3WGDA

Crystal structure of erp46 trx1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
HMSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin domain-containing protein 5
publication title Radically different thioredoxin domain arrangement of ERp46, an efficient disulfide bond introducer of the mammalian PDI family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wgdA00
5A4WA 1PRXA 2PGTA 2X99A 1WIKA 1ABAA 4LLRA 5J4UA 2CT6A 1ZL9A 2VL3A 3H8QA 1TK8B 3EMPA 3F8UA 2JACA 2MBTA 2EIOA 2HSHA 5JWQB 4EVMA 3DYRA 3ERWA 3A5WA 5G2ZA 1LJRA 1J08A 2VLVA 3EE2A 4O92A 3I9V2 17GSA 5JCUA 4KA0A 1FOVA 6GSSA 5L71A 2OE0A 4I6XA 4DSSB 1X5EA 1O85A 1OYJA 2H1BA 5CREA 4JRRA 5DQSA 3D5JA 1Z6NA 2H76A 3L0HA 1BJXA 2GDRA 3VWXA 2C0EA 2DJ3A 4ZL7A 4ULXA 4Q5QA 1GRXA 3DXBA 1V9WA 1S3CA 3DRNA 3IAS2 4K7NA 1F2EA 2PN8A 1HQOA 4E8HA 3NOFA 1JHBA 2DJ2A 1FG4A 1FW1A 3ZRDA 5D9XA 3WGXA 2HI7A 4GLTA 1TOFA 4FYCA 4K1FA 3HY2A 1NM3A 3ZLPA 2X64A 1GTAA 1G7EA 1G7OA 5C00A 3GN3A 4EF0A 2FWHA 1I5GA 3IOSA 5A4UA 4KCAA 1GL8A 3PR8A 2ES7A 2C0DA 4MH2A 3BCIA 5ECRB 1K0BA 3HVVA 3OR5A 5D9TA 5IIZA 1ZOFA 4HJ2A 2YV9A 2CX4A 1XWCA 4POMA 1PMTA 3LFLA 1GSUA 1M2AA 2VD1A 1U87A 3HKRA 1QMVA 4YAVA 3Q74A 2V41A 2AYTA 3IE3A 4XHMA 4GSTA 3C7MA 1XWAA 1ILOA 2BMXA 2MBSA 4EXJA 4ECIA 3G9BA 3FR3A 3M9JA 2C4JA 2IIYA 2CQ9A 3IBHA 2LNSA 2XC2A 2C3NA 2QKEA 4K7IA 4Q5FA 2WDUA 2H0HA 3PINA 4NHWA 2LJRA 1PGTA 4XRAA 3QD9A 3TOTA 4F0CA 2GQLA 2HZFA 3CSJA 3FZ5A 1T1VA 4PNFA 1Z6MA 2EIRA 2VIMA 2XBIA 5HFGA 3QPMA 3GSSA 4IKHA 1YKCA 5G31A 1PL1A 2FGXA 3A2VA 2YWOA 4EL1A 4V2MA 3ZL5A 2KUCA 2LSTA 4YAPA 4ML6A 2N5AA 2LNTA 3L9UA 3HA9A 2L5LA 4N30A 2GSQA 5HFKA 2HZEB 1OC3A 3EU3A 2MMNA 4ZBDA 5IPGA 1A2MA 2VCWA 3IA1A 3DIEA 2GT5A 3NZNA 1A2LA 2GSTA 3TJFA 1K3LA 3UBKA 4NPBA 4IJ3A 4O32A 4V1Ap 2C3QA 4H86A 3V1WA 1GUKA 3MSZA 1TW9A 3LYKA 5HR0A 1UA5A 4PQHA 4XS6A 2WCIA 4HDEA 3WYWA 4KH7A 1OKTA 3NIVA 3EYTA 1BQ7A 3HYPA 2M80A 2LJKA 3CSHA 11GSA 3GV1A 1ACVA 2OKAA 1HNBA 1X5DA 1J0FA 2B5YA 3I69A 1XVQA 4FYUA 1R4WA 1K0CA 3M9KA 1GSQA 1XIYA 2HXKA 2YV7A 1JZRA 1IYIA 3JCML 4F03A 1F9MA 3C1SA 5HR1A 2L6DA 1MDJA 2FD3A 4BVXA 5DJMA 2VCTA 2HLSA 4HQZA 4POBA 2O89A 2GQKA 1GH2A 2TIRA 4KGIA 1SKSB 2LKUA 3LXTA 2YJ7A 3BD2A 2H6XA 1XZOA 1VGLA 2B3SA 2CZ3A 2MMOA 3GFKA 1R26A 3TRXA 1ML6A 5B8BA 1EV4A 1SU9A 5KEJA 2LS5A 4ZXGA 3M0FA 1UVZA 5GAPD 1V40A 1YEPA 4MZBA 2OJLA 3ZITA 2LRTA 1USBA 3IXRA 3KH7A 2X8HA 1ZCPA 1XOBA 5COHA 4OCFA 1TU7A 3E3EA 2RUFA 3C1RA 2G0FA 22GSA 4GQCA 3GKXA 1PL2A 3ZIJA 4MJEA 3VWUA 2L59A 4ZIJA 4TXOA 1XCCA 2EIQA 4XCSA 2V32A 3DD3A 4NAXA 3A2XA 4D73B 8GSSA 1O81A 2I9HA 1X0RA 2L57A 4K0NA 2C8UA 1YJ6A 3HHVA 2DJ0A 3DGQA 3IC4A 4ZL9A 2FWEA 1WP0A 1F6MC 2H1DA 4AJ8A 2H1AA 3TKRA 4FH8A 5CNWA 1THXA 2REMA 1JFUA 3FHKA 3GIXA 2RM5A 5EY6A 5GSSA 1OAZA 4BPYA 2VCQA 2H19A 3F9UA 1M2BA 5F0GA 4L5LA 3H1NA 2DMLA 2MMZA 1U3IA 4JZQA 2HRFA 2EC4A 3L4NA 4J56E 4ZB6A 3TJJA 1GSYA 1NHYA 2H8LA 4GSNA 4BWQA 1GP1A 3RDWA 4IP1A 4CDOA 1V98A 4K8MA 4K0GA 4AJ7A 3P7XA 3U5RE 3GMFA 4DEJA 4X1UA 2D2ZA 5G1LA 4FYBA 1TDIA 2YANA 1TRWA 1K0AA 3F6DA 1WWJA 3GKKA 3VPTA 1QFNA 2QGVA 2HNLA 1FB0A 19GSA 3LORA 4N0ZA 1EOHA 3P90A 3QMXA 4FO5A 1THOA 1T00A 4O5RA 2JZTA 2H72A 3TJBA 2DLXA 4TR1A 5HFIA 3LJRA 3UMAA 4IS0A 1YY7A 1PKWA 1XW6A 3L9SA 2GZZA 4TR3A 1ERWA 1A23A 3US3A 4IHUA 4MMMA 2MZCA 5J3RA 3KTBA 1QUWA 3PH9A 1OC9A 2R6KA 2ALBA 2ON5A 2Z9SA 1PA3A 2H70A 5AISA 4N11A 1Z9HA 3W8SA 3M3MA 2RM6A 2C3TA 1YDKA 4PQ1A 1FO5A 2FA4A 4MCUA 4I5QA 2K8VA 4EDYA 3H79A 3ZREA 1N2AA 4OFMA 1ZYEA 1AAZA 4KCEA 4WBJA 2IMIA 4HJMA 1EZKA 1NHOA 1X5CA 4EC0A 4OO5A 2DBCA 1MD3A 2KP2A 2B5XA 6GSWA 2IMDA 4EKZA 3CXGA 3GTUA 3HJPA 1SL1B 1VRSD 1A8YA 3MWHA 3QDNA 3TCOA 4PUFC 3APQA 1GSEA 1TI3A 5B6MA 2HSYA 2LJAA 2WB9A 1MD4A 4KNDA 3UARA 2B5EA 5G5EA 2WFCA 4HQSA 1VF1A 3RBTA 3ZIVA 3QAGA 1SENA 1MEKA 3APOA 2FLSA 3VFIA 1ON4A 4Q5NA 3ZMKA 3A2WA 4GRFA 4NHZA 2OE1A 2LQOA 2GZPA 2KP1A 5G30A 2DSAA 1TKDB 5DBQA 5KN1A 1A0FA 5DVBA 3GA4A 1B9XC 1T7PB 4G19A 4GQFA 1PX6A 1XBSA 2AUVA 1UN2A 3FR9A 1YKAA 4KSOA 4MDCA 5D93A 2H30A 2YOIA 1GLPA 2IMFA 5H5SA 2OBKA 3KTLA 4X43A 3RAZA 4KUNA 2FCHA 5JCGA 1TRSA 1HNCA 1AQXA 1EP8A 1V57A 4I8BA 4XS4A 3IK9A 3S9FA 3G7YA 3FEUA 4F9ZA 2AJQB 5IOXA 5ABRA 4K9ZA 3IV4A 1AC1A 4QQ7A 4HUAA 1GWCA 3GL5A 1B4QA 5F05A 1SJIA 4PXOA 4QL9A 3GURA 2O87A 3H4KA 4JU5A 3J7Yk 2GSSA 4E8EA 4K6XA 4L5OA 2C0GA 3FRCA 4KE3A 2OADA 4PUAA 4F0BA 2YZUA 3F63A 1WE0A 2YWIA 2YPMA 6GSXA 5DCGA 3GNJA 1QK8A 2O8VB 2VL2C 1WRYA 1GNWA 4LMVA 5ECQB 5C04A 2H0GA 4MPFA 1RK4A 1T8EB 2PERA 2IL3A 1A8LA 3GKMA 2MYGA 2FA8A 2HE3A 2A2SA 6GSYA 3KM6A 2WS2A 2ZUPA 3ERGA 1G0TA 2KHPA 3UJ1A 3F6FA 1UC7A 3ZVJD 2H6YA 2C0FA 3HXSA 3FKFA 4V2LA 2F8FA 3TB2A 3HCZA 4CHSA 3C8EA 3HDCA 4KX4A 1O8XA 1GULA 5FT3A 2H74A 3DKSA 5ECPB 3C73A 3LGCA 3P8WA 2HT9A 2CVKA 5IMVA 1WPIA 1U88A 2DJKA 3APSA 3KZQA 5HR3A 2VL9A 4OD7A 3F4RA 2FWFA 1YF0A 4IW9A 4ZL8A 3I43A 2F9SA 3LXZA 1VF4A 2GLRA 5D96A 2ZCTA 5FWGA 3CBUA 3DWVA 4MP4A 1GUHA 2X8CA 4RUVA 2PBJA 3LG6A 5A5KA 1IYHA 1Q4JA 3VLNA 2H66A 5ECNB 2V2GA 2WGRA 1SYRA 1JLWA 5EL8A 1B4PA 2QC7A 2R5GA 5ELAA 1U6TA 1PQNA 4HU7A 3ZFBA 2GSRA 2C1YA 3GKNA 4IBPA 3LYPA 2MMAA 3K8NA 1HNAA 4TXOB 1EEJA 3CYNA 2H75A 3N9JA 4TVEA 4DSRA 4L0WA 3TJGA 1OVNA 3GHAA 2LEGA 2M46A 2RUEA 3HJOA 5IMCA 1VF3A 2YWNA 3QAVA 4TR0A 4GTUA 1AIUA 5F07A 2LQQA 1XW9A 2NBSA 2XBQA 5DCHA 4PQIA 16GSA 3WGEA 1PN9A 4ECCA 3F3RA 1M9AA 2VL2A 1ZMAA 4WR5A 4HEA2 1X9WB 3CSIA 3BOAA 3EINA 1AW9A 1GTIA 2PMTA 1BYEA 2E2MA 1OE8A 2OACA 5E4WA 3IR4A 1H75A 3GSTA 4L0UA 4RQXA 4ZBBA 4AGSA 5IMAA 4YQMA 2H71A 2CA8A 1KBNA 4TN8A 2CAIA 4OFTA 3RHBA 4HOJA 1E2YA 3FZ4A 2NDOA 3KCMA 1I9DA 4BWSA 5INYA 1ZGNA 6GSUA 1ERVA 5AIXA 4ZB8A 2O7KA 3BCKA 3DVXA 3VI7A 4OFNA 5LNKe 1SD8A 1TRUA 4IJIA 4MJAA 4TR1B 3GH6A 2M72A 4IVFA 3D21A 4MJCA 2FHEA 3CTGA 5DDLA 13GSA 3KD0A 1PSQA 4G9HA 2GGTA 1MDKA 4JR4A 2N5BA 2I4AA 3KH9A 10GSA 2GQMA 2LV3A 1H4OA 1OE7A 2JU5A 2F8AA 1OC9B 2GTUA 12GSA 2R2JA 3Q19A 1V58A 2VO4A 3IAM2 5KN3A 2XHFA 5G1KA 1SJ6A 2VCVA 2VCZA 1N8JA 1SD9A 2XPEA 4O7HA 2HRNA 4ACSA 1G6YA 4POLA 2NPBA 1YZXA 4MJBA 1B9YC 2BJXA 1QGVA 3KEBA 3TDGA 2AHEA 3DMLA 3CTFA 1A0RP 1JZWA 4RI7A 5DALA 4JBBA 4Z7XA 1KTEA 5IOWA 1T3BA 3DVWA 3IPZA 2VM2A 3EU4A 2RLIA 1GUMA 1XW5A 3GTUB 2VLUA 4GF0A 2B1LA 4AF2A 1TK0B 3RHCA 3D4MA 4HU9A 4MF5A 3M8NA 4KSMA 2P5RA 2B1KA 1F3BA 1FAAA 1U3AA 2NVLA 2FWGA 1QQ2A 1V2AA 3FYGA 2N5FA 3D0ZA 1K3YA 5IMZA 5J5NA 2IN3A 2A4VA 3AY8A 5IPHA 1OC8A 2R37A 2AB6A 2KLXA 4WF4A 4EUYA 4OMVA 2H0IA 2E2GA 4BA7A 2VAFA 4RQRA 4OWYA 5CRGA 4YQUA 3QOUA 1GTUA 5JWOB 1TTZA 2GZYA 5DAKA 3TJKA 1T4ZA 4KDYA 3C71A 2WULA 4MH3A 4IN0A 2J23A 5ID2A 5GAND 2FUG2 4JR6A 4P3YB 1EV9A 4XS1A 1SK1A 3VWWA 4YH2A 1EOGA 3FR6A 2VCXA 1KEBA 2YN1A 5AGYA 5GZZB 3TGZA 1PX7A 1MTCA 5J9BA 5LCZA 5DQYA 3WT2A 2OA7A 1GTBA 2VUPA 2GVPA 4KDUA 2IMKA 2YJHA 4N10A 4MZCA 2IFQA 3FZ9A 4XS4B 4PGTA 4LA1A 3UVTA 1W89A 3HZ8A 4GCIA 4POKA 2TRXA 5JWRB 1M7TA 2I81A 4NXIA 5A4VA 4EE0A 3CMIA 4WEYA 3SBCA 4QL7A 5D73A 3VWVA 2L6CA 2L5OA 1BEDA 3GX0A 4IQ1A 5CRWA 2PVQA 4MPGA 4PNGA 2G2QA 2K8SA 3QAWA 3ED3A 1ERTA 1W4VA 1S3DA 4ZB9A 3UVHA 3KP9A 2J9HA 1X9MB 1SK2A 2B7KA 3KMOA 1URMA 1BX9A 1M0UA 1YF1A 5B6NA 4TW5A 2JZRA 3HD5A 2YNXA 2BTOT 2VD0A 2NTOA 1GSDA 3N5OA 4NV2A 5CRHA 2LUSA 4DSQA 1EGOA 3CRUA 1SL2B 4GSSA 5EVOA 2IPAA 4JE1A 3VK9A 2F3MA 1JZOA 3MAKA 3F3QA 1SJZA 1XPVA 5GSTA 1K0MA 3EWLA 4NMUA 4NWYA 3D22A 5ECKB 4PURA 1SKRB 6GSVA 5KN0A 1GNEA 1Y25A 1O8WA 1B8XA 3E9JB 2PUKC 3D4TA 3EURA 2P0GA 3KXOA 4WXTA 4MLYA 3GL3A 3UAPA 1A2JA 2H01A 4Q5RA 1S3AA 2YZHA 1XXUA 1M2DA 3FY7A 1X9SB 1YEXA 3ME8A 2CAQA 3FK8A 3ISOA 3VI5A 2CVBA 1TXXA 1YQ1A 1T4YA 2R4VA 3TKPA 4XIHA 2YP6A 5HR2A 4TOPA 18GSA 1SKWB 5F06A 2DJJA 5D9VA 2WRTA 4ILFA 1XWBA 2F51A 4V1Ag 2RIIA 3UBLA 2KOKA 1BAYA 1SK0A 5CYYA 3ME7A 4WKWA 3F4SA 3P2AA 5ECLB 4NV5A 5J9CA 1VF2A 5ECMB 3KGKA 1RW1A 1FB6A 4YQVA 4MABA 2DMMA 2CX3A 3TRPA 4DSSA 4KDXA 3IRAA 4MF6A 1CQGA 2X8GA 3J7Yb 4JEDA 5IM9A 1AXDA 1NSWA 3IK7A 3GYKA 3QCPA 2WZ9A 5CP1A 1WMJA 2I1UA 1K0OA 3FZAA 3MNGA 5D9WA 2AAWA 2IJYA 3RPPA 1M99A 1R5AA 2IWTA 1JZDA 2XPDA 2H1GA 4G10A 4I2TA 5FHIA 1HD2A 4CW9A 3QFAC 3VURA 2FY6A 3U6VA 1C72A 2JSYA 4IELA 2YCDA 2R3XA 3KIJA 5E59A 1XOAA 2OBIA 2V6KA 1F3AA 4WBRD 4WETA 4I2UA 4ECBA 1Z5YE 3GUSA 5B8AA 2IMEA 5AN1A 2P5QA 3EMXA 4IP6A 3WT1A 1TP9A 1FVKA 2VOCA 1TK5B 1TJDA 3FW2A 2CZ2A 4LMWA 5DJLA 1G6WA 4TRXA 3L78A 3F0IA 3E0UA 3G7JA 4ECJA 4V2NA 4N0VA 4MK3A 3ZYWA 1BG5A 5CRDA 4KB3A 3UIWA 1O6JA 3WD6A 2PU9C 2VLTA 3O6TA 1R7HA 4I97A 1Z3EA 4J2FA 4ISDA 1A24A 2PPTA 3I6AA 1TRVA 4TR4A 1QXHA 2K9FA 1LU4A 4EDZA 3ZTLA 4ML1A 4KW6A 1LBKA 2L4CA 4L8EA 2AV4A 1K0NA 1AQVA 5ELGA 5H5RA 5KN2A 4BL7A 3M1GA 1XVWA 3TKSE 5IO2A 4IGJA 1XWGA 1Y6EA 4MF7A 5D8IA 9GSSA 14GSA 1EWXA 2LRCA 1JLVA 2JZSA 4X0XA 1EP7A 2HFDA 3Q6OA 2CVDA 1GSFA 5G5FA 5LD0A 3A3TA 5DALB 4FIWA 2V6OA 4KAEA 1Z7RA 1M9BA 5ECHB 3TKSC 5IQYA 3KP8A 1DBYA 3LEFA 3TKQA 2HZEA 5CAXA 3VPQA 5AIVA 4MZWA 4K7OA 3UL3A 1F37A 5IMDA 3ZFLA 2LTKA 1FHEA 3D6IA 3QR6A 5ENUA 4OO4A 2GS3A 1EGRA 1ERUA 3ZVJA 1FVJA 1GLQA 4HS1A 3IHQA 4GXZA 2VM1A 3G7IA 3GRXA 2JADA 3TRQA 3LQ7A 1ST9A 2P31A 1SYXA 4MA9A 1XFLA 2ON7A 3W6GA 3KJYA 5IO0A 4F82A 2FNOA 3CRTA 2DC5A 2DJ1A 4BVYA 2O85A 20GSA 1Z7PA 4WR4A 3R2QA 1SL0B 1CQHA 5CO3A 5DAKB 4HZ4A 4DVCA 3F4TA 4J57E 5ID2B 1PD21 4IQAA 2E0QA 3BBYA 1O73A 2I3YA 4TKYA 2JL4A 4OCEA 5IMFA 1DUGA 3H93A 6GSTA 4ID0A 5J41A 3BJ5A 3LWAA 4TXVA 3DEXA 2HYXA 2PVOC 3TOUA 3W8JA 1RQMA 4ZILA 2YWMA 2PWJA 1K0DA 2CV4A 2C80A 5JCWA 3TUEA 1TI1A 4HI7A 1HYUA 5B7CA 1K3OA 2V1MA 1R5PA 2DIZA 2DIYA 1DE1A 4ZBAA 1O7UA 3WGDA 3L9VA 3HJMA 2ZNMA 3IDVA 2IFQB 3QFBC 4EO3A 4RI6A 2B6MA 3ZZXA 4XRDA 7GSSA 2GT6A 3HVXA 3KMNA 5ECOB 3EVIA 4PX1A 3HVSA 2QSIA 1EEMA 4GWRA 2E7PA 2K6VA 3UEMA 1E6BA 4K2DA 4HZ2A 3HZ4A 3TKSA 1XWKA 1AQWA 1MDIA 5EPFA 1B48A 3UOMA 4WF5A 4XTSA 4AJ6A 3O76A 1TU8A 5HQPA 4G2EA 1Q98A 3PGTA 3EC3A 1ZYQB 4LL4B 3RPNA 2JSZA 3GH9A 3ZMLA 5F8BA 4D73A 1PKZA 2B7JA 5ECIB 3GX8A 3MDKA 4LL1B 2K18A 4F2IA 3ERFA 1DSBA 2LRNA 1J9BA 2OE3A 3LSZA 1NW2A 2H73A 2H6ZA 3SWLA 5ECSA 1DE2A 1GSSA 2TRCP 1WJKA 1KNGA 3O3TA 3Q18A 5H5QA 1WOUA 2A2RA 2WJUA 2L4QA 1OKDA 1AUCA 1ZZYA
chains in the Genus database with same CATH superfamily
5A4WA 2HRAA 1PRXA 2PGTA 2X99A 1WIKA 1ABAA 2R0PA 4LLRA 5J4UA 2CT6A 1ZL9A 2VL3A 3H8QA 1TK8B 3EMPA 3F8UA 4K5RA 2JACA 4A5PA 2MBTA 2EIOA 2HSHA 5JWQB 4EVMA 3DYRA 3ERWA 3A5WA 5G2ZA 1LJRA 1J08A 2VLVA 3EE2A 4O92A 3I9V2 17GSA 5JCUA 4KA0A 1FOVA 6GSSA 5L71A 2OE0A 4I6XA 4DSSB 1X5EA 1O85A 1OYJA 2H1BA 5CREA 4JRRA 5BRTA 5DQSA 3D5JA 1Z6NA 2H76A 3L0HA 1BJXA 2GDRA 3VWXA 2C0EA 2DJ3A 4ZL7A 4ULXA 3MYDA 4Q5QA 1GRXA 3DXBA 1V9WA 1S3CA 3DRNA 3IAS2 4K7NA 1F2EA 2PN8A 1HQOA 4E8HA 3NOFA 1JHBA 2DJ2A 1FG4A 1FW1A 3ZRDA 5D9XA 3WGXA 2HI7A 5KOXA 4GLTA 1TOFA 4FYCA 4K1FA 3HY2A 1NM3A 3ZLPA 2X64A 1GTAA 1G7EA 1G7OA 5C00A 3GN3A 4EF0A 2FWHA 1I5GA 3IOSA 4HSCX 5A4UA 4KCAA 1GL8A 3PR8A 2ES7A 2C0DA 5BMUA 4MH2A 3R3EA 3BCIA 5ECRB 1K0BA 3HVVA 3OR5A 5D9TA 5IIZA 1ZOFA 1ZYPA 4HJ2A 2YV9A 2CX4A 1XWCA 4POMA 1PMTA 3LFLA 1GSUA 1M2AA 2VD1A 1U87A 3HKRA 1QMVA 4YAVA 3Q74A 2V41A 2AYTA 2HRKA 3IE3A 4XHMA 4GSTA 3C7MA 1XWAA 1ILOA 2BMXA 2MBSA 4EXJA 4ECIA 3G9BA 3FR3A 3M9JA 2C4JA 2IIYA 2CQ9A 3IBHA 2LNSA 2XC2A 2C3NA 2QKEA 4K7IA 4Q5FA 2WDUA 2H0HA 3PINA 4NHWA 2LJRA 1PGTA 4XRAA 3QD9A 3TOTA 4F0CA 2GQLA 2HZFA 3CSJA 3FZ5A 1T1VA 4PNFA 1Z6MA 2EIRA 2VIMA 2XBIA 5HFGA 3QPMA 4K5SA 3GSSA 4IKHA 1YKCA 5G31A 1PL1A 2FGXA 3A2VA 2YWOA 4EL1A 4V2MA 3ZL5A 2KUCA 2LSTA 4YAPA 4ML6A 2N5AA 2LNTA 3L9UA 3HA9A 2L5LA 4N30A 2GSQA 5HFKA 4EIQA 2HZEB 1OC3A 3EU3A 2MMNA 4ZBDA 5IPGA 1A2MA 2VCWA 3IA1A 3DIEA 2GT5A 3NZNA 1A2LA 2GSTA 3TJFA 1K3LA 3UBKA 4NPBA 4IJ3A 4O32A 4V1Ap 2C3QA 4H86A 3V1WA 1GUKA 3MSZA 1TW9A 3LYKA 5HR0A 1UA5A 4PQHA 4XS6A 2WCIA 4HDEA 3WYWA 4KH7A 1OKTA 4X4JA 3NIVA 3EYTA 1BQ7A 3HYPA 2M80A 2LJKA 4BVYB 3CSHA 11GSA 3GV1A 1ACVA 2OKAA 1HNBA 1X5DA 1J0FA 2B5YA 3I69A 1XVQA 4FYUA 1R4WA 1K0CA 3M9KA 1GSQA 1XIYA 2HXKA 2YV7A 1JZRA 1IYIA 3JCML 4F03A 1F9MA 3C1SA 5HR1A 2L6DA 1MDJA 2FD3A 4BVXA 5DJMA 2HSMA 4HQZA 2HLSA 2VCTA 4POBA 2O89A 2GQKA 1GH2A 2TIRA 4KGIA 1SKSB 2LKUA 3LXTA 2YJ7A 3BD2A 2H6XA 1XZOA 1VGLA 2B3SA 1M3JA 3LW9A 2CZ3A 2MMOA 3GFKA 1R26A 3TRXA 1ML6A 5B8BA 1EV4A 1SU9A 5KEJA 2LS5A 4ZXGA 3M0FA 1UVZA 5GAPD 1V40A 1YEPA 4MZBA 2OJLA 3ZITA 2LRTA 1USBA 3IXRA 3KH7A 2X8HA 1ZCPA 2QA2A 1XOBA 5COHA 4OCFA 1TU7A 3E3EA 2RUFA 3C1RA 2G0FA 22GSA 4GQCA 3GKXA 1PL2A 3ZIJA 4MJEA 3VWUA 2L59A 4ZIJA 4TXOA 1XCCA 2EIQA 4XCSA 2V32A 3DD3A 4NAXA 3A2XA 4D73B 8GSSA 1O81A 2I9HA 1X0RA 2L57A 4K0NA 2C8UA 1YJ6A 3HHVA 2DJ0A 3DGQA 3IC4A 4ZL9A 2FWEA 2X4AA 1WP0A 1F6MC 2H1DA 4AJ8A 2H1AA 3TKRA 4FH8A 5CNWA 1THXA 2REMA 1JFUA 3FHKA 3GIXA 2RM5A 5EY6A 5GSSA 1OAZA 4BPYA 1PN0A 2VCQA 2H19A 3F9UA 1M2BA 5F0GA 4L5LA 3H1NA 2DMLA 2MMZA 1U3IA 4JZQA 2HRFA 2EC4A 3L4NA 4J56E 4ZB6A 3TJJA 1GSYA 1NHYA 2H8LA 4GSNA 4BWQA 1GP1A 3RDWA 4IP1A 4CDOA 1V98A 4K8MA 4K0GA 4AJ7A 3P7XA 3U5RE 3GMFA 4DEJA 4X1UA 2D2ZA 5G1LA 4FYBA 1TDIA 2YANA 1TRWA 1K0AA 3F6DA 1WWJA 3GKKA 3VPTA 1QFNA 2QGVA 2HNLA 1FB0A 19GSA 3LORA 4N0ZA 1EOHA 3P90A 3QMXA 4FO5A 1THOA 1T00A 4O5RA 2JZTA 2H72A 3TJBA 2DLXA 4O5QA 4TR1A 5HFIA 4O5UA 3LJRA 3UMAA 4IS0A 1YY7A 1PKWA 4USSA 1XW6A 3L9SA 2GZZA 4TR3A 1ERWA 1A23A 3US3A 4IHUA 4MMMA 2MZCA 5J3RA 4KF9A 3KTBA 1QUWA 3PH9A 1OC9A 2R6KA 2ALBA 2ON5A 2Z9SA 1PA3A 2H70A 5AISA 4N11A 1Z9HA 3W8SA 3M3MA 2RM6A 2C3TA 1YDKA 3EPTA 4PQ1A 1FO5A 2FA4A 4MCUA 4I5QA 2K8VA 4EDYA 3H79A 3ZREA 2UZ8A 1N2AA 4OFMA 1ZYEA 1AAZA 4KCEA 4WBJA 2IMIA 4PTSA 4HJMA 1EZKA 1NHOA 1X5CA 4EC0A 4OO5A 2DBCA 1MD3A 2KP2A 2B5XA 6GSWA 2IMDA 4EKZA 3CXGA 3GTUA 3HJPA 1SL1B 1VRSD 1A8YA 3MWHA 3QDNA 3TCOA 4PUFC 3APQA 1GSEA 1TI3A 5B6MA 2HSYA 3IHGA 2LJAA 2WB9A 1MD4A 4KNDA 3UARA 2B5EA 5G5EA 2WFCA 4HQSA 1VF1A 3RBTA 3ZIVA 3QAGA 1SENA 1MEKA 3APOA 2FLSA 3VFIA 1ON4A 4Q5NA 3ZMKA 3A2WA 4GRFA 4NHZA 2OE1A 2LQOA 2GZPA 2KP1A 5G30A 2DSAA 1TKDB 5DBQA 5KN1A 1A0FA 5DVBA 3GA4A 1B9XC 1T7PB 4G19A 4GQFA 1PX6A 1XBSA 2AUVA 1UN2A 3FR9A 1YKAA 4KSOA 4MDCA 5D93A 2H30A 2YOIA 1GLPA 2IMFA 5H5SA 2OBKA 3KTLA 4X43A 3RAZA 4KUNA 2FCHA 5JCGA 1TRSA 1HNCA 1AQXA 1EP8A 1V57A 4I8BA 4XS4A 3IK9A 3S9FA 3G7YA 3FEUA 4F9ZA 2AJQB 5IOXA 5ABRA 4K9ZA 3IV4A 1AC1A 4QQ7A 4HUAA 1GWCA 1ZYNA 3GL5A 1B4QA 5F05A 1SJIA 4PXOA 4QL9A 3GURA 2O87A 3H4KA 4JU5A 3J7Yk 2GSSA 4E8EA 4K6XA 4L5OA 2C0GA 3FRCA 4KE3A 2OADA 4PUAA 4F0BA 2YZUA 3F63A 1WE0A 4YKGA 2YWIA 2YPMA 6GSXA 5DCGA 3GNJA 1QK8A 2O8VB 2VL2C 1WRYA 1GNWA 4LMVA 5ECQB 5C04A 2H0GA 4MPFA 1RK4A 1T8EB 2PERA 2IL3A 1A8LA 3GKMA 2MYGA 2FA8A 2HE3A 2A2SA 6GSYA 3KM6A 4BL7B 2WS2A 2ZUPA 3ERGA 1G0TA 2KHPA 3UJ1A 3F6FA 1UC7A 3ZVJD 2H6YA 2C0FA 3HXSA 3FKFA 4V2LA 2F8FA 3TB2A 3HCZA 4CHSA 3C8EA 3HDCA 4KX4A 1O8XA 1GULA 5FT3A 4BVXB 2H74A 3DKSA 5ECPB 3C73A 3LGCA 3P8WA 2HT9A 2CVKA 5IMVA 1WPIA 1U88A 2DJKA 3APSA 3KZQA 5HR3A 4Z2RA 2VL9A 4OD7A 3F4RA 2FWFA 1YF0A 4IW9A 4ZL8A 3I43A 2F9SA 3LXZA 1VF4A 2GLRA 5D96A 2ZCTA 5FWGA 3CBUA 3DWVA 4MP4A 1GUHA 2X8CA 4RUVA 2PBJA 3LG6A 5A5KA 1IYHA 1Q4JA 3VLNA 2H66A 5ECNB 3CQFA 2V2GA 2WGRA 1SYRA 1JLWA 5EL8A 1B4PA 2QC7A 2R5GA 5ELAA 1U6TA 1PQNA 4HU7A 3ZFBA 2GSRA 2C1YA 3GKNA 4IBPA 3LYPA 2MMAA 3K8NA 1HNAA 4TXOB 5KOWA 1EEJA 3CYNA 2H75A 3N9JA 4TVEA 4DSRA 4L0WA 3TJGA 1OVNA 3GHAA 2LEGA 2M46A 2RUEA 3HJOA 5IMCA 1VF3A 2YWNA 3QAVA 4TR0A 4GTUA 1AIUA 5F07A 2LQQA 1XW9A 2NBSA 2XBQA 5DCHA 4PQIA 16GSA 3WGEA 1PN9A 4ECCA 3F3RA 4G0LA 1M9AA 2VL2A 1ZMAA 4WR5A 4HEA2 1X9WB 3CSIA 3BOAA 3EINA 1AW9A 1GTIA 2PMTA 1BYEA 2E2MA 1OE8A 2OACA 5E4WA 3IR4A 1H75A 3GSTA 4L0UA 4RQXA 4ZBBA 4AGSA 5IMAA 4YQMA 2H71A 2CA8A 1KBNA 4TN8A 2CAIA 4OFTA 3RHBA 4HOJA 1E2YA 3FZ4A 2NDOA 3KCMA 1I9DA 4BWSA 5INYA 1ZGNA 6GSUA 1ERVA 5AIXA 4ZB8A 2O7KA 3BCKA 3DVXA 3VI7A 4OFNA 5LNKe 4MNNA 1SD8A 1TRUA 4IJIA 4Z2UA 4MJAA 4TR1B 3GH6A 2M72A 4IVFA 3D21A 4MJCA 2FHEA 3CTGA 5DDLA 13GSA 3KD0A 1PSQA 4G9HA 2GGTA 1MDKA 4JR4A 2N5BA 2I4AA 3KH9A 10GSA 2GQMA 2LV3A 1H4OA 1OE7A 2JU5A 2F8AA 1OC9B 2GTUA 12GSA 2R2JA 3IC8A 3Q19A 1V58A 2VO4A 3IAM2 5KN3A 2XHFA 5G1KA 1SJ6A 2DKHA 2VCVA 2VCZA 1N8JA 1SD9A 2XPEA 4O7HA 2HRNA 4ACSA 1G6YA 4POLA 2NPBA 1YZXA 4MJBA 1B9YC 2BJXA 1QGVA 3KEBA 3TDGA 2AHEA 3DMLA 3CTFA 1A0RP 1JZWA 4RI7A 5DALA 4JBBA 4Z7XA 1KTEA 4Z2TA 5IOWA 1T3BA 2R0CA 3DVWA 3IPZA 2VM2A 3EU4A 2RLIA 1GUMA 1XW5A 3GTUB 2VLUA 4GF0A 2B1LA 4AF2A 1TK0B 3RHCA 3D4MA 4HU9A 4MF5A 3M8NA 4KSMA 2P5RA 2B1KA 1F3BA 1FAAA 1U3AA 2NVLA 2FWGA 1QQ2A 1V2AA 3FYGA 2N5FA 3D0ZA 1K3YA 5IMZA 5J5NA 2IN3A 2A4VA 3AY8A 5IPHA 1OC8A 2R37A 2AB6A 2KLXA 4WF4A 4EUYA 4OMVA 2H0IA 2E2GA 4BA7A 2VAFA 4RQRA 4OWYA 5CRGA 4YQUA 3QOUA 1GTUA 5JWOB 1TTZA 2GZYA 5DAKA 3TJKA 1T4ZA 4KDYA 3C71A 3HVNA 2WULA 4MH3A 4IN0A 2J23A 5ID2A 5GAND 2FUG2 4JR6A 4P3YB 1EV9A 4XS1A 4BIKA 1SK1A 3VWWA 4YH2A 1EOGA 3FR6A 2VCXA 1KEBA 2YN1A 4K2XA 4G0IA 5AGYA 5GZZB 3TGZA 1PX7A 1MTCA 5J9BA 5LCZA 5DQYA 3WT2A 2OA7A 1GTBA 2VUPA 2GVPA 4KDUA 2IMKA 2YJHA 4N10A 4MZCA 2IFQA 3FZ9A 4XS4B 4PGTA 4LA1A 3UVTA 1W89A 3HZ8A 4GCIA 4POKA 2TRXA 5JWRB 2QA1A 1M7TA 2I81A 4NXIA 5A4VA 4EE0A 3CMIA 4WEYA 3SBCA 4QL7A 5D73A 3VWVA 2L6CA 2L5OA 1BEDA 3GX0A 4IQ1A 5CRWA 4G0KA 2PVQA 4MPGA 4PNGA 2G2QA 2K8SA 3QAWA 3ED3A 1ERTA 1W4VA 1S3DA 4ZB9A 3UVHA 3KP9A 2J9HA 1X9MB 4ICYA 1SK2A 2B7KA 3KMOA 1URMA 1BX9A 1M0UA 1YF1A 5B6NA 4TW5A 2JZRA 3HD5A 2YNXA 2BTOT 2VD0A 2NTOA 1GSDA 3N5OA 4NV2A 5CRHA 2LUSA 4DSQA 1EGOA 3CRUA 1SL2B 4GSSA 5EVOA 2IPAA 4JE1A 3VK9A 2F3MA 1JZOA 3MAKA 2DKIA 3F3QA 1SJZA 1XPVA 5GSTA 1K0MA 3EWLA 4NMUA 4NWYA 3D22A 5ECKB 4PURA 1SKRB 6GSVA 5KN0A 1GNEA 1Y25A 1O8WA 1B8XA 3E9JB 2PUKC 3D4TA 3EURA 2P0GA 3KXOA 4WXTA 4MLYA 3GL3A 3UAPA 1A2JA 2H01A 4Q5RA 1S3AA 3MIXA 2YZHA 1XXUA 1M2DA 4YKFA 3FY7A 1X9SB 1YEXA 3ME8A 2CAQA 3FK8A 3ISOA 3VI5A 2CVBA 1TXXA 1YQ1A 1T4YA 2R4VA 3TKPA 4XIHA 2YP6A 5HR2A 4TOPA 18GSA 1SKWB 5F06A 2DJJA 5D9VA 2WRTA 4ILFA 1XWBA 2F51A 4V1Ag 2RIIA 3UBLA 2KOKA 1BAYA 1SK0A 5CYYA 3ME7A 4WKWA 3F4SA 2A2PA 3P2AA 5ECLB 4NV5A 5J9CA 1VF2A 5ECMB 3KGKA 1RW1A 1FB6A 4YQVA 4MABA 2DMMA 2CX3A 3TRPA 4DSSA 4KDXA 3IRAA 4MF6A 1CQGA 2X8GA 3J7Yb 4JEDA 5IM9A 1AXDA 1FOHA 1NSWA 3IK7A 3GYKA 3QCPA 2WZ9A 5CP1A 1WMJA 2I1UA 1K0OA 3FZAA 3MNGA 5D9WA 2AAWA 2IJYA 3RPPA 1M99A 1R5AA 2IWTA 1JZDA 2XPDA 2H1GA 4G10A 4I2TA 2R0GA 5FHIA 1HD2A 4CW9A 3QFAC 3VURA 2FY6A 3U6VA 1C72A 2JSYA 4IELA 2YCDA 2R3XA 3KIJA 5E59A 1XOAA 2OBIA 2V6KA 1F3AA 4WBRD 4WETA 4I2UA 4ECBA 1Z5YE 3GUSA 5B8AA 2IMEA 5AN1A 2P5QA 3EMXA 4IP6A 3WT1A 1TP9A 1FVKA 2VOCA 1TK5B 1TJDA 3FW2A 2CZ2A 4LMWA 5DJLA 1G6WA 4TRXA 3L78A 3F0IA 3E0UA 3G7JA 4ECJA 4V2NA 4N0VA 4MK3A 3ZYWA 1BG5A 5CRDA 1S3RA 4KB3A 3UIWA 1O6JA 3WD6A 2PU9C 2VLTA 3O6TA 1R7HA 4I97A 1Z3EA 4J2FA 4ISDA 1A24A 2PPTA 3I6AA 1TRVA 4TR4A 4EIPA 1QXHA 2K9FA 1LU4A 4EDZA 3ZTLA 4ML1A 4KW6A 1LBKA 2L4CA 4CY6A 4L8EA 2AV4A 1K0NA 1AQVA 5ELGA 5H5RA 5KN2A 4BL7A 3M1GA 1XVWA 3TKSE 5IO2A 4IGJA 1XWGA 1Y6EA 4MF7A 5D8IA 9GSSA 14GSA 1EWXA 2LRCA 1JLVA 2JZSA 4X0XA 1EP7A 2HFDA 3Q6OA 2CVDA 1GSFA 5G5FA 5LD0A 3A3TA 5DALB 4FIWA 2V6OA 4KAEA 1Z7RA 1M9BA 5ECHB 3TKSC 5IQYA 3KP8A 1DBYA 3LEFA 3TKQA 2HZEA 5CAXA 3VPQA 5AIVA 3FMWA 4MZWA 4K7OA 3UL3A 1F37A 5IMDA 3ZFLA 2LTKA 1FHEA 3D6IA 3QR6A 5ENUA 4OO4A 2GS3A 1EGRA 1ERUA 3ZVJA 1M3IA 1FVJA 1GLQA 4HS1A 3IHQA 4GXZA 3A5IA 2VM1A 3G7IA 3GRXA 2JADA 3TRQA 3LQ7A 1ST9A 2P31A 1SYXA 4MA9A 1XFLA 2ON7A 3W6GA 3KJYA 5IO0A 4F82A 2FNOA 3CRTA 2DC5A 2DJ1A 4BVYA 2O85A 20GSA 1Z7PA 4WR4A 3R2QA 1SL0B 1CQHA 5CO3A 5DAKB 4HZ4A 4DVCA 3F4TA 1XG8A 4J57E 5ID2B 1PD21 4IQAA 2E0QA 1PFOA 3BBYA 1O73A 2I3YA 4TKYA 2JL4A 4OCEA 5IMFA 1DUGA 3H93A 6GSTA 4ID0A 5J41A 3BJ5A 3LWAA 4TXVA 3DEXA 2HYXA 2PVOC 3TOUA 3W8JA 1RQMA 4ZILA 2YWMA 2PWJA 1K0DA 2CV4A 2C80A 5JCWA 3TUEA 1TI1A 4HI7A 1HYUA 5B7CA 1K3OA 2V1MA 1R5PA 2DIZA 2DIYA 1DE1A 4ZBAA 1O7UA 3WGDA 3L9VA 3HJMA 2ZNMA 3IDVA 2IFQB 3QFBC 4EO3A 4RI6A 2B6MA 3ZZXA 4XRDA 7GSSA 2A4HA 2GT6A 3HVXA 3KMNA 5ECOB 3EVIA 4PX1A 3HVSA 2QSIA 1EEMA 4GWRA 2E7PA 2K6VA 3UEMA 1E6BA 4K2DA 4HZ2A 3HZ4A 3TKSA 1XWKA 1AQWA 1MDIA 5EPFA 1B48A 3UOMA 4WF5A 4XTSA 4AJ6A 3O76A 1TU8A 5HQPA 4G2EA 1Q98A 3PGTA 3EC3A 1ZYQB 4LL4B 3RPNA 2JSZA 3GH9A 3ZMLA 5F8BA 4D73A 1PKZA 2B7JA 5ECIB 3GX8A 3MDKA 4LL1B 2K18A 4F2IA 3ERFA 2X49A 1DSBA 2LRNA 1J9BA 2OE3A 3LSZA 1NW2A 4FQUA 2H73A 2H6ZA 3SWLA 5ECSA 1DE2A 1GSSA 2TRCP 4CY8A 1WJKA 1KNGA 3O3TA 3PPUA 3Q18A 5H5QA 1WOUA 2A2RA 2WJUA 2L4QA 1OKDA 1AUCA 1ZZYA
chains in the Genus database with same CATH topology
5A4WA 2HRAA 1PRXA 2PGTA 2X99A 1WIKA 1ABAA 2R0PA 4LLRA 5J4UA 2CT6A 1ZL9A 2VL3A 3H8QA 1TK8B 3EMPA 3F8UA 4K5RA 2JACA 4A5PA 2MBTA 2EIOA 2HSHA 5JWQB 4EVMA 3DYRA 3ERWA 3A5WA 5G2ZA 1LJRA 1J08A 2VLVA 3EE2A 4O92A 3I9V2 17GSA 5JCUA 4KA0A 1FOVA 6GSSA 5L71A 2OE0A 4I6XA 4DSSB 1X5EA 1O85A 1OYJA 2H1BA 5CREA 4JRRA 5BRTA 5DQSA 3D5JA 1Z6NA 2H76A 3L0HA 1BJXA 2GDRA 3VWXA 2C0EA 2DJ3A 4ZL7A 4ULXA 3MYDA 4Q5QA 1GRXA 3DXBA 1V9WA 1S3CA 3DRNA 3IAS2 4K7NA 1F2EA 2PN8A 1HQOA 4E8HA 3NOFA 1JHBA 2DJ2A 1FG4A 1FW1A 3ZRDA 5D9XA 3WGXA 2HI7A 5KOXA 4GLTA 1TOFA 4FYCA 4K1FA 3HY2A 1NM3A 3ZLPA 2X64A 1GTAA 1G7EA 1G7OA 5C00A 3GN3A 4EF0A 2FWHA 1I5GA 3IOSA 5A4UA 4KCAA 1GL8A 3PR8A 2ES7A 2C0DA 5BMUA 4MH2A 3R3EA 3BCIA 5ECRB 1K0BA 3HVVA 3OR5A 5D9TA 5IIZA 1ZOFA 1ZYPA 4HJ2A 2YV9A 2CX4A 1XWCA 4POMA 1PMTA 3LFLA 1GSUA 1M2AA 2VD1A 1U87A 3HKRA 1QMVA 4YAVA 3Q74A 2V41A 2AYTA 2HRKA 3IE3A 4XHMA 4GSTA 3C7MA 1XWAA 1ILOA 2BMXA 2MBSA 4EXJA 4ECIA 3G9BA 3FR3A 3M9JA 2C4JA 2IIYA 2CQ9A 3IBHA 2LNSA 2XC2A 2C3NA 2QKEA 4K7IA 4Q5FA 2WDUA 2H0HA 3PINA 4NHWA 2LJRA 1PGTA 4XRAA 3QD9A 3TOTA 4F0CA 2GQLA 2HZFA 3CSJA 3FZ5A 1T1VA 4PNFA 1Z6MA 2EIRA 2VIMA 2XBIA 5HFGA 3QPMA 4K5SA 3GSSA 4IKHA 1YKCA 5G31A 1PL1A 2FGXA 3A2VA 2YWOA 4EL1A 4V2MA 3ZL5A 2KUCA 2LSTA 4YAPA 4ML6A 2N5AA 2LNTA 3L9UA 3HA9A 2L5LA 4N30A 2GSQA 5HFKA 4EIQA 2HZEB 1OC3A 3EU3A 2MMNA 4ZBDA 5IPGA 1A2MA 2VCWA 3IA1A 3DIEA 2GT5A 3NZNA 1A2LA 2GSTA 3TJFA 1K3LA 3UBKA 4NPBA 4IJ3A 4O32A 4V1Ap 2C3QA 4H86A 3V1WA 1GUKA 3MSZA 1TW9A 3LYKA 5HR0A 1UA5A 4PQHA 4XS6A 2WCIA 4HDEA 3WYWA 4KH7A 1OKTA 4X4JA 3NIVA 3EYTA 1BQ7A 3HYPA 2M80A 2LJKA 4BVYB 3CSHA 11GSA 3GV1A 1ACVA 2OKAA 1HNBA 1X5DA 1J0FA 2B5YA 3I69A 1XVQA 4FYUA 1R4WA 1K0CA 3M9KA 1GSQA 1XIYA 2HXKA 2YV7A 1JZRA 1IYIA 3JCML 4F03A 1F9MA 3C1SA 5HR1A 2L6DA 1MDJA 2FD3A 4BVXA 5DJMA 2HSMA 4HQZA 2HLSA 2VCTA 4POBA 2O89A 2GQKA 1GH2A 2TIRA 4KGIA 1SKSB 2LKUA 3LXTA 2YJ7A 3BD2A 2H6XA 1XZOA 1VGLA 2B3SA 3LW9A 2CZ3A 2MMOA 3GFKA 1R26A 3TRXA 1ML6A 5B8BA 1EV4A 1SU9A 5KEJA 2LS5A 4ZXGA 3M0FA 1UVZA 5GAPD 1V40A 1YEPA 4MZBA 2OJLA 3ZITA 2LRTA 1USBA 3IXRA 3KH7A 2X8HA 1ZCPA 2QA2A 1XOBA 5COHA 4OCFA 1TU7A 3E3EA 2RUFA 3C1RA 2G0FA 22GSA 4GQCA 3GKXA 1PL2A 3ZIJA 4MJEA 3VWUA 2L59A 4ZIJA 4TXOA 1XCCA 2EIQA 4XCSA 2V32A 3DD3A 4NAXA 3A2XA 4D73B 8GSSA 1O81A 2I9HA 1X0RA 2L57A 4K0NA 2C8UA 1YJ6A 3HHVA 2DJ0A 3DGQA 3IC4A 4ZL9A 2FWEA 2X4AA 1WP0A 1F6MC 2H1DA 4AJ8A 2H1AA 3TKRA 4FH8A 5CNWA 1THXA 2REMA 1JFUA 3FHKA 3GIXA 2RM5A 5EY6A 5GSSA 1OAZA 4BPYA 1PN0A 2VCQA 2H19A 3F9UA 1M2BA 5F0GA 4L5LA 3H1NA 2DMLA 2MMZA 1U3IA 4JZQA 2HRFA 2EC4A 3L4NA 4J56E 4ZB6A 3TJJA 1GSYA 1NHYA 2H8LA 4GSNA 4BWQA 1GP1A 3RDWA 4IP1A 4CDOA 1V98A 4K8MA 4K0GA 4AJ7A 3P7XA 3U5RE 3GMFA 4DEJA 4X1UA 2D2ZA 5G1LA 4FYBA 1TDIA 2YANA 1TRWA 1K0AA 3F6DA 1WWJA 3GKKA 3VPTA 1QFNA 2QGVA 2HNLA 1FB0A 19GSA 3LORA 4N0ZA 1EOHA 3P90A 3QMXA 4FO5A 1THOA 1T00A 4O5RA 2JZTA 2H72A 3TJBA 2DLXA 4O5QA 4TR1A 5HFIA 4O5UA 3LJRA 3UMAA 4IS0A 1YY7A 1PKWA 4USSA 1XW6A 3L9SA 2GZZA 4TR3A 1ERWA 1A23A 3US3A 4IHUA 4MMMA 2MZCA 5J3RA 4KF9A 3KTBA 1QUWA 3PH9A 1OC9A 2R6KA 2ALBA 2ON5A 2Z9SA 1PA3A 2H70A 5AISA 4N11A 1Z9HA 3W8SA 3M3MA 2RM6A 2C3TA 1YDKA 3EPTA 4PQ1A 1FO5A 2FA4A 4MCUA 4I5QA 2K8VA 4EDYA 3H79A 3ZREA 2UZ8A 1N2AA 4OFMA 1ZYEA 1AAZA 4KCEA 4WBJA 2IMIA 4PTSA 4HJMA 1EZKA 1NHOA 1X5CA 4EC0A 4OO5A 2DBCA 1MD3A 2KP2A 2B5XA 6GSWA 2IMDA 4EKZA 3CXGA 3GTUA 3HJPA 1SL1B 1VRSD 1A8YA 3MWHA 3QDNA 3TCOA 4PUFC 3APQA 1GSEA 1TI3A 5B6MA 2HSYA 3IHGA 2LJAA 2WB9A 1MD4A 4KNDA 3UARA 2B5EA 5G5EA 2WFCA 4HQSA 1VF1A 3RBTA 3ZIVA 3QAGA 1SENA 1MEKA 3APOA 2FLSA 3VFIA 1ON4A 4Q5NA 3ZMKA 3A2WA 4GRFA 4NHZA 2OE1A 2LQOA 2GZPA 2KP1A 5G30A 2DSAA 1TKDB 5DBQA 5KN1A 1A0FA 5DVBA 3GA4A 1B9XC 1T7PB 4G19A 4GQFA 1PX6A 1XBSA 2AUVA 1UN2A 3FR9A 1YKAA 4KSOA 4MDCA 5D93A 2H30A 2YOIA 1GLPA 2IMFA 5H5SA 2OBKA 3KTLA 4X43A 3RAZA 4KUNA 2FCHA 5JCGA 1TRSA 1HNCA 1AQXA 1EP8A 1V57A 4I8BA 4XS4A 3IK9A 3S9FA 3G7YA 3FEUA 4F9ZA 2AJQB 5IOXA 5ABRA 4K9ZA 3IV4A 1AC1A 4QQ7A 4HUAA 1GWCA 1ZYNA 3GL5A 1B4QA 5F05A 1SJIA 4PXOA 4QL9A 3GURA 2O87A 3H4KA 4JU5A 3J7Yk 2GSSA 4E8EA 4K6XA 4L5OA 2C0GA 3FRCA 4KE3A 2OADA 4PUAA 4F0BA 2YZUA 3F63A 1WE0A 4YKGA 2YWIA 2YPMA 6GSXA 5DCGA 3GNJA 1QK8A 2O8VB 2VL2C 1WRYA 1GNWA 4LMVA 5ECQB 5C04A 2H0GA 4MPFA 1RK4A 1T8EB 2PERA 2IL3A 1A8LA 3GKMA 2MYGA 2FA8A 2HE3A 2A2SA 6GSYA 3KM6A 4BL7B 2WS2A 2ZUPA 3ERGA 1G0TA 2KHPA 3UJ1A 3F6FA 1UC7A 3ZVJD 2H6YA 2C0FA 3HXSA 3FKFA 4V2LA 2F8FA 3TB2A 3HCZA 4CHSA 3C8EA 3HDCA 4KX4A 1O8XA 1GULA 5FT3A 4BVXB 2H74A 3DKSA 5ECPB 3C73A 3LGCA 3P8WA 2HT9A 2CVKA 5IMVA 1WPIA 1U88A 2DJKA 3APSA 3KZQA 5HR3A 4Z2RA 2VL9A 4OD7A 3F4RA 2FWFA 1YF0A 4IW9A 4ZL8A 3I43A 2F9SA 3LXZA 1VF4A 2GLRA 5D96A 2ZCTA 5FWGA 3CBUA 3DWVA 4MP4A 1GUHA 2X8CA 4RUVA 2PBJA 3LG6A 5A5KA 1IYHA 1Q4JA 3VLNA 2H66A 5ECNB 2V2GA 2WGRA 1SYRA 1JLWA 5EL8A 1B4PA 2QC7A 2R5GA 5ELAA 1U6TA 1PQNA 4HU7A 3ZFBA 2GSRA 2C1YA 3GKNA 4IBPA 3LYPA 2MMAA 3K8NA 1HNAA 4TXOB 5KOWA 1EEJA 3CYNA 2H75A 3N9JA 4TVEA 4DSRA 4L0WA 3TJGA 1OVNA 3GHAA 2LEGA 2M46A 2RUEA 3HJOA 5IMCA 1VF3A 2YWNA 3QAVA 4TR0A 4GTUA 1AIUA 5F07A 2LQQA 1XW9A 2NBSA 2XBQA 5DCHA 4PQIA 16GSA 3WGEA 1PN9A 4ECCA 3F3RA 4G0LA 1M9AA 2VL2A 1ZMAA 4WR5A 4HEA2 1X9WB 3CSIA 3BOAA 3EINA 1AW9A 1GTIA 2PMTA 1BYEA 2E2MA 1OE8A 2OACA 5E4WA 3IR4A 1H75A 3GSTA 4L0UA 4RQXA 4ZBBA 4AGSA 5IMAA 4YQMA 2H71A 2CA8A 1KBNA 4TN8A 2CAIA 4OFTA 3RHBA 4HOJA 1E2YA 3FZ4A 2NDOA 3KCMA 1I9DA 4BWSA 5INYA 1ZGNA 6GSUA 1ERVA 5AIXA 4ZB8A 2O7KA 3BCKA 3DVXA 3VI7A 4OFNA 5LNKe 4MNNA 1SD8A 1TRUA 4IJIA 4Z2UA 4MJAA 4TR1B 3GH6A 2M72A 4IVFA 3D21A 4MJCA 2FHEA 3CTGA 5DDLA 13GSA 3KD0A 1PSQA 4G9HA 2GGTA 1MDKA 4JR4A 2N5BA 2I4AA 3KH9A 10GSA 2GQMA 2LV3A 1H4OA 1OE7A 2JU5A 2F8AA 1OC9B 2GTUA 12GSA 2R2JA 3IC8A 3Q19A 1V58A 2VO4A 3IAM2 5KN3A 2XHFA 5G1KA 1SJ6A 2DKHA 2VCVA 2VCZA 1N8JA 1SD9A 2XPEA 4O7HA 2HRNA 4ACSA 1G6YA 4POLA 2NPBA 1YZXA 4MJBA 1B9YC 2BJXA 1QGVA 3KEBA 3TDGA 2AHEA 3DMLA 3CTFA 1A0RP 1JZWA 4RI7A 5DALA 4JBBA 4Z7XA 1KTEA 4Z2TA 5IOWA 1T3BA 2R0CA 3DVWA 3IPZA 2VM2A 3EU4A 2RLIA 1GUMA 1XW5A 3GTUB 2VLUA 4GF0A 2B1LA 4AF2A 1TK0B 3RHCA 3D4MA 4HU9A 4MF5A 3M8NA 4KSMA 2P5RA 2B1KA 1F3BA 1FAAA 1U3AA 2NVLA 2FWGA 1QQ2A 1V2AA 3FYGA 2N5FA 3D0ZA 1K3YA 5IMZA 5J5NA 2IN3A 2A4VA 3AY8A 5IPHA 1OC8A 2R37A 2AB6A 2KLXA 4WF4A 4EUYA 4OMVA 2H0IA 2E2GA 4BA7A 2VAFA 4RQRA 4OWYA 5CRGA 4YQUA 3QOUA 1GTUA 5JWOB 1TTZA 2GZYA 5DAKA 3TJKA 1T4ZA 4KDYA 3C71A 2WULA 4MH3A 4IN0A 2J23A 5ID2A 5GAND 2FUG2 4JR6A 4P3YB 1EV9A 4XS1A 1SK1A 3VWWA 4YH2A 1EOGA 3FR6A 2VCXA 1KEBA 2YN1A 4K2XA 4G0IA 5AGYA 5GZZB 3TGZA 1PX7A 1MTCA 5J9BA 5LCZA 5DQYA 3WT2A 2OA7A 1GTBA 2VUPA 2GVPA 4KDUA 2IMKA 2YJHA 4N10A 4MZCA 2IFQA 3FZ9A 4XS4B 4PGTA 4LA1A 3UVTA 1W89A 3HZ8A 4GCIA 4POKA 2TRXA 5JWRB 2QA1A 1M7TA 2I81A 4NXIA 5A4VA 4EE0A 3CMIA 4WEYA 3SBCA 4QL7A 5D73A 3VWVA 2L6CA 2L5OA 1BEDA 3GX0A 4IQ1A 5CRWA 4G0KA 2PVQA 4MPGA 4PNGA 2G2QA 2K8SA 3QAWA 3ED3A 1ERTA 1W4VA 1S3DA 4ZB9A 3UVHA 3KP9A 2J9HA 1X9MB 4ICYA 1SK2A 2B7KA 3KMOA 1URMA 1BX9A 1M0UA 1YF1A 5B6NA 4TW5A 2JZRA 3HD5A 2YNXA 2BTOT 2VD0A 2NTOA 1GSDA 3N5OA 4NV2A 5CRHA 2LUSA 4DSQA 1EGOA 3CRUA 1SL2B 4GSSA 5EVOA 2IPAA 4JE1A 3VK9A 2F3MA 1JZOA 3MAKA 2DKIA 3F3QA 1SJZA 1XPVA 5GSTA 1K0MA 3EWLA 4NMUA 4NWYA 3D22A 5ECKB 4PURA 1SKRB 6GSVA 5KN0A 1GNEA 1Y25A 1O8WA 1B8XA 3E9JB 2PUKC 3D4TA 3EURA 2P0GA 3KXOA 4WXTA 4MLYA 3GL3A 3UAPA 1A2JA 2H01A 4Q5RA 1S3AA 3MIXA 2YZHA 1XXUA 1M2DA 4YKFA 3FY7A 1X9SB 1YEXA 3ME8A 2CAQA 3FK8A 3ISOA 3VI5A 2CVBA 1TXXA 1YQ1A 1T4YA 2R4VA 3TKPA 4XIHA 2YP6A 5HR2A 4TOPA 18GSA 1SKWB 5F06A 2DJJA 5D9VA 2WRTA 4ILFA 1XWBA 2F51A 4V1Ag 2RIIA 3UBLA 2KOKA 1BAYA 1SK0A 5CYYA 3ME7A 4WKWA 3F4SA 2A2PA 3P2AA 5ECLB 4NV5A 5J9CA 1VF2A 5ECMB 3KGKA 1RW1A 1FB6A 4YQVA 4MABA 2DMMA 2CX3A 3TRPA 4DSSA 4KDXA 3IRAA 4MF6A 1CQGA 2X8GA 3J7Yb 4JEDA 5IM9A 1AXDA 1FOHA 1NSWA 3IK7A 3GYKA 3QCPA 2WZ9A 5CP1A 1WMJA 2I1UA 1K0OA 3FZAA 3MNGA 5D9WA 2AAWA 2IJYA 3RPPA 1M99A 1R5AA 2IWTA 1JZDA 2XPDA 2H1GA 4G10A 4I2TA 2R0GA 5FHIA 1HD2A 4CW9A 3QFAC 3VURA 2FY6A 3U6VA 1C72A 2JSYA 4IELA 2YCDA 2R3XA 3KIJA 5E59A 1XOAA 2OBIA 2V6KA 1F3AA 4WBRD 4WETA 4I2UA 4ECBA 1Z5YE 3GUSA 5B8AA 2IMEA 5AN1A 2P5QA 3EMXA 4IP6A 3WT1A 1TP9A 1FVKA 2VOCA 1TK5B 1TJDA 3FW2A 2CZ2A 4LMWA 5DJLA 1G6WA 4TRXA 3L78A 3F0IA 3E0UA 3G7JA 4ECJA 4V2NA 4N0VA 4MK3A 3ZYWA 1BG5A 5CRDA 4KB3A 3UIWA 1O6JA 3WD6A 2PU9C 2VLTA 3O6TA 1R7HA 4I97A 1Z3EA 4J2FA 4ISDA 1A24A 2PPTA 3I6AA 1TRVA 4TR4A 4EIPA 1QXHA 2K9FA 1LU4A 4EDZA 3ZTLA 4ML1A 4KW6A 1LBKA 2L4CA 4CY6A 4L8EA 2AV4A 1K0NA 1AQVA 5ELGA 5H5RA 5KN2A 4BL7A 3M1GA 1XVWA 3TKSE 5IO2A 4IGJA 1XWGA 1Y6EA 4MF7A 5D8IA 9GSSA 14GSA 1EWXA 2LRCA 1JLVA 2JZSA 4X0XA 1EP7A 2HFDA 3Q6OA 2CVDA 1GSFA 5G5FA 5LD0A 3A3TA 5DALB 4FIWA 2V6OA 4KAEA 1Z7RA 1M9BA 5ECHB 3TKSC 5IQYA 3KP8A 1DBYA 3LEFA 3TKQA 2HZEA 5CAXA 3VPQA 5AIVA 3FMWA 4MZWA 4K7OA 3UL3A 1F37A 5IMDA 3ZFLA 2LTKA 1FHEA 3D6IA 3QR6A 5ENUA 4OO4A 2GS3A 1EGRA 1ERUA 3ZVJA 1FVJA 1GLQA 4HS1A 3IHQA 4GXZA 3A5IA 2VM1A 3G7IA 3GRXA 2JADA 3TRQA 3LQ7A 1ST9A 2P31A 1SYXA 4MA9A 1XFLA 2ON7A 3W6GA 3KJYA 5IO0A 4F82A 2FNOA 3CRTA 2DC5A 2DJ1A 4BVYA 2O85A 20GSA 1Z7PA 4WR4A 3R2QA 1SL0B 1CQHA 5CO3A 5DAKB 4HZ4A 4DVCA 3F4TA 4J57E 5ID2B 1PD21 4IQAA 2E0QA 3BBYA 1O73A 2I3YA 4TKYA 2JL4A 4OCEA 5IMFA 1DUGA 3H93A 6GSTA 4ID0A 5J41A 3BJ5A 3LWAA 4TXVA 3DEXA 2HYXA 2PVOC 3TOUA 3W8JA 1RQMA 4ZILA 2YWMA 2PWJA 1K0DA 2CV4A 2C80A 5JCWA 3TUEA 1TI1A 4HI7A 1HYUA 5B7CA 1K3OA 2V1MA 1R5PA 2DIZA 2DIYA 1DE1A 4ZBAA 1O7UA 3WGDA 3L9VA 3HJMA 2ZNMA 3IDVA 2IFQB 3QFBC 4EO3A 4RI6A 2B6MA 3ZZXA 4XRDA 7GSSA 2A4HA 2GT6A 3HVXA 3KMNA 5ECOB 3EVIA 4PX1A 3HVSA 2QSIA 1EEMA 4GWRA 2E7PA 2K6VA 3UEMA 1E6BA 4K2DA 4HZ2A 3HZ4A 3TKSA 1XWKA 1AQWA 1MDIA 5EPFA 1B48A 3UOMA 4WF5A 4XTSA 4AJ6A 3O76A 1TU8A 5HQPA 4G2EA 1Q98A 3PGTA 3EC3A 1ZYQB 4LL4B 3RPNA 2JSZA 3GH9A 3ZMLA 5F8BA 4D73A 1PKZA 2B7JA 5ECIB 3GX8A 3MDKA 4LL1B 2K18A 4F2IA 3ERFA 2X49A 1DSBA 2LRNA 1J9BA 2OE3A 3LSZA 1NW2A 4FQUA 2H73A 2H6ZA 3SWLA 5ECSA 1DE2A 1GSSA 2TRCP 4CY8A 1WJKA 1KNGA 3O3TA 3PPUA 3Q18A 5H5QA 1WOUA 2A2RA 2WJUA 2L4QA 1OKDA 1AUCA 1ZZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A4W A;  1PRX A;  2PGT A;  2X99 A;  1WIK A;  1ABA A;  4LLR A;  5J4U A;  2CT6 A;  1ZL9 A;  2VL3 A;  3H8Q A;  1TK8 B;  3EMP A;  3F8U A;  2JAC A;  2MBT A;  2EIO A;  2HSH A;  5JWQ B;  4EVM A;  3DYR A;  3ERW A;  3A5W A;  5G2Z A;  1LJR A;  1J08 A;  2VLV A;  3EE2 A;  4O92 A;  3I9V 2;  17GS A;  5JCU A;  4KA0 A;  1FOV A;  6GSS A;  5L71 A;  2OE0 A;  4I6X A;  4DSS B;  1X5E A;  1O85 A;  1OYJ A;  2H1B A;  5CRE A;  4JRR A;  5DQS A;  3D5J A;  1Z6N A;  2H76 A;  3L0H A;  1BJX A;  2GDR A;  3VWX A;  2C0E A;  2DJ3 A;  4ZL7 A;  4ULX A;  4Q5Q A;  1GRX A;  3DXB A;  1V9W A;  1S3C A;  3DRN A;  3IAS 2;  4K7N A;  1F2E A;  2PN8 A;  1HQO A;  4E8H A;  3NOF A;  1JHB A;  2DJ2 A;  1FG4 A;  1FW1 A;  3ZRD A;  5D9X A;  3WGX A;  2HI7 A;  4GLT A;  1TOF A;  4FYC A;  4K1F A;  3HY2 A;  1NM3 A;  3ZLP A;  2X64 A;  1GTA A;  1G7E A;  1G7O A;  5C00 A;  3GN3 A;  4EF0 A;  2FWH A;  1I5G A;  3IOS A;  5A4U A;  4KCA A;  1GL8 A;  3PR8 A;  2ES7 A;  2C0D A;  4MH2 A;  3BCI A;  5ECR B;  1K0B A;  3HVV A;  3OR5 A;  5D9T A;  5IIZ A;  1ZOF A;  4HJ2 A;  2YV9 A;  2CX4 A;  1XWC A;  4POM A;  1PMT A;  3LFL A;  1GSU A;  1M2A A;  2VD1 A;  1U87 A;  3HKR A;  1QMV A;  4YAV A;  3Q74 A;  2V41 A;  2AYT A;  3IE3 A;  4XHM A;  4GST A;  3C7M A;  1XWA A;  1ILO A;  2BMX A;  2MBS A;  4EXJ A;  4ECI A;  3G9B A;  3FR3 A;  3M9J A;  2C4J A;  2IIY A;  2CQ9 A;  3IBH A;  2LNS A;  2XC2 A;  2C3N A;  2QKE A;  4K7I A;  4Q5F A;  2WDU A;  2H0H A;  3PIN A;  4NHW A;  2LJR A;  1PGT A;  4XRA A;  3QD9 A;  3TOT A;  4F0C A;  2GQL A;  2HZF A;  3CSJ A;  3FZ5 A;  1T1V A;  4PNF A;  1Z6M A;  2EIR A;  2VIM A;  2XBI A;  5HFG A;  3QPM A;  3GSS A;  4IKH A;  1YKC A;  5G31 A;  1PL1 A;  2FGX A;  3A2V A;  2YWO A;  4EL1 A;  4V2M A;  3ZL5 A;  2KUC A;  2LST A;  4YAP A;  4ML6 A;  2N5A A;  2LNT A;  3L9U A;  3HA9 A;  2L5L A;  4N30 A;  2GSQ A;  5HFK A;  2HZE B;  1OC3 A;  3EU3 A;  2MMN A;  4ZBD A;  5IPG A;  1A2M A;  2VCW A;  3IA1 A;  3DIE A;  2GT5 A;  3NZN A;  1A2L A;  2GST A;  3TJF A;  1K3L A;  3UBK A;  4NPB A;  4IJ3 A;  4O32 A;  4V1A p;  2C3Q A;  4H86 A;  3V1W A;  1GUK A;  3MSZ A;  1TW9 A;  3LYK A;  5HR0 A;  1UA5 A;  4PQH A;  4XS6 A;  2WCI A;  4HDE A;  3WYW A;  4KH7 A;  1OKT A;  3NIV A;  3EYT A;  1BQ7 A;  3HYP A;  2M80 A;  2LJK A;  3CSH A;  11GS A;  3GV1 A;  1ACV A;  2OKA A;  1HNB A;  1X5D A;  1J0F A;  2B5Y A;  3I69 A;  1XVQ A;  4FYU A;  1R4W A;  1K0C A;  3M9K A;  1GSQ A;  1XIY A;  2HXK A;  2YV7 A;  1JZR A;  1IYI A;  3JCM L;  4F03 A;  1F9M A;  3C1S A;  5HR1 A;  2L6D A;  1MDJ A;  2FD3 A;  4BVX A;  5DJM A;  2VCT A;  2HLS A;  4HQZ A;  4POB A;  2O89 A;  2GQK A;  1GH2 A;  2TIR A;  4KGI A;  1SKS B;  2LKU A;  3LXT A;  2YJ7 A;  3BD2 A;  2H6X A;  1XZO A;  1VGL A;  2B3S A;  2CZ3 A;  2MMO A;  3GFK A;  1R26 A;  3TRX A;  1ML6 A;  5B8B A;  1EV4 A;  1SU9 A;  5KEJ A;  2LS5 A;  4ZXG A;  3M0F A;  1UVZ A;  5GAP D;  1V40 A;  1YEP A;  4MZB A;  2OJL A;  3ZIT A;  2LRT A;  1USB A;  3IXR A;  3KH7 A;  2X8H A;  1ZCP A;  1XOB A;  5COH A;  4OCF A;  1TU7 A;  3E3E A;  2RUF A;  3C1R A;  2G0F A;  22GS A;  4GQC A;  3GKX A;  1PL2 A;  3ZIJ A;  4MJE A;  3VWU A;  2L59 A;  4ZIJ A;  4TXO A;  1XCC A;  2EIQ A;  4XCS A;  2V32 A;  3DD3 A;  4NAX A;  3A2X A;  4D73 B;  8GSS A;  1O81 A;  2I9H A;  1X0R A;  2L57 A;  4K0N A;  2C8U A;  1YJ6 A;  3HHV A;  2DJ0 A;  3DGQ A;  3IC4 A;  4ZL9 A;  2FWE A;  1WP0 A;  1F6M C;  2H1D A;  4AJ8 A;  2H1A A;  3TKR A;  4FH8 A;  5CNW A;  1THX A;  2REM A;  1JFU A;  3FHK A;  3GIX A;  2RM5 A;  5EY6 A;  5GSS A;  1OAZ A;  4BPY A;  2VCQ A;  2H19 A;  3F9U A;  1M2B A;  5F0G A;  4L5L A;  3H1N A;  2DML A;  2MMZ A;  1U3I A;  4JZQ A;  2HRF A;  2EC4 A;  3L4N A;  4J56 E;  4ZB6 A;  3TJJ A;  1GSY A;  1NHY A;  2H8L A;  4GSN A;  4BWQ A;  1GP1 A;  3RDW A;  4IP1 A;  4CDO A;  1V98 A;  4K8M A;  4K0G A;  4AJ7 A;  3P7X A;  3U5R E;  3GMF A;  4DEJ A;  4X1U A;  2D2Z A;  5G1L A;  4FYB A;  1TDI A;  2YAN A;  1TRW A;  1K0A A;  3F6D A;  1WWJ A;  3GKK A;  3VPT A;  1QFN A;  2QGV A;  2HNL A;  1FB0 A;  19GS A;  3LOR A;  4N0Z A;  1EOH A;  3P90 A;  3QMX A;  4FO5 A;  1THO A;  1T00 A;  4O5R A;  2JZT A;  2H72 A;  3TJB A;  2DLX A;  4TR1 A;  5HFI A;  3LJR A;  3UMA A;  4IS0 A;  1YY7 A;  1PKW A;  1XW6 A;  3L9S A;  2GZZ A;  4TR3 A;  1ERW A;  1A23 A;  3US3 A;  4IHU A;  4MMM A;  2MZC A;  5J3R A;  3KTB A;  1QUW A;  3PH9 A;  1OC9 A;  2R6K A;  2ALB A;  2ON5 A;  2Z9S A;  1PA3 A;  2H70 A;  5AIS A;  4N11 A;  1Z9H A;  3W8S A;  3M3M A;  2RM6 A;  2C3T A;  1YDK A;  4PQ1 A;  1FO5 A;  2FA4 A;  4MCU A;  4I5Q A;  2K8V A;  4EDY A;  3H79 A;  3ZRE A;  1N2A A;  4OFM A;  1ZYE A;  1AAZ A;  4KCE A;  4WBJ A;  2IMI A;  4HJM A;  1EZK A;  1NHO A;  1X5C A;  4EC0 A;  4OO5 A;  2DBC A;  1MD3 A;  2KP2 A;  2B5X A;  6GSW A;  2IMD A;  4EKZ A;  3CXG A;  3GTU A;  3HJP A;  1SL1 B;  1VRS D;  1A8Y A;  3MWH A;  3QDN A;  3TCO A;  4PUF C;  3APQ A;  1GSE A;  1TI3 A;  5B6M A;  2HSY A;  2LJA A;  2WB9 A;  1MD4 A;  4KND A;  3UAR A;  2B5E A;  5G5E A;  2WFC A;  4HQS A;  1VF1 A;  3RBT A;  3ZIV A;  3QAG A;  1SEN A;  1MEK A;  3APO A;  2FLS A;  3VFI A;  1ON4 A;  4Q5N A;  3ZMK A;  3A2W A;  4GRF A;  4NHZ A;  2OE1 A;  2LQO A;  2GZP A;  2KP1 A;  5G30 A;  2DSA A;  1TKD B;  5DBQ A;  5KN1 A;  1A0F A;  5DVB A;  3GA4 A;  1B9X C;  1T7P B;  4G19 A;  4GQF A;  1PX6 A;  1XBS A;  2AUV A;  1UN2 A;  3FR9 A;  1YKA A;  4KSO A;  4MDC A;  5D93 A;  2H30 A;  2YOI A;  1GLP A;  2IMF A;  5H5S A;  2OBK A;  3KTL A;  4X43 A;  3RAZ A;  4KUN A;  2FCH A;  5JCG A;  1TRS A;  1HNC A;  1AQX A;  1EP8 A;  1V57 A;  4I8B A;  4XS4 A;  3IK9 A;  3S9F A;  3G7Y A;  3FEU A;  4F9Z A;  2AJQ B;  5IOX A;  5ABR A;  4K9Z A;  3IV4 A;  1AC1 A;  4QQ7 A;  4HUA A;  1GWC A;  3GL5 A;  1B4Q A;  5F05 A;  1SJI A;  4PXO A;  4QL9 A;  3GUR A;  2O87 A;  3H4K A;  4JU5 A;  3J7Y k;  2GSS A;  4E8E A;  4K6X A;  4L5O A;  2C0G A;  3FRC A;  4KE3 A;  2OAD A;  4PUA A;  4F0B A;  2YZU A;  3F63 A;  1WE0 A;  2YWI A;  2YPM A;  6GSX A;  5DCG A;  3GNJ A;  1QK8 A;  2O8V B;  2VL2 C;  1WRY A;  1GNW A;  4LMV A;  5ECQ B;  5C04 A;  2H0G A;  4MPF A;  1RK4 A;  1T8E B;  2PER A;  2IL3 A;  1A8L A;  3GKM A;  2MYG A;  2FA8 A;  2HE3 A;  2A2S A;  6GSY A;  3KM6 A;  2WS2 A;  2ZUP A;  3ERG A;  1G0T A;  2KHP A;  3UJ1 A;  3F6F A;  1UC7 A;  3ZVJ D;  2H6Y A;  2C0F A;  3HXS A;  3FKF A;  4V2L A;  2F8F A;  3TB2 A;  3HCZ A;  4CHS A;  3C8E A;  3HDC A;  4KX4 A;  1O8X A;  1GUL A;  5FT3 A;  2H74 A;  3DKS A;  5ECP B;  3C73 A;  3LGC A;  3P8W A;  2HT9 A;  2CVK A;  5IMV A;  1WPI A;  1U88 A;  2DJK A;  3APS A;  3KZQ A;  5HR3 A;  2VL9 A;  4OD7 A;  3F4R A;  2FWF A;  1YF0 A;  4IW9 A;  4ZL8 A;  3I43 A;  2F9S A;  3LXZ A;  1VF4 A;  2GLR A;  5D96 A;  2ZCT A;  5FWG A;  3CBU A;  3DWV A;  4MP4 A;  1GUH A;  2X8C A;  4RUV A;  2PBJ A;  3LG6 A;  5A5K A;  1IYH A;  1Q4J A;  3VLN A;  2H66 A;  5ECN B;  2V2G A;  2WGR A;  1SYR A;  1JLW A;  5EL8 A;  1B4P A;  2QC7 A;  2R5G A;  5ELA A;  1U6T A;  1PQN A;  4HU7 A;  3ZFB A;  2GSR A;  2C1Y A;  3GKN A;  4IBP A;  3LYP A;  2MMA A;  3K8N A;  1HNA A;  4TXO B;  1EEJ A;  3CYN A;  2H75 A;  3N9J A;  4TVE A;  4DSR A;  4L0W A;  3TJG A;  1OVN A;  3GHA A;  2LEG A;  2M46 A;  2RUE A;  3HJO A;  5IMC A;  1VF3 A;  2YWN A;  3QAV A;  4TR0 A;  4GTU A;  1AIU A;  5F07 A;  2LQQ A;  1XW9 A;  2NBS A;  2XBQ A;  5DCH A;  4PQI A;  16GS A;  3WGE A;  1PN9 A;  4ECC A;  3F3R A;  1M9A A;  2VL2 A;  1ZMA A;  4WR5 A;  4HEA 2;  1X9W B;  3CSI A;  3BOA A;  3EIN A;  1AW9 A;  1GTI A;  2PMT A;  1BYE A;  2E2M A;  1OE8 A;  2OAC A;  5E4W A;  3IR4 A;  1H75 A;  3GST A;  4L0U A;  4RQX A;  4ZBB A;  4AGS A;  5IMA A;  4YQM A;  2H71 A;  2CA8 A;  1KBN A;  4TN8 A;  2CAI A;  4OFT A;  3RHB A;  4HOJ A;  1E2Y A;  3FZ4 A;  2NDO A;  3KCM A;  1I9D A;  4BWS A;  5INY A;  1ZGN A;  6GSU A;  1ERV A;  5AIX A;  4ZB8 A;  2O7K A;  3BCK A;  3DVX A;  3VI7 A;  4OFN A;  5LNK e;  1SD8 A;  1TRU A;  4IJI A;  4MJA A;  4TR1 B;  3GH6 A;  2M72 A;  4IVF A;  3D21 A;  4MJC A;  2FHE A;  3CTG A;  5DDL A;  13GS A;  3KD0 A;  1PSQ A;  4G9H A;  2GGT A;  1MDK A;  4JR4 A;  2N5B A;  2I4A A;  3KH9 A;  10GS A;  2GQM A;  2LV3 A;  1H4O A;  1OE7 A;  2JU5 A;  2F8A A;  1OC9 B;  2GTU A;  12GS A;  2R2J A;  3Q19 A;  1V58 A;  2VO4 A;  3IAM 2;  5KN3 A;  2XHF A;  5G1K A;  1SJ6 A;  2VCV A;  2VCZ A;  1N8J A;  1SD9 A;  2XPE A;  4O7H A;  2HRN A;  4ACS A;  1G6Y A;  4POL A;  2NPB A;  1YZX A;  4MJB A;  1B9Y C;  2BJX A;  1QGV A;  3KEB A;  3TDG A;  2AHE A;  3DML A;  3CTF A;  1A0R P;  1JZW A;  4RI7 A;  5DAL A;  4JBB A;  4Z7X A;  1KTE A;  5IOW A;  1T3B A;  3DVW A;  3IPZ A;  2VM2 A;  3EU4 A;  2RLI A;  1GUM A;  1XW5 A;  3GTU B;  2VLU A;  4GF0 A;  2B1L A;  4AF2 A;  1TK0 B;  3RHC A;  3D4M A;  4HU9 A;  4MF5 A;  3M8N A;  4KSM A;  2P5R A;  2B1K A;  1F3B A;  1FAA A;  1U3A A;  2NVL A;  2FWG A;  1QQ2 A;  1V2A A;  3FYG A;  2N5F A;  3D0Z A;  1K3Y A;  5IMZ A;  5J5N A;  2IN3 A;  2A4V A;  3AY8 A;  5IPH A;  1OC8 A;  2R37 A;  2AB6 A;  2KLX A;  4WF4 A;  4EUY A;  4OMV A;  2H0I A;  2E2G A;  4BA7 A;  2VAF A;  4RQR A;  4OWY A;  5CRG A;  4YQU A;  3QOU A;  1GTU A;  5JWO B;  1TTZ A;  2GZY A;  5DAK A;  3TJK A;  1T4Z A;  4KDY A;  3C71 A;  2WUL A;  4MH3 A;  4IN0 A;  2J23 A;  5ID2 A;  5GAN D;  2FUG 2;  4JR6 A;  4P3Y B;  1EV9 A;  4XS1 A;  1SK1 A;  3VWW A;  4YH2 A;  1EOG A;  3FR6 A;  2VCX A;  1KEB A;  2YN1 A;  5AGY A;  5GZZ B;  3TGZ A;  1PX7 A;  1MTC A;  5J9B A;  5LCZ A;  5DQY A;  3WT2 A;  2OA7 A;  1GTB A;  2VUP A;  2GVP A;  4KDU A;  2IMK A;  2YJH A;  4N10 A;  4MZC A;  2IFQ A;  3FZ9 A;  4XS4 B;  4PGT A;  4LA1 A;  3UVT A;  1W89 A;  3HZ8 A;  4GCI A;  4POK A;  2TRX A;  5JWR B;  1M7T A;  2I81 A;  4NXI A;  5A4V A;  4EE0 A;  3CMI A;  4WEY A;  3SBC A;  4QL7 A;  5D73 A;  3VWV A;  2L6C A;  2L5O A;  1BED A;  3GX0 A;  4IQ1 A;  5CRW A;  2PVQ A;  4MPG A;  4PNG A;  2G2Q A;  2K8S A;  3QAW A;  3ED3 A;  1ERT A;  1W4V A;  1S3D A;  4ZB9 A;  3UVH A;  3KP9 A;  2J9H A;  1X9M B;  1SK2 A;  2B7K A;  3KMO A;  1URM A;  1BX9 A;  1M0U A;  1YF1 A;  5B6N A;  4TW5 A;  2JZR A;  3HD5 A;  2YNX A;  2BTO T;  2VD0 A;  2NTO A;  1GSD A;  3N5O A;  4NV2 A;  5CRH A;  2LUS A;  4DSQ A;  1EGO A;  3CRU A;  1SL2 B;  4GSS A;  5EVO A;  2IPA A;  4JE1 A;  3VK9 A;  2F3M A;  1JZO A;  3MAK A;  3F3Q A;  1SJZ A;  1XPV A;  5GST A;  1K0M A;  3EWL A;  4NMU A;  4NWY A;  3D22 A;  5ECK B;  4PUR A;  1SKR B;  6GSV A;  5KN0 A;  1GNE A;  1Y25 A;  1O8W A;  1B8X A;  3E9J B;  2PUK C;  3D4T A;  3EUR A;  2P0G A;  3KXO A;  4WXT A;  4MLY A;  3GL3 A;  3UAP A;  1A2J A;  2H01 A;  4Q5R A;  1S3A A;  2YZH A;  1XXU A;  1M2D A;  3FY7 A;  1X9S B;  1YEX A;  3ME8 A;  2CAQ A;  3FK8 A;  3ISO A;  3VI5 A;  2CVB A;  1TXX A;  1YQ1 A;  1T4Y A;  2R4V A;  3TKP A;  4XIH A;  2YP6 A;  5HR2 A;  4TOP A;  18GS A;  1SKW B;  5F06 A;  2DJJ A;  5D9V A;  2WRT A;  4ILF A;  1XWB A;  2F51 A;  4V1A g;  2RII A;  3UBL A;  2KOK A;  1BAY A;  1SK0 A;  5CYY A;  3ME7 A;  4WKW A;  3F4S A;  3P2A A;  5ECL B;  4NV5 A;  5J9C A;  1VF2 A;  5ECM B;  3KGK A;  1RW1 A;  1FB6 A;  4YQV A;  4MAB A;  2DMM A;  2CX3 A;  3TRP A;  4DSS A;  4KDX A;  3IRA A;  4MF6 A;  1CQG A;  2X8G A;  3J7Y b;  4JED A;  5IM9 A;  1AXD A;  1NSW A;  3IK7 A;  3GYK A;  3QCP A;  2WZ9 A;  5CP1 A;  1WMJ A;  2I1U A;  1K0O A;  3FZA A;  3MNG A;  5D9W A;  2AAW A;  2IJY A;  3RPP A;  1M99 A;  1R5A A;  2IWT A;  1JZD A;  2XPD A;  2H1G A;  4G10 A;  4I2T A;  5FHI A;  1HD2 A;  4CW9 A;  3QFA C;  3VUR A;  2FY6 A;  3U6V A;  1C72 A;  2JSY A;  4IEL A;  2YCD A;  2R3X A;  3KIJ A;  5E59 A;  1XOA A;  2OBI A;  2V6K A;  1F3A A;  4WBR D;  4WET A;  4I2U A;  4ECB A;  1Z5Y E;  3GUS A;  5B8A A;  2IME A;  5AN1 A;  2P5Q A;  3EMX A;  4IP6 A;  3WT1 A;  1TP9 A;  1FVK A;  2VOC A;  1TK5 B;  1TJD A;  3FW2 A;  2CZ2 A;  4LMW A;  5DJL A;  1G6W A;  4TRX A;  3L78 A;  3F0I A;  3E0U A;  3G7J A;  4ECJ A;  4V2N A;  4N0V A;  4MK3 A;  3ZYW A;  1BG5 A;  5CRD A;  4KB3 A;  3UIW A;  1O6J A;  3WD6 A;  2PU9 C;  2VLT A;  3O6T A;  1R7H A;  4I97 A;  1Z3E A;  4J2F A;  4ISD A;  1A24 A;  2PPT A;  3I6A A;  1TRV A;  4TR4 A;  1QXH A;  2K9F A;  1LU4 A;  4EDZ A;  3ZTL A;  4ML1 A;  4KW6 A;  1LBK A;  2L4C A;  4L8E A;  2AV4 A;  1K0N A;  1AQV A;  5ELG A;  5H5R A;  5KN2 A;  4BL7 A;  3M1G A;  1XVW A;  3TKS E;  5IO2 A;  4IGJ A;  1XWG A;  1Y6E A;  4MF7 A;  5D8I A;  9GSS A;  14GS A;  1EWX A;  2LRC A;  1JLV A;  2JZS A;  4X0X A;  1EP7 A;  2HFD A;  3Q6O A;  2CVD A;  1GSF A;  5G5F A;  5LD0 A;  3A3T A;  5DAL B;  4FIW A;  2V6O A;  4KAE A;  1Z7R A;  1M9B A;  5ECH B;  3TKS C;  5IQY A;  3KP8 A;  1DBY A;  3LEF A;  3TKQ A;  2HZE A;  5CAX A;  3VPQ A;  5AIV A;  4MZW A;  4K7O A;  3UL3 A;  1F37 A;  5IMD A;  3ZFL A;  2LTK A;  1FHE A;  3D6I A;  3QR6 A;  5ENU A;  4OO4 A;  2GS3 A;  1EGR A;  1ERU A;  3ZVJ A;  1FVJ A;  1GLQ A;  4HS1 A;  3IHQ A;  4GXZ A;  2VM1 A;  3G7I A;  3GRX A;  2JAD A;  3TRQ A;  3LQ7 A;  1ST9 A;  2P31 A;  1SYX A;  4MA9 A;  1XFL A;  2ON7 A;  3W6G A;  3KJY A;  5IO0 A;  4F82 A;  2FNO A;  3CRT A;  2DC5 A;  2DJ1 A;  4BVY A;  2O85 A;  20GS A;  1Z7P A;  4WR4 A;  3R2Q A;  1SL0 B;  1CQH A;  5CO3 A;  5DAK B;  4HZ4 A;  4DVC A;  3F4T A;  4J57 E;  5ID2 B;  1PD2 1;  4IQA A;  2E0Q A;  3BBY A;  1O73 A;  2I3Y A;  4TKY A;  2JL4 A;  4OCE A;  5IMF A;  1DUG A;  3H93 A;  6GST A;  4ID0 A;  5J41 A;  3BJ5 A;  3LWA A;  4TXV A;  3DEX A;  2HYX A;  2PVO C;  3TOU A;  3W8J A;  1RQM A;  4ZIL A;  2YWM A;  2PWJ A;  1K0D A;  2CV4 A;  2C80 A;  5JCW A;  3TUE A;  1TI1 A;  4HI7 A;  1HYU A;  5B7C A;  1K3O A;  2V1M A;  1R5P A;  2DIZ A;  2DIY A;  1DE1 A;  4ZBA A;  1O7U A;  3WGD A;  3L9V A;  3HJM A;  2ZNM A;  3IDV A;  2IFQ B;  3QFB C;  4EO3 A;  4RI6 A;  2B6M A;  3ZZX A;  4XRD A;  7GSS A;  2GT6 A;  3HVX A;  3KMN A;  5ECO B;  3EVI A;  4PX1 A;  3HVS A;  2QSI A;  1EEM A;  4GWR A;  2E7P A;  2K6V A;  3UEM A;  1E6B A;  4K2D A;  4HZ2 A;  3HZ4 A;  3TKS A;  1XWK A;  1AQW A;  1MDI A;  5EPF A;  1B48 A;  3UOM A;  4WF5 A;  4XTS A;  4AJ6 A;  3O76 A;  1TU8 A;  5HQP A;  4G2E A;  1Q98 A;  3PGT A;  3EC3 A;  1ZYQ B;  4LL4 B;  3RPN A;  2JSZ A;  3GH9 A;  3ZML A;  5F8B A;  4D73 A;  1PKZ A;  2B7J A;  5ECI B;  3GX8 A;  3MDK A;  4LL1 B;  2K18 A;  4F2I A;  3ERF A;  1DSB A;  2LRN A;  1J9B A;  2OE3 A;  3LSZ A;  1NW2 A;  2H73 A;  2H6Z A;  3SWL A;  5ECS A;  1DE2 A;  1GSS A;  2TRC P;  1WJK A;  1KNG A;  3O3T A;  3Q18 A;  5H5Q A;  1WOU A;  2A2R A;  2WJU A;  2L4Q A;  1OKD A;  1AUC A;  1ZZY A; 
#chains in the Genus database with same CATH topology
 5A4W A;  2HRA A;  1PRX A;  2PGT A;  2X99 A;  1WIK A;  1ABA A;  2R0P A;  4LLR A;  5J4U A;  2CT6 A;  1ZL9 A;  2VL3 A;  3H8Q A;  1TK8 B;  3EMP A;  3F8U A;  4K5R A;  2JAC A;  4A5P A;  2MBT A;  2EIO A;  2HSH A;  5JWQ B;  4EVM A;  3DYR A;  3ERW A;  3A5W A;  5G2Z A;  1LJR A;  1J08 A;  2VLV A;  3EE2 A;  4O92 A;  3I9V 2;  17GS A;  5JCU A;  4KA0 A;  1FOV A;  6GSS A;  5L71 A;  2OE0 A;  4I6X A;  4DSS B;  1X5E A;  1O85 A;  1OYJ A;  2H1B A;  5CRE A;  4JRR A;  5BRT A;  5DQS A;  3D5J A;  1Z6N A;  2H76 A;  3L0H A;  1BJX A;  2GDR A;  3VWX A;  2C0E A;  2DJ3 A;  4ZL7 A;  4ULX A;  3MYD A;  4Q5Q A;  1GRX A;  3DXB A;  1V9W A;  1S3C A;  3DRN A;  3IAS 2;  4K7N A;  1F2E A;  2PN8 A;  1HQO A;  4E8H A;  3NOF A;  1JHB A;  2DJ2 A;  1FG4 A;  1FW1 A;  3ZRD A;  5D9X A;  3WGX A;  2HI7 A;  5KOX A;  4GLT A;  1TOF A;  4FYC A;  4K1F A;  3HY2 A;  1NM3 A;  3ZLP A;  2X64 A;  1GTA A;  1G7E A;  1G7O A;  5C00 A;  3GN3 A;  4EF0 A;  2FWH A;  1I5G A;  3IOS A;  4HSC X;  5A4U A;  4KCA A;  1GL8 A;  3PR8 A;  2ES7 A;  2C0D A;  5BMU A;  4MH2 A;  3R3E A;  3BCI A;  5ECR B;  1K0B A;  3HVV A;  3OR5 A;  5D9T A;  5IIZ A;  1ZOF A;  1ZYP A;  4HJ2 A;  2YV9 A;  2CX4 A;  1XWC A;  4POM A;  1PMT A;  3LFL A;  1GSU A;  1M2A A;  2VD1 A;  1U87 A;  3HKR A;  1QMV A;  4YAV A;  3Q74 A;  2V41 A;  2AYT A;  2HRK A;  3IE3 A;  4XHM A;  4GST A;  3C7M A;  1XWA A;  1ILO A;  2BMX A;  2MBS A;  4EXJ A;  4ECI A;  3G9B A;  3FR3 A;  3M9J A;  2C4J A;  2IIY A;  2CQ9 A;  3IBH A;  2LNS A;  2XC2 A;  2C3N A;  2QKE A;  4K7I A;  4Q5F A;  2WDU A;  2H0H A;  3PIN A;  4NHW A;  2LJR A;  1PGT A;  4XRA A;  3QD9 A;  3TOT A;  4F0C A;  2GQL A;  2HZF A;  3CSJ A;  3FZ5 A;  1T1V A;  4PNF A;  1Z6M A;  2EIR A;  2VIM A;  2XBI A;  5HFG A;  3QPM A;  4K5S A;  3GSS A;  4IKH A;  1YKC A;  5G31 A;  1PL1 A;  2FGX A;  3A2V A;  2YWO A;  4EL1 A;  4V2M A;  3ZL5 A;  2KUC A;  2LST A;  4YAP A;  4ML6 A;  2N5A A;  2LNT A;  3L9U A;  3HA9 A;  2L5L A;  4N30 A;  2GSQ A;  5HFK A;  4EIQ A;  2HZE B;  1OC3 A;  3EU3 A;  2MMN A;  4ZBD A;  5IPG A;  1A2M A;  2VCW A;  3IA1 A;  3DIE A;  2GT5 A;  3NZN A;  1A2L A;  2GST A;  3TJF A;  1K3L A;  3UBK A;  4NPB A;  4IJ3 A;  4O32 A;  4V1A p;  2C3Q A;  4H86 A;  3V1W A;  1GUK A;  3MSZ A;  1TW9 A;  3LYK A;  5HR0 A;  1UA5 A;  4PQH A;  4XS6 A;  2WCI A;  4HDE A;  3WYW A;  4KH7 A;  1OKT A;  4X4J A;  3NIV A;  3EYT A;  1BQ7 A;  3HYP A;  2M80 A;  2LJK A;  4BVY B;  3CSH A;  11GS A;  3GV1 A;  1ACV A;  2OKA A;  1HNB A;  1X5D A;  1J0F A;  2B5Y A;  3I69 A;  1XVQ A;  4FYU A;  1R4W A;  1K0C A;  3M9K A;  1GSQ A;  1XIY A;  2HXK A;  2YV7 A;  1JZR A;  1IYI A;  3JCM L;  4F03 A;  1F9M A;  3C1S A;  5HR1 A;  2L6D A;  1MDJ A;  2FD3 A;  4BVX A;  5DJM A;  2HSM A;  4HQZ A;  2HLS A;  2VCT A;  4POB A;  2O89 A;  2GQK A;  1GH2 A;  2TIR A;  4KGI A;  1SKS B;  2LKU A;  3LXT A;  2YJ7 A;  3BD2 A;  2H6X A;  1XZO A;  1VGL A;  2B3S A;  1M3J A;  3LW9 A;  2CZ3 A;  2MMO A;  3GFK A;  1R26 A;  3TRX A;  1ML6 A;  5B8B A;  1EV4 A;  1SU9 A;  5KEJ A;  2LS5 A;  4ZXG A;  3M0F A;  1UVZ A;  5GAP D;  1V40 A;  1YEP A;  4MZB A;  2OJL A;  3ZIT A;  2LRT A;  1USB A;  3IXR A;  3KH7 A;  2X8H A;  1ZCP A;  2QA2 A;  1XOB A;  5COH A;  4OCF A;  1TU7 A;  3E3E A;  2RUF A;  3C1R A;  2G0F A;  22GS A;  4GQC A;  3GKX A;  1PL2 A;  3ZIJ A;  4MJE A;  3VWU A;  2L59 A;  4ZIJ A;  4TXO A;  1XCC A;  2EIQ A;  4XCS A;  2V32 A;  3DD3 A;  4NAX A;  3A2X A;  4D73 B;  8GSS A;  1O81 A;  2I9H A;  1X0R A;  2L57 A;  4K0N A;  2C8U A;  1YJ6 A;  3HHV A;  2DJ0 A;  3DGQ A;  3IC4 A;  4ZL9 A;  2FWE A;  2X4A A;  1WP0 A;  1F6M C;  2H1D A;  4AJ8 A;  2H1A A;  3TKR A;  4FH8 A;  5CNW A;  1THX A;  2REM A;  1JFU A;  3FHK A;  3GIX A;  2RM5 A;  5EY6 A;  5GSS A;  1OAZ A;  4BPY A;  1PN0 A;  2VCQ A;  2H19 A;  3F9U A;  1M2B A;  5F0G A;  4L5L A;  3H1N A;  2DML A;  2MMZ A;  1U3I A;  4JZQ A;  2HRF A;  2EC4 A;  3L4N A;  4J56 E;  4ZB6 A;  3TJJ A;  1GSY A;  1NHY A;  2H8L A;  4GSN A;  4BWQ A;  1GP1 A;  3RDW A;  4IP1 A;  4CDO A;  1V98 A;  4K8M A;  4K0G A;  4AJ7 A;  3P7X A;  3U5R E;  3GMF A;  4DEJ A;  4X1U A;  2D2Z A;  5G1L A;  4FYB A;  1TDI A;  2YAN A;  1TRW A;  1K0A A;  3F6D A;  1WWJ A;  3GKK A;  3VPT A;  1QFN A;  2QGV A;  2HNL A;  1FB0 A;  19GS A;  3LOR A;  4N0Z A;  1EOH A;  3P90 A;  3QMX A;  4FO5 A;  1THO A;  1T00 A;  4O5R A;  2JZT A;  2H72 A;  3TJB A;  2DLX A;  4O5Q A;  4TR1 A;  5HFI A;  4O5U A;  3LJR A;  3UMA A;  4IS0 A;  1YY7 A;  1PKW A;  4USS A;  1XW6 A;  3L9S A;  2GZZ A;  4TR3 A;  1ERW A;  1A23 A;  3US3 A;  4IHU A;  4MMM A;  2MZC A;  5J3R A;  4KF9 A;  3KTB A;  1QUW A;  3PH9 A;  1OC9 A;  2R6K A;  2ALB A;  2ON5 A;  2Z9S A;  1PA3 A;  2H70 A;  5AIS A;  4N11 A;  1Z9H A;  3W8S A;  3M3M A;  2RM6 A;  2C3T A;  1YDK A;  3EPT A;  4PQ1 A;  1FO5 A;  2FA4 A;  4MCU A;  4I5Q A;  2K8V A;  4EDY A;  3H79 A;  3ZRE A;  2UZ8 A;  1N2A A;  4OFM A;  1ZYE A;  1AAZ A;  4KCE A;  4WBJ A;  2IMI A;  4PTS A;  4HJM A;  1EZK A;  1NHO A;  1X5C A;  4EC0 A;  4OO5 A;  2DBC A;  1MD3 A;  2KP2 A;  2B5X A;  6GSW A;  2IMD A;  4EKZ A;  3CXG A;  3GTU A;  3HJP A;  1SL1 B;  1VRS D;  1A8Y A;  3MWH A;  3QDN A;  3TCO A;  4PUF C;  3APQ A;  1GSE A;  1TI3 A;  5B6M A;  2HSY A;  3IHG A;  2LJA A;  2WB9 A;  1MD4 A;  4KND A;  3UAR A;  2B5E A;  5G5E A;  2WFC A;  4HQS A;  1VF1 A;  3RBT A;  3ZIV A;  3QAG A;  1SEN A;  1MEK A;  3APO A;  2FLS A;  3VFI A;  1ON4 A;  4Q5N A;  3ZMK A;  3A2W A;  4GRF A;  4NHZ A;  2OE1 A;  2LQO A;  2GZP A;  2KP1 A;  5G30 A;  2DSA A;  1TKD B;  5DBQ A;  5KN1 A;  1A0F A;  5DVB A;  3GA4 A;  1B9X C;  1T7P B;  4G19 A;  4GQF A;  1PX6 A;  1XBS A;  2AUV A;  1UN2 A;  3FR9 A;  1YKA A;  4KSO A;  4MDC A;  5D93 A;  2H30 A;  2YOI A;  1GLP A;  2IMF A;  5H5S A;  2OBK A;  3KTL A;  4X43 A;  3RAZ A;  4KUN A;  2FCH A;  5JCG A;  1TRS A;  1HNC A;  1AQX A;  1EP8 A;  1V57 A;  4I8B A;  4XS4 A;  3IK9 A;  3S9F A;  3G7Y A;  3FEU A;  4F9Z A;  2AJQ B;  5IOX A;  5ABR A;  4K9Z A;  3IV4 A;  1AC1 A;  4QQ7 A;  4HUA A;  1GWC A;  1ZYN A;  3GL5 A;  1B4Q A;  5F05 A;  1SJI A;  4PXO A;  4QL9 A;  3GUR A;  2O87 A;  3H4K A;  4JU5 A;  3J7Y k;  2GSS A;  4E8E A;  4K6X A;  4L5O A;  2C0G A;  3FRC A;  4KE3 A;  2OAD A;  4PUA A;  4F0B A;  2YZU A;  3F63 A;  1WE0 A;  4YKG A;  2YWI A;  2YPM A;  6GSX A;  5DCG A;  3GNJ A;  1QK8 A;  2O8V B;  2VL2 C;  1WRY A;  1GNW A;  4LMV A;  5ECQ B;  5C04 A;  2H0G A;  4MPF A;  1RK4 A;  1T8E B;  2PER A;  2IL3 A;  1A8L A;  3GKM A;  2MYG A;  2FA8 A;  2HE3 A;  2A2S A;  6GSY A;  3KM6 A;  4BL7 B;  2WS2 A;  2ZUP A;  3ERG A;  1G0T A;  2KHP A;  3UJ1 A;  3F6F A;  1UC7 A;  3ZVJ D;  2H6Y A;  2C0F A;  3HXS A;  3FKF A;  4V2L A;  2F8F A;  3TB2 A;  3HCZ A;  4CHS A;  3C8E A;  3HDC A;  4KX4 A;  1O8X A;  1GUL A;  5FT3 A;  4BVX B;  2H74 A;  3DKS A;  5ECP B;  3C73 A;  3LGC A;  3P8W A;  2HT9 A;  2CVK A;  5IMV A;  1WPI A;  1U88 A;  2DJK A;  3APS A;  3KZQ A;  5HR3 A;  4Z2R A;  2VL9 A;  4OD7 A;  3F4R A;  2FWF A;  1YF0 A;  4IW9 A;  4ZL8 A;  3I43 A;  2F9S A;  3LXZ A;  1VF4 A;  2GLR A;  5D96 A;  2ZCT A;  5FWG A;  3CBU A;  3DWV A;  4MP4 A;  1GUH A;  2X8C A;  4RUV A;  2PBJ A;  3LG6 A;  5A5K A;  1IYH A;  1Q4J A;  3VLN A;  2H66 A;  5ECN B;  3CQF A;  2V2G A;  2WGR A;  1SYR A;  1JLW A;  5EL8 A;  1B4P A;  2QC7 A;  2R5G A;  5ELA A;  1U6T A;  1PQN A;  4HU7 A;  3ZFB A;  2GSR A;  2C1Y A;  3GKN A;  4IBP A;  3LYP A;  2MMA A;  3K8N A;  1HNA A;  4TXO B;  5KOW A;  1EEJ A;  3CYN A;  2H75 A;  3N9J A;  4TVE A;  4DSR A;  4L0W A;  3TJG A;  1OVN A;  3GHA A;  2LEG A;  2M46 A;  2RUE A;  3HJO A;  5IMC A;  1VF3 A;  2YWN A;  3QAV A;  4TR0 A;  4GTU A;  1AIU A;  5F07 A;  2LQQ A;  1XW9 A;  2NBS A;  2XBQ A;  5DCH A;  4PQI A;  16GS A;  3WGE A;  1PN9 A;  4ECC A;  3F3R A;  4G0L A;  1M9A A;  2VL2 A;  1ZMA A;  4WR5 A;  4HEA 2;  1X9W B;  3CSI A;  3BOA A;  3EIN A;  1AW9 A;  1GTI A;  2PMT A;  1BYE A;  2E2M A;  1OE8 A;  2OAC A;  5E4W A;  3IR4 A;  1H75 A;  3GST A;  4L0U A;  4RQX A;  4ZBB A;  4AGS A;  5IMA A;  4YQM A;  2H71 A;  2CA8 A;  1KBN A;  4TN8 A;  2CAI A;  4OFT A;  3RHB A;  4HOJ A;  1E2Y A;  3FZ4 A;  2NDO A;  3KCM A;  1I9D A;  4BWS A;  5INY A;  1ZGN A;  6GSU A;  1ERV A;  5AIX A;  4ZB8 A;  2O7K A;  3BCK A;  3DVX A;  3VI7 A;  4OFN A;  5LNK e;  4MNN A;  1SD8 A;  1TRU A;  4IJI A;  4Z2U A;  4MJA A;  4TR1 B;  3GH6 A;  2M72 A;  4IVF A;  3D21 A;  4MJC A;  2FHE A;  3CTG A;  5DDL A;  13GS A;  3KD0 A;  1PSQ A;  4G9H A;  2GGT A;  1MDK A;  4JR4 A;  2N5B A;  2I4A A;  3KH9 A;  10GS A;  2GQM A;  2LV3 A;  1H4O A;  1OE7 A;  2JU5 A;  2F8A A;  1OC9 B;  2GTU A;  12GS A;  2R2J A;  3IC8 A;  3Q19 A;  1V58 A;  2VO4 A;  3IAM 2;  5KN3 A;  2XHF A;  5G1K A;  1SJ6 A;  2DKH A;  2VCV A;  2VCZ A;  1N8J A;  1SD9 A;  2XPE A;  4O7H A;  2HRN A;  4ACS A;  1G6Y A;  4POL A;  2NPB A;  1YZX A;  4MJB A;  1B9Y C;  2BJX A;  1QGV A;  3KEB A;  3TDG A;  2AHE A;  3DML A;  3CTF A;  1A0R P;  1JZW A;  4RI7 A;  5DAL A;  4JBB A;  4Z7X A;  1KTE A;  4Z2T A;  5IOW A;  1T3B A;  2R0C A;  3DVW A;  3IPZ A;  2VM2 A;  3EU4 A;  2RLI A;  1GUM A;  1XW5 A;  3GTU B;  2VLU A;  4GF0 A;  2B1L A;  4AF2 A;  1TK0 B;  3RHC A;  3D4M A;  4HU9 A;  4MF5 A;  3M8N A;  4KSM A;  2P5R A;  2B1K A;  1F3B A;  1FAA A;  1U3A A;  2NVL A;  2FWG A;  1QQ2 A;  1V2A A;  3FYG A;  2N5F A;  3D0Z A;  1K3Y A;  5IMZ A;  5J5N A;  2IN3 A;  2A4V A;  3AY8 A;  5IPH A;  1OC8 A;  2R37 A;  2AB6 A;  2KLX A;  4WF4 A;  4EUY A;  4OMV A;  2H0I A;  2E2G A;  4BA7 A;  2VAF A;  4RQR A;  4OWY A;  5CRG A;  4YQU A;  3QOU A;  1GTU A;  5JWO B;  1TTZ A;  2GZY A;  5DAK A;  3TJK A;  1T4Z A;  4KDY A;  3C71 A;  3HVN A;  2WUL A;  4MH3 A;  4IN0 A;  2J23 A;  5ID2 A;  5GAN D;  2FUG 2;  4JR6 A;  4P3Y B;  1EV9 A;  4XS1 A;  4BIK A;  1SK1 A;  3VWW A;  4YH2 A;  1EOG A;  3FR6 A;  2VCX A;  1KEB A;  2YN1 A;  4K2X A;  4G0I A;  5AGY A;  5GZZ B;  3TGZ A;  1PX7 A;  1MTC A;  5J9B A;  5LCZ A;  5DQY A;  3WT2 A;  2OA7 A;  1GTB A;  2VUP A;  2GVP A;  4KDU A;  2IMK A;  2YJH A;  4N10 A;  4MZC A;  2IFQ A;  3FZ9 A;  4XS4 B;  4PGT A;  4LA1 A;  3UVT A;  1W89 A;  3HZ8 A;  4GCI A;  4POK A;  2TRX A;  5JWR B;  2QA1 A;  1M7T A;  2I81 A;  4NXI A;  5A4V A;  4EE0 A;  3CMI A;  4WEY A;  3SBC A;  4QL7 A;  5D73 A;  3VWV A;  2L6C A;  2L5O A;  1BED A;  3GX0 A;  4IQ1 A;  5CRW A;  4G0K A;  2PVQ A;  4MPG A;  4PNG A;  2G2Q A;  2K8S A;  3QAW A;  3ED3 A;  1ERT A;  1W4V A;  1S3D A;  4ZB9 A;  3UVH A;  3KP9 A;  2J9H A;  1X9M B;  4ICY A;  1SK2 A;  2B7K A;  3KMO A;  1URM A;  1BX9 A;  1M0U A;  1YF1 A;  5B6N A;  4TW5 A;  2JZR A;  3HD5 A;  2YNX A;  2BTO T;  2VD0 A;  2NTO A;  1GSD A;  3N5O A;  4NV2 A;  5CRH A;  2LUS A;  4DSQ A;  1EGO A;  3CRU A;  1SL2 B;  4GSS A;  5EVO A;  2IPA A;  4JE1 A;  3VK9 A;  2F3M A;  1JZO A;  3MAK A;  2DKI A;  3F3Q A;  1SJZ A;  1XPV A;  5GST A;  1K0M A;  3EWL A;  4NMU A;  4NWY A;  3D22 A;  5ECK B;  4PUR A;  1SKR B;  6GSV A;  5KN0 A;  1GNE A;  1Y25 A;  1O8W A;  1B8X A;  3E9J B;  2PUK C;  3D4T A;  3EUR A;  2P0G A;  3KXO A;  4WXT A;  4MLY A;  3GL3 A;  3UAP A;  1A2J A;  2H01 A;  4Q5R A;  1S3A A;  3MIX A;  2YZH A;  1XXU A;  1M2D A;  4YKF A;  3FY7 A;  1X9S B;  1YEX A;  3ME8 A;  2CAQ A;  3FK8 A;  3ISO A;  3VI5 A;  2CVB A;  1TXX A;  1YQ1 A;  1T4Y A;  2R4V A;  3TKP A;  4XIH A;  2YP6 A;  5HR2 A;  4TOP A;  18GS A;  1SKW B;  5F06 A;  2DJJ A;  5D9V A;  2WRT A;  4ILF A;  1XWB A;  2F51 A;  4V1A g;  2RII A;  3UBL A;  2KOK A;  1BAY A;  1SK0 A;  5CYY A;  3ME7 A;  4WKW A;  3F4S A;  2A2P A;  3P2A A;  5ECL B;  4NV5 A;  5J9C A;  1VF2 A;  5ECM B;  3KGK A;  1RW1 A;  1FB6 A;  4YQV A;  4MAB A;  2DMM A;  2CX3 A;  3TRP A;  4DSS A;  4KDX A;  3IRA A;  4MF6 A;  1CQG A;  2X8G A;  3J7Y b;  4JED A;  5IM9 A;  1AXD A;  1FOH A;  1NSW A;  3IK7 A;  3GYK A;  3QCP A;  2WZ9 A;  5CP1 A;  1WMJ A;  2I1U A;  1K0O A;  3FZA A;  3MNG A;  5D9W A;  2AAW A;  2IJY A;  3RPP A;  1M99 A;  1R5A A;  2IWT A;  1JZD A;  2XPD A;  2H1G A;  4G10 A;  4I2T A;  2R0G A;  5FHI A;  1HD2 A;  4CW9 A;  3QFA C;  3VUR A;  2FY6 A;  3U6V A;  1C72 A;  2JSY A;  4IEL A;  2YCD A;  2R3X A;  3KIJ A;  5E59 A;  1XOA A;  2OBI A;  2V6K A;  1F3A A;  4WBR D;  4WET A;  4I2U A;  4ECB A;  1Z5Y E;  3GUS A;  5B8A A;  2IME A;  5AN1 A;  2P5Q A;  3EMX A;  4IP6 A;  3WT1 A;  1TP9 A;  1FVK A;  2VOC A;  1TK5 B;  1TJD A;  3FW2 A;  2CZ2 A;  4LMW A;  5DJL A;  1G6W A;  4TRX A;  3L78 A;  3F0I A;  3E0U A;  3G7J A;  4ECJ A;  4V2N A;  4N0V A;  4MK3 A;  3ZYW A;  1BG5 A;  5CRD A;  1S3R A;  4KB3 A;  3UIW A;  1O6J A;  3WD6 A;  2PU9 C;  2VLT A;  3O6T A;  1R7H A;  4I97 A;  1Z3E A;  4J2F A;  4ISD A;  1A24 A;  2PPT A;  3I6A A;  1TRV A;  4TR4 A;  4EIP A;  1QXH A;  2K9F A;  1LU4 A;  4EDZ A;  3ZTL A;  4ML1 A;  4KW6 A;  1LBK A;  2L4C A;  4CY6 A;  4L8E A;  2AV4 A;  1K0N A;  1AQV A;  5ELG A;  5H5R A;  5KN2 A;  4BL7 A;  3M1G A;  1XVW A;  3TKS E;  5IO2 A;  4IGJ A;  1XWG A;  1Y6E A;  4MF7 A;  5D8I A;  9GSS A;  14GS A;  1EWX A;  2LRC A;  1JLV A;  2JZS A;  4X0X A;  1EP7 A;  2HFD A;  3Q6O A;  2CVD A;  1GSF A;  5G5F A;  5LD0 A;  3A3T A;  5DAL B;  4FIW A;  2V6O A;  4KAE A;  1Z7R A;  1M9B A;  5ECH B;  3TKS C;  5IQY A;  3KP8 A;  1DBY A;  3LEF A;  3TKQ A;  2HZE A;  5CAX A;  3VPQ A;  5AIV A;  3FMW A;  4MZW A;  4K7O A;  3UL3 A;  1F37 A;  5IMD A;  3ZFL A;  2LTK A;  1FHE A;  3D6I A;  3QR6 A;  5ENU A;  4OO4 A;  2GS3 A;  1EGR A;  1ERU A;  3ZVJ A;  1M3I A;  1FVJ A;  1GLQ A;  4HS1 A;  3IHQ A;  4GXZ A;  3A5I A;  2VM1 A;  3G7I A;  3GRX A;  2JAD A;  3TRQ A;  3LQ7 A;  1ST9 A;  2P31 A;  1SYX A;  4MA9 A;  1XFL A;  2ON7 A;  3W6G A;  3KJY A;  5IO0 A;  4F82 A;  2FNO A;  3CRT A;  2DC5 A;  2DJ1 A;  4BVY A;  2O85 A;  20GS A;  1Z7P A;  4WR4 A;  3R2Q A;  1SL0 B;  1CQH A;  5CO3 A;  5DAK B;  4HZ4 A;  4DVC A;  3F4T A;  1XG8 A;  4J57 E;  5ID2 B;  1PD2 1;  4IQA A;  2E0Q A;  1PFO A;  3BBY A;  1O73 A;  2I3Y A;  4TKY A;  2JL4 A;  4OCE A;  5IMF A;  1DUG A;  3H93 A;  6GST A;  4ID0 A;  5J41 A;  3BJ5 A;  3LWA A;  4TXV A;  3DEX A;  2HYX A;  2PVO C;  3TOU A;  3W8J A;  1RQM A;  4ZIL A;  2YWM A;  2PWJ A;  1K0D A;  2CV4 A;  2C80 A;  5JCW A;  3TUE A;  1TI1 A;  4HI7 A;  1HYU A;  5B7C A;  1K3O A;  2V1M A;  1R5P A;  2DIZ A;  2DIY A;  1DE1 A;  4ZBA A;  1O7U A;  3WGD A;  3L9V A;  3HJM A;  2ZNM A;  3IDV A;  2IFQ B;  3QFB C;  4EO3 A;  4RI6 A;  2B6M A;  3ZZX A;  4XRD A;  7GSS A;  2A4H A;  2GT6 A;  3HVX A;  3KMN A;  5ECO B;  3EVI A;  4PX1 A;  3HVS A;  2QSI A;  1EEM A;  4GWR A;  2E7P A;  2K6V A;  3UEM A;  1E6B A;  4K2D A;  4HZ2 A;  3HZ4 A;  3TKS A;  1XWK A;  1AQW A;  1MDI A;  5EPF A;  1B48 A;  3UOM A;  4WF5 A;  4XTS A;  4AJ6 A;  3O76 A;  1TU8 A;  5HQP A;  4G2E A;  1Q98 A;  3PGT A;  3EC3 A;  1ZYQ B;  4LL4 B;  3RPN A;  2JSZ A;  3GH9 A;  3ZML A;  5F8B A;  4D73 A;  1PKZ A;  2B7J A;  5ECI B;  3GX8 A;  3MDK A;  4LL1 B;  2K18 A;  4F2I A;  3ERF A;  2X49 A;  1DSB A;  2LRN A;  1J9B A;  2OE3 A;  3LSZ A;  1NW2 A;  4FQU A;  2H73 A;  2H6Z A;  3SWL A;  5ECS A;  1DE2 A;  1GSS A;  2TRC P;  4CY8 A;  1WJK A;  1KNG A;  3O3T A;  3PPU A;  3Q18 A;  5H5Q A;  1WOU A;  2A2R A;  2WJU A;  2L4Q A;  1OKD A;  1AUC A;  1ZZY A; 
#chains in the Genus database with same CATH homology
 5A4W A;  2HRA A;  1PRX A;  2PGT A;  2X99 A;  1WIK A;  1ABA A;  2R0P A;  4LLR A;  5J4U A;  2CT6 A;  1ZL9 A;  2VL3 A;  3H8Q A;  1TK8 B;  3EMP A;  3F8U A;  4K5R A;  2JAC A;  4A5P A;  2MBT A;  2EIO A;  2HSH A;  5JWQ B;  4EVM A;  3DYR A;  3ERW A;  3A5W A;  5G2Z A;  1LJR A;  1J08 A;  2VLV A;  3EE2 A;  4O92 A;  3I9V 2;  17GS A;  5JCU A;  4KA0 A;  1FOV A;  6GSS A;  5L71 A;  2OE0 A;  4I6X A;  4DSS B;  1X5E A;  1O85 A;  1OYJ A;  2H1B A;  5CRE A;  4JRR A;  5BRT A;  5DQS A;  3D5J A;  1Z6N A;  2H76 A;  3L0H A;  1BJX A;  2GDR A;  3VWX A;  2C0E A;  2DJ3 A;  4ZL7 A;  4ULX A;  3MYD A;  4Q5Q A;  1GRX A;  3DXB A;  1V9W A;  1S3C A;  3DRN A;  3IAS 2;  4K7N A;  1F2E A;  2PN8 A;  1HQO A;  4E8H A;  3NOF A;  1JHB A;  2DJ2 A;  1FG4 A;  1FW1 A;  3ZRD A;  5D9X A;  3WGX A;  2HI7 A;  5KOX A;  4GLT A;  1TOF A;  4FYC A;  4K1F A;  3HY2 A;  1NM3 A;  3ZLP A;  2X64 A;  1GTA A;  1G7E A;  1G7O A;  5C00 A;  3GN3 A;  4EF0 A;  2FWH A;  1I5G A;  3IOS A;  5A4U A;  4KCA A;  1GL8 A;  3PR8 A;  2ES7 A;  2C0D A;  5BMU A;  4MH2 A;  3R3E A;  3BCI A;  5ECR B;  1K0B A;  3HVV A;  3OR5 A;  5D9T A;  5IIZ A;  1ZOF A;  1ZYP A;  4HJ2 A;  2YV9 A;  2CX4 A;  1XWC A;  4POM A;  1PMT A;  3LFL A;  1GSU A;  1M2A A;  2VD1 A;  1U87 A;  3HKR A;  1QMV A;  4YAV A;  3Q74 A;  2V41 A;  2AYT A;  2HRK A;  3IE3 A;  4XHM A;  4GST A;  3C7M A;  1XWA A;  1ILO A;  2BMX A;  2MBS A;  4EXJ A;  4ECI A;  3G9B A;  3FR3 A;  3M9J A;  2C4J A;  2IIY A;  2CQ9 A;  3IBH A;  2LNS A;  2XC2 A;  2C3N A;  2QKE A;  4K7I A;  4Q5F A;  2WDU A;  2H0H A;  3PIN A;  4NHW A;  2LJR A;  1PGT A;  4XRA A;  3QD9 A;  3TOT A;  4F0C A;  2GQL A;  2HZF A;  3CSJ A;  3FZ5 A;  1T1V A;  4PNF A;  1Z6M A;  2EIR A;  2VIM A;  2XBI A;  5HFG A;  3QPM A;  4K5S A;  3GSS A;  4IKH A;  1YKC A;  5G31 A;  1PL1 A;  2FGX A;  3A2V A;  2YWO A;  4EL1 A;  4V2M A;  3ZL5 A;  2KUC A;  2LST A;  4YAP A;  4ML6 A;  2N5A A;  2LNT A;  3L9U A;  3HA9 A;  2L5L A;  4N30 A;  2GSQ A;  5HFK A;  4EIQ A;  2HZE B;  1OC3 A;  3EU3 A;  2MMN A;  4ZBD A;  5IPG A;  1A2M A;  2VCW A;  3IA1 A;  3DIE A;  2GT5 A;  3NZN A;  1A2L A;  2GST A;  3TJF A;  1K3L A;  3UBK A;  4NPB A;  4IJ3 A;  4O32 A;  4V1A p;  2C3Q A;  4H86 A;  3V1W A;  1GUK A;  3MSZ A;  1TW9 A;  3LYK A;  5HR0 A;  1UA5 A;  4PQH A;  4XS6 A;  2WCI A;  4HDE A;  3WYW A;  4KH7 A;  1OKT A;  4X4J A;  3NIV A;  3EYT A;  1BQ7 A;  3HYP A;  2M80 A;  2LJK A;  4BVY B;  3CSH A;  11GS A;  3GV1 A;  1ACV A;  2OKA A;  1HNB A;  1X5D A;  1J0F A;  2B5Y A;  3I69 A;  1XVQ A;  4FYU A;  1R4W A;  1K0C A;  3M9K A;  1GSQ A;  1XIY A;  2HXK A;  2YV7 A;  1JZR A;  1IYI A;  3JCM L;  4F03 A;  1F9M A;  3C1S A;  5HR1 A;  2L6D A;  1MDJ A;  2FD3 A;  4BVX A;  5DJM A;  2HSM A;  4HQZ A;  2HLS A;  2VCT A;  4POB A;  2O89 A;  2GQK A;  1GH2 A;  2TIR A;  4KGI A;  1SKS B;  2LKU A;  3LXT A;  2YJ7 A;  3BD2 A;  2H6X A;  1XZO A;  1VGL A;  2B3S A;  3LW9 A;  2CZ3 A;  2MMO A;  3GFK A;  1R26 A;  3TRX A;  1ML6 A;  5B8B A;  1EV4 A;  1SU9 A;  5KEJ A;  2LS5 A;  4ZXG A;  3M0F A;  1UVZ A;  5GAP D;  1V40 A;  1YEP A;  4MZB A;  2OJL A;  3ZIT A;  2LRT A;  1USB A;  3IXR A;  3KH7 A;  2X8H A;  1ZCP A;  2QA2 A;  1XOB A;  5COH A;  4OCF A;  1TU7 A;  3E3E A;  2RUF A;  3C1R A;  2G0F A;  22GS A;  4GQC A;  3GKX A;  1PL2 A;  3ZIJ A;  4MJE A;  3VWU A;  2L59 A;  4ZIJ A;  4TXO A;  1XCC A;  2EIQ A;  4XCS A;  2V32 A;  3DD3 A;  4NAX A;  3A2X A;  4D73 B;  8GSS A;  1O81 A;  2I9H A;  1X0R A;  2L57 A;  4K0N A;  2C8U A;  1YJ6 A;  3HHV A;  2DJ0 A;  3DGQ A;  3IC4 A;  4ZL9 A;  2FWE A;  2X4A A;  1WP0 A;  1F6M C;  2H1D A;  4AJ8 A;  2H1A A;  3TKR A;  4FH8 A;  5CNW A;  1THX A;  2REM A;  1JFU A;  3FHK A;  3GIX A;  2RM5 A;  5EY6 A;  5GSS A;  1OAZ A;  4BPY A;  1PN0 A;  2VCQ A;  2H19 A;  3F9U A;  1M2B A;  5F0G A;  4L5L A;  3H1N A;  2DML A;  2MMZ A;  1U3I A;  4JZQ A;  2HRF A;  2EC4 A;  3L4N A;  4J56 E;  4ZB6 A;  3TJJ A;  1GSY A;  1NHY A;  2H8L A;  4GSN A;  4BWQ A;  1GP1 A;  3RDW A;  4IP1 A;  4CDO A;  1V98 A;  4K8M A;  4K0G A;  4AJ7 A;  3P7X A;  3U5R E;  3GMF A;  4DEJ A;  4X1U A;  2D2Z A;  5G1L A;  4FYB A;  1TDI A;  2YAN A;  1TRW A;  1K0A A;  3F6D A;  1WWJ A;  3GKK A;  3VPT A;  1QFN A;  2QGV A;  2HNL A;  1FB0 A;  19GS A;  3LOR A;  4N0Z A;  1EOH A;  3P90 A;  3QMX A;  4FO5 A;  1THO A;  1T00 A;  4O5R A;  2JZT A;  2H72 A;  3TJB A;  2DLX A;  4O5Q A;  4TR1 A;  5HFI A;  4O5U A;  3LJR A;  3UMA A;  4IS0 A;  1YY7 A;  1PKW A;  4USS A;  1XW6 A;  3L9S A;  2GZZ A;  4TR3 A;  1ERW A;  1A23 A;  3US3 A;  4IHU A;  4MMM A;  2MZC A;  5J3R A;  4KF9 A;  3KTB A;  1QUW A;  3PH9 A;  1OC9 A;  2R6K A;  2ALB A;  2ON5 A;  2Z9S A;  1PA3 A;  2H70 A;  5AIS A;  4N11 A;  1Z9H A;  3W8S A;  3M3M A;  2RM6 A;  2C3T A;  1YDK A;  3EPT A;  4PQ1 A;  1FO5 A;  2FA4 A;  4MCU A;  4I5Q A;  2K8V A;  4EDY A;  3H79 A;  3ZRE A;  2UZ8 A;  1N2A A;  4OFM A;  1ZYE A;  1AAZ A;  4KCE A;  4WBJ A;  2IMI A;  4PTS A;  4HJM A;  1EZK A;  1NHO A;  1X5C A;  4EC0 A;  4OO5 A;  2DBC A;  1MD3 A;  2KP2 A;  2B5X A;  6GSW A;  2IMD A;  4EKZ A;  3CXG A;  3GTU A;  3HJP A;  1SL1 B;  1VRS D;  1A8Y A;  3MWH A;  3QDN A;  3TCO A;  4PUF C;  3APQ A;  1GSE A;  1TI3 A;  5B6M A;  2HSY A;  3IHG A;  2LJA A;  2WB9 A;  1MD4 A;  4KND A;  3UAR A;  2B5E A;  5G5E A;  2WFC A;  4HQS A;  1VF1 A;  3RBT A;  3ZIV A;  3QAG A;  1SEN A;  1MEK A;  3APO A;  2FLS A;  3VFI A;  1ON4 A;  4Q5N A;  3ZMK A;  3A2W A;  4GRF A;  4NHZ A;  2OE1 A;  2LQO A;  2GZP A;  2KP1 A;  5G30 A;  2DSA A;  1TKD B;  5DBQ A;  5KN1 A;  1A0F A;  5DVB A;  3GA4 A;  1B9X C;  1T7P B;  4G19 A;  4GQF A;  1PX6 A;  1XBS A;  2AUV A;  1UN2 A;  3FR9 A;  1YKA A;  4KSO A;  4MDC A;  5D93 A;  2H30 A;  2YOI A;  1GLP A;  2IMF A;  5H5S A;  2OBK A;  3KTL A;  4X43 A;  3RAZ A;  4KUN A;  2FCH A;  5JCG A;  1TRS A;  1HNC A;  1AQX A;  1EP8 A;  1V57 A;  4I8B A;  4XS4 A;  3IK9 A;  3S9F A;  3G7Y A;  3FEU A;  4F9Z A;  2AJQ B;  5IOX A;  5ABR A;  4K9Z A;  3IV4 A;  1AC1 A;  4QQ7 A;  4HUA A;  1GWC A;  1ZYN A;  3GL5 A;  1B4Q A;  5F05 A;  1SJI A;  4PXO A;  4QL9 A;  3GUR A;  2O87 A;  3H4K A;  4JU5 A;  3J7Y k;  2GSS A;  4E8E A;  4K6X A;  4L5O A;  2C0G A;  3FRC A;  4KE3 A;  2OAD A;  4PUA A;  4F0B A;  2YZU A;  3F63 A;  1WE0 A;  4YKG A;  2YWI A;  2YPM A;  6GSX A;  5DCG A;  3GNJ A;  1QK8 A;  2O8V B;  2VL2 C;  1WRY A;  1GNW A;  4LMV A;  5ECQ B;  5C04 A;  2H0G A;  4MPF A;  1RK4 A;  1T8E B;  2PER A;  2IL3 A;  1A8L A;  3GKM A;  2MYG A;  2FA8 A;  2HE3 A;  2A2S A;  6GSY A;  3KM6 A;  4BL7 B;  2WS2 A;  2ZUP A;  3ERG A;  1G0T A;  2KHP A;  3UJ1 A;  3F6F A;  1UC7 A;  3ZVJ D;  2H6Y A;  2C0F A;  3HXS A;  3FKF A;  4V2L A;  2F8F A;  3TB2 A;  3HCZ A;  4CHS A;  3C8E A;  3HDC A;  4KX4 A;  1O8X A;  1GUL A;  5FT3 A;  4BVX B;  2H74 A;  3DKS A;  5ECP B;  3C73 A;  3LGC A;  3P8W A;  2HT9 A;  2CVK A;  5IMV A;  1WPI A;  1U88 A;  2DJK A;  3APS A;  3KZQ A;  5HR3 A;  4Z2R A;  2VL9 A;  4OD7 A;  3F4R A;  2FWF A;  1YF0 A;  4IW9 A;  4ZL8 A;  3I43 A;  2F9S A;  3LXZ A;  1VF4 A;  2GLR A;  5D96 A;  2ZCT A;  5FWG A;  3CBU A;  3DWV A;  4MP4 A;  1GUH A;  2X8C A;  4RUV A;  2PBJ A;  3LG6 A;  5A5K A;  1IYH A;  1Q4J A;  3VLN A;  2H66 A;  5ECN B;  2V2G A;  2WGR A;  1SYR A;  1JLW A;  5EL8 A;  1B4P A;  2QC7 A;  2R5G A;  5ELA A;  1U6T A;  1PQN A;  4HU7 A;  3ZFB A;  2GSR A;  2C1Y A;  3GKN A;  4IBP A;  3LYP A;  2MMA A;  3K8N A;  1HNA A;  4TXO B;  5KOW A;  1EEJ A;  3CYN A;  2H75 A;  3N9J A;  4TVE A;  4DSR A;  4L0W A;  3TJG A;  1OVN A;  3GHA A;  2LEG A;  2M46 A;  2RUE A;  3HJO A;  5IMC A;  1VF3 A;  2YWN A;  3QAV A;  4TR0 A;  4GTU A;  1AIU A;  5F07 A;  2LQQ A;  1XW9 A;  2NBS A;  2XBQ A;  5DCH A;  4PQI A;  16GS A;  3WGE A;  1PN9 A;  4ECC A;  3F3R A;  4G0L A;  1M9A A;  2VL2 A;  1ZMA A;  4WR5 A;  4HEA 2;  1X9W B;  3CSI A;  3BOA A;  3EIN A;  1AW9 A;  1GTI A;  2PMT A;  1BYE A;  2E2M A;  1OE8 A;  2OAC A;  5E4W A;  3IR4 A;  1H75 A;  3GST A;  4L0U A;  4RQX A;  4ZBB A;  4AGS A;  5IMA A;  4YQM A;  2H71 A;  2CA8 A;  1KBN A;  4TN8 A;  2CAI A;  4OFT A;  3RHB A;  4HOJ A;  1E2Y A;  3FZ4 A;  2NDO A;  3KCM A;  1I9D A;  4BWS A;  5INY A;  1ZGN A;  6GSU A;  1ERV A;  5AIX A;  4ZB8 A;  2O7K A;  3BCK A;  3DVX A;  3VI7 A;  4OFN A;  5LNK e;  4MNN A;  1SD8 A;  1TRU A;  4IJI A;  4Z2U A;  4MJA A;  4TR1 B;  3GH6 A;  2M72 A;  4IVF A;  3D21 A;  4MJC A;  2FHE A;  3CTG A;  5DDL A;  13GS A;  3KD0 A;  1PSQ A;  4G9H A;  2GGT A;  1MDK A;  4JR4 A;  2N5B A;  2I4A A;  3KH9 A;  10GS A;  2GQM A;  2LV3 A;  1H4O A;  1OE7 A;  2JU5 A;  2F8A A;  1OC9 B;  2GTU A;  12GS A;  2R2J A;  3IC8 A;  3Q19 A;  1V58 A;  2VO4 A;  3IAM 2;  5KN3 A;  2XHF A;  5G1K A;  1SJ6 A;  2DKH A;  2VCV A;  2VCZ A;  1N8J A;  1SD9 A;  2XPE A;  4O7H A;  2HRN A;  4ACS A;  1G6Y A;  4POL A;  2NPB A;  1YZX A;  4MJB A;  1B9Y C;  2BJX A;  1QGV A;  3KEB A;  3TDG A;  2AHE A;  3DML A;  3CTF A;  1A0R P;  1JZW A;  4RI7 A;  5DAL A;  4JBB A;  4Z7X A;  1KTE A;  4Z2T A;  5IOW A;  1T3B A;  2R0C A;  3DVW A;  3IPZ A;  2VM2 A;  3EU4 A;  2RLI A;  1GUM A;  1XW5 A;  3GTU B;  2VLU A;  4GF0 A;  2B1L A;  4AF2 A;  1TK0 B;  3RHC A;  3D4M A;  4HU9 A;  4MF5 A;  3M8N A;  4KSM A;  2P5R A;  2B1K A;  1F3B A;  1FAA A;  1U3A A;  2NVL A;  2FWG A;  1QQ2 A;  1V2A A;  3FYG A;  2N5F A;  3D0Z A;  1K3Y A;  5IMZ A;  5J5N A;  2IN3 A;  2A4V A;  3AY8 A;  5IPH A;  1OC8 A;  2R37 A;  2AB6 A;  2KLX A;  4WF4 A;  4EUY A;  4OMV A;  2H0I A;  2E2G A;  4BA7 A;  2VAF A;  4RQR A;  4OWY A;  5CRG A;  4YQU A;  3QOU A;  1GTU A;  5JWO B;  1TTZ A;  2GZY A;  5DAK A;  3TJK A;  1T4Z A;  4KDY A;  3C71 A;  2WUL A;  4MH3 A;  4IN0 A;  2J23 A;  5ID2 A;  5GAN D;  2FUG 2;  4JR6 A;  4P3Y B;  1EV9 A;  4XS1 A;  1SK1 A;  3VWW A;  4YH2 A;  1EOG A;  3FR6 A;  2VCX A;  1KEB A;  2YN1 A;  4K2X A;  4G0I A;  5AGY A;  5GZZ B;  3TGZ A;  1PX7 A;  1MTC A;  5J9B A;  5LCZ A;  5DQY A;  3WT2 A;  2OA7 A;  1GTB A;  2VUP A;  2GVP A;  4KDU A;  2IMK A;  2YJH A;  4N10 A;  4MZC A;  2IFQ A;  3FZ9 A;  4XS4 B;  4PGT A;  4LA1 A;  3UVT A;  1W89 A;  3HZ8 A;  4GCI A;  4POK A;  2TRX A;  5JWR B;  2QA1 A;  1M7T A;  2I81 A;  4NXI A;  5A4V A;  4EE0 A;  3CMI A;  4WEY A;  3SBC A;  4QL7 A;  5D73 A;  3VWV A;  2L6C A;  2L5O A;  1BED A;  3GX0 A;  4IQ1 A;  5CRW A;  4G0K A;  2PVQ A;  4MPG A;  4PNG A;  2G2Q A;  2K8S A;  3QAW A;  3ED3 A;  1ERT A;  1W4V A;  1S3D A;  4ZB9 A;  3UVH A;  3KP9 A;  2J9H A;  1X9M B;  4ICY A;  1SK2 A;  2B7K A;  3KMO A;  1URM A;  1BX9 A;  1M0U A;  1YF1 A;  5B6N A;  4TW5 A;  2JZR A;  3HD5 A;  2YNX A;  2BTO T;  2VD0 A;  2NTO A;  1GSD A;  3N5O A;  4NV2 A;  5CRH A;  2LUS A;  4DSQ A;  1EGO A;  3CRU A;  1SL2 B;  4GSS A;  5EVO A;  2IPA A;  4JE1 A;  3VK9 A;  2F3M A;  1JZO A;  3MAK A;  2DKI A;  3F3Q A;  1SJZ A;  1XPV A;  5GST A;  1K0M A;  3EWL A;  4NMU A;  4NWY A;  3D22 A;  5ECK B;  4PUR A;  1SKR B;  6GSV A;  5KN0 A;  1GNE A;  1Y25 A;  1O8W A;  1B8X A;  3E9J B;  2PUK C;  3D4T A;  3EUR A;  2P0G A;  3KXO A;  4WXT A;  4MLY A;  3GL3 A;  3UAP A;  1A2J A;  2H01 A;  4Q5R A;  1S3A A;  3MIX A;  2YZH A;  1XXU A;  1M2D A;  4YKF A;  3FY7 A;  1X9S B;  1YEX A;  3ME8 A;  2CAQ A;  3FK8 A;  3ISO A;  3VI5 A;  2CVB A;  1TXX A;  1YQ1 A;  1T4Y A;  2R4V A;  3TKP A;  4XIH A;  2YP6 A;  5HR2 A;  4TOP A;  18GS A;  1SKW B;  5F06 A;  2DJJ A;  5D9V A;  2WRT A;  4ILF A;  1XWB A;  2F51 A;  4V1A g;  2RII A;  3UBL A;  2KOK A;  1BAY A;  1SK0 A;  5CYY A;  3ME7 A;  4WKW A;  3F4S A;  2A2P A;  3P2A A;  5ECL B;  4NV5 A;  5J9C A;  1VF2 A;  5ECM B;  3KGK A;  1RW1 A;  1FB6 A;  4YQV A;  4MAB A;  2DMM A;  2CX3 A;  3TRP A;  4DSS A;  4KDX A;  3IRA A;  4MF6 A;  1CQG A;  2X8G A;  3J7Y b;  4JED A;  5IM9 A;  1AXD A;  1FOH A;  1NSW A;  3IK7 A;  3GYK A;  3QCP A;  2WZ9 A;  5CP1 A;  1WMJ A;  2I1U A;  1K0O A;  3FZA A;  3MNG A;  5D9W A;  2AAW A;  2IJY A;  3RPP A;  1M99 A;  1R5A A;  2IWT A;  1JZD A;  2XPD A;  2H1G A;  4G10 A;  4I2T A;  2R0G A;  5FHI A;  1HD2 A;  4CW9 A;  3QFA C;  3VUR A;  2FY6 A;  3U6V A;  1C72 A;  2JSY A;  4IEL A;  2YCD A;  2R3X A;  3KIJ A;  5E59 A;  1XOA A;  2OBI A;  2V6K A;  1F3A A;  4WBR D;  4WET A;  4I2U A;  4ECB A;  1Z5Y E;  3GUS A;  5B8A A;  2IME A;  5AN1 A;  2P5Q A;  3EMX A;  4IP6 A;  3WT1 A;  1TP9 A;  1FVK A;  2VOC A;  1TK5 B;  1TJD A;  3FW2 A;  2CZ2 A;  4LMW A;  5DJL A;  1G6W A;  4TRX A;  3L78 A;  3F0I A;  3E0U A;  3G7J A;  4ECJ A;  4V2N A;  4N0V A;  4MK3 A;  3ZYW A;  1BG5 A;  5CRD A;  4KB3 A;  3UIW A;  1O6J A;  3WD6 A;  2PU9 C;  2VLT A;  3O6T A;  1R7H A;  4I97 A;  1Z3E A;  4J2F A;  4ISD A;  1A24 A;  2PPT A;  3I6A A;  1TRV A;  4TR4 A;  4EIP A;  1QXH A;  2K9F A;  1LU4 A;  4EDZ A;  3ZTL A;  4ML1 A;  4KW6 A;  1LBK A;  2L4C A;  4CY6 A;  4L8E A;  2AV4 A;  1K0N A;  1AQV A;  5ELG A;  5H5R A;  5KN2 A;  4BL7 A;  3M1G A;  1XVW A;  3TKS E;  5IO2 A;  4IGJ A;  1XWG A;  1Y6E A;  4MF7 A;  5D8I A;  9GSS A;  14GS A;  1EWX A;  2LRC A;  1JLV A;  2JZS A;  4X0X A;  1EP7 A;  2HFD A;  3Q6O A;  2CVD A;  1GSF A;  5G5F A;  5LD0 A;  3A3T A;  5DAL B;  4FIW A;  2V6O A;  4KAE A;  1Z7R A;  1M9B A;  5ECH B;  3TKS C;  5IQY A;  3KP8 A;  1DBY A;  3LEF A;  3TKQ A;  2HZE A;  5CAX A;  3VPQ A;  5AIV A;  3FMW A;  4MZW A;  4K7O A;  3UL3 A;  1F37 A;  5IMD A;  3ZFL A;  2LTK A;  1FHE A;  3D6I A;  3QR6 A;  5ENU A;  4OO4 A;  2GS3 A;  1EGR A;  1ERU A;  3ZVJ A;  1FVJ A;  1GLQ A;  4HS1 A;  3IHQ A;  4GXZ A;  3A5I A;  2VM1 A;  3G7I A;  3GRX A;  2JAD A;  3TRQ A;  3LQ7 A;  1ST9 A;  2P31 A;  1SYX A;  4MA9 A;  1XFL A;  2ON7 A;  3W6G A;  3KJY A;  5IO0 A;  4F82 A;  2FNO A;  3CRT A;  2DC5 A;  2DJ1 A;  4BVY A;  2O85 A;  20GS A;  1Z7P A;  4WR4 A;  3R2Q A;  1SL0 B;  1CQH A;  5CO3 A;  5DAK B;  4HZ4 A;  4DVC A;  3F4T A;  4J57 E;  5ID2 B;  1PD2 1;  4IQA A;  2E0Q A;  3BBY A;  1O73 A;  2I3Y A;  4TKY A;  2JL4 A;  4OCE A;  5IMF A;  1DUG A;  3H93 A;  6GST A;  4ID0 A;  5J41 A;  3BJ5 A;  3LWA A;  4TXV A;  3DEX A;  2HYX A;  2PVO C;  3TOU A;  3W8J A;  1RQM A;  4ZIL A;  2YWM A;  2PWJ A;  1K0D A;  2CV4 A;  2C80 A;  5JCW A;  3TUE A;  1TI1 A;  4HI7 A;  1HYU A;  5B7C A;  1K3O A;  2V1M A;  1R5P A;  2DIZ A;  2DIY A;  1DE1 A;  4ZBA A;  1O7U A;  3WGD A;  3L9V A;  3HJM A;  2ZNM A;  3IDV A;  2IFQ B;  3QFB C;  4EO3 A;  4RI6 A;  2B6M A;  3ZZX A;  4XRD A;  7GSS A;  2A4H A;  2GT6 A;  3HVX A;  3KMN A;  5ECO B;  3EVI A;  4PX1 A;  3HVS A;  2QSI A;  1EEM A;  4GWR A;  2E7P A;  2K6V A;  3UEM A;  1E6B A;  4K2D A;  4HZ2 A;  3HZ4 A;  3TKS A;  1XWK A;  1AQW A;  1MDI A;  5EPF A;  1B48 A;  3UOM A;  4WF5 A;  4XTS A;  4AJ6 A;  3O76 A;  1TU8 A;  5HQP A;  4G2E A;  1Q98 A;  3PGT A;  3EC3 A;  1ZYQ B;  4LL4 B;  3RPN A;  2JSZ A;  3GH9 A;  3ZML A;  5F8B A;  4D73 A;  1PKZ A;  2B7J A;  5ECI B;  3GX8 A;  3MDK A;  4LL1 B;  2K18 A;  4F2I A;  3ERF A;  2X49 A;  1DSB A;  2LRN A;  1J9B A;  2OE3 A;  3LSZ A;  1NW2 A;  4FQU A;  2H73 A;  2H6Z A;  3SWL A;  5ECS A;  1DE2 A;  1GSS A;  2TRC P;  4CY8 A;  1WJK A;  1KNG A;  3O3T A;  3PPU A;  3Q18 A;  5H5Q A;  1WOU A;  2A2R A;  2WJU A;  2L4Q A;  1OKD A;  1AUC A;  1ZZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...