J8LA 2EO5A 4WYCA 1Z7DA 4ZM3A 2AY5A 2GMUA 1TPLA 1WYVB 3HT4A 2AEUA 1ASMA 2TPLA 1WKHA 4UHMA 1M7YA 4UHNA 5FT6A 4WBTA 1W3UA 4JE5D 1GC4A 3AV7A 2O1BA 5EFSA 2D66A 1UU2A 1M0NA 1D7SA 1ARHA 3KKIA 1AMRA 3WCOA 4ITGA 2YCNA 3E2FA 5EUEA 1BJOB 1PG8A 1WKGA 2BIEA 2EGYA 3MBBA 3P1TA 2V0YA 3RUYA 1W7NA 1AJSB 4JEXA 4W1VA 1CZEA 3MEBA 1AKAA 4ADBA 5FT5A 1AKCA 3VK4A 4CVQA 5J8QA 5AX8A 5D5SA 3A8UX 4OBVA 1YOOA 3QBOA 1DJ9A 1O61A 2FNUA 3H7FA 1BW0A 4B98A 4A0HA 1FG3A 1M0OA 4A6TA 2Z61A 3FFRA 1GCKA 2EH6A 1B5PA 1KKPA 4W5KA 3AEPA 3MC6A 5HXXA 2VMYA 1AHGA 1CS1A 3Q8NA 3IHJA 2CSTA 2VI9A 3N0LA 3RCHA 2VGSA 4GRXA 4WD2A 1H0CA 1TOEA 1DTYA 3JTXA 1IUGA 1AICA 1OATA 4RJ0A 3HBXA 1SVVA 4XJOA 4ZSYA 3JW9A 2C81A 4W1WA 1J32A 1Z3ZA 2VMZA 3PA9A 1C7NA 1SF2A 2GB3A 4JEVA 3M5UA 3WY7A 1DGDA 1J04A 3GZDA 4GE4A 1ASNA 2Z20A 3WGCA 1CQ8A 4MQQA 2VMNA 2C44A 3WCNA 3EI7A 1RV4A 3ZZKA 1BJNA 1ELQA 4P7YA 3B8XA 1RVYA 4IXOA 1MAQA 1DKAA 3A9XA 1B9HA 2FYFA 3FVXA 4HVKA 2W7FA 3E6GA 2ZY4A 1AMAA 4BMKA 2VMQA 1UU0A 4L0OA 2CJHA 2VGUA 1CQ6A 2YKYA 2VMWA 1BJWA 3ELPA 3IF2A 2W7JA 4M2MA 4W91A 2CY8A 5DJ1A 4WXGA 2BKWA 1ZODA 2G6WA 1JF9A 4R2NA 2VGVA 3PD6B 2OQXA 2BI2A 2VGZA 1QISA 3HVYA 2Z9XA 1W23A 1SPAA 4A0RA 3BB8A 5EUNA 4BQ0A 1Y4IA 4TN4A 1KMKA 3FQ8A 2AY3A 4IW7A 2QMAA 2BWOA 5DB5A 5DX5A 3DODA 4TMRA 3PJ0A 4IYOA 1GC3A 1IX8A 1M0PA 2X5FA 3NUIA 4Q31A 2GMSA 5EAVA 1FC4A 1PMMA 2YCTA 3DR4A 3GZDC 3EUCA 2AY9A 1ARGA 1YNUA 2AY2A 1X0MA 1JS6A 3CAIA 3P6KA 4RAEA 4TV7A 4E1OA 2ZY5A 5G09A 1GD9A 1WSTA 3CQ4A 1S09A 1AX4A 3FZ6A 4R5FA 2W7EA 2FQ6A 3JZLA 3LVMA 2BHXA 4JE5A 1CL1A 5EUDA 3VAXA 1C4KA 1EQBA 2E7JA 2PO3A 2CH1A 1GC2A 4LW2A 4RLGA 3QN6A 1LKCA 3AENB 1H1CA 2HP1A 4DBCA 1B9IA 1C9CA 4ZASA 2WK9A 1ECXA 3FSLA 3B46A 5FT8A 3NYTA 1X29A 3ASAA 4NOGA 2W7HA 1DFOA 3CQ6A 2FNIA 3AEOA 1WYTB 3A2BA 4F5LA 3AEMA 4CBSA 4R5ZA 3HMUA 2R0TA 3PGYA 1XI9A 4R8DA 4A0FA 1TOGA 3BWNC 4JF1A 4KXKA 4WB0A 4EU1A 2ZYJA 1SZKA 2BIAA 2ZUKA 4ADDA 1ASAA 4EB5A 3GWPA 2CANA 4OTLA 4EMYA 3W1JA 5G4IA 4WYDA 4BA5A 1PMOA 3FQAA 3CQ5A 4Q6RA 3DZZA 3B1DA 5EAAA 3AELA 1I48A 3ACZA 3L8AA 4RIZA 3PDXA 3EZ1A 3QM2A 4ZDLA 5K8BA 2VLHA 3AATA 2R5CA 4ATPA 1M32A 1BS0A 1TOIA 2DKBA 2XH1A 3ASBA 4WYEA 5E3KA 3LWSA 5EIGB 4JF0A 1MLYA 1PFFA 2JJFA 1RVUA 3B1CA 4MQRA 2W8VA 1BJ4A 1N8PA 4DGTA 4Y0IA 1M0QA 3EIBA 2QBTA 1D2FA 1KMJA 2CFBA 2O0RA 2EZ1A 2ZJGA 4XJLA 3G8MA 4B9BA 2EPJA 3HQTA 1AJRA 4BA4A 4M2KA 2AY1A 3VK3A 4A0GA 1OHWA 3TCMA 4F5MA 1V72A 4XEWA 4CXQA 7AATA 3VP6A 3GR9A 2AY8A 3JU7A 4RJYA 3WKRA 4RKDA 4GSAA 3PDBB 1S0AA 1LW4A 2AY6A 4MSOA 3AEMC 4CXRA 2CTZA 5HDMA 2WK8A 2OGEA 3GSBA 2W8TA 3AOWA 4AH3A 2D5YA 2BYLA 3NU8A 4OC9A 1G7XA 3FZ8A 4ATQA 1KL1A 3FRKA 2C0RA 4WLJA 4F5KA 2GQNA 2ORDA 1WYVA 1GBNA 2PB2A 1GEXA 2VMUA 3MKJA 2ZC0A 1T3IA 1D7RA 1KKJA 1C7OA 1AMQA 4MGRA 1VEFA 2VLFA 2D64A 1CJ0A 4GDYA 1V2EA 2FN6A 3VK2A 2W7KA 2YCPA 2VIBA 2YRRA 4LNMA 3MADA 3OKSA 1V2FA 5M4BA 2ZSLA 4WYGA 1LC5A 4PFNA 4KAMA 2V1PA 4XJMA 1YAAA 1VJOA 1BJOA 2W8UA 4P3MA 2YKUA 3ATHA 3FD0A 3PIUA 1M4NA 5E5IA 3TQXA 2DKJA 3WX9A 4WXBA 1G7WA 1AJSA 2HUUA 1RV3A 4Q75A 4MQPA 2HOZA 1VP4A 3HLMA 3BCBA 2VMOA 3A9YA 1IVRA 3R9AA 2W7DA 4LW4A 4WP0A 3I4JA 4WYAA 2EZ2A 1E5EA 3DC1A 3BS8A 3UAKA 1TOKA 3WGBA 1GEWA 1IAYA 1B8GA 1AHXA 1C7GA 3BCAA 5I92A 1QJ5A 2BWPA 3RI6A 3BWNA 2BWNA 4N0BA 4UQVA 2OKKA 1YJSA 3FDDA 3PDBA 3N5MA 5M46A 1I29A 2VGWA 2Z9UA 3MAFB 2FM1A 2OKJA 1WYUB 4FFCA 2E54A 1OXOA 3EIAA 1AIAA 5M49A 3FFHA 2HOYA 2DGLA 4K2IA 2HOXA 1AY5A 4ISYA 5BJ3A 2E7UA 4ZWMA 4XAUA 4OYTA 4DQ6A 4EFFA 4OCAA 2ZY2A 4AZJA 4E77A 2AY7A 1QITA 4ZLVA 3BC8A 1N31A 3B1EA 3D6KA 3QPGA 4Y0DA 1M6SA 4E3QA 5F9SA 2DGKA 4ZWVA 1MDZA 3GZCA 5FT4A 1IAXA 1X2AA 1ARTA 1EJIA 2DR1A 1DGEA 2OGAA 3BWOA 1O4SA 3G0TA 2VGTA 1U08A 4J5UA 2D7YA 2JISA 3N75A 5BJ4A 4JEZA 2D61A 3FZ7A 2W7MA 1YIZA 2W7LA 3QI6A 3DR7A 1D7VA 2VMTA 3MAUA 3ISLA 4I8AA 4MKJA 1FG7A 2BYJA 3DRDA 1S06A 4ZAHA 5TF5A 4WYFA 5F8VA 4ZDOA 2NMPA 3AOVA 1GC0A 5IWQA 3QGUA 2Z1YA 2YKXA 3FVSA 1YIYA 1SZUA 3KGWA 1ASFA 3PPLA 4H51A 3FTBA 3PD6A 4OT8A 4ZM4A 1OXPA 1IJIA 3WLXA 1C0NA 2W8JA 4F5IA 1I41A 2X5DA 3VOMA 1AAMA 2E7IA 4F5JA 3RQ1A 1LC8A 3KE3A 3L44A 1KL2A 5LHAA 3KGXA 4E3RA 3PAAA 5DJ9A 3JWBA 4AZKA 1BQAA 1ZOBA 3E77A 3II0A 4IXSA 4F4EA 4JEYA 1UKJA 1MDOA 1GEYA 4FL0A 4IY7A 3E9KA 2YOBA 3ZRQA 5JAYA 1AAWA 4UHOA 2X8UA 3T32A 1AY8A 2R5EA 1ORDA 2XBNA 3NX3A 4AO9A 1MAPA 1G4VA 2YRIA 2AEVA 3K40A 1TARA 2GSAA 3EI8A 2HZPA 4M2JA 2VYCA 2D63A 3E2YA 1V2DA 1DJEA 3GJUA 4W8IA 1N2TA 1X28A 4ADEA 4A6RA 3NDNA 5HHYA 3HL2A 3FVUA 1BKGA 2ZY3A 3UWCA 2Z9WA 4F5HA 4EB7A 3AENA 4IX8A 4RKCA 4K2MA 2QLRA 4Y0HA 2W8WA 2Q7WA 4A00A 3ZZJA 2QB2A 3OP7A 1YJYA 2VMVA 1QJ3A 3TFUA 1ELUA 3TFTA 4UOYA 2WKAA 2DOUA 2VMPA 2OATA 1YJZA 4PIWA 3DXWA 2D7ZA 1GDEA 3NYSA 1IBJA 4XJPA 1WYTA 3ECDA 1D7UA 2JJHA 1MDXA 8AATA 1E5FA 2ZSMA 3LG0A 2JJGA 3W1HA 1LC7A 2HP2A 3NU7A 5EQCA 2CB1A 3EI5A 1G4XA 4A72A 3R4TA 3EZSA 4IYOB 3WZFA 1QIRA 2RFVA 3FDBA 3K28A 5LH9A 1LK9A 4F5GA 3BN1A 1AIBA 1ASBA 1ASLA 1QGNA 1S08A 1AKBA 1W7LA 2F8JA 3F0HA 3TATA 3ZRPA 1AHYA 2YKVA 2Z67A 3GETA 3UE8A 1JG8A 4K2BA 4W1XA 1SZSA 4AOAA 5C6UA 5EIGA 2C7TA 2VI8A 2BIGA 4GEBA 3DU4A 1ASGA 2Z9VA 4N0WA 2ZP7A 1DJUA 3A9ZA 2PB0A 2QB3A 2YHKA 1O62A 1SFFA 4QGRA 4CBRA 1ASCA 4ITXA 1W7MA 4HF8A 3CBFA 3NNKA 1CL2A 3E2ZB 2JG2A 2VIAA 3AEJA 3K7YA 2BI3A 1O69A 4ZSWA 5M4DA 2AATA 3ZRRA 3BCXA 2JJEA 5G2QA 1AMSA 1QZ9A 3EI9A 4IXZA 4MY5A 4RM1A 2O7CA 5E4ZA 3W1IA 2JGTA 2X3LA 5G4JA 1S07A 3DYDA 4JEWA 3HDOA 1JS3A 4WB0B 1EG5A 2CH2A 2QA3A 3BV0A 4GE9A 4LNLA 3MC6C 4O6ZA 3RBFA 1LW5A 1MGVA 1ASEA 1TASA 1TATA 3F9TA 3GBXA 1MLZA 3G7QA 1AHEA 3LV2A 1CQ7A 4XQ2A 3QHXA 5G2PA 3LY1A 2AY4A 4LNJA 1IX6A 3H14A 4LC3A 4WXFA 3LVLB 1OHYA 5D95A 2BI5A 2WK7A 2R5CB 3NRAA 1AHFA 1OHVA 3I16A 3WKSA 2Z1ZA 4GE7A 4PVFA 4U2HA 4RITA 1B4XA 4XK1A 2VMSA 5G0AA 3I5TA 2BI1A 1BQDA 3NYUA 2R2NA 1AY4A 2VMXA 3EI6A 4MKKA 1ASDA 2DGMA 3FCRA 1ZC9A 4OMAA 4Q76A 2CJGA 3RBLA 2VMRA 3FKDA 2CJDA 3FQ7A 3AEJC 4A6UA 3F6TA 9AATA 1B5OA 3LVKA 2W7GA 1TOJA 3COGA
chains in the Genus database with same CATH superfamily
1BT4A 4ADCA 4F5FA 4KYOA 1XEYA 2BI9A 2CINA 3LVJA 4PFFA 3ELEA 3N7NA 1CZCA 3E2ZA 4U1TA 3NTJA 3RCHB 3USFA 4ZDPA 3NUBA 1LS3A 3JWAA 4OBUA 4AO4A 2HUFA 1UU1A 2HUIA 4BHDA 1ARIA 1ARSA 1P3WA 3MAFA 1I43A 4WLHA 1WYUA 1IX7A 2D65A 3DXVA 2W7IA 2HORA 4J8LA 2EO5A 4WYCA 1Z7DA 4ZM3A 2AY5A 2GMUA 1TPLA 1WYVB 3HT4A 2AEUA 1ASMA 2TPLA 1WKHA 4UHMA 1M7YA 4UHNA 5FT6A 4WBTA 1W3UA 4JE5D 2KFPA 1GC4A 3AV7A 2O1BA 5EFSA 2D66A 1UU2A 1M0NA 1D7SA 1ARHA 3KKIA 1AMRA 3WCOA 4ITGA 2YCNA 3E2FA 5EUEA 1BJOB 1PG8A 1WKGA 2BIEA 2EGYA 3MBBA 3P1TA 2V0YA 3RUYA 1W7NA 1AJSB 4JEXA 3H9XA 4W1VA 1CZEA 3MEBA 1AKAA 4ADBA 5FT5A 1AKCA 3VK4A 4CVQA 5J8QA 5AX8A 5D5SA 3A8UX 4OBVA 1YOOA 3QBOA 1DJ9A 1O61A 2FNUA 3H7FA 1BW0A 4B98A 4A0HA 1FG3A 1M0OA 4A6TA 2Z61A 3FFRA 1GCKA 2EH6A 1B5PA 1KKPA 4W5KA 3AEPA 3MC6A 5HXXA 2VMYA 1AHGA 1CS1A 3Q8NA 3IHJA 2CSTA 2VI9A 3N0LA 3RCHA 2VGSA 4GRXA 4WD2A 1H0CA 1TOEA 1DTYA 3JTXA 1IUGA 1AICA 1OATA 4RJ0A 3HBXA 1SVVA 4XJOA 4ZSYA 3JW9A 2C81A 4W1WA 1J32A 1Z3ZA 2VMZA 3PA9A 1C7NA 1SF2A 2GB3A 4JEVA 3M5UA 3WY7A 1DGDA 1J04A 3GZDA 4GE4A 1ASNA 2Z20A 3WGCA 1CQ8A 4MQQA 2WB6A 2VMNA 2C44A 3WCNA 3EI7A 1RV4A 3ZZKA 1BJNA 1ELQA 4P7YA 3B8XA 1RVYA 4IXOA 1MAQA 1DKAA 3A9XA 1B9HA 2FYFA 3FVXA 4HVKA 2W7FA 3E6GA 2ZY4A 1AMAA 4BMKA 2VMQA 1UU0A 4L0OA 2CJHA 2VGUA 1KAFA 1CQ6A 2YKYA 2VMWA 1BJWA 3ELPA 3IF2A 2W7JA 4M2MA 4W91A 2CY8A 5DJ1A 4WXGA 2BKWA 1ZODA 2G6WA 1JF9A 4R2NA 2VGVA 3PD6B 2OQXA 2BI2A 2VGZA 1QISA 3HVYA 2Z9XA 1W23A 1SPAA 4A0RA 3BB8A 5EUNA 4BQ0A 1Y4IA 4TN4A 1KMKA 3FQ8A 2AY3A 4IW7A 2QMAA 2BWOA 5DB5A 5DX5A 3DODA 4TMRA 3PJ0A 4IYOA 1GC3A 1IX8A 1M0PA 2X5FA 3NUIA 4Q31A 2GMSA 5EAVA 1FC4A 1PMMA 2YCTA 3DR4A 3GZDC 3EUCA 2AY9A 1ARGA 1YNUA 2AY2A 1X0MA 1JS6A 3CAIA 3P6KA 4RAEA 4TV7A 4E1OA 2ZY5A 5G09A 1GD9A 1WSTA 3CQ4A 1S09A 1AX4A 3FZ6A 4R5FA 2W7EA 2FQ6A 3JZLA 3LVMA 2BHXA 4JE5A 1CL1A 5EUDA 3VAXA 1C4KA 1EQBA 2E7JA 2PO3A 2CH1A 1GC2A 4LW2A 4RLGA 3QN6A 1LKCA 3AENB 3N4XA 1H1CA 2HP1A 4DBCA 1B9IA 1C9CA 4ZASA 2WK9A 1ECXA 3FSLA 3B46A 5FT8A 3NYTA 1X29A 3ASAA 4NOGA 2W7HA 1DFOA 3CQ6A 2FNIA 3AEOA 1WYTB 3A2BA 4F5LA 3AEMA 4CBSA 4R5ZA 3HMUA 2R0TA 3PGYA 1XI9A 4R8DA 4A0FA 1TOGA 3BWNC 4JF1A 4KXKA 4WB0A 4EU1A 2ZYJA 1SZKA 2BIAA 2ZUKA 4ADDA 1ASAA 4EB5A 3GWPA 2CANA 4OTLA 4EMYA 3W1JA 5G4IA 4WYDA 4BA5A 1PMOA 3FQAA 3CQ5A 4Q6RA 3DZZA 3B1DA 5EAAA 3AELA 1I48A 3ACZA 3L8AA 4RIZA 3PDXA 3EZ1A 3QM2A 4ZDLA 5K8BA 2VLHA 3AATA 2R5CA 4ATPA 1M32A 1BS0A 1TOIA 2DKBA 2XH1A 3ASBA 4WYEA 5E3KA 3LWSA 5EIGB 4JF0A 1MLYA 1PFFA 2JJFA 1RVUA 3B1CA 4MQRA 2W8VA 1BJ4A 1N8PA 4DGTA 4Y0IA 1M0QA 3EIBA 2QBTA 1D2FA 1KMJA 2CFBA 2O0RA 2EZ1A 2ZJGA 4XJLA 3G8MA 4B9BA 2QSRA 3N4RA 2EPJA 3HQTA 1AJRA 4BA4A 4M2KA 2AY1A 3VK3A 4A0GA 1OHWA 3TCMA 4F5MA 1V72A 4XEWA 4CXQA 7AATA 3VP6A 3GR9A 2AY8A 3JU7A 4RJYA 3WKRA 4RKDA 4GSAA 3PDBB 2A1VA 1S0AA 1LW4A 2AY6A 4MSOA 3AEMC 4CXRA 2CTZA 5HDMA 2WK8A 2OGEA 3GSBA 2W8TA 3AOWA 4AH3A 2D5YA 2BYLA 3NU8A 4OC9A 1G7XA 3FZ8A 4ATQA 1KL1A 3FRKA 2C0RA 4WLJA 4F5KA 2GQNA 2ORDA 1WYVA 1GBNA 2PB2A 1GEXA 2VMUA 3MKJA 2ZC0A 1T3IA 1D7RA 1KKJA 1C7OA 1AMQA 4MGRA 1VEFA 2VLFA 2D64A 1CJ0A 4GDYA 1V2EA 2FN6A 3VK2A 2W7KA 2YCPA 2VIBA 2YRRA 4LNMA 3MADA 3OKSA 1V2FA 5M4BA 2ZSLA 4WYGA 1LC5A 4PFNA 4KAMA 2V1PA 4XJMA 1YAAA 1VJOA 1BJOA 2W8UA 4P3MA 2YKUA 3ATHA 3FD0A 3PIUA 1M4NA 5E5IA 3TQXA 2DKJA 3WX9A 4WXBA 1G7WA 1AJSA 2HUUA 1RV3A 4Q75A 4MQPA 2HOZA 1VP4A 3HLMA 2FKIA 3BCBA 2VMOA 3A9YA 1IVRA 3R9AA 2W7DA 4LW4A 4WP0A 3I4JA 4WYAA 2EZ2A 1E5EA 3DC1A 3BS8A 3UAKA 1TOKA 3WGBA 1GEWA 1IAYA 1B8GA 1AHXA 1C7GA 3BCAA 5I92A 1QJ5A 2BWPA 3RI6A 3BWNA 2BWNA 4N0BA 4UQVA 2OKKA 1YJSA 3FDDA 3PDBA 3N5MA 5M46A 1I29A 2VGWA 2Z9UA 3MAFB 2FM1A 2OKJA 1WYUB 4FFCA 2E54A 1OXOA 3EIAA 1AIAA 5M49A 3FFHA 2HOYA 2DGLA 4K2IA 2HOXA 1AY5A 4ISYA 5BJ3A 2E7UA 4ZWMA 4XAUA 4OYTA 4DQ6A 4EFFA 4OCAA 2ZY2A 4AZJA 4E77A 2AY7A 1QITA 4ZLVA 3BC8A 1N31A 3B1EA 3D6KA 3QPGA 4Y0DA 1M6SA 4E3QA 5F9SA 2DGKA 4ZWVA 1MDZA 3GZCA 5FT4A 1IAXA 1X2AA 1ARTA 1EJIA 2DR1A 1DGEA 2OGAA 3BWOA 1O4SA 3G0TA 2VGTA 1U08A 4J5UA 2D7YA 2JISA 3N75A 5BJ4A 4JEZA 2G7JA 2D61A 3FZ7A 2W7MA 1YIZA 2W7LA 3QI6A 3DR7A 1D7VA 2VMTA 3MAUA 3ISLA 4I8AA 4MKJA 1FG7A 2BYJA 3DRDA 1S06A 4ZAHA 5TF5A 4WYFA 5F8VA 4ZDOA 2NMPA 3AOVA 1GC0A 5IWQA 3QGUA 2Z1YA 2YKXA 3FVSA 1YIYA 1SZUA 3KGWA 1ASFA 3PPLA 4H51A 3FTBA 3PD6A 4OT8A 4ZM4A 1OXPA 1IJIA 3WLXA 1C0NA 2W8JA 4F5IA 1I41A 2X5DA 3VOMA 1AAMA 2E7IA 4F5JA 3RQ1A 1LC8A 3KE3A 3L44A 1KL2A 5LHAA 3KGXA 4E3RA 3PAAA 5DJ9A 3JWBA 4AZKA 1BQAA 1ZOBA 3E77A 3II0A 4IXSA 4F4EA 4JEYA 1UKJA 1MDOA 1GEYA 4FL0A 4IY7A 3E9KA 2YOBA 3ZRQA 5JAYA 1AAWA 4UHOA 2X8UA 3T32A 1AY8A 2R5EA 1ORDA 2XBNA 3NX3A 4AO9A 1MAPA 1G4VA 2YRIA 2AEVA 3K40A 1TARA 2GSAA 3EI8A 2HZPA 4M2JA 2VYCA 2D63A 3E2YA 1V2DA 1DJEA 3GJUA 4W8IA 3N4SA 1N2TA 1X28A 4ADEA 4A6RA 3NDNA 5HHYA 3HL2A 3FVUA 1BKGA 2ZY3A 3UWCA 2Z9WA 4F5HA 4EB7A 3AENA 4IX8A 4RKCA 4K2MA 4H63Q 2QLRA 4Y0HA 2W8WA 2Q7WA 4A00A 3ZZJA 2QB2A 3OP7A 1YJYA 2VMVA 1QJ3A 3TFUA 1ELUA 3TFTA 4UOYA 2WKAA 2DOUA 2VMPA 2OATA 1YJZA 4PIWA 3DXWA 2D7ZA 1GDEA 3NYSA 1IBJA 4XJPA 1WYTA 3ECDA 1D7UA 2JJHA 1MDXA 8AATA 1E5FA 2ZSMA 3LG0A 2JJGA 3W1HA 1LC7A 2HP2A 3NU7A 5EQCA 2CB1A 3EI5A 1G4XA 4A72A 3R4TA 3EZSA 4IYOB 3WZFA 1QIRA 2RFVA 3FDBA 3K28A 5LH9A 1LK9A 4F5GA 3BN1A 1AIBA 1ASBA 1ASLA 1QGNA 1S08A 1AKBA 1W7LA 2F8JA 3F0HA 3TATA 3ZRPA 1AHYA 2YKVA 2Z67A 3GETA 3UE8A 1JG8A 4K2BA 4W1XA 1SZSA 4AOAA 5C6UA 5EIGA 2C7TA 2VI8A 2BIGA 4GEBA 3DU4A 1ASGA 2Z9VA 4N0WA 2ZP7A 1DJUA 3A9ZA 2PB0A 2QB3A 2YHKA 1O62A 1SFFA 4QGRA 4CBRA 5KTBA 1ASCA 4ITXA 1W7MA 4HF8A 3CBFA 3NNKA 1CL2A 3E2ZB 2JG2A 2VIAA 3AEJA 3K7YA 2BI3A 1O69A 4ZSWA 5M4DA 2AATA 3ZRRA 3BCXA 2JJEA 5G2QA 1AMSA 1QZ9A 3EI9A 4IXZA 4MY5A 4RM1A 2O7CA 5E4ZA 3W1IA 2JGTA 2X3LA 5G4JA 1S07A 3DYDA 4JEWA 3HDOA 1JS3A 4WB0B 1EG5A 2CH2A 2QA3A 3BV0A 4GE9A 4LNLA 3MC6C 4O6ZA 3RBFA 1LW5A 1MGVA 1ASEA 1TASA 1TATA 3F9TA 3GBXA 1MLZA 3G7QA 1AHEA 3LV2A 1CQ7A 4XQ2A 4K05A 3QHXA 5G2PA 3LY1A 2AY4A 4LNJA 1IX6A 3H14A 4LC3A 4WXFA 3LVLB 1OHYA 5D95A 2BI5A 2WK7A 2R5CB 3NRAA 1AHFA 1OHVA 3I16A 3WKSA 2Z1ZA 4GE7A 4PVFA 4U2HA 4RITA 1B4XA 4XK1A 2VMSA 5G0AA 3I5TA 2BI1A 1BQDA 3NYUA 2R2NA 1AY4A 2VMXA 3EI6A 4MKKA 1ASDA 2DGMA 3FCRA 1ZC9A 4OMAA 4Q76A 2CJGA 3RBLA 2VMRA 3FKDA 2CJDA 3FQ7A 3AEJC 4A6UA 3F6TA 9AATA 1B5OA 2EYQA 3LVKA 2W7GA 1TOJA 3COGA
chains in the Genus database with same CATH topology
1BT4A 4ADCA 4F5FA 4KYOA 1XEYA 2BI9A 2CINA 3LVJA 4PFFA 3ELEA 3N7NA 1CZCA 3E2ZA 4U1TA 3NTJA 3RCHB 3USFA 4ZDPA 3NUBA 1LS3A 3JWAA 4OBUA 4AO4A 2HUFA 1UU1A 2HUIA 4BHDA 1ARIA 1ARSA 1P3WA 3MAFA 1I43A 4WLHA 1WYUA 1IX7A 2D65A 3DXVA 2W7IA 2HORA 4J8LA 2EO5A 4WYCA 1Z7DA 4ZM3A 2AY5A 2GMUA 1TPLA 1WYVB 3HT4A 2AEUA 1ASMA 2TPLA 1WKHA 4UHMA 1M7YA 4UHNA 5FT6A 4WBTA 1W3UA 4JE5D 2KFPA 1GC4A 3AV7A 2O1BA 5EFSA 2D66A 1UU2A 1M0NA 1D7SA 1ARHA 3KKIA 1AMRA 3WCOA 4ITGA 2YCNA 3E2FA 5EUEA 1BJOB 1PG8A 1WKGA 2BIEA 2EGYA 3MBBA 3P1TA 2V0YA 3RUYA 1W7NA 1AJSB 4JEXA 3H9XA 4W1VA 1CZEA 3MEBA 1AKAA 4ADBA 5FT5A 1AKCA 3VK4A 4CVQA 5J8QA 5AX8A 5D5SA 3A8UX 4OBVA 1YOOA 3QBOA 1DJ9A 1O61A 2FNUA 3H7FA 1BW0A 4B98A 4A0HA 1FG3A 1M0OA 4A6TA 2Z61A 3FFRA 1GCKA 2EH6A 1B5PA 1KKPA 4W5KA 3AEPA 3MC6A 5HXXA 2VMYA 1AHGA 1CS1A 3Q8NA 3IHJA 2CSTA 2VI9A 3N0LA 3RCHA 2VGSA 4GRXA 4WD2A 1H0CA 1TOEA 1DTYA 3JTXA 1IUGA 1AICA 1OATA 4RJ0A 3HBXA 1SVVA 4XJOA 4ZSYA 3JW9A 2C81A 4W1WA 1J32A 1Z3ZA 2VMZA 3PA9A 1C7NA 1SF2A 2GB3A 4JEVA 3M5UA 3WY7A 1DGDA 1J04A 3GZDA 4GE4A 1ASNA 2Z20A 3WGCA 1CQ8A 4MQQA 2WB6A 2VMNA 2C44A 3WCNA 3EI7A 1RV4A 3ZZKA 1BJNA 1ELQA 4P7YA 3B8XA 1RVYA 4IXOA 1MAQA 1DKAA 3A9XA 1B9HA 2FYFA 3FVXA 4HVKA 2W7FA 3E6GA 2ZY4A 1AMAA 4BMKA 2VMQA 1UU0A 4L0OA 2CJHA 2VGUA 1CQ6A 2YKYA 2VMWA 1BJWA 3ELPA 3IF2A 2W7JA 4M2MA 4W91A 2CY8A 5DJ1A 4WXGA 2BKWA 1ZODA 2G6WA 1JF9A 4R2NA 2VGVA 3PD6B 2OQXA 2BI2A 2VGZA 1QISA 3HVYA 2Z9XA 1W23A 1SPAA 4A0RA 3BB8A 5EUNA 4BQ0A 1Y4IA 4TN4A 1KMKA 3FQ8A 2AY3A 4IW7A 2QMAA 2BWOA 5DB5A 5DX5A 3DODA 4TMRA 3PJ0A 4IYOA 1GC3A 1IX8A 1M0PA 2X5FA 3NUIA 4Q31A 2GMSA 5EAVA 1FC4A 1PMMA 2YCTA 3DR4A 3GZDC 3EUCA 2AY9A 1ARGA 1YNUA 2AY2A 1X0MA 1JS6A 3CAIA 3P6KA 4RAEA 4TV7A 4E1OA 2ZY5A 5G09A 1GD9A 1WSTA 3CQ4A 1S09A 1AX4A 3FZ6A 4R5FA 2W7EA 2FQ6A 3JZLA 3LVMA 2BHXA 4JE5A 1CL1A 5EUDA 3VAXA 1C4KA 1EQBA 2E7JA 2PO3A 2CH1A 1GC2A 4LW2A 4RLGA 3QN6A 1LKCA 3AENB 3N4XA 1H1CA 2HP1A 4DBCA 1B9IA 1C9CA 4ZASA 2WK9A 1ECXA 3FSLA 3B46A 5FT8A 3NYTA 1X29A 3ASAA 4NOGA 2W7HA 1DFOA 3CQ6A 2FNIA 3AEOA 1WYTB 3A2BA 4F5LA 3AEMA 4CBSA 4R5ZA 3HMUA 2R0TA 3PGYA 1XI9A 4R8DA 4A0FA 1TOGA 3BWNC 4JF1A 4KXKA 4WB0A 4EU1A 2ZYJA 1SZKA 2BIAA 2ZUKA 4ADDA 1ASAA 4EB5A 3GWPA 2CANA 4OTLA 4EMYA 3W1JA 5G4IA 4WYDA 4BA5A 1PMOA 3FQAA 3CQ5A 4Q6RA 3DZZA 3B1DA 5EAAA 3AELA 1I48A 3ACZA 3L8AA 4RIZA 3PDXA 3EZ1A 3QM2A 4ZDLA 5K8BA 2VLHA 3AATA 2R5CA 4ATPA 1M32A 1BS0A 1TOIA 2DKBA 2XH1A 3ASBA 4WYEA 5E3KA 3LWSA 5EIGB 4JF0A 1MLYA 1PFFA 2JJFA 1RVUA 3B1CA 4MQRA 2W8VA 1BJ4A 1N8PA 4DGTA 4Y0IA 1M0QA 3EIBA 2QBTA 1D2FA 1KMJA 2CFBA 2O0RA 2EZ1A 2ZJGA 4XJLA 3G8MA 4B9BA 2QSRA 3N4RA 2EPJA 3HQTA 1AJRA 4BA4A 4M2KA 2AY1A 3VK3A 4A0GA 1OHWA 3TCMA 4F5MA 1V72A 4XEWA 4CXQA 7AATA 3VP6A 3GR9A 2AY8A 3JU7A 4RJYA 3WKRA 4RKDA 4GSAA 3PDBB 2A1VA 1S0AA 1LW4A 2AY6A 4MSOA 3AEMC 4CXRA 2CTZA 5HDMA 2WK8A 2OGEA 3GSBA 2W8TA 3AOWA 4AH3A 2D5YA 2BYLA 3NU8A 4OC9A 1G7XA 3FZ8A 4ATQA 1KL1A 3FRKA 2C0RA 4WLJA 4F5KA 2GQNA 2ORDA 1WYVA 1GBNA 2PB2A 1GEXA 2VMUA 3MKJA 2ZC0A 1T3IA 1D7RA 1KKJA 1C7OA 1AMQA 4MGRA 1VEFA 2VLFA 2D64A 1CJ0A 4GDYA 1V2EA 2FN6A 3VK2A 2W7KA 2YCPA 2VIBA 2YRRA 4LNMA 3MADA 3OKSA 1V2FA 5M4BA 2ZSLA 4WYGA 1LC5A 4PFNA 4KAMA 2V1PA 4XJMA 1YAAA 1VJOA 1BJOA 2W8UA 4P3MA 2YKUA 3ATHA 3FD0A 3PIUA 1M4NA 5E5IA 3TQXA 2DKJA 3WX9A 4WXBA 1G7WA 1AJSA 2HUUA 1RV3A 4Q75A 4MQPA 2HOZA 1VP4A 3HLMA 2FKIA 3BCBA 2VMOA 3A9YA 1IVRA 3R9AA 2W7DA 4LW4A 4WP0A 3I4JA 4WYAA 2EZ2A 1E5EA 3DC1A 3BS8A 3UAKA 1TOKA 3WGBA 1GEWA 1IAYA 1B8GA 1AHXA 1C7GA 3BCAA 5I92A 1QJ5A 2BWPA 3RI6A 3BWNA 2BWNA 4N0BA 4UQVA 2OKKA 1YJSA 3FDDA 3PDBA 3N5MA 5M46A 1I29A 2VGWA 2Z9UA 3MAFB 2FM1A 2OKJA 1WYUB 4FFCA 2E54A 1OXOA 3EIAA 1AIAA 5M49A 3FFHA 2HOYA 2DGLA 4K2IA 2HOXA 1AY5A 4ISYA 5BJ3A 2E7UA 4ZWMA 4XAUA 4OYTA 4DQ6A 4EFFA 4OCAA 2ZY2A 4AZJA 4E77A 2AY7A 1QITA 4ZLVA 3BC8A 1N31A 3B1EA 3D6KA 3QPGA 4Y0DA 1M6SA 4E3QA 5F9SA 2DGKA 4ZWVA 1MDZA 3GZCA 5FT4A 1IAXA 1X2AA 1ARTA 1EJIA 2DR1A 1DGEA 2OGAA 3BWOA 1O4SA 3G0TA 2VGTA 1U08A 4J5UA 2D7YA 2JISA 3N75A 5BJ4A 4JEZA 2G7JA 2D61A 3FZ7A 2W7MA 1YIZA 2W7LA 3QI6A 3DR7A 1D7VA 2VMTA 3MAUA 3ISLA 4I8AA 4MKJA 1FG7A 2BYJA 3DRDA 1S06A 4ZAHA 5TF5A 4WYFA 5F8VA 4ZDOA 2NMPA 3AOVA 1GC0A 5IWQA 3QGUA 2Z1YA 2YKXA 3FVSA 1YIYA 1SZUA 3KGWA 1ASFA 3PPLA 4H51A 3FTBA 3PD6A 4OT8A 4ZM4A 1OXPA 1IJIA 3WLXA 1C0NA 2W8JA 4F5IA 1I41A 2X5DA 3VOMA 1AAMA 2E7IA 4F5JA 3RQ1A 1LC8A 3KE3A 3L44A 1KL2A 5LHAA 3KGXA 4E3RA 3PAAA 5DJ9A 3JWBA 4AZKA 1BQAA 1ZOBA 3E77A 3II0A 4IXSA 4F4EA 4JEYA 1UKJA 1MDOA 1GEYA 4FL0A 4IY7A 3E9KA 2YOBA 3ZRQA 5JAYA 1AAWA 4UHOA 2X8UA 3T32A 1AY8A 2R5EA 1ORDA 2XBNA 3NX3A 4AO9A 1MAPA 1G4VA 2YRIA 2AEVA 3K40A 1TARA 2GSAA 3EI8A 2HZPA 4M2JA 2VYCA 2D63A 3E2YA 1V2DA 1DJEA 3GJUA 4W8IA 3N4SA 1N2TA 1X28A 4ADEA 4A6RA 3NDNA 5HHYA 3HL2A 3FVUA 1BKGA 2ZY3A 3UWCA 2Z9WA 4F5HA 4EB7A 3AENA 4IX8A 4RKCA 4K2MA 4H63Q 2QLRA 4Y0HA 2W8WA 2Q7WA 4A00A 3ZZJA 2QB2A 3OP7A 1YJYA 2VMVA 1QJ3A 3TFUA 1ELUA 3TFTA 4UOYA 2WKAA 2DOUA 2VMPA 2OATA 1YJZA 4PIWA 3DXWA 2D7ZA 1GDEA 3NYSA 1IBJA 4XJPA 1WYTA 3ECDA 1D7UA 2JJHA 1MDXA 8AATA 1E5FA 2ZSMA 3LG0A 2JJGA 3W1HA 1LC7A 2HP2A 3NU7A 5EQCA 2CB1A 3EI5A 1G4XA 4A72A 3R4TA 3EZSA 4IYOB 3WZFA 1QIRA 2RFVA 3FDBA 3K28A 5LH9A 1LK9A 4F5GA 3BN1A 1AIBA 1ASBA 1ASLA 1QGNA 1S08A 1AKBA 1W7LA 2F8JA 3F0HA 3TATA 3ZRPA 1AHYA 2YKVA 2Z67A 3GETA 3UE8A 1JG8A 4K2BA 4W1XA 1SZSA 4AOAA 5C6UA 5EIGA 2C7TA 2VI8A 2BIGA 4GEBA 3DU4A 1ASGA 2Z9VA 4N0WA 2ZP7A 1DJUA 3A9ZA 2PB0A 2QB3A 2YHKA 1O62A 1SFFA 4QGRA 4CBRA 5KTBA 1ASCA 4ITXA 1W7MA 4HF8A 3CBFA 3NNKA 1CL2A 3E2ZB 2JG2A 2VIAA 3AEJA 3K7YA 2BI3A 1O69A 4ZSWA 5M4DA 2AATA 3ZRRA 3BCXA 2JJEA 5G2QA 1AMSA 1QZ9A 3EI9A 4IXZA 4MY5A 4RM1A 2O7CA 5E4ZA 3W1IA 2JGTA 2X3LA 5G4JA 1S07A 3DYDA 4JEWA 3HDOA 1JS3A 4WB0B 1EG5A 2CH2A 2QA3A 3BV0A 4GE9A 4LNLA 3MC6C 4O6ZA 3RBFA 1LW5A 1MGVA 1ASEA 1TASA 1TATA 3F9TA 3GBXA 1MLZA 3G7QA 1AHEA 3LV2A 1CQ7A 4XQ2A 4K05A 3QHXA 5G2PA 3LY1A 2AY4A 4LNJA 1IX6A 3H14A 4LC3A 4WXFA 3LVLB 1OHYA 5D95A 2BI5A 2WK7A 2R5CB 3NRAA 1AHFA 1OHVA 3I16A 3WKSA 2Z1ZA 4GE7A 4PVFA 4U2HA 4RITA 1B4XA 4XK1A 2VMSA 5G0AA 3I5TA 2BI1A 1BQDA 3NYUA 2R2NA 1AY4A 2VMXA 3EI6A 4MKKA 1ASDA 2DGMA 3FCRA 1ZC9A 4OMAA 4Q76A 2CJGA 3RBLA 2VMRA 3FKDA 2CJDA 3FQ7A 3AEJC 4A6UA 3F6TA 9AATA 1B5OA 2EYQA 3LVKA 2W7GA 1TOJA 3COGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT4 A;  4ADC A;  4F5F A;  4KYO A;  1XEY A;  2BI9 A;  2CIN A;  3LVJ A;  4PFF A;  3ELE A;  1CZC A;  3E2Z A;  4U1T A;  3NTJ A;  3RCH B;  3USF A;  4ZDP A;  3NUB A;  1LS3 A;  3JWA A;  4OBU A;  4AO4 A;  2HUF A;  1UU1 A;  2HUI A;  4BHD A;  1ARI A;  1ARS A;  1P3W A;  3MAF A;  1I43 A;  4WLH A;  1WYU A;  1IX7 A;  2D65 A;  3DXV A;  2W7I A;  2HOR A;  4J8L A;  2EO5 A;  4WYC A;  1Z7D A;  4ZM3 A;  2AY5 A;  2GMU A;  1TPL A;  1WYV B;  3HT4 A;  2AEU A;  1ASM A;  2TPL A;  1WKH A;  4UHM A;  1M7Y A;  4UHN A;  5FT6 A;  4WBT A;  1W3U A;  4JE5 D;  1GC4 A;  3AV7 A;  2O1B A;  5EFS A;  2D66 A;  1UU2 A;  1M0N A;  1D7S A;  1ARH A;  3KKI A;  1AMR A;  3WCO A;  4ITG A;  2YCN A;  3E2F A;  5EUE A;  1BJO B;  1PG8 A;  1WKG A;  2BIE A;  2EGY A;  3MBB A;  3P1T A;  2V0Y A;  3RUY A;  1W7N A;  1AJS B;  4JEX A;  4W1V A;  1CZE A;  3MEB A;  1AKA A;  4ADB A;  5FT5 A;  1AKC A;  3VK4 A;  4CVQ A;  5J8Q A;  5AX8 A;  5D5S A;  3A8U X;  4OBV A;  1YOO A;  3QBO A;  1DJ9 A;  1O61 A;  2FNU A;  3H7F A;  1BW0 A;  4B98 A;  4A0H A;  1FG3 A;  1M0O A;  4A6T A;  2Z61 A;  3FFR A;  1GCK A;  2EH6 A;  1B5P A;  1KKP A;  4W5K A;  3AEP A;  3MC6 A;  5HXX A;  2VMY A;  1AHG A;  1CS1 A;  3Q8N A;  3IHJ A;  2CST A;  2VI9 A;  3N0L A;  3RCH A;  2VGS A;  4GRX A;  4WD2 A;  1H0C A;  1TOE A;  1DTY A;  3JTX A;  1IUG A;  1AIC A;  1OAT A;  4RJ0 A;  3HBX A;  1SVV A;  4XJO A;  4ZSY A;  3JW9 A;  2C81 A;  4W1W A;  1J32 A;  1Z3Z A;  2VMZ A;  3PA9 A;  1C7N A;  1SF2 A;  2GB3 A;  4JEV A;  3M5U A;  3WY7 A;  1DGD A;  1J04 A;  3GZD A;  4GE4 A;  1ASN A;  2Z20 A;  3WGC A;  1CQ8 A;  4MQQ A;  2VMN A;  2C44 A;  3WCN A;  3EI7 A;  1RV4 A;  3ZZK A;  1BJN A;  1ELQ A;  4P7Y A;  3B8X A;  1RVY A;  4IXO A;  1MAQ A;  1DKA A;  3A9X A;  1B9H A;  2FYF A;  3FVX A;  4HVK A;  2W7F A;  3E6G A;  2ZY4 A;  1AMA A;  4BMK A;  2VMQ A;  1UU0 A;  4L0O A;  2CJH A;  2VGU A;  1CQ6 A;  2YKY A;  2VMW A;  1BJW A;  3ELP A;  3IF2 A;  2W7J A;  4M2M A;  4W91 A;  2CY8 A;  5DJ1 A;  4WXG A;  2BKW A;  1ZOD A;  2G6W A;  1JF9 A;  4R2N A;  2VGV A;  3PD6 B;  2OQX A;  2BI2 A;  2VGZ A;  1QIS A;  3HVY A;  2Z9X A;  1W23 A;  1SPA A;  4A0R A;  3BB8 A;  5EUN A;  4BQ0 A;  1Y4I A;  4TN4 A;  1KMK A;  3FQ8 A;  2AY3 A;  4IW7 A;  2QMA A;  2BWO A;  5DB5 A;  5DX5 A;  3DOD A;  4TMR A;  3PJ0 A;  4IYO A;  1GC3 A;  1IX8 A;  1M0P A;  2X5F A;  3NUI A;  4Q31 A;  2GMS A;  5EAV A;  1FC4 A;  1PMM A;  2YCT A;  3DR4 A;  3GZD C;  3EUC A;  2AY9 A;  1ARG A;  1YNU A;  2AY2 A;  1X0M A;  1JS6 A;  3CAI A;  3P6K A;  4RAE A;  4TV7 A;  4E1O A;  2ZY5 A;  5G09 A;  1GD9 A;  1WST A;  3CQ4 A;  1S09 A;  1AX4 A;  3FZ6 A;  4R5F A;  2W7E A;  2FQ6 A;  3JZL A;  3LVM A;  2BHX A;  4JE5 A;  1CL1 A;  5EUD A;  3VAX A;  1C4K A;  1EQB A;  2E7J A;  2PO3 A;  2CH1 A;  1GC2 A;  4LW2 A;  4RLG A;  3QN6 A;  1LKC A;  3AEN B;  1H1C A;  2HP1 A;  4DBC A;  1B9I A;  1C9C A;  4ZAS A;  2WK9 A;  1ECX A;  3FSL A;  3B46 A;  5FT8 A;  3NYT A;  1X29 A;  3ASA A;  4NOG A;  2W7H A;  1DFO A;  3CQ6 A;  2FNI A;  3AEO A;  1WYT B;  3A2B A;  4F5L A;  3AEM A;  4CBS A;  4R5Z A;  3HMU A;  2R0T A;  3PGY A;  1XI9 A;  4R8D A;  4A0F A;  1TOG A;  3BWN C;  4JF1 A;  4KXK A;  4WB0 A;  4EU1 A;  2ZYJ A;  1SZK A;  2BIA A;  2ZUK A;  4ADD A;  1ASA A;  4EB5 A;  3GWP A;  2CAN A;  4OTL A;  4EMY A;  3W1J A;  5G4I A;  4WYD A;  4BA5 A;  1PMO A;  3FQA A;  3CQ5 A;  4Q6R A;  3DZZ A;  3B1D A;  5EAA A;  3AEL A;  1I48 A;  3ACZ A;  3L8A A;  4RIZ A;  3PDX A;  3EZ1 A;  3QM2 A;  4ZDL A;  5K8B A;  2VLH A;  3AAT A;  2R5C A;  4ATP A;  1M32 A;  1BS0 A;  1TOI A;  2DKB A;  2XH1 A;  3ASB A;  4WYE A;  5E3K A;  3LWS A;  5EIG B;  4JF0 A;  1MLY A;  1PFF A;  2JJF A;  1RVU A;  3B1C A;  4MQR A;  2W8V A;  1BJ4 A;  1N8P A;  4DGT A;  4Y0I A;  1M0Q A;  3EIB A;  2QBT A;  1D2F A;  1KMJ A;  2CFB A;  2O0R A;  2EZ1 A;  2ZJG A;  4XJL A;  3G8M A;  4B9B A;  2EPJ A;  3HQT A;  1AJR A;  4BA4 A;  4M2K A;  2AY1 A;  3VK3 A;  4A0G A;  1OHW A;  3TCM A;  4F5M A;  1V72 A;  4XEW A;  4CXQ A;  7AAT A;  3VP6 A;  3GR9 A;  2AY8 A;  3JU7 A;  4RJY A;  3WKR A;  4RKD A;  4GSA A;  3PDB B;  1S0A A;  1LW4 A;  2AY6 A;  4MSO A;  3AEM C;  4CXR A;  2CTZ A;  5HDM A;  2WK8 A;  2OGE A;  3GSB A;  2W8T A;  3AOW A;  4AH3 A;  2D5Y A;  2BYL A;  3NU8 A;  4OC9 A;  1G7X A;  3FZ8 A;  4ATQ A;  1KL1 A;  3FRK A;  2C0R A;  4WLJ A;  4F5K A;  2GQN A;  2ORD A;  1WYV A;  1GBN A;  2PB2 A;  1GEX A;  2VMU A;  3MKJ A;  2ZC0 A;  1T3I A;  1D7R A;  1KKJ A;  1C7O A;  1AMQ A;  4MGR A;  1VEF A;  2VLF A;  2D64 A;  1CJ0 A;  4GDY A;  1V2E A;  2FN6 A;  3VK2 A;  2W7K A;  2YCP A;  2VIB A;  2YRR A;  4LNM A;  3MAD A;  3OKS A;  1V2F A;  5M4B A;  2ZSL A;  4WYG A;  1LC5 A;  4PFN A;  4KAM A;  2V1P A;  4XJM A;  1YAA A;  1VJO A;  1BJO A;  2W8U A;  4P3M A;  2YKU A;  3ATH A;  3FD0 A;  3PIU A;  1M4N A;  5E5I A;  3TQX A;  2DKJ A;  3WX9 A;  4WXB A;  1G7W A;  1AJS A;  2HUU A;  1RV3 A;  4Q75 A;  4MQP A;  2HOZ A;  1VP4 A;  3HLM A;  3BCB A;  2VMO A;  3A9Y A;  1IVR A;  3R9A A;  2W7D A;  4LW4 A;  4WP0 A;  3I4J A;  4WYA A;  2EZ2 A;  1E5E A;  3DC1 A;  3BS8 A;  3UAK A;  1TOK A;  3WGB A;  1GEW A;  1IAY A;  1B8G A;  1AHX A;  1C7G A;  3BCA A;  5I92 A;  1QJ5 A;  2BWP A;  3RI6 A;  3BWN A;  2BWN A;  4N0B A;  4UQV A;  2OKK A;  1YJS A;  3FDD A;  3PDB A;  3N5M A;  5M46 A;  1I29 A;  2VGW A;  2Z9U A;  3MAF B;  2FM1 A;  2OKJ A;  1WYU B;  4FFC A;  2E54 A;  1OXO A;  3EIA A;  1AIA A;  5M49 A;  3FFH A;  2HOY A;  2DGL A;  4K2I A;  2HOX A;  1AY5 A;  4ISY A;  5BJ3 A;  2E7U A;  4ZWM A;  4XAU A;  4OYT A;  4DQ6 A;  4EFF A;  4OCA A;  2ZY2 A;  4AZJ A;  4E77 A;  2AY7 A;  1QIT A;  4ZLV A;  3BC8 A;  1N31 A;  3B1E A;  3D6K A;  3QPG A;  4Y0D A;  1M6S A;  4E3Q A;  5F9S A;  2DGK A;  4ZWV A;  1MDZ A;  3GZC A;  5FT4 A;  1IAX A;  1X2A A;  1ART A;  1EJI A;  2DR1 A;  1DGE A;  2OGA A;  3BWO A;  1O4S A;  3G0T A;  2VGT A;  1U08 A;  4J5U A;  2D7Y A;  2JIS A;  3N75 A;  5BJ4 A;  4JEZ A;  2D61 A;  3FZ7 A;  2W7M A;  1YIZ A;  2W7L A;  3QI6 A;  3DR7 A;  1D7V A;  2VMT A;  3MAU A;  3ISL A;  4I8A A;  4MKJ A;  1FG7 A;  2BYJ A;  3DRD A;  1S06 A;  4ZAH A;  5TF5 A;  4WYF A;  5F8V A;  4ZDO A;  2NMP A;  3AOV A;  1GC0 A;  5IWQ A;  3QGU A;  2Z1Y A;  2YKX A;  3FVS A;  1YIY A;  1SZU A;  3KGW A;  1ASF A;  3PPL A;  4H51 A;  3FTB A;  3PD6 A;  4OT8 A;  4ZM4 A;  1OXP A;  1IJI A;  3WLX A;  1C0N A;  2W8J A;  4F5I A;  1I41 A;  2X5D A;  3VOM A;  1AAM A;  2E7I A;  4F5J A;  3RQ1 A;  1LC8 A;  3KE3 A;  3L44 A;  1KL2 A;  5LHA A;  3KGX A;  4E3R A;  3PAA A;  5DJ9 A;  3JWB A;  4AZK A;  1BQA A;  1ZOB A;  3E77 A;  3II0 A;  4IXS A;  4F4E A;  4JEY A;  1UKJ A;  1MDO A;  1GEY A;  4FL0 A;  4IY7 A;  3E9K A;  2YOB A;  3ZRQ A;  5JAY A;  1AAW A;  4UHO A;  2X8U A;  3T32 A;  1AY8 A;  2R5E A;  1ORD A;  2XBN A;  3NX3 A;  4AO9 A;  1MAP A;  1G4V A;  2YRI A;  2AEV A;  3K40 A;  1TAR A;  2GSA A;  3EI8 A;  2HZP A;  4M2J A;  2VYC A;  2D63 A;  3E2Y A;  1V2D A;  1DJE A;  3GJU A;  4W8I A;  1N2T A;  1X28 A;  4ADE A;  4A6R A;  3NDN A;  5HHY A;  3HL2 A;  3FVU A;  1BKG A;  2ZY3 A;  3UWC A;  2Z9W A;  4F5H A;  4EB7 A;  3AEN A;  4IX8 A;  4RKC A;  4K2M A;  2QLR A;  4Y0H A;  2W8W A;  2Q7W A;  4A00 A;  3ZZJ A;  2QB2 A;  3OP7 A;  1YJY A;  2VMV A;  1QJ3 A;  3TFU A;  1ELU A;  3TFT A;  4UOY A;  2WKA A;  2DOU A;  2VMP A;  2OAT A;  1YJZ A;  4PIW A;  3DXW A;  2D7Z A;  1GDE A;  3NYS A;  1IBJ A;  4XJP A;  1WYT A;  3ECD A;  1D7U A;  2JJH A;  1MDX A;  8AAT A;  1E5F A;  2ZSM A;  3LG0 A;  2JJG A;  3W1H A;  1LC7 A;  2HP2 A;  3NU7 A;  5EQC A;  2CB1 A;  3EI5 A;  1G4X A;  4A72 A;  3R4T A;  3EZS A;  4IYO B;  3WZF A;  1QIR A;  2RFV A;  3FDB A;  3K28 A;  5LH9 A;  1LK9 A;  4F5G A;  3BN1 A;  1AIB A;  1ASB A;  1ASL A;  1QGN A;  1S08 A;  1AKB A;  1W7L A;  2F8J A;  3F0H A;  3TAT A;  3ZRP A;  1AHY A;  2YKV A;  2Z67 A;  3GET A;  3UE8 A;  1JG8 A;  4K2B A;  4W1X A;  1SZS A;  4AOA A;  5C6U A;  5EIG A;  2C7T A;  2VI8 A;  2BIG A;  4GEB A;  3DU4 A;  1ASG A;  2Z9V A;  4N0W A;  2ZP7 A;  1DJU A;  3A9Z A;  2PB0 A;  2QB3 A;  2YHK A;  1O62 A;  1SFF A;  4QGR A;  4CBR A;  1ASC A;  4ITX A;  1W7M A;  4HF8 A;  3CBF A;  3NNK A;  1CL2 A;  3E2Z B;  2JG2 A;  2VIA A;  3AEJ A;  3K7Y A;  2BI3 A;  1O69 A;  4ZSW A;  5M4D A;  2AAT A;  3ZRR A;  3BCX A;  2JJE A;  5G2Q A;  1AMS A;  1QZ9 A;  3EI9 A;  4IXZ A;  4MY5 A;  4RM1 A;  2O7C A;  5E4Z A;  3W1I A;  2JGT A;  2X3L A;  5G4J A;  1S07 A;  3DYD A;  4JEW A;  3HDO A;  1JS3 A;  4WB0 B;  1EG5 A;  2CH2 A;  2QA3 A;  3BV0 A;  4GE9 A;  4LNL A;  3MC6 C;  4O6Z A;  3RBF A;  1LW5 A;  1MGV A;  1ASE A;  1TAS A;  1TAT A;  3F9T A;  3GBX A;  1MLZ A;  3G7Q A;  1AHE A;  3LV2 A;  1CQ7 A;  4XQ2 A;  3QHX A;  5G2P A;  3LY1 A;  2AY4 A;  4LNJ A;  1IX6 A;  3H14 A;  4LC3 A;  4WXF A;  3LVL B;  1OHY A;  5D95 A;  2BI5 A;  2WK7 A;  2R5C B;  3NRA A;  1AHF A;  1OHV A;  3I16 A;  3WKS A;  2Z1Z A;  4GE7 A;  4PVF A;  4U2H A;  4RIT A;  1B4X A;  4XK1 A;  2VMS A;  5G0A A;  3I5T A;  2BI1 A;  1BQD A;  3NYU A;  2R2N A;  1AY4 A;  2VMX A;  3EI6 A;  4MKK A;  1ASD A;  2DGM A;  3FCR A;  1ZC9 A;  4OMA A;  4Q76 A;  2CJG A;  3RBL A;  2VMR A;  3FKD A;  2CJD A;  3FQ7 A;  3AEJ C;  4A6U A;  3F6T A;  9AAT A;  1B5O A;  3LVK A;  2W7G A;  1TOJ A;  3COG A; 
#chains in the Genus database with same CATH topology
 1BT4 A;  4ADC A;  4F5F A;  4KYO A;  1XEY A;  2BI9 A;  2CIN A;  3LVJ A;  4PFF A;  3ELE A;  3N7N A;  1CZC A;  3E2Z A;  4U1T A;  3NTJ A;  3RCH B;  3USF A;  4ZDP A;  3NUB A;  1LS3 A;  3JWA A;  4OBU A;  4AO4 A;  2HUF A;  1UU1 A;  2HUI A;  4BHD A;  1ARI A;  1ARS A;  1P3W A;  3MAF A;  1I43 A;  4WLH A;  1WYU A;  1IX7 A;  2D65 A;  3DXV A;  2W7I A;  2HOR A;  4J8L A;  2EO5 A;  4WYC A;  1Z7D A;  4ZM3 A;  2AY5 A;  2GMU A;  1TPL A;  1WYV B;  3HT4 A;  2AEU A;  1ASM A;  2TPL A;  1WKH A;  4UHM A;  1M7Y A;  4UHN A;  5FT6 A;  4WBT A;  1W3U A;  4JE5 D;  2KFP A;  1GC4 A;  3AV7 A;  2O1B A;  5EFS A;  2D66 A;  1UU2 A;  1M0N A;  1D7S A;  1ARH A;  3KKI A;  1AMR A;  3WCO A;  4ITG A;  2YCN A;  3E2F A;  5EUE A;  1BJO B;  1PG8 A;  1WKG A;  2BIE A;  2EGY A;  3MBB A;  3P1T A;  2V0Y A;  3RUY A;  1W7N A;  1AJS B;  4JEX A;  3H9X A;  4W1V A;  1CZE A;  3MEB A;  1AKA A;  4ADB A;  5FT5 A;  1AKC A;  3VK4 A;  4CVQ A;  5J8Q A;  5AX8 A;  5D5S A;  3A8U X;  4OBV A;  1YOO A;  3QBO A;  1DJ9 A;  1O61 A;  2FNU A;  3H7F A;  1BW0 A;  4B98 A;  4A0H A;  1FG3 A;  1M0O A;  4A6T A;  2Z61 A;  3FFR A;  1GCK A;  2EH6 A;  1B5P A;  1KKP A;  4W5K A;  3AEP A;  3MC6 A;  5HXX A;  2VMY A;  1AHG A;  1CS1 A;  3Q8N A;  3IHJ A;  2CST A;  2VI9 A;  3N0L A;  3RCH A;  2VGS A;  4GRX A;  4WD2 A;  1H0C A;  1TOE A;  1DTY A;  3JTX A;  1IUG A;  1AIC A;  1OAT A;  4RJ0 A;  3HBX A;  1SVV A;  4XJO A;  4ZSY A;  3JW9 A;  2C81 A;  4W1W A;  1J32 A;  1Z3Z A;  2VMZ A;  3PA9 A;  1C7N A;  1SF2 A;  2GB3 A;  4JEV A;  3M5U A;  3WY7 A;  1DGD A;  1J04 A;  3GZD A;  4GE4 A;  1ASN A;  2Z20 A;  3WGC A;  1CQ8 A;  4MQQ A;  2WB6 A;  2VMN A;  2C44 A;  3WCN A;  3EI7 A;  1RV4 A;  3ZZK A;  1BJN A;  1ELQ A;  4P7Y A;  3B8X A;  1RVY A;  4IXO A;  1MAQ A;  1DKA A;  3A9X A;  1B9H A;  2FYF A;  3FVX A;  4HVK A;  2W7F A;  3E6G A;  2ZY4 A;  1AMA A;  4BMK A;  2VMQ A;  1UU0 A;  4L0O A;  2CJH A;  2VGU A;  1KAF A;  1CQ6 A;  2YKY A;  2VMW A;  1BJW A;  3ELP A;  3IF2 A;  2W7J A;  4M2M A;  4W91 A;  2CY8 A;  5DJ1 A;  4WXG A;  2BKW A;  1ZOD A;  2G6W A;  1JF9 A;  4R2N A;  2VGV A;  3PD6 B;  2OQX A;  2BI2 A;  2VGZ A;  1QIS A;  3HVY A;  2Z9X A;  1W23 A;  1SPA A;  4A0R A;  3BB8 A;  5EUN A;  4BQ0 A;  1Y4I A;  4TN4 A;  1KMK A;  3FQ8 A;  2AY3 A;  4IW7 A;  2QMA A;  2BWO A;  5DB5 A;  5DX5 A;  3DOD A;  4TMR A;  3PJ0 A;  4IYO A;  1GC3 A;  1IX8 A;  1M0P A;  2X5F A;  3NUI A;  4Q31 A;  2GMS A;  5EAV A;  1FC4 A;  1PMM A;  2YCT A;  3DR4 A;  3GZD C;  3EUC A;  2AY9 A;  1ARG A;  1YNU A;  2AY2 A;  1X0M A;  1JS6 A;  3CAI A;  3P6K A;  4RAE A;  4TV7 A;  4E1O A;  2ZY5 A;  5G09 A;  1GD9 A;  1WST A;  3CQ4 A;  1S09 A;  1AX4 A;  3FZ6 A;  4R5F A;  2W7E A;  2FQ6 A;  3JZL A;  3LVM A;  2BHX A;  4JE5 A;  1CL1 A;  5EUD A;  3VAX A;  1C4K A;  1EQB A;  2E7J A;  2PO3 A;  2CH1 A;  1GC2 A;  4LW2 A;  4RLG A;  3QN6 A;  1LKC A;  3AEN B;  3N4X A;  1H1C A;  2HP1 A;  4DBC A;  1B9I A;  1C9C A;  4ZAS A;  2WK9 A;  1ECX A;  3FSL A;  3B46 A;  5FT8 A;  3NYT A;  1X29 A;  3ASA A;  4NOG A;  2W7H A;  1DFO A;  3CQ6 A;  2FNI A;  3AEO A;  1WYT B;  3A2B A;  4F5L A;  3AEM A;  4CBS A;  4R5Z A;  3HMU A;  2R0T A;  3PGY A;  1XI9 A;  4R8D A;  4A0F A;  1TOG A;  3BWN C;  4JF1 A;  4KXK A;  4WB0 A;  4EU1 A;  2ZYJ A;  1SZK A;  2BIA A;  2ZUK A;  4ADD A;  1ASA A;  4EB5 A;  3GWP A;  2CAN A;  4OTL A;  4EMY A;  3W1J A;  5G4I A;  4WYD A;  4BA5 A;  1PMO A;  3FQA A;  3CQ5 A;  4Q6R A;  3DZZ A;  3B1D A;  5EAA A;  3AEL A;  1I48 A;  3ACZ A;  3L8A A;  4RIZ A;  3PDX A;  3EZ1 A;  3QM2 A;  4ZDL A;  5K8B A;  2VLH A;  3AAT A;  2R5C A;  4ATP A;  1M32 A;  1BS0 A;  1TOI A;  2DKB A;  2XH1 A;  3ASB A;  4WYE A;  5E3K A;  3LWS A;  5EIG B;  4JF0 A;  1MLY A;  1PFF A;  2JJF A;  1RVU A;  3B1C A;  4MQR A;  2W8V A;  1BJ4 A;  1N8P A;  4DGT A;  4Y0I A;  1M0Q A;  3EIB A;  2QBT A;  1D2F A;  1KMJ A;  2CFB A;  2O0R A;  2EZ1 A;  2ZJG A;  4XJL A;  3G8M A;  4B9B A;  2QSR A;  3N4R A;  2EPJ A;  3HQT A;  1AJR A;  4BA4 A;  4M2K A;  2AY1 A;  3VK3 A;  4A0G A;  1OHW A;  3TCM A;  4F5M A;  1V72 A;  4XEW A;  4CXQ A;  7AAT A;  3VP6 A;  3GR9 A;  2AY8 A;  3JU7 A;  4RJY A;  3WKR A;  4RKD A;  4GSA A;  3PDB B;  2A1V A;  1S0A A;  1LW4 A;  2AY6 A;  4MSO A;  3AEM C;  4CXR A;  2CTZ A;  5HDM A;  2WK8 A;  2OGE A;  3GSB A;  2W8T A;  3AOW A;  4AH3 A;  2D5Y A;  2BYL A;  3NU8 A;  4OC9 A;  1G7X A;  3FZ8 A;  4ATQ A;  1KL1 A;  3FRK A;  2C0R A;  4WLJ A;  4F5K A;  2GQN A;  2ORD A;  1WYV A;  1GBN A;  2PB2 A;  1GEX A;  2VMU A;  3MKJ A;  2ZC0 A;  1T3I A;  1D7R A;  1KKJ A;  1C7O A;  1AMQ A;  4MGR A;  1VEF A;  2VLF A;  2D64 A;  1CJ0 A;  4GDY A;  1V2E A;  2FN6 A;  3VK2 A;  2W7K A;  2YCP A;  2VIB A;  2YRR A;  4LNM A;  3MAD A;  3OKS A;  1V2F A;  5M4B A;  2ZSL A;  4WYG A;  1LC5 A;  4PFN A;  4KAM A;  2V1P A;  4XJM A;  1YAA A;  1VJO A;  1BJO A;  2W8U A;  4P3M A;  2YKU A;  3ATH A;  3FD0 A;  3PIU A;  1M4N A;  5E5I A;  3TQX A;  2DKJ A;  3WX9 A;  4WXB A;  1G7W A;  1AJS A;  2HUU A;  1RV3 A;  4Q75 A;  4MQP A;  2HOZ A;  1VP4 A;  3HLM A;  2FKI A;  3BCB A;  2VMO A;  3A9Y A;  1IVR A;  3R9A A;  2W7D A;  4LW4 A;  4WP0 A;  3I4J A;  4WYA A;  2EZ2 A;  1E5E A;  3DC1 A;  3BS8 A;  3UAK A;  1TOK A;  3WGB A;  1GEW A;  1IAY A;  1B8G A;  1AHX A;  1C7G A;  3BCA A;  5I92 A;  1QJ5 A;  2BWP A;  3RI6 A;  3BWN A;  2BWN A;  4N0B A;  4UQV A;  2OKK A;  1YJS A;  3FDD A;  3PDB A;  3N5M A;  5M46 A;  1I29 A;  2VGW A;  2Z9U A;  3MAF B;  2FM1 A;  2OKJ A;  1WYU B;  4FFC A;  2E54 A;  1OXO A;  3EIA A;  1AIA A;  5M49 A;  3FFH A;  2HOY A;  2DGL A;  4K2I A;  2HOX A;  1AY5 A;  4ISY A;  5BJ3 A;  2E7U A;  4ZWM A;  4XAU A;  4OYT A;  4DQ6 A;  4EFF A;  4OCA A;  2ZY2 A;  4AZJ A;  4E77 A;  2AY7 A;  1QIT A;  4ZLV A;  3BC8 A;  1N31 A;  3B1E A;  3D6K A;  3QPG A;  4Y0D A;  1M6S A;  4E3Q A;  5F9S A;  2DGK A;  4ZWV A;  1MDZ A;  3GZC A;  5FT4 A;  1IAX A;  1X2A A;  1ART A;  1EJI A;  2DR1 A;  1DGE A;  2OGA A;  3BWO A;  1O4S A;  3G0T A;  2VGT A;  1U08 A;  4J5U A;  2D7Y A;  2JIS A;  3N75 A;  5BJ4 A;  4JEZ A;  2G7J A;  2D61 A;  3FZ7 A;  2W7M A;  1YIZ A;  2W7L A;  3QI6 A;  3DR7 A;  1D7V A;  2VMT A;  3MAU A;  3ISL A;  4I8A A;  4MKJ A;  1FG7 A;  2BYJ A;  3DRD A;  1S06 A;  4ZAH A;  5TF5 A;  4WYF A;  5F8V A;  4ZDO A;  2NMP A;  3AOV A;  1GC0 A;  5IWQ A;  3QGU A;  2Z1Y A;  2YKX A;  3FVS A;  1YIY A;  1SZU A;  3KGW A;  1ASF A;  3PPL A;  4H51 A;  3FTB A;  3PD6 A;  4OT8 A;  4ZM4 A;  1OXP A;  1IJI A;  3WLX A;  1C0N A;  2W8J A;  4F5I A;  1I41 A;  2X5D A;  3VOM A;  1AAM A;  2E7I A;  4F5J A;  3RQ1 A;  1LC8 A;  3KE3 A;  3L44 A;  1KL2 A;  5LHA A;  3KGX A;  4E3R A;  3PAA A;  5DJ9 A;  3JWB A;  4AZK A;  1BQA A;  1ZOB A;  3E77 A;  3II0 A;  4IXS A;  4F4E A;  4JEY A;  1UKJ A;  1MDO A;  1GEY A;  4FL0 A;  4IY7 A;  3E9K A;  2YOB A;  3ZRQ A;  5JAY A;  1AAW A;  4UHO A;  2X8U A;  3T32 A;  1AY8 A;  2R5E A;  1ORD A;  2XBN A;  3NX3 A;  4AO9 A;  1MAP A;  1G4V A;  2YRI A;  2AEV A;  3K40 A;  1TAR A;  2GSA A;  3EI8 A;  2HZP A;  4M2J A;  2VYC A;  2D63 A;  3E2Y A;  1V2D A;  1DJE A;  3GJU A;  4W8I A;  3N4S A;  1N2T A;  1X28 A;  4ADE A;  4A6R A;  3NDN A;  5HHY A;  3HL2 A;  3FVU A;  1BKG A;  2ZY3 A;  3UWC A;  2Z9W A;  4F5H A;  4EB7 A;  3AEN A;  4IX8 A;  4RKC A;  4K2M A;  4H63 Q;  2QLR A;  4Y0H A;  2W8W A;  2Q7W A;  4A00 A;  3ZZJ A;  2QB2 A;  3OP7 A;  1YJY A;  2VMV A;  1QJ3 A;  3TFU A;  1ELU A;  3TFT A;  4UOY A;  2WKA A;  2DOU A;  2VMP A;  2OAT A;  1YJZ A;  4PIW A;  3DXW A;  2D7Z A;  1GDE A;  3NYS A;  1IBJ A;  4XJP A;  1WYT A;  3ECD A;  1D7U A;  2JJH A;  1MDX A;  8AAT A;  1E5F A;  2ZSM A;  3LG0 A;  2JJG A;  3W1H A;  1LC7 A;  2HP2 A;  3NU7 A;  5EQC A;  2CB1 A;  3EI5 A;  1G4X A;  4A72 A;  3R4T A;  3EZS A;  4IYO B;  3WZF A;  1QIR A;  2RFV A;  3FDB A;  3K28 A;  5LH9 A;  1LK9 A;  4F5G A;  3BN1 A;  1AIB A;  1ASB A;  1ASL A;  1QGN A;  1S08 A;  1AKB A;  1W7L A;  2F8J A;  3F0H A;  3TAT A;  3ZRP A;  1AHY A;  2YKV A;  2Z67 A;  3GET A;  3UE8 A;  1JG8 A;  4K2B A;  4W1X A;  1SZS A;  4AOA A;  5C6U A;  5EIG A;  2C7T A;  2VI8 A;  2BIG A;  4GEB A;  3DU4 A;  1ASG A;  2Z9V A;  4N0W A;  2ZP7 A;  1DJU A;  3A9Z A;  2PB0 A;  2QB3 A;  2YHK A;  1O62 A;  1SFF A;  4QGR A;  4CBR A;  5KTB A;  1ASC A;  4ITX A;  1W7M A;  4HF8 A;  3CBF A;  3NNK A;  1CL2 A;  3E2Z B;  2JG2 A;  2VIA A;  3AEJ A;  3K7Y A;  2BI3 A;  1O69 A;  4ZSW A;  5M4D A;  2AAT A;  3ZRR A;  3BCX A;  2JJE A;  5G2Q A;  1AMS A;  1QZ9 A;  3EI9 A;  4IXZ A;  4MY5 A;  4RM1 A;  2O7C A;  5E4Z A;  3W1I A;  2JGT A;  2X3L A;  5G4J A;  1S07 A;  3DYD A;  4JEW A;  3HDO A;  1JS3 A;  4WB0 B;  1EG5 A;  2CH2 A;  2QA3 A;  3BV0 A;  4GE9 A;  4LNL A;  3MC6 C;  4O6Z A;  3RBF A;  1LW5 A;  1MGV A;  1ASE A;  1TAS A;  1TAT A;  3F9T A;  3GBX A;  1MLZ A;  3G7Q A;  1AHE A;  3LV2 A;  1CQ7 A;  4XQ2 A;  4K05 A;  3QHX A;  5G2P A;  3LY1 A;  2AY4 A;  4LNJ A;  1IX6 A;  3H14 A;  4LC3 A;  4WXF A;  3LVL B;  1OHY A;  5D95 A;  2BI5 A;  2WK7 A;  2R5C B;  3NRA A;  1AHF A;  1OHV A;  3I16 A;  3WKS A;  2Z1Z A;  4GE7 A;  4PVF A;  4U2H A;  4RIT A;  1B4X A;  4XK1 A;  2VMS A;  5G0A A;  3I5T A;  2BI1 A;  1BQD A;  3NYU A;  2R2N A;  1AY4 A;  2VMX A;  3EI6 A;  4MKK A;  1ASD A;  2DGM A;  3FCR A;  1ZC9 A;  4OMA A;  4Q76 A;  2CJG A;  3RBL A;  2VMR A;  3FKD A;  2CJD A;  3FQ7 A;  3AEJ C;  4A6U A;  3F6T A;  9AAT A;  1B5O A;  2EYQ A;  3LVK A;  2W7G A;  1TOJ A;  3COG A; 
#chains in the Genus database with same CATH homology
 1BT4 A;  4ADC A;  4F5F A;  4KYO A;  1XEY A;  2BI9 A;  2CIN A;  3LVJ A;  4PFF A;  3ELE A;  3N7N A;  1CZC A;  3E2Z A;  4U1T A;  3NTJ A;  3RCH B;  3USF A;  4ZDP A;  3NUB A;  1LS3 A;  3JWA A;  4OBU A;  4AO4 A;  2HUF A;  1UU1 A;  2HUI A;  4BHD A;  1ARI A;  1ARS A;  1P3W A;  3MAF A;  1I43 A;  4WLH A;  1WYU A;  1IX7 A;  2D65 A;  3DXV A;  2W7I A;  2HOR A;  4J8L A;  2EO5 A;  4WYC A;  1Z7D A;  4ZM3 A;  2AY5 A;  2GMU A;  1TPL A;  1WYV B;  3HT4 A;  2AEU A;  1ASM A;  2TPL A;  1WKH A;  4UHM A;  1M7Y A;  4UHN A;  5FT6 A;  4WBT A;  1W3U A;  4JE5 D;  2KFP A;  1GC4 A;  3AV7 A;  2O1B A;  5EFS A;  2D66 A;  1UU2 A;  1M0N A;  1D7S A;  1ARH A;  3KKI A;  1AMR A;  3WCO A;  4ITG A;  2YCN A;  3E2F A;  5EUE A;  1BJO B;  1PG8 A;  1WKG A;  2BIE A;  2EGY A;  3MBB A;  3P1T A;  2V0Y A;  3RUY A;  1W7N A;  1AJS B;  4JEX A;  3H9X A;  4W1V A;  1CZE A;  3MEB A;  1AKA A;  4ADB A;  5FT5 A;  1AKC A;  3VK4 A;  4CVQ A;  5J8Q A;  5AX8 A;  5D5S A;  3A8U X;  4OBV A;  1YOO A;  3QBO A;  1DJ9 A;  1O61 A;  2FNU A;  3H7F A;  1BW0 A;  4B98 A;  4A0H A;  1FG3 A;  1M0O A;  4A6T A;  2Z61 A;  3FFR A;  1GCK A;  2EH6 A;  1B5P A;  1KKP A;  4W5K A;  3AEP A;  3MC6 A;  5HXX A;  2VMY A;  1AHG A;  1CS1 A;  3Q8N A;  3IHJ A;  2CST A;  2VI9 A;  3N0L A;  3RCH A;  2VGS A;  4GRX A;  4WD2 A;  1H0C A;  1TOE A;  1DTY A;  3JTX A;  1IUG A;  1AIC A;  1OAT A;  4RJ0 A;  3HBX A;  1SVV A;  4XJO A;  4ZSY A;  3JW9 A;  2C81 A;  4W1W A;  1J32 A;  1Z3Z A;  2VMZ A;  3PA9 A;  1C7N A;  1SF2 A;  2GB3 A;  4JEV A;  3M5U A;  3WY7 A;  1DGD A;  1J04 A;  3GZD A;  4GE4 A;  1ASN A;  2Z20 A;  3WGC A;  1CQ8 A;  4MQQ A;  2WB6 A;  2VMN A;  2C44 A;  3WCN A;  3EI7 A;  1RV4 A;  3ZZK A;  1BJN A;  1ELQ A;  4P7Y A;  3B8X A;  1RVY A;  4IXO A;  1MAQ A;  1DKA A;  3A9X A;  1B9H A;  2FYF A;  3FVX A;  4HVK A;  2W7F A;  3E6G A;  2ZY4 A;  1AMA A;  4BMK A;  2VMQ A;  1UU0 A;  4L0O A;  2CJH A;  2VGU A;  1CQ6 A;  2YKY A;  2VMW A;  1BJW A;  3ELP A;  3IF2 A;  2W7J A;  4M2M A;  4W91 A;  2CY8 A;  5DJ1 A;  4WXG A;  2BKW A;  1ZOD A;  2G6W A;  1JF9 A;  4R2N A;  2VGV A;  3PD6 B;  2OQX A;  2BI2 A;  2VGZ A;  1QIS A;  3HVY A;  2Z9X A;  1W23 A;  1SPA A;  4A0R A;  3BB8 A;  5EUN A;  4BQ0 A;  1Y4I A;  4TN4 A;  1KMK A;  3FQ8 A;  2AY3 A;  4IW7 A;  2QMA A;  2BWO A;  5DB5 A;  5DX5 A;  3DOD A;  4TMR A;  3PJ0 A;  4IYO A;  1GC3 A;  1IX8 A;  1M0P A;  2X5F A;  3NUI A;  4Q31 A;  2GMS A;  5EAV A;  1FC4 A;  1PMM A;  2YCT A;  3DR4 A;  3GZD C;  3EUC A;  2AY9 A;  1ARG A;  1YNU A;  2AY2 A;  1X0M A;  1JS6 A;  3CAI A;  3P6K A;  4RAE A;  4TV7 A;  4E1O A;  2ZY5 A;  5G09 A;  1GD9 A;  1WST A;  3CQ4 A;  1S09 A;  1AX4 A;  3FZ6 A;  4R5F A;  2W7E A;  2FQ6 A;  3JZL A;  3LVM A;  2BHX A;  4JE5 A;  1CL1 A;  5EUD A;  3VAX A;  1C4K A;  1EQB A;  2E7J A;  2PO3 A;  2CH1 A;  1GC2 A;  4LW2 A;  4RLG A;  3QN6 A;  1LKC A;  3AEN B;  3N4X A;  1H1C A;  2HP1 A;  4DBC A;  1B9I A;  1C9C A;  4ZAS A;  2WK9 A;  1ECX A;  3FSL A;  3B46 A;  5FT8 A;  3NYT A;  1X29 A;  3ASA A;  4NOG A;  2W7H A;  1DFO A;  3CQ6 A;  2FNI A;  3AEO A;  1WYT B;  3A2B A;  4F5L A;  3AEM A;  4CBS A;  4R5Z A;  3HMU A;  2R0T A;  3PGY A;  1XI9 A;  4R8D A;  4A0F A;  1TOG A;  3BWN C;  4JF1 A;  4KXK A;  4WB0 A;  4EU1 A;  2ZYJ A;  1SZK A;  2BIA A;  2ZUK A;  4ADD A;  1ASA A;  4EB5 A;  3GWP A;  2CAN A;  4OTL A;  4EMY A;  3W1J A;  5G4I A;  4WYD A;  4BA5 A;  1PMO A;  3FQA A;  3CQ5 A;  4Q6R A;  3DZZ A;  3B1D A;  5EAA A;  3AEL A;  1I48 A;  3ACZ A;  3L8A A;  4RIZ A;  3PDX A;  3EZ1 A;  3QM2 A;  4ZDL A;  5K8B A;  2VLH A;  3AAT A;  2R5C A;  4ATP A;  1M32 A;  1BS0 A;  1TOI A;  2DKB A;  2XH1 A;  3ASB A;  4WYE A;  5E3K A;  3LWS A;  5EIG B;  4JF0 A;  1MLY A;  1PFF A;  2JJF A;  1RVU A;  3B1C A;  4MQR A;  2W8V A;  1BJ4 A;  1N8P A;  4DGT A;  4Y0I A;  1M0Q A;  3EIB A;  2QBT A;  1D2F A;  1KMJ A;  2CFB A;  2O0R A;  2EZ1 A;  2ZJG A;  4XJL A;  3G8M A;  4B9B A;  2QSR A;  3N4R A;  2EPJ A;  3HQT A;  1AJR A;  4BA4 A;  4M2K A;  2AY1 A;  3VK3 A;  4A0G A;  1OHW A;  3TCM A;  4F5M A;  1V72 A;  4XEW A;  4CXQ A;  7AAT A;  3VP6 A;  3GR9 A;  2AY8 A;  3JU7 A;  4RJY A;  3WKR A;  4RKD A;  4GSA A;  3PDB B;  2A1V A;  1S0A A;  1LW4 A;  2AY6 A;  4MSO A;  3AEM C;  4CXR A;  2CTZ A;  5HDM A;  2WK8 A;  2OGE A;  3GSB A;  2W8T A;  3AOW A;  4AH3 A;  2D5Y A;  2BYL A;  3NU8 A;  4OC9 A;  1G7X A;  3FZ8 A;  4ATQ A;  1KL1 A;  3FRK A;  2C0R A;  4WLJ A;  4F5K A;  2GQN A;  2ORD A;  1WYV A;  1GBN A;  2PB2 A;  1GEX A;  2VMU A;  3MKJ A;  2ZC0 A;  1T3I A;  1D7R A;  1KKJ A;  1C7O A;  1AMQ A;  4MGR A;  1VEF A;  2VLF A;  2D64 A;  1CJ0 A;  4GDY A;  1V2E A;  2FN6 A;  3VK2 A;  2W7K A;  2YCP A;  2VIB A;  2YRR A;  4LNM A;  3MAD A;  3OKS A;  1V2F A;  5M4B A;  2ZSL A;  4WYG A;  1LC5 A;  4PFN A;  4KAM A;  2V1P A;  4XJM A;  1YAA A;  1VJO A;  1BJO A;  2W8U A;  4P3M A;  2YKU A;  3ATH A;  3FD0 A;  3PIU A;  1M4N A;  5E5I A;  3TQX A;  2DKJ A;  3WX9 A;  4WXB A;  1G7W A;  1AJS A;  2HUU A;  1RV3 A;  4Q75 A;  4MQP A;  2HOZ A;  1VP4 A;  3HLM A;  2FKI A;  3BCB A;  2VMO A;  3A9Y A;  1IVR A;  3R9A A;  2W7D A;  4LW4 A;  4WP0 A;  3I4J A;  4WYA A;  2EZ2 A;  1E5E A;  3DC1 A;  3BS8 A;  3UAK A;  1TOK A;  3WGB A;  1GEW A;  1IAY A;  1B8G A;  1AHX A;  1C7G A;  3BCA A;  5I92 A;  1QJ5 A;  2BWP A;  3RI6 A;  3BWN A;  2BWN A;  4N0B A;  4UQV A;  2OKK A;  1YJS A;  3FDD A;  3PDB A;  3N5M A;  5M46 A;  1I29 A;  2VGW A;  2Z9U A;  3MAF B;  2FM1 A;  2OKJ A;  1WYU B;  4FFC A;  2E54 A;  1OXO A;  3EIA A;  1AIA A;  5M49 A;  3FFH A;  2HOY A;  2DGL A;  4K2I A;  2HOX A;  1AY5 A;  4ISY A;  5BJ3 A;  2E7U A;  4ZWM A;  4XAU A;  4OYT A;  4DQ6 A;  4EFF A;  4OCA A;  2ZY2 A;  4AZJ A;  4E77 A;  2AY7 A;  1QIT A;  4ZLV A;  3BC8 A;  1N31 A;  3B1E A;  3D6K A;  3QPG A;  4Y0D A;  1M6S A;  4E3Q A;  5F9S A;  2DGK A;  4ZWV A;  1MDZ A;  3GZC A;  5FT4 A;  1IAX A;  1X2A A;  1ART A;  1EJI A;  2DR1 A;  1DGE A;  2OGA A;  3BWO A;  1O4S A;  3G0T A;  2VGT A;  1U08 A;  4J5U A;  2D7Y A;  2JIS A;  3N75 A;  5BJ4 A;  4JEZ A;  2G7J A;  2D61 A;  3FZ7 A;  2W7M A;  1YIZ A;  2W7L A;  3QI6 A;  3DR7 A;  1D7V A;  2VMT A;  3MAU A;  3ISL A;  4I8A A;  4MKJ A;  1FG7 A;  2BYJ A;  3DRD A;  1S06 A;  4ZAH A;  5TF5 A;  4WYF A;  5F8V A;  4ZDO A;  2NMP A;  3AOV A;  1GC0 A;  5IWQ A;  3QGU A;  2Z1Y A;  2YKX A;  3FVS A;  1YIY A;  1SZU A;  3KGW A;  1ASF A;  3PPL A;  4H51 A;  3FTB A;  3PD6 A;  4OT8 A;  4ZM4 A;  1OXP A;  1IJI A;  3WLX A;  1C0N A;  2W8J A;  4F5I A;  1I41 A;  2X5D A;  3VOM A;  1AAM A;  2E7I A;  4F5J A;  3RQ1 A;  1LC8 A;  3KE3 A;  3L44 A;  1KL2 A;  5LHA A;  3KGX A;  4E3R A;  3PAA A;  5DJ9 A;  3JWB A;  4AZK A;  1BQA A;  1ZOB A;  3E77 A;  3II0 A;  4IXS A;  4F4E A;  4JEY A;  1UKJ A;  1MDO A;  1GEY A;  4FL0 A;  4IY7 A;  3E9K A;  2YOB A;  3ZRQ A;  5JAY A;  1AAW A;  4UHO A;  2X8U A;  3T32 A;  1AY8 A;  2R5E A;  1ORD A;  2XBN A;  3NX3 A;  4AO9 A;  1MAP A;  1G4V A;  2YRI A;  2AEV A;  3K40 A;  1TAR A;  2GSA A;  3EI8 A;  2HZP A;  4M2J A;  2VYC A;  2D63 A;  3E2Y A;  1V2D A;  1DJE A;  3GJU A;  4W8I A;  3N4S A;  1N2T A;  1X28 A;  4ADE A;  4A6R A;  3NDN A;  5HHY A;  3HL2 A;  3FVU A;  1BKG A;  2ZY3 A;  3UWC A;  2Z9W A;  4F5H A;  4EB7 A;  3AEN A;  4IX8 A;  4RKC A;  4K2M A;  4H63 Q;  2QLR A;  4Y0H A;  2W8W A;  2Q7W A;  4A00 A;  3ZZJ A;  2QB2 A;  3OP7 A;  1YJY A;  2VMV A;  1QJ3 A;  3TFU A;  1ELU A;  3TFT A;  4UOY A;  2WKA A;  2DOU A;  2VMP A;  2OAT A;  1YJZ A;  4PIW A;  3DXW A;  2D7Z A;  1GDE A;  3NYS A;  1IBJ A;  4XJP A;  1WYT A;  3ECD A;  1D7U A;  2JJH A;  1MDX A;  8AAT A;  1E5F A;  2ZSM A;  3LG0 A;  2JJG A;  3W1H A;  1LC7 A;  2HP2 A;  3NU7 A;  5EQC A;  2CB1 A;  3EI5 A;  1G4X A;  4A72 A;  3R4T A;  3EZS A;  4IYO B;  3WZF A;  1QIR A;  2RFV A;  3FDB A;  3K28 A;  5LH9 A;  1LK9 A;  4F5G A;  3BN1 A;  1AIB A;  1ASB A;  1ASL A;  1QGN A;  1S08 A;  1AKB A;  1W7L A;  2F8J A;  3F0H A;  3TAT A;  3ZRP A;  1AHY A;  2YKV A;  2Z67 A;  3GET A;  3UE8 A;  1JG8 A;  4K2B A;  4W1X A;  1SZS A;  4AOA A;  5C6U A;  5EIG A;  2C7T A;  2VI8 A;  2BIG A;  4GEB A;  3DU4 A;  1ASG A;  2Z9V A;  4N0W A;  2ZP7 A;  1DJU A;  3A9Z A;  2PB0 A;  2QB3 A;  2YHK A;  1O62 A;  1SFF A;  4QGR A;  4CBR A;  5KTB A;  1ASC A;  4ITX A;  1W7M A;  4HF8 A;  3CBF A;  3NNK A;  1CL2 A;  3E2Z B;  2JG2 A;  2VIA A;  3AEJ A;  3K7Y A;  2BI3 A;  1O69 A;  4ZSW A;  5M4D A;  2AAT A;  3ZRR A;  3BCX A;  2JJE A;  5G2Q A;  1AMS A;  1QZ9 A;  3EI9 A;  4IXZ A;  4MY5 A;  4RM1 A;  2O7C A;  5E4Z A;  3W1I A;  2JGT A;  2X3L A;  5G4J A;  1S07 A;  3DYD A;  4JEW A;  3HDO A;  1JS3 A;  4WB0 B;  1EG5 A;  2CH2 A;  2QA3 A;  3BV0 A;  4GE9 A;  4LNL A;  3MC6 C;  4O6Z A;  3RBF A;  1LW5 A;  1MGV A;  1ASE A;  1TAS A;  1TAT A;  3F9T A;  3GBX A;  1MLZ A;  3G7Q A;  1AHE A;  3LV2 A;  1CQ7 A;  4XQ2 A;  4K05 A;  3QHX A;  5G2P A;  3LY1 A;  2AY4 A;  4LNJ A;  1IX6 A;  3H14 A;  4LC3 A;  4WXF A;  3LVL B;  1OHY A;  5D95 A;  2BI5 A;  2WK7 A;  2R5C B;  3NRA A;  1AHF A;  1OHV A;  3I16 A;  3WKS A;  2Z1Z A;  4GE7 A;  4PVF A;  4U2H A;  4RIT A;  1B4X A;  4XK1 A;  2VMS A;  5G0A A;  3I5T A;  2BI1 A;  1BQD A;  3NYU A;  2R2N A;  1AY4 A;  2VMX A;  3EI6 A;  4MKK A;  1ASD A;  2DGM A;  3FCR A;  1ZC9 A;  4OMA A;  4Q76 A;  2CJG A;  3RBL A;  2VMR A;  3FKD A;  2CJD A;  3FQ7 A;  3AEJ C;  4A6U A;  3F6T A;  9AAT A;  1B5O A;  2EYQ A;  3LVK A;  2W7G A;  1TOJ A;  3COG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...