3WGEA

Crystal structure of erp46 trx2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
111
structure length
111
Chain Sequence
GSHMGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioredoxin domain-containing protein 5
publication title Radically different thioredoxin domain arrangement of ERp46, an efficient disulfide bond introducer of the mammalian PDI family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wgeA00
4FO5A 1K0AA 20GSA 4NMUA 1RW1A 4IBPA 3BCKA 3SBCA 1Z6MA 3HYPA 4XS1A 4HI7A 1K3OA 5CRHA 4K0GA 1BG5A 3BOAA 2VIMA 1SK1A 2VL9A 1GSYA 3GFKA 4WF5A 3APQA 4TN8A 4F2IA 2HYXA 1ZGNA 2P0GA 1ZL9A 3GA4A 3EINA 4EKZA 2V41A 2BTOT 5CO3A 5CRWA 3R2QA 5AN1A 1OE7A 3RHCA 3WT1A 3TJJA 4TW5A 1K0CA 3FZ4A 4LA1A 4IS0A 4XHMA 2I3YA 2ES7A 4K7NA 2GQMA 3C7MA 5B7CA 2HSYA 4IELA 1TI1A 3UVTA 1UC7A 2WGRA 2WB9A 4CHSA 1VF3A 1TI3A 3QD9A 3TJKA 4WF4A 2OE3A 4IW9A 1YDKA 1PKZA 1TJDA 3VWWA 3KH7A 2A2SA 2HRNA 1EEMA 2ON7A 1XOAA 2D2ZA 3I9V2 5G1LA 1SU9A 3RPNA 1SL1B 5IPHA 2EIRA 1YEXA 4X1UA 3US3A 3DKSA 3GSTA 4DSRA 5E59A 3OR5A 2AJQB 4ULXA 5KN2A 3BJ5A 3GKMA 1J08A 2H74A 1XW6A 1A2LA 1EV9A 2LUSA 3DD3A 4N0VA 4LMWA 1Z7RA 2AAWA 2C8UA 4PUAA 3CXGA 2KOKA 4KDXA 2H66A 4HQSA 3FR3A 3K8NA 5HR2A 3TJFA 4POKA 4NXIA 3U6VA 1V9WA 2L4QA 3EC3A 3CSJA 4NHWA 2H19A 3C1RA 1A24A 3FYGA 3ZFLA 1YKCA 3RPPA 1M99A 4AJ7A 2C4JA 3D22A 4KSOA 2WCIA 3LWAA 1X9MB 2RM5A 1T3BA 2LSTA 1GRXA 2ZNMA 1BX9A 4JR4A 3TDGA 2IL3A 5GSTA 5J41A 2J9HA 2IPAA 3GL5A 2B7KA 4ZBDA 3KGKA 4MZCA 3EURA 4K9ZA 2VM2A 3ZVJA 1GSQA 1YKAA 2R5GA 1UVZA 3QCPA 1WWJA 3HD5A 2QC7A 2PERA 1MTCA 2DSAA 1AIUA 4XS6A 3H1NA 2V6OA 3IC4A 4J57E 3G7YA 3L4NA 4F03A 1YEPA 3MSZA 3C8EA 2B7JA 3LXTA 1YJ6A 3W8SA 1ML6A 5HFGA 1ZYQB 4GXZA 3G7JA 1LBKA 3GUSA 2LEGA 3LXZA 1O73A 2JSYA 5A4UA 2NPBA 1U6TA 4KW6A 2JACA 1VRSD 5J3RA 2IMIA 1JZRA 2DIYA 3PH9A 2YJ7A 1T7PB 3DGQA 4ZB6A 2KP1A 5H5QA 3CMIA 1GSEA 3J7Yb 3GYKA 2YANA 1GWCA 2EIOA 3N5OA 2FUG2 2K9FA 3UJ1A 3F63A 1W89A 3I6AA 3HXSA 2IJYA 2VD1A 2REMA 4TKYA 4WBRD 3VWVA 3IOSA 3A3TA 2YCDA 4PURA 2CVDA 5D8IA 3Q74A 4JU5A 4D73A 4K7IA 4Z7XA 3HKRA 1GTIA 2HT9A 4IGJA 1AC1A 2EC4A 3UOMA 3P90A 1OC9A 1WOUA 2YOIA 3L78A 4K2DA 2ON5A 1F6MC 1TW9A 4BA7A 1SENA 4K0NA 1M9AA 2FWFA 1NSWA 3AY8A 3TUEA 2FWHA 3ZZXA 1EGRA 1ZMAA 2H0HA 3O6TA 1E6BA 2N5AA 3KZQA 3IK7A 4TVEA 3F8UA 2OADA 3I69A 1YF1A 2H70A 2VCZA 1A23A 5IMVA 1R26A 4EC0A 2PPTA 4XS4A 1GSUA 3C71A 1N2AA 4RI6A 1RQMA 4NV5A 2VLTA 5C04A 4HEA2 1ZOFA 1K0DA 1XXUA 2AB6A 2F51A 5GAND 4K6XA 1ERVA 3QAWA 3DRNA 3EVIA 3IXRA 3A2XA 5D9WA 1MD3A 4GRFA 1FB0A 2HI7A 1TXXA 2CAQA 5DALA 2FHEA 1OKTA 4HDEA 3VI5A 6GSUA 2FWGA 2TIRA 5ECNB 3NZNA 4I5QA 3S9FA 1SD8A 3IA1A 1G6YA 3EWLA 3LG6A 3EU4A 1QGVA 3D21A 1UN2A 4HUAA 1QXHA 2H6XA 5B8AA 3WD6A 4NAXA 1TK5B 2GZYA 1X5CA 22GSA 4MF5A 4ZL7A 4AJ6A 3F4TA 2EIQA 4XTSA 4HU7A 1BAYA 3M0FA 3RDWA 1THOA 4MMMA 4ISDA 3DIEA 3IRAA 3RBTA 1AXDA 3TKSA 3GRXA 5G1KA 2X8HA 4OMVA 3M3MA 4DSSA 2LTKA 4YAVA 2DBCA 2V1MA 3KCMA 3ZVJD 4KX4A 3E0UA 1ERTA 2P5QA 1M2AA 5ECRB 3A2VA 3TRPA 2YWMA 4MPFA 2IFQB 5CAXA 2AV4A 1SJIA 4GSSA 2E0QA 2H76A 1MDIA 1MDJA 4KCEA 1PD21 1KBNA 3HDCA 2MMNA 3PR8A 1EV4A 2YWIA 1VF1A 1GLPA 1X5DA 4YQVA 4N10A 3TOTA 3M9JA 2H1AA 2CVBA 4OD7A 4TR3A 4DVCA 4AJ8A 4MDCA 4OFTA 4RI7A 4KDUA 1H75A 1USBA 4PX1A 2WS2A 4HOJA 5IOWA 2XPDA 2CZ3A 3GV1A 4MH2A 2GTUA 5ELGA 3UBKA 5JWRB 4HZ2A 1HYUA 4MJEA 3DVWA 5ABRA 4KCAA 2L6CA 4ZIJA 2M80A 1PX6A 3UARA 3GH9A 5D9TA 3KH9A 1T4ZA 2GDRA 6GSXA 1M2DA 5IQYA 5IMAA 2GQLA 2NVLA 1B4PA 5IIZA 1BEDA 3TRQA 1GTBA 3TJBA 1GTAA 3FZ5A 3D4MA 2VCQA 3NOFA 1FG4A 1OC9B 4OO5A 3LQ7A 5DAKA 3DWVA 2GSSA 1B4QA 1O85A 4V1Ap 1LU4A 3D0ZA 1U87A 3VK9A 5D93A 4V2LA 2LJKA 2C80A 1B8XA 3GSSA 1EP7A 1XOBA 4I6XA 4PNFA 4GTUA 1S3AA 2CT6A 4GSNA 4WR5A 4TR1A 1TP9A 2L5LA 4XS4B 5EY6A 1CQGA 2LV3A 4E8EA 3GIXA 4OFMA 4EO3A 1GUHA 2LKUA 4KA0A 2DJKA 1J9BA 1F3BA 2F9SA 4F82A 2G2QA 1HNAA 4JBBA 1Z3EA 3Q19A 4POMA 5KN1A 2J23A 4CW9A 2DMLA 2AYTA 1GSSA 4PQIA 4TXOA 3JCML 5IMCA 3IDVA 14GSA 1XW9A 3U5RE 2BJXA 2YWOA 4TR0A 2VCWA 2GSTA 4ILFA 2FWEA 2NTOA 2L4CA 5J9CA 1A2MA 3F6FA 1B48A 5HR1A 2LRNA 2R3XA 1FHEA 2B5YA 2GZZA 5IMDA 1PMTA 3TJGA 4N11A 2YP6A 3ERGA 1OE8A 2OA7A 2VAFA 10GSA 3H8QA 2K8SA 3EE2A 3MWHA 2HZEA 3LSZA 1EEJA 3CYNA 1G7OA 1XZOA 2L59A 2KHPA 2IN3A 1FVKA 5H5SA 1GULA 2B5EA 5A4VA 5L71A 1XBSA 3FW2A 3TKSC 2K6VA 3WT2A 2N5BA 3EYTA 3FRCA 1YY7A 2I81A 4X0XA 4ECCA 3ME7A 2F3MA 1N8JA 2HE3A 2MMAA 4V2NA 4WR4A 5J4UA 1V40A 5KN0A 4I97A 4KDYA 3HVSA 5A5KA 4KSMA 1LJRA 1DBYA 1V57A 3UAPA 3VI7A 1BQ7A 4EE0A 1WP0A 3QOUA 2DMMA 2JZTA 1EGOA 2ALBA 2YV7A 4G19A 3ZREA 4L5LA 3V1WA 3M8NA 3FEUA 3DXBA 1F37A 5D9XA 5G31A 4MCUA 1FOVA 4FIWA 4MJAA 1X9WB 4ZXGA 2K8VA 1A2JA 2DJ1A 3VFIA 4BL7A 4ML6A 1R7HA 3TKPA 4RUVA 3F3QA 8GSSA 3HVVA 1OVNA 4XRAA 2R6KA 5AGYA 1O6JA 5HR0A 2O85A 2H0GA 3QAGA 3KEBA 3J7Yk 4L8EA 1TRSA 5J5NA 2H75A 4MABA 2PBJA 5IPGA 1M2BA 3QDNA 2X8GA 2YN1A 3APOA 3TKSE 4MZWA 3CSIA 4GCIA 4BWQA 3VLNA 1XCCA 1V2AA 2H6ZA 3KMNA 5A4WA 5F07A 2DIZA 3LGCA 1Y6EA 2QSIA 5EPFA 3UIWA 3H4KA 2X99A 4GSTA 5G30A 1EOHA 1PQNA 2C0EA 4J2FA 2YNXA 5IO2A 5DCGA 3KJYA 5FHIA 2H71A 3E3EA 3IK9A 2V32A 3EMXA 1OC8A 3UBLA 1PRXA 1FB6A 4WBJA 5EL8A 5ID2A 4RQXA 1ACVA 4KUNA 1M0UA 2FA8A 4IN0A 1SKRB 5COHA 1GP1A 4YQUA 3DYRA 3O76A 4EDZA 4TXVA 3RAZA 2L6DA 2CVKA 2TRCP 3ZLPA 2VCTA 2DJJA 3KMOA 2IMEA 1YQ1A 4POLA 3KTLA 2L5OA 1E2YA 4CDOA 2E7PA 3ZL5A 2CV4A 5IMZA 4TXOB 1THXA 5D9VA 2HRFA 4L5OA 1SKWB 4OWYA 1Q4JA 1O7UA 4MK3A 4BVYA 5KN3A 3D5JA 2VCVA 1TK8B 5B8BA 3TB2A 1TDIA 3TOUA 2QGVA 1WPIA 3I43A 3GTUA 4XCSA 2H6YA 1TTZA 4KB3A 2LRCA 3ME8A 3Q6OA 3VURA 1F3AA 1OAZA 1KNGA 3GNJA 4GQCA 3GURA 4I2TA 1JLVA 3P2AA 1KTEA 4WETA 1T1VA 5G5EA 2V6KA 4MA9A 1GTUA 4WEYA 5F0GA 2VL2A 4F0BA 1K3LA 2WJUA 2C1YA 2JSZA 2WZ9A 5AIVA 4AGSA 1MD4A 2RLIA 4PNGA 3O3TA 3GX8A 1VF4A 1GNEA 4FYUA 3KTBA 4HZ4A 1VGLA 1H4OA 2I1UA 4MH3A 3L9UA 1BJXA 1G7EA 1SJZA 2PVQA 2YZHA 1Z7PA 2VCXA 4ZILA 5ECOB 2HLSA 3IBHA 2C3QA 2LNSA 1ZCPA 2YWNA 3M1GA 4EUYA 1GNWA 1K0NA 2M72A 4G9HA 3ZITA 2DJ3A 3UVHA 3FR6A 4MJBA 1K0OA 2GGTA 4G10A 4IQAA 3GKNA 4MF6A 3W6GA 4V2MA 1I5GA 1V98A 2VOCA 4QQ7A 3ZTLA 2XPEA 4MF7A 4OO4A 1SD9A 5G5FA 3D4TA 3MDKA 4IKHA 1ST9A 2H0IA 5GZZB 4OCEA 1KEBA 4J56E 4ECJA 3F6DA 1QQ2A 5ENUA 1TRVA 3KM6A 5AIXA 3L9VA 3GN3A 3ISOA 3MAKA 5JCWA 1Z5YE 3LYPA 3F3RA 3C73A 1URMA 4K7OA 2MMZA 2KUCA 1GLQA 3CTGA 4HJMA 2LJAA 2RUFA 4EXJA 3HA9A 4KAEA 2PWJA 2YZUA 3N9JA 4BVXA 5CP1A 3GMFA 3ZRDA 2CQ9A 1K3YA 3QR6A 6GSYA 5F06A 1J0FA 2PUKC 4IP6A 4EVMA 5ECLB 4MP4A 2GZPA 3TCOA 2ZCTA 4HQZA 1TOFA 1JHBA 1A8YA 1SL0B 2JZRA 5CNWA 4D73B 1FAAA 5ECQB 1NM3A 2O87A 3SWLA 3UEMA 2C3NA 3HY2A 2MMOA 4F0CA 2P5RA 3FK8A 1DE1A 2IMKA 1TU8A 4IVFA 1W4VA 4MPGA 1WMJA 1AQXA 2FLSA 4QL7A 1MDKA 5ELAA 2VLUA 2A2RA 2H8LA 3PINA 2XHFA 2NBSA 1AUCA 2HXKA 1Y25A 5F8BA 4X43A 2XBIA 1XVQA 2FCHA 1HQOA 1Z9HA 1ERUA 2LNTA 4EL1A 5HQPA 3A5WA 5ECIB 1TRWA 3DEXA 2QKEA 3HJOA 1XWCA 2DJ0A 4QL9A 3QFBC 1X9SB 4PQ1A 1XWGA 2N5FA 3GKXA 1K0BA 3BD2A 3GTUB 4PXOA 5CRGA 1SK2A 3F0IA 2I4AA 1ABAA 1OKDA 4O5RA 1I9DA 2P31A 6GSTA 2VO4A 3VPQA 3ZMLA 5DCHA 1JZOA 3QFAC 5GSSA 2CZ2A 3G9BA 5DALB 1ILOA 1QK8A 3HZ8A 4DEJA 5LNKe 1QFNA 6GSSA 4L0UA 2WDUA 2H72A 3D6IA 4Q5QA 4FYCA 1GSFA 3GH6A 5GAPD 3LORA 2VL2C 2K18A 1F9MA 2PU9C 1A8LA 4Q5NA 2MBTA 2OBIA 2RIIA 3DVXA 3GX0A 4PGTA 1U88A 4AF2A 1UA5A 2H30A 1GUKA 1ZYEA 1AW9A 4F9ZA 2FNOA 1BYEA 3LYKA 3LEFA 4E8HA 4IJ3A 1XVWA 4DSSB 3ERWA 4N30A 4OCFA 2FY6A 5G2ZA 3M9KA 4JZQA 3HHVA 5DBQA 3PGTA 1A0FA 2VLVA 4ECIA 4LLRA 5HFKA 1AQVA 3FKFA 4OFNA 4NWYA 4O7HA 1PL1A 2OE1A 4GF0A 1JLWA 3HZ4A 2VM1A 11GSA 5B6NA 2H73A 1X0RA 2PGTA 1OC3A 2RM6A 1R5PA 5DJLA 1B9XC 1FW1A 2JADA 3FZAA 2KLXA 5D96A 6GSVA 2KP2A 2C3TA 5DJMA 2YPMA 5J9BA 3W8JA 2FGXA 3TGZA 1R4WA 4DSQA 16GSA 5LD0A 3P8WA 2GVPA 2FA4A 3LJRA 4WXTA 1TK0B 2M46A 2H1BA 3IAS2 3GHAA 1G6WA 1WRYA 3HCZA 4XIHA 2C0FA 3FR9A 2XC2A 2JZSA 1DUGA 1B9YC 1VF2A 4MLYA 3F4SA 3WGEA 4PQHA 1PSQA 1PN9A 4IJIA 1SYRA 4LL4B 5CREA 1PA3A 3QPMA 5HFIA 1TKDB 4LL1B 4ECBA 5AISA 3IE3A 1DSBA 2IFQA 2MZCA 2LQOA 2IIYA 4BWSA 2R4VA 2HZFA 3CRUA 1M9BA 4NPBA 3CTFA 1PX7A 3FHKA 2IMFA 3QMXA 2AUVA 1A0RP 5IO0A 2O7KA 2H01A 2HFDA 3RHBA 1JZWA 3ZMKA 4ZBBA 4Q5FA 5DAKB 2HSHA 1QUWA 3IHQA 4JRRA 3IPZA 3VPTA 2C0GA 3KP9A 2PN8A 1WJKA 2DLXA 1AQWA 18GSA 3KD0A 4G2EA 13GSA 2F8AA 2RUEA 3HJMA 2VUPA 2GSQA 2OKAA 5DDLA 3Q18A 1U3AA 4TR1B 1NHYA 4ZL8A 4GWRA 3APSA 2V2GA 2FD3A 4POBA 4ACSA 1MEKA 3VWUA 5LCZA 1SJ6A 1XWAA 2MYGA 1FVJA 2BMXA 1Q98A 1ON4A 1V58A 2B6MA 4O32A 2CAIA 3BBYA 1SKSB 4IHUA 1RK4A 2IMDA 5ECPB 2OBKA 2E2MA 4IQ1A 3WGDA 1JZDA 3CSHA 1GUMA 1T00A 3KIJA 4K1FA 1XW5A 4RQRA 5H5RA 4ZBAA 4L0WA 5IMFA 2CA8A 1R5AA 3UMAA 2NDOA 2G0FA 2HNLA 4P3YB 2DC5A 5EVOA 3HVXA 4LMVA 2WRTA 1CQHA 2LQQA 4KNDA 3H93A 4EF0A 6GSWA 4JEDA 5DQYA 2DJ2A 1HNCA 4TR4A 1C72A 2JU5A 3ED3A 12GSA 1SL2B 2F8FA 5ECSA 2GS3A 4PUFC 2LS5A 1JFUA 5JCUA 3FY7A 4NV2A 5IOXA 2ZUPA 1PKWA 2HZEB 3GL3A 2PVOC 1AAZA 4I2UA 5ECKB 4ZB8A 1M7TA 2GQKA 5INYA 3TKQA 4YH2A 2OJLA 9GSSA 1YF0A 1TU7A 2LRTA 3TKRA 1K0MA 1PL2A 4XRDA 2YV9A 3E9JB 1XIYA 4KGIA 4JR6A 1GSDA 1TRUA 2L57A 2B1LA 1T8EB 4GLTA 1PGTA 1NW2A 4GQFA 1HNBA 3KP8A 1HD2A 3L9SA 4V1Ag 5HR3A 4FH8A 2X64A 5B6MA 4H86A 3C1SA 1NHOA 1GL8A 4HU9A 5CRDA 2OE0A 3LFLA 1IYIA 3KXOA 2CX4A 19GSA 4MZBA 1XWBA 4EDYA 4KE3A 4HJ2A 4WKWA 1G0TA 1EWXA 2IWTA 3GKKA 1SK0A 3G7IA 1S3CA 2H1DA 2GT6A 5DVBA 3ERFA 1T4YA 2XBQA 3VWXA 4BPYA 3UL3A 5JWQB 2TRXA 4JE1A 2O89A 1O81A 1OYJA 2YJHA 4TOPA 3ZYWA 7GSSA 4K8MA 1ERWA 4ZL9A 1O8WA 1XPVA 1SYXA 1FO5A 4N0ZA 2CX3A 4MJCA 2A4VA 3BCIA 2X8CA 2WFCA 4Q5RA 3EU3A 3F9UA 2PMTA 1WIKA 2R2JA 2GSRA 3WYWA 5FT3A 1DE2A 3MNGA 3L0HA 4O92A 4TRXA 3CRTA 3A2WA 1X5EA 1YZXA 3HJPA 1U3IA 2Z9SA 1EP8A 3FZ9A 5D73A 5KEJA 5FWGA 1EZKA 3CBUA 4YQMA 3F4RA 1IYHA 5ECHB 2O8VB 4HS1A 1ZZYA 2R37A 1EOGA 4IP1A 3IR4A 1WE0A 4I8BA 4NHZA 2VL3A 4ML1A 2C0DA 5ID2B 2GLRA 4ZB9A 2WULA 2LJRA 2VD0A 3QAVA 2B1KA 3TRXA 5ECMB 3IV4A 5IM9A 1QMVA 1F2EA 4FYBA 5E4WA 3IAM2 3NIVA 5JWOB 2GT5A 1Z6NA 3WGXA 2I9HA 5DQSA 1O8XA 2B3SA 3ZIJA 3P7XA 3ZIVA 2B5XA 2AHEA 4KH7A 2MBSA 4ID0A 2E2GA 5C00A 5F05A 17GSA 1GH2A 1XFLA 2JL4A 5CYYA 1S3DA 2H1GA 3DMLA 3EMPA 3H79A 5JCGA 3ZFBA 2OACA 4YAPA 1XWKA
chains in the Genus database with same CATH superfamily
4FO5A 1K0AA 20GSA 4NMUA 1RW1A 4IBPA 3BCKA 3SBCA 1Z6MA 3HYPA 2DKHA 4XS1A 4Z2TA 4HI7A 1K3OA 5CRHA 4K0GA 1BG5A 3BOAA 2VIMA 1SK1A 2VL9A 1GSYA 3GFKA 4WF5A 3APQA 4TN8A 4F2IA 2HYXA 1ZGNA 2P0GA 1ZL9A 3GA4A 3EINA 4EKZA 2V41A 2BTOT 5CO3A 5CRWA 3R2QA 5AN1A 1OE7A 3RHCA 3WT1A 3TJJA 4TW5A 1K0CA 3FZ4A 4LA1A 4IS0A 4XHMA 2I3YA 2ES7A 4K7NA 2GQMA 3C7MA 5B7CA 2HSYA 4IELA 1TI1A 3UVTA 1UC7A 2WGRA 2WB9A 4CHSA 1VF3A 1TI3A 3QD9A 3TJKA 4WF4A 2OE3A 4IW9A 1YDKA 1PKZA 1FOHA 1TJDA 3VWWA 3KH7A 2A2SA 2HRNA 1EEMA 2ON7A 1XOAA 2D2ZA 3I9V2 5G1LA 1SU9A 3RPNA 1SL1B 5IPHA 3R3EA 2EIRA 1YEXA 4X1UA 3US3A 3DKSA 3GSTA 4DSRA 5E59A 3OR5A 2AJQB 4ULXA 5KN2A 3BJ5A 3GKMA 1J08A 2H74A 1XW6A 1A2LA 1EV9A 2LUSA 3DD3A 4N0VA 3PPUA 4LMWA 1Z7RA 2AAWA 2C8UA 4PUAA 3CXGA 2KOKA 4KDXA 2H66A 4HQSA 3FR3A 3K8NA 5HR2A 3TJFA 4POKA 4NXIA 2HRAA 1M3JA 3U6VA 4PTSA 1V9WA 2L4QA 3EC3A 3CSJA 4NHWA 2H19A 3C1RA 3IC8A 5BRTA 3FYGA 1A24A 3ZFLA 1YKCA 3RPPA 1M99A 4AJ7A 2C4JA 3D22A 4KSOA 2WCIA 3LWAA 1X9MB 2RM5A 1T3BA 2LSTA 1GRXA 2ZNMA 1BX9A 4JR4A 3TDGA 2IL3A 5GSTA 5J41A 2J9HA 2A2PA 2IPAA 3GL5A 2B7KA 4ZBDA 3KGKA 4MZCA 3EURA 4K9ZA 2VM2A 3ZVJA 1GSQA 1YKAA 2R5GA 1UVZA 3QCPA 1WWJA 3HD5A 2QC7A 2PERA 1MTCA 2DSAA 1AIUA 4XS6A 3H1NA 2V6OA 3IC4A 4J57E 3G7YA 3L4NA 4F03A 1YEPA 3MSZA 3C8EA 2B7JA 3LXTA 1YJ6A 4CY8A 3W8SA 1ML6A 5HFGA 1ZYQB 4GXZA 3G7JA 1LBKA 3GUSA 2LEGA 3LXZA 1O73A 2JSYA 5A4UA 3HVNA 2NPBA 1U6TA 4KW6A 2JACA 1VRSD 5J3RA 2IMIA 1JZRA 2DIYA 3PH9A 2YJ7A 1T7PB 3DGQA 4ZB6A 2KP1A 5H5QA 3CMIA 1GSEA 3J7Yb 3GYKA 2YANA 1GWCA 2EIOA 3N5OA 2FUG2 2K9FA 3UJ1A 3F63A 1W89A 3I6AA 3HXSA 2IJYA 2VD1A 2REMA 4TKYA 4WBRD 3VWVA 3CQFA 3IOSA 3A3TA 2YCDA 4PURA 2CVDA 5D8IA 3Q74A 4JU5A 4D73A 4K7IA 4Z7XA 3HKRA 1GTIA 2HT9A 4IGJA 1AC1A 2EC4A 3UOMA 3P90A 1OC9A 1WOUA 2YOIA 3L78A 4K2DA 2ON5A 1F6MC 1M3IA 1TW9A 4BA7A 1SENA 4K0NA 1M9AA 2FWFA 1NSWA 3AY8A 3TUEA 2FWHA 3ZZXA 1EGRA 1ZMAA 4HSCX 2H0HA 3O6TA 1E6BA 2N5AA 3KZQA 3IK7A 4TVEA 3F8UA 2OADA 3I69A 1YF1A 2H70A 2VCZA 1A23A 5IMVA 1R26A 4EC0A 2PPTA 4XS4A 1GSUA 3C71A 1N2AA 4RI6A 1RQMA 4NV5A 2VLTA 5C04A 4HEA2 1ZOFA 1K0DA 1XXUA 4G0IA 2AB6A 2F51A 5GAND 4K6XA 1ERVA 3QAWA 3DRNA 3EVIA 3IXRA 3A2XA 5D9WA 1MD3A 4GRFA 1FB0A 2HI7A 1TXXA 2CAQA 5DALA 2FHEA 1OKTA 4HDEA 3VI5A 6GSUA 2FWGA 2TIRA 5ECNB 3NZNA 4I5QA 3S9FA 1SD8A 3IA1A 1G6YA 3EWLA 3LG6A 3EU4A 1QGVA 3D21A 1UN2A 4HUAA 1QXHA 2H6XA 5B8AA 3WD6A 4NAXA 1TK5B 2GZYA 1X5CA 22GSA 4MF5A 4ZL7A 4AJ6A 2R0CA 3F4TA 2EIQA 4XTSA 4HU7A 1BAYA 3M0FA 3RDWA 1THOA 4MMMA 4ISDA 3DIEA 3IRAA 3RBTA 1AXDA 3TKSA 3GRXA 5G1KA 2X8HA 4OMVA 3M3MA 4DSSA 2LTKA 4YAVA 4FQUA 2DBCA 2V1MA 3KCMA 3ZVJD 4KX4A 3E0UA 1ERTA 2P5QA 1M2AA 5ECRB 3A2VA 3TRPA 2YWMA 4USSA 4MPFA 2IFQB 5CAXA 2AV4A 1SJIA 4GSSA 2E0QA 2H76A 1MDIA 1MDJA 4KCEA 1PD21 1KBNA 3HDCA 2MMNA 3PR8A 1EV4A 2YWIA 1VF1A 1GLPA 1X5DA 4YQVA 4N10A 3TOTA 3M9JA 2H1AA 2CVBA 4OD7A 4TR3A 4DVCA 4AJ8A 4MDCA 4OFTA 1PFOA 4RI7A 4KDUA 1H75A 1USBA 4PX1A 2WS2A 4HOJA 5IOWA 2XPDA 2CZ3A 3GV1A 4MH2A 2GTUA 5ELGA 3UBKA 5JWRB 4HZ2A 1HYUA 4MJEA 3DVWA 5ABRA 3A5IA 4KCAA 2L6CA 4ZIJA 2M80A 1PX6A 3UARA 3GH9A 5D9TA 3KH9A 1T4ZA 3MYDA 2GDRA 4G0LA 6GSXA 1M2DA 4CY6A 4EIPA 5IQYA 5IMAA 2GQLA 2NVLA 1B4PA 5IIZA 1BEDA 3TRQA 1GTBA 3TJBA 1GTAA 3FZ5A 3D4MA 2VCQA 3NOFA 1FG4A 1OC9B 4OO5A 3LQ7A 5DAKA 4K5SA 3DWVA 2GSSA 1B4QA 1O85A 4V1Ap 1LU4A 3D0ZA 1U87A 3VK9A 5D93A 4V2LA 2LJKA 2C80A 1B8XA 3GSSA 1EP7A 1ZYNA 1XOBA 4I6XA 4PNFA 4GTUA 1S3AA 2CT6A 4GSNA 4WR5A 1ZYPA 4TR1A 1TP9A 2L5LA 4XS4B 5EY6A 1CQGA 2LV3A 4E8EA 3GIXA 4Z2UA 4OFMA 4EO3A 1GUHA 2LKUA 4KA0A 2DJKA 1J9BA 1F3BA 2F9SA 4F82A 2G2QA 1HNAA 4JBBA 1Z3EA 3Q19A 4POMA 5KN1A 2J23A 4CW9A 2DMLA 2AYTA 1GSSA 4PQIA 4TXOA 3JCML 3LW9A 5IMCA 3IDVA 14GSA 1XW9A 3U5RE 2BJXA 2YWOA 4TR0A 2VCWA 2GSTA 4ILFA 2FWEA 2NTOA 2L4CA 5J9CA 1A2MA 3F6FA 1B48A 5HR1A 2LRNA 2R3XA 5KOXA 1FHEA 2B5YA 2GZZA 5IMDA 1PMTA 3TJGA 4N11A 2YP6A 3ERGA 1OE8A 2OA7A 2VAFA 4EIQA 10GSA 3H8QA 2K8SA 3EE2A 3MWHA 2HZEA 3LSZA 1EEJA 3CYNA 1G7OA 1XZOA 2L59A 2KHPA 2IN3A 1FVKA 5H5SA 1GULA 2B5EA 5A4VA 5L71A 1XBSA 3FW2A 3TKSC 2K6VA 3WT2A 2N5BA 3EYTA 3FRCA 1YY7A 2I81A 4X0XA 4ECCA 3ME7A 2F3MA 1N8JA 2HE3A 2MMAA 4V2NA 4WR4A 5J4UA 1V40A 5KN0A 4I97A 4KDYA 3HVSA 5A5KA 4KSMA 1LJRA 1DBYA 1V57A 3UAPA 3VI7A 1BQ7A 4EE0A 1WP0A 3QOUA 2DMMA 2JZTA 1EGOA 2ALBA 2YV7A 4G19A 3ZREA 4L5LA 3V1WA 3M8NA 3FEUA 4Z2RA 3DXBA 1F37A 5D9XA 5G31A 4MCUA 1FOVA 4FIWA 4MJAA 1X9WB 4ZXGA 2K8VA 1A2JA 2DJ1A 3VFIA 4BL7A 4ML6A 1R7HA 3TKPA 4RUVA 3F3QA 8GSSA 3HVVA 1OVNA 4XRAA 2R6KA 5AGYA 1O6JA 5HR0A 2O85A 2H0GA 3QAGA 3KEBA 3J7Yk 4L8EA 1TRSA 5J5NA 2H75A 4MABA 2PBJA 5IPGA 1M2BA 3QDNA 2X8GA 2YN1A 2QA2A 3APOA 3TKSE 4MZWA 3CSIA 4GCIA 4BWQA 3VLNA 1XCCA 1V2AA 2H6ZA 3KMNA 4BIKA 5A4WA 5F07A 2DIZA 3LGCA 1Y6EA 2QSIA 5EPFA 3UIWA 3H4KA 2X99A 4GSTA 5G30A 1PN0A 1EOHA 1PQNA 2C0EA 4J2FA 2YNXA 5IO2A 5DCGA 3KJYA 5FHIA 2H71A 3E3EA 3IK9A 2V32A 3EMXA 1OC8A 3UBLA 1PRXA 1FB6A 4WBJA 5EL8A 5ID2A 4RQXA 1ACVA 4KUNA 1M0UA 2FA8A 4IN0A 1SKRB 5COHA 1GP1A 4YQUA 3DYRA 3O76A 4EDZA 4TXVA 3RAZA 2L6DA 2CVKA 2TRCP 3ZLPA 2VCTA 2DJJA 3KMOA 2IMEA 1YQ1A 4POLA 3KTLA 2L5OA 1E2YA 4CDOA 2E7PA 3ZL5A 2CV4A 5IMZA 4TXOB 4O5UA 1THXA 5D9VA 2HRFA 4L5OA 1SKWB 4OWYA 1Q4JA 1O7UA 4MK3A 4BVYA 5KN3A 3D5JA 4O5QA 2VCVA 3IHGA 1TK8B 5B8BA 3TB2A 1TDIA 3TOUA 2QGVA 1WPIA 3I43A 3GTUA 4KF9A 4XCSA 2H6YA 1TTZA 4KB3A 2LRCA 3ME8A 3Q6OA 3VURA 1F3AA 1OAZA 1KNGA 3GNJA 4GQCA 3GURA 4I2TA 1JLVA 3P2AA 1KTEA 4WETA 1T1VA 5G5EA 2V6KA 4MA9A 1GTUA 4WEYA 5F0GA 2VL2A 4F0BA 1K3LA 2WJUA 2C1YA 2JSZA 2WZ9A 5AIVA 4AGSA 1MD4A 2RLIA 4PNGA 3O3TA 3GX8A 1VF4A 1GNEA 4FYUA 3KTBA 4K2XA 4HZ4A 1VGLA 1H4OA 2I1UA 4MH3A 3L9UA 1BJXA 1G7EA 1SJZA 2PVQA 2YZHA 1Z7PA 2VCXA 4ZILA 5ECOB 2HLSA 3IBHA 2C3QA 2LNSA 1ZCPA 2YWNA 3M1GA 4EUYA 1GNWA 1K0NA 2M72A 1S3RA 4G9HA 3ZITA 2DJ3A 3UVHA 3FR6A 4MJBA 1K0OA 4BL7B 2GGTA 4G10A 4IQAA 3GKNA 4MF6A 3W6GA 4V2MA 1I5GA 1V98A 2VOCA 4QQ7A 3ZTLA 2XPEA 4MF7A 4OO4A 1SD9A 5G5FA 3D4TA 3MDKA 4IKHA 1ST9A 2H0IA 5GZZB 4OCEA 1KEBA 4J56E 4ECJA 3F6DA 1QQ2A 5ENUA 1TRVA 3KM6A 5AIXA 3L9VA 3GN3A 3ISOA 3MAKA 5JCWA 1Z5YE 3LYPA 3F3RA 3C73A 1URMA 4K7OA 2MMZA 2KUCA 1GLQA 3CTGA 4HJMA 2LJAA 2RUFA 4EXJA 3HA9A 4KAEA 2PWJA 2R0GA 2YZUA 3N9JA 4BVXA 5CP1A 3GMFA 3ZRDA 2CQ9A 1K3YA 3QR6A 6GSYA 5F06A 1J0FA 2PUKC 4IP6A 4EVMA 5ECLB 4MP4A 2GZPA 3TCOA 2ZCTA 4HQZA 1TOFA 1JHBA 1A8YA 2UZ8A 2X4AA 1SL0B 2JZRA 5CNWA 4D73B 1FAAA 5ECQB 1NM3A 2O87A 3SWLA 3UEMA 2C3NA 3HY2A 2MMOA 4F0CA 2P5RA 3FK8A 1DE1A 2IMKA 1TU8A 4IVFA 1W4VA 4MPGA 1WMJA 1AQXA 2FLSA 4QL7A 1MDKA 5ELAA 2VLUA 2A2RA 2H8LA 3PINA 2XHFA 2NBSA 1AUCA 2HXKA 1Y25A 5F8BA 4X43A 2XBIA 1XVQA 2FCHA 1HQOA 1Z9HA 1ERUA 4BVYB 2LNTA 4EL1A 5HQPA 3A5WA 5ECIB 1TRWA 3DEXA 2QKEA 3HJOA 1XWCA 2DJ0A 4QL9A 3QFBC 1X9SB 4PQ1A 1XWGA 2N5FA 3GKXA 1K0BA 3BD2A 4PXOA 3GTUB 5CRGA 1SK2A 3F0IA 3EPTA 2I4AA 1ABAA 1OKDA 4O5RA 1I9DA 2P31A 6GSTA 2VO4A 3VPQA 3ZMLA 5DCHA 1JZOA 3QFAC 5GSSA 2CZ2A 3G9BA 5DALB 1ILOA 1QK8A 3HZ8A 4DEJA 5LNKe 1QFNA 6GSSA 5BMUA 4L0UA 2WDUA 2H72A 3D6IA 4Q5QA 4FYCA 1GSFA 3GH6A 2HSMA 5GAPD 3LORA 2VL2C 2K18A 1F9MA 2PU9C 1A8LA 4Q5NA 2MBTA 2OBIA 5KOWA 2RIIA 3DVXA 3GX0A 4PGTA 4YKGA 1U88A 4AF2A 1UA5A 2H30A 1GUKA 1ZYEA 1AW9A 4F9ZA 2FNOA 3FMWA 1BYEA 3LYKA 3LEFA 4E8HA 4IJ3A 1XVWA 4DSSB 3ERWA 4N30A 4OCFA 2FY6A 5G2ZA 3M9KA 4JZQA 3HHVA 5DBQA 3MIXA 3PGTA 1A0FA 2VLVA 4ECIA 4LLRA 5HFKA 1AQVA 3FKFA 4OFNA 4NWYA 4O7HA 1PL1A 2OE1A 4GF0A 1JLWA 3HZ4A 2VM1A 11GSA 5B6NA 2H73A 2X49A 1X0RA 2PGTA 1OC3A 2RM6A 1R5PA 5DJLA 1B9XC 1FW1A 2JADA 3FZAA 2A4HA 2KLXA 5D96A 6GSVA 2KP2A 2C3TA 5DJMA 2YPMA 5J9BA 3W8JA 2FGXA 3TGZA 1R4WA 4DSQA 4MNNA 16GSA 5LD0A 3P8WA 2GVPA 2FA4A 3LJRA 4WXTA 1TK0B 2M46A 2H1BA 3IAS2 3GHAA 1G6WA 1WRYA 3HCZA 4XIHA 2C0FA 3FR9A 2XC2A 2JZSA 1DUGA 1B9YC 1VF2A 4MLYA 3F4SA 3WGEA 4PQHA 1PSQA 1PN9A 4IJIA 1SYRA 4LL4B 5CREA 1PA3A 3QPMA 5HFIA 1TKDB 4LL1B 4ECBA 5AISA 3IE3A 1DSBA 4BVXB 2IFQA 2MZCA 2LQOA 2IIYA 4BWSA 4X4JA 2R4VA 2HZFA 3CRUA 1M9BA 4NPBA 3CTFA 1PX7A 3FHKA 2IMFA 3QMXA 2AUVA 1A0RP 5IO0A 2O7KA 2H01A 2HFDA 3RHBA 1JZWA 3ZMKA 4ZBBA 4ICYA 4Q5FA 5DAKB 4A5PA 2HSHA 4G0KA 1QUWA 3IHQA 4JRRA 3IPZA 3VPTA 2C0GA 3KP9A 2PN8A 1WJKA 2DLXA 1AQWA 18GSA 3KD0A 4G2EA 13GSA 2F8AA 2RUEA 3HJMA 2VUPA 2GSQA 2OKAA 5DDLA 3Q18A 1U3AA 4TR1B 1NHYA 4ZL8A 4GWRA 3APSA 2V2GA 2FD3A 4POBA 4ACSA 1MEKA 3VWUA 5LCZA 1SJ6A 1XWAA 2MYGA 1FVJA 2BMXA 1Q98A 1ON4A 1V58A 2B6MA 4O32A 2CAIA 3BBYA 1SKSB 4IHUA 1RK4A 2IMDA 5ECPB 2OBKA 2E2MA 4IQ1A 3WGDA 1JZDA 3CSHA 1GUMA 1T00A 3KIJA 4K1FA 1XW5A 4RQRA 5H5RA 4ZBAA 4L0WA 5IMFA 2CA8A 1R5AA 3UMAA 2NDOA 2G0FA 2HNLA 4P3YB 2DC5A 5EVOA 3HVXA 4LMVA 2WRTA 1CQHA 2LQQA 4KNDA 3H93A 4EF0A 6GSWA 4JEDA 5DQYA 2DJ2A 1HNCA 4TR4A 1C72A 2JU5A 3ED3A 12GSA 1SL2B 2F8FA 5ECSA 2GS3A 4PUFC 2LS5A 1JFUA 5JCUA 3FY7A 4NV2A 5IOXA 2ZUPA 1PKWA 2HZEB 3GL3A 2PVOC 1AAZA 4I2UA 5ECKB 4ZB8A 1M7TA 2GQKA 5INYA 3TKQA 4YH2A 2OJLA 9GSSA 1YF0A 4YKFA 1TU7A 2LRTA 3TKRA 1K0MA 1PL2A 4XRDA 2YV9A 3E9JB 1XIYA 4KGIA 4JR6A 1GSDA 1TRUA 2L57A 2B1LA 1T8EB 4GLTA 1PGTA 1NW2A 4GQFA 1HNBA 3KP8A 1HD2A 3L9SA 4V1Ag 5HR3A 4FH8A 2X64A 5B6MA 4H86A 3C1SA 1NHOA 1GL8A 4HU9A 5CRDA 2OE0A 3LFLA 1IYIA 3KXOA 2CX4A 19GSA 4MZBA 1XWBA 4EDYA 4KE3A 4HJ2A 4WKWA 1G0TA 1EWXA 2IWTA 3GKKA 1SK0A 3G7IA 1S3CA 2H1DA 2GT6A 5DVBA 3ERFA 1T4YA 2XBQA 3VWXA 4BPYA 3UL3A 5JWQB 2TRXA 4JE1A 2O89A 1O81A 1OYJA 2YJHA 4TOPA 3ZYWA 7GSSA 4K8MA 1ERWA 4ZL9A 1O8WA 1XPVA 1SYXA 1FO5A 4N0ZA 2CX3A 4MJCA 2A4VA 3BCIA 2X8CA 2WFCA 4Q5RA 3EU3A 3F9UA 2PMTA 1WIKA 2HRKA 2R2JA 2GSRA 3WYWA 5FT3A 1DE2A 3MNGA 4K5RA 3L0HA 4O92A 4TRXA 3CRTA 3A2WA 1X5EA 1YZXA 2QA1A 3HJPA 1U3IA 2Z9SA 2R0PA 1EP8A 3FZ9A 1XG8A 5D73A 5KEJA 5FWGA 1EZKA 3CBUA 4YQMA 3F4RA 1IYHA 5ECHB 2O8VB 4HS1A 1ZZYA 2DKIA 2R37A 1EOGA 4IP1A 3IR4A 1WE0A 4I8BA 4NHZA 2VL3A 4ML1A 2C0DA 5ID2B 2GLRA 4ZB9A 2WULA 2LJRA 2VD0A 3QAVA 2B1KA 3TRXA 5ECMB 3IV4A 5IM9A 1QMVA 1F2EA 4FYBA 5E4WA 3IAM2 3NIVA 5JWOB 2GT5A 1Z6NA 3WGXA 2I9HA 5DQSA 1O8XA 2B3SA 3ZIJA 3P7XA 3ZIVA 2B5XA 2AHEA 4KH7A 2MBSA 4ID0A 2E2GA 5C00A 5F05A 17GSA 1GH2A 1XFLA 2JL4A 5CYYA 1S3DA 2H1GA 3DMLA 3EMPA 3H79A 5JCGA 3ZFBA 2OACA 4YAPA 1XWKA
chains in the Genus database with same CATH topology
4FO5A 1K0AA 20GSA 4NMUA 1RW1A 4IBPA 3BCKA 3SBCA 1Z6MA 3HYPA 2DKHA 4XS1A 4Z2TA 4HI7A 1K3OA 5CRHA 4K0GA 1BG5A 3BOAA 2VIMA 1SK1A 2VL9A 1GSYA 3GFKA 4WF5A 3APQA 4TN8A 4F2IA 2HYXA 1ZGNA 2P0GA 1ZL9A 3GA4A 3EINA 4EKZA 2V41A 2BTOT 5CO3A 5CRWA 3R2QA 5AN1A 1OE7A 3RHCA 3WT1A 3TJJA 4TW5A 1K0CA 3FZ4A 4LA1A 4IS0A 4XHMA 2I3YA 2ES7A 4K7NA 2GQMA 3C7MA 5B7CA 2HSYA 4IELA 1TI1A 3UVTA 1UC7A 2WGRA 2WB9A 4CHSA 1VF3A 1TI3A 3QD9A 3TJKA 4WF4A 2OE3A 4IW9A 1YDKA 1PKZA 1FOHA 1TJDA 3VWWA 3KH7A 2A2SA 2HRNA 1EEMA 2ON7A 1XOAA 2D2ZA 3I9V2 5G1LA 1SU9A 3RPNA 1SL1B 5IPHA 3R3EA 2EIRA 1YEXA 4X1UA 3US3A 3DKSA 3GSTA 4DSRA 5E59A 3OR5A 2AJQB 4ULXA 5KN2A 3BJ5A 3GKMA 1J08A 2H74A 1XW6A 1A2LA 1EV9A 2LUSA 3DD3A 4N0VA 3PPUA 4LMWA 1Z7RA 2AAWA 2C8UA 4PUAA 3CXGA 2KOKA 4KDXA 2H66A 4HQSA 3FR3A 3K8NA 5HR2A 3TJFA 4POKA 4NXIA 2HRAA 3U6VA 4PTSA 1V9WA 2L4QA 3EC3A 3CSJA 4NHWA 2H19A 3C1RA 3IC8A 5BRTA 3FYGA 1A24A 3ZFLA 1YKCA 3RPPA 1M99A 4AJ7A 2C4JA 3D22A 4KSOA 2WCIA 3LWAA 1X9MB 2RM5A 1T3BA 2LSTA 1GRXA 2ZNMA 1BX9A 4JR4A 3TDGA 2IL3A 5GSTA 5J41A 2J9HA 2A2PA 2IPAA 3GL5A 2B7KA 4ZBDA 3KGKA 4MZCA 3EURA 4K9ZA 2VM2A 3ZVJA 1GSQA 1YKAA 2R5GA 1UVZA 3QCPA 1WWJA 3HD5A 2QC7A 2PERA 1MTCA 2DSAA 1AIUA 4XS6A 3H1NA 2V6OA 3IC4A 4J57E 3G7YA 3L4NA 4F03A 1YEPA 3MSZA 3C8EA 2B7JA 3LXTA 1YJ6A 4CY8A 3W8SA 1ML6A 5HFGA 1ZYQB 4GXZA 3G7JA 1LBKA 3GUSA 2LEGA 3LXZA 1O73A 2JSYA 5A4UA 2NPBA 1U6TA 4KW6A 2JACA 1VRSD 5J3RA 2IMIA 1JZRA 2DIYA 3PH9A 2YJ7A 1T7PB 3DGQA 4ZB6A 2KP1A 5H5QA 3CMIA 1GSEA 3J7Yb 3GYKA 2YANA 1GWCA 2EIOA 3N5OA 2FUG2 2K9FA 3UJ1A 3F63A 1W89A 3I6AA 3HXSA 2IJYA 2VD1A 2REMA 4TKYA 4WBRD 3VWVA 3IOSA 3A3TA 2YCDA 4PURA 2CVDA 5D8IA 3Q74A 4JU5A 4D73A 4K7IA 4Z7XA 3HKRA 1GTIA 2HT9A 4IGJA 1AC1A 2EC4A 3UOMA 3P90A 1OC9A 1WOUA 2YOIA 3L78A 4K2DA 2ON5A 1F6MC 1TW9A 4BA7A 1SENA 4K0NA 1M9AA 2FWFA 1NSWA 3AY8A 3TUEA 2FWHA 3ZZXA 1EGRA 1ZMAA 2H0HA 3O6TA 1E6BA 2N5AA 3KZQA 3IK7A 4TVEA 3F8UA 2OADA 3I69A 1YF1A 2H70A 2VCZA 1A23A 5IMVA 1R26A 4EC0A 2PPTA 4XS4A 1GSUA 3C71A 1N2AA 4RI6A 1RQMA 4NV5A 2VLTA 5C04A 4HEA2 1ZOFA 1K0DA 1XXUA 4G0IA 2AB6A 2F51A 5GAND 4K6XA 1ERVA 3QAWA 3DRNA 3EVIA 3IXRA 3A2XA 5D9WA 1MD3A 4GRFA 1FB0A 2HI7A 1TXXA 2CAQA 5DALA 2FHEA 1OKTA 4HDEA 3VI5A 6GSUA 2FWGA 2TIRA 5ECNB 3NZNA 4I5QA 3S9FA 1SD8A 3IA1A 1G6YA 3EWLA 3LG6A 3EU4A 1QGVA 3D21A 1UN2A 4HUAA 1QXHA 2H6XA 5B8AA 3WD6A 4NAXA 1TK5B 2GZYA 1X5CA 22GSA 4MF5A 4ZL7A 4AJ6A 2R0CA 3F4TA 2EIQA 4XTSA 4HU7A 1BAYA 3M0FA 3RDWA 1THOA 4MMMA 4ISDA 3DIEA 3IRAA 3RBTA 1AXDA 3TKSA 3GRXA 5G1KA 2X8HA 4OMVA 3M3MA 4DSSA 2LTKA 4YAVA 4FQUA 2DBCA 2V1MA 3KCMA 3ZVJD 4KX4A 3E0UA 1ERTA 2P5QA 1M2AA 5ECRB 3A2VA 3TRPA 2YWMA 4USSA 4MPFA 2IFQB 5CAXA 2AV4A 1SJIA 4GSSA 2E0QA 2H76A 1MDIA 1MDJA 4KCEA 1PD21 1KBNA 3HDCA 2MMNA 3PR8A 1EV4A 2YWIA 1VF1A 1GLPA 1X5DA 4YQVA 4N10A 3TOTA 3M9JA 2H1AA 2CVBA 4OD7A 4TR3A 4DVCA 4AJ8A 4MDCA 4OFTA 4RI7A 4KDUA 1H75A 1USBA 4PX1A 2WS2A 4HOJA 5IOWA 2XPDA 2CZ3A 3GV1A 4MH2A 2GTUA 5ELGA 3UBKA 5JWRB 4HZ2A 1HYUA 4MJEA 3DVWA 5ABRA 3A5IA 4KCAA 2L6CA 4ZIJA 2M80A 1PX6A 3UARA 3GH9A 5D9TA 3KH9A 1T4ZA 3MYDA 2GDRA 4G0LA 6GSXA 1M2DA 4CY6A 4EIPA 5IQYA 5IMAA 2GQLA 2NVLA 1B4PA 5IIZA 1BEDA 3TRQA 1GTBA 3TJBA 1GTAA 3FZ5A 3D4MA 2VCQA 3NOFA 1FG4A 1OC9B 4OO5A 3LQ7A 5DAKA 4K5SA 3DWVA 2GSSA 1B4QA 1O85A 4V1Ap 1LU4A 3D0ZA 1U87A 3VK9A 5D93A 4V2LA 2LJKA 2C80A 1B8XA 3GSSA 1EP7A 1ZYNA 1XOBA 4I6XA 4PNFA 4GTUA 1S3AA 2CT6A 4GSNA 4WR5A 1ZYPA 4TR1A 1TP9A 2L5LA 4XS4B 5EY6A 1CQGA 2LV3A 4E8EA 3GIXA 4Z2UA 4OFMA 4EO3A 1GUHA 2LKUA 4KA0A 2DJKA 1J9BA 1F3BA 2F9SA 4F82A 2G2QA 1HNAA 4JBBA 1Z3EA 3Q19A 4POMA 5KN1A 2J23A 4CW9A 2DMLA 2AYTA 1GSSA 4PQIA 4TXOA 3JCML 3LW9A 5IMCA 3IDVA 14GSA 1XW9A 3U5RE 2BJXA 2YWOA 4TR0A 2VCWA 2GSTA 4ILFA 2FWEA 2NTOA 2L4CA 5J9CA 1A2MA 3F6FA 1B48A 5HR1A 2LRNA 2R3XA 5KOXA 1FHEA 2B5YA 2GZZA 5IMDA 1PMTA 3TJGA 4N11A 2YP6A 3ERGA 1OE8A 2OA7A 2VAFA 4EIQA 10GSA 3H8QA 2K8SA 3EE2A 3MWHA 2HZEA 3LSZA 1EEJA 3CYNA 1G7OA 1XZOA 2L59A 2KHPA 2IN3A 1FVKA 5H5SA 1GULA 2B5EA 5A4VA 5L71A 1XBSA 3FW2A 3TKSC 2K6VA 3WT2A 2N5BA 3EYTA 3FRCA 1YY7A 2I81A 4X0XA 4ECCA 3ME7A 2F3MA 1N8JA 2HE3A 2MMAA 4V2NA 4WR4A 5J4UA 1V40A 5KN0A 4I97A 4KDYA 3HVSA 5A5KA 4KSMA 1LJRA 1DBYA 1V57A 3UAPA 3VI7A 1BQ7A 4EE0A 1WP0A 3QOUA 2DMMA 2JZTA 1EGOA 2ALBA 2YV7A 4G19A 3ZREA 4L5LA 3V1WA 3M8NA 3FEUA 4Z2RA 3DXBA 1F37A 5D9XA 5G31A 4MCUA 1FOVA 4FIWA 4MJAA 1X9WB 4ZXGA 2K8VA 1A2JA 2DJ1A 3VFIA 4BL7A 4ML6A 1R7HA 3TKPA 4RUVA 3F3QA 8GSSA 3HVVA 1OVNA 4XRAA 2R6KA 5AGYA 1O6JA 5HR0A 2O85A 2H0GA 3QAGA 3KEBA 3J7Yk 4L8EA 1TRSA 5J5NA 2H75A 4MABA 2PBJA 5IPGA 1M2BA 3QDNA 2X8GA 2YN1A 2QA2A 3APOA 3TKSE 4MZWA 3CSIA 4GCIA 4BWQA 3VLNA 1XCCA 1V2AA 2H6ZA 3KMNA 5A4WA 5F07A 2DIZA 3LGCA 1Y6EA 2QSIA 5EPFA 3UIWA 3H4KA 2X99A 4GSTA 5G30A 1PN0A 1EOHA 1PQNA 2C0EA 4J2FA 2YNXA 5IO2A 5DCGA 3KJYA 5FHIA 2H71A 3E3EA 3IK9A 2V32A 3EMXA 1OC8A 3UBLA 1PRXA 1FB6A 4WBJA 5EL8A 5ID2A 4RQXA 1ACVA 4KUNA 1M0UA 2FA8A 4IN0A 1SKRB 5COHA 1GP1A 4YQUA 3DYRA 3O76A 4EDZA 4TXVA 3RAZA 2L6DA 2CVKA 2TRCP 3ZLPA 2VCTA 2DJJA 3KMOA 2IMEA 1YQ1A 4POLA 3KTLA 2L5OA 1E2YA 4CDOA 2E7PA 3ZL5A 2CV4A 5IMZA 4TXOB 4O5UA 1THXA 5D9VA 2HRFA 4L5OA 1SKWB 4OWYA 1Q4JA 1O7UA 4MK3A 4BVYA 5KN3A 3D5JA 4O5QA 2VCVA 3IHGA 1TK8B 5B8BA 3TB2A 1TDIA 3TOUA 2QGVA 1WPIA 3I43A 3GTUA 4KF9A 4XCSA 2H6YA 1TTZA 4KB3A 2LRCA 3ME8A 3Q6OA 3VURA 1F3AA 1OAZA 1KNGA 3GNJA 4GQCA 3GURA 4I2TA 1JLVA 3P2AA 1KTEA 4WETA 1T1VA 5G5EA 2V6KA 4MA9A 1GTUA 4WEYA 5F0GA 2VL2A 4F0BA 1K3LA 2WJUA 2C1YA 2JSZA 2WZ9A 5AIVA 4AGSA 1MD4A 2RLIA 4PNGA 3O3TA 3GX8A 1VF4A 1GNEA 4FYUA 3KTBA 4K2XA 4HZ4A 1VGLA 1H4OA 2I1UA 4MH3A 3L9UA 1BJXA 1G7EA 1SJZA 2PVQA 2YZHA 1Z7PA 2VCXA 4ZILA 5ECOB 2HLSA 3IBHA 2C3QA 2LNSA 1ZCPA 2YWNA 3M1GA 4EUYA 1GNWA 1K0NA 2M72A 4G9HA 3ZITA 2DJ3A 3UVHA 3FR6A 4MJBA 1K0OA 4BL7B 2GGTA 4G10A 4IQAA 3GKNA 4MF6A 3W6GA 4V2MA 1I5GA 1V98A 2VOCA 4QQ7A 3ZTLA 2XPEA 4MF7A 4OO4A 1SD9A 5G5FA 3D4TA 3MDKA 4IKHA 1ST9A 2H0IA 5GZZB 4OCEA 1KEBA 4J56E 4ECJA 3F6DA 1QQ2A 5ENUA 1TRVA 3KM6A 5AIXA 3L9VA 3GN3A 3ISOA 3MAKA 5JCWA 1Z5YE 3LYPA 3F3RA 3C73A 1URMA 4K7OA 2MMZA 2KUCA 1GLQA 3CTGA 4HJMA 2LJAA 2RUFA 4EXJA 3HA9A 4KAEA 2PWJA 2R0GA 2YZUA 3N9JA 4BVXA 5CP1A 3GMFA 3ZRDA 2CQ9A 1K3YA 3QR6A 6GSYA 5F06A 1J0FA 2PUKC 4IP6A 4EVMA 5ECLB 4MP4A 2GZPA 3TCOA 2ZCTA 4HQZA 1TOFA 1JHBA 1A8YA 2UZ8A 2X4AA 1SL0B 2JZRA 5CNWA 4D73B 1FAAA 5ECQB 1NM3A 2O87A 3SWLA 3UEMA 2C3NA 3HY2A 2MMOA 4F0CA 2P5RA 3FK8A 1DE1A 2IMKA 1TU8A 4IVFA 1W4VA 4MPGA 1WMJA 1AQXA 2FLSA 4QL7A 1MDKA 5ELAA 2VLUA 2A2RA 2H8LA 3PINA 2XHFA 2NBSA 1AUCA 2HXKA 1Y25A 5F8BA 4X43A 2XBIA 1XVQA 2FCHA 1HQOA 1Z9HA 1ERUA 4BVYB 2LNTA 4EL1A 5HQPA 3A5WA 5ECIB 1TRWA 3DEXA 2QKEA 3HJOA 1XWCA 2DJ0A 4QL9A 3QFBC 1X9SB 4PQ1A 1XWGA 2N5FA 3GKXA 1K0BA 3BD2A 3GTUB 4PXOA 5CRGA 1SK2A 3F0IA 3EPTA 2I4AA 1ABAA 1OKDA 4O5RA 1I9DA 2P31A 6GSTA 2VO4A 3VPQA 3ZMLA 5DCHA 1JZOA 3QFAC 5GSSA 2CZ2A 3G9BA 5DALB 1ILOA 1QK8A 3HZ8A 4DEJA 5LNKe 1QFNA 6GSSA 5BMUA 4L0UA 2WDUA 2H72A 3D6IA 4Q5QA 4FYCA 1GSFA 3GH6A 2HSMA 5GAPD 3LORA 2VL2C 2K18A 1F9MA 2PU9C 1A8LA 4Q5NA 2MBTA 2OBIA 5KOWA 2RIIA 3DVXA 3GX0A 4PGTA 4YKGA 1U88A 4AF2A 1UA5A 2H30A 1GUKA 1ZYEA 1AW9A 4F9ZA 2FNOA 3FMWA 1BYEA 3LYKA 3LEFA 4E8HA 4IJ3A 1XVWA 4DSSB 3ERWA 4N30A 4OCFA 2FY6A 5G2ZA 3M9KA 4JZQA 3HHVA 5DBQA 3MIXA 3PGTA 1A0FA 2VLVA 4ECIA 4LLRA 5HFKA 1AQVA 3FKFA 4OFNA 4NWYA 4O7HA 1PL1A 2OE1A 4GF0A 1JLWA 3HZ4A 2VM1A 11GSA 5B6NA 2H73A 2X49A 1X0RA 2PGTA 1OC3A 2RM6A 1R5PA 5DJLA 1B9XC 1FW1A 2JADA 3FZAA 2A4HA 5D96A 2KLXA 6GSVA 2KP2A 2C3TA 5DJMA 2YPMA 5J9BA 3W8JA 2FGXA 3TGZA 1R4WA 4DSQA 4MNNA 16GSA 5LD0A 3P8WA 2GVPA 2FA4A 3LJRA 4WXTA 1TK0B 2M46A 2H1BA 3IAS2 3GHAA 1G6WA 1WRYA 3HCZA 4XIHA 2C0FA 3FR9A 2XC2A 2JZSA 1DUGA 1B9YC 1VF2A 4MLYA 3F4SA 3WGEA 4PQHA 1PSQA 1PN9A 4IJIA 1SYRA 4LL4B 5CREA 1PA3A 3QPMA 5HFIA 1TKDB 4LL1B 4ECBA 5AISA 3IE3A 1DSBA 4BVXB 2IFQA 2MZCA 2LQOA 2IIYA 4BWSA 4X4JA 2R4VA 2HZFA 3CRUA 1M9BA 4NPBA 3CTFA 1PX7A 3FHKA 2IMFA 3QMXA 2AUVA 1A0RP 5IO0A 2O7KA 2H01A 2HFDA 3RHBA 1JZWA 3ZMKA 4ZBBA 4ICYA 4Q5FA 5DAKB 4A5PA 2HSHA 4G0KA 1QUWA 3IHQA 4JRRA 3IPZA 3VPTA 2C0GA 3KP9A 2PN8A 1WJKA 2DLXA 1AQWA 18GSA 3KD0A 4G2EA 13GSA 2F8AA 2RUEA 3HJMA 2VUPA 2GSQA 2OKAA 5DDLA 3Q18A 1U3AA 4TR1B 1NHYA 4ZL8A 4GWRA 3APSA 2V2GA 2FD3A 4POBA 4ACSA 1MEKA 3VWUA 5LCZA 1SJ6A 1XWAA 2MYGA 1FVJA 2BMXA 1Q98A 1ON4A 1V58A 2B6MA 4O32A 2CAIA 3BBYA 1SKSB 4IHUA 1RK4A 2IMDA 5ECPB 2OBKA 2E2MA 4IQ1A 3WGDA 1JZDA 3CSHA 1GUMA 1T00A 3KIJA 4K1FA 1XW5A 4RQRA 5H5RA 4ZBAA 4L0WA 5IMFA 2CA8A 1R5AA 3UMAA 2NDOA 2G0FA 2HNLA 4P3YB 2DC5A 5EVOA 3HVXA 4LMVA 2WRTA 1CQHA 2LQQA 4KNDA 3H93A 4EF0A 6GSWA 4JEDA 5DQYA 2DJ2A 1HNCA 4TR4A 1C72A 2JU5A 3ED3A 12GSA 1SL2B 2F8FA 5ECSA 2GS3A 4PUFC 2LS5A 1JFUA 5JCUA 3FY7A 4NV2A 5IOXA 2ZUPA 1PKWA 2HZEB 3GL3A 2PVOC 1AAZA 4I2UA 5ECKB 4ZB8A 1M7TA 2GQKA 5INYA 3TKQA 4YH2A 2OJLA 9GSSA 1YF0A 4YKFA 1TU7A 2LRTA 3TKRA 1K0MA 1PL2A 4XRDA 2YV9A 3E9JB 1XIYA 4KGIA 4JR6A 1GSDA 1TRUA 2L57A 2B1LA 1T8EB 4GLTA 1PGTA 1NW2A 4GQFA 1HNBA 3KP8A 1HD2A 3L9SA 4V1Ag 5HR3A 4FH8A 2X64A 5B6MA 4H86A 3C1SA 1NHOA 1GL8A 4HU9A 5CRDA 2OE0A 3LFLA 1IYIA 3KXOA 2CX4A 19GSA 4MZBA 1XWBA 4EDYA 4KE3A 4HJ2A 4WKWA 1G0TA 1EWXA 2IWTA 3GKKA 1SK0A 3G7IA 1S3CA 2H1DA 2GT6A 5DVBA 3ERFA 1T4YA 2XBQA 3VWXA 4BPYA 3UL3A 5JWQB 2TRXA 4JE1A 2O89A 1O81A 1OYJA 2YJHA 4TOPA 3ZYWA 7GSSA 4K8MA 1ERWA 4ZL9A 1O8WA 1XPVA 1SYXA 1FO5A 4N0ZA 2CX3A 4MJCA 2A4VA 3BCIA 2X8CA 2WFCA 4Q5RA 3EU3A 3F9UA 2PMTA 1WIKA 2HRKA 2R2JA 2GSRA 3WYWA 5FT3A 1DE2A 3MNGA 4K5RA 3L0HA 4O92A 4TRXA 3CRTA 3A2WA 1X5EA 1YZXA 2QA1A 3HJPA 1U3IA 2Z9SA 2R0PA 1EP8A 3FZ9A 5D73A 5KEJA 5FWGA 1EZKA 3CBUA 4YQMA 3F4RA 1IYHA 5ECHB 2O8VB 4HS1A 1ZZYA 2DKIA 2R37A 1EOGA 4IP1A 3IR4A 1WE0A 4I8BA 4NHZA 2VL3A 4ML1A 2C0DA 5ID2B 2GLRA 4ZB9A 2WULA 2LJRA 2VD0A 3QAVA 2B1KA 3TRXA 5ECMB 3IV4A 5IM9A 1QMVA 1F2EA 4FYBA 5E4WA 3IAM2 3NIVA 5JWOB 2GT5A 1Z6NA 3WGXA 2I9HA 5DQSA 1O8XA 2B3SA 3ZIJA 3P7XA 3ZIVA 2B5XA 2AHEA 4KH7A 2MBSA 4ID0A 2E2GA 5C00A 5F05A 17GSA 1GH2A 1XFLA 2JL4A 5CYYA 1S3DA 2H1GA 3DMLA 3EMPA 3H79A 5JCGA 3ZFBA 2OACA 4YAPA 1XWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO5 A;  1K0A A;  20GS A;  4NMU A;  1RW1 A;  4IBP A;  3BCK A;  3SBC A;  1Z6M A;  3HYP A;  4XS1 A;  4HI7 A;  1K3O A;  5CRH A;  4K0G A;  1BG5 A;  3BOA A;  2VIM A;  1SK1 A;  2VL9 A;  1GSY A;  3GFK A;  4WF5 A;  3APQ A;  4TN8 A;  4F2I A;  2HYX A;  1ZGN A;  2P0G A;  1ZL9 A;  3GA4 A;  3EIN A;  4EKZ A;  2V41 A;  2BTO T;  5CO3 A;  5CRW A;  3R2Q A;  5AN1 A;  1OE7 A;  3RHC A;  3WT1 A;  3TJJ A;  4TW5 A;  1K0C A;  3FZ4 A;  4LA1 A;  4IS0 A;  4XHM A;  2I3Y A;  2ES7 A;  4K7N A;  2GQM A;  3C7M A;  5B7C A;  2HSY A;  4IEL A;  1TI1 A;  3UVT A;  1UC7 A;  2WGR A;  2WB9 A;  4CHS A;  1VF3 A;  1TI3 A;  3QD9 A;  3TJK A;  4WF4 A;  2OE3 A;  4IW9 A;  1YDK A;  1PKZ A;  1TJD A;  3VWW A;  3KH7 A;  2A2S A;  2HRN A;  1EEM A;  2ON7 A;  1XOA A;  2D2Z A;  3I9V 2;  5G1L A;  1SU9 A;  3RPN A;  1SL1 B;  5IPH A;  2EIR A;  1YEX A;  4X1U A;  3US3 A;  3DKS A;  3GST A;  4DSR A;  5E59 A;  3OR5 A;  2AJQ B;  4ULX A;  5KN2 A;  3BJ5 A;  3GKM A;  1J08 A;  2H74 A;  1XW6 A;  1A2L A;  1EV9 A;  2LUS A;  3DD3 A;  4N0V A;  4LMW A;  1Z7R A;  2AAW A;  2C8U A;  4PUA A;  3CXG A;  2KOK A;  4KDX A;  2H66 A;  4HQS A;  3FR3 A;  3K8N A;  5HR2 A;  3TJF A;  4POK A;  4NXI A;  3U6V A;  1V9W A;  2L4Q A;  3EC3 A;  3CSJ A;  4NHW A;  2H19 A;  3C1R A;  1A24 A;  3FYG A;  3ZFL A;  1YKC A;  3RPP A;  1M99 A;  4AJ7 A;  2C4J A;  3D22 A;  4KSO A;  2WCI A;  3LWA A;  1X9M B;  2RM5 A;  1T3B A;  2LST A;  1GRX A;  2ZNM A;  1BX9 A;  4JR4 A;  3TDG A;  2IL3 A;  5GST A;  5J41 A;  2J9H A;  2IPA A;  3GL5 A;  2B7K A;  4ZBD A;  3KGK A;  4MZC A;  3EUR A;  4K9Z A;  2VM2 A;  3ZVJ A;  1GSQ A;  1YKA A;  2R5G A;  1UVZ A;  3QCP A;  1WWJ A;  3HD5 A;  2QC7 A;  2PER A;  1MTC A;  2DSA A;  1AIU A;  4XS6 A;  3H1N A;  2V6O A;  3IC4 A;  4J57 E;  3G7Y A;  3L4N A;  4F03 A;  1YEP A;  3MSZ A;  3C8E A;  2B7J A;  3LXT A;  1YJ6 A;  3W8S A;  1ML6 A;  5HFG A;  1ZYQ B;  4GXZ A;  3G7J A;  1LBK A;  3GUS A;  2LEG A;  3LXZ A;  1O73 A;  2JSY A;  5A4U A;  2NPB A;  1U6T A;  4KW6 A;  2JAC A;  1VRS D;  5J3R A;  2IMI A;  1JZR A;  2DIY A;  3PH9 A;  2YJ7 A;  1T7P B;  3DGQ A;  4ZB6 A;  2KP1 A;  5H5Q A;  3CMI A;  1GSE A;  3J7Y b;  3GYK A;  2YAN A;  1GWC A;  2EIO A;  3N5O A;  2FUG 2;  2K9F A;  3UJ1 A;  3F63 A;  1W89 A;  3I6A A;  3HXS A;  2IJY A;  2VD1 A;  2REM A;  4TKY A;  4WBR D;  3VWV A;  3IOS A;  3A3T A;  2YCD A;  4PUR A;  2CVD A;  5D8I A;  3Q74 A;  4JU5 A;  4D73 A;  4K7I A;  4Z7X A;  3HKR A;  1GTI A;  2HT9 A;  4IGJ A;  1AC1 A;  2EC4 A;  3UOM A;  3P90 A;  1OC9 A;  1WOU A;  2YOI A;  3L78 A;  4K2D A;  2ON5 A;  1F6M C;  1TW9 A;  4BA7 A;  1SEN A;  4K0N A;  1M9A A;  2FWF A;  1NSW A;  3AY8 A;  3TUE A;  2FWH A;  3ZZX A;  1EGR A;  1ZMA A;  2H0H A;  3O6T A;  1E6B A;  2N5A A;  3KZQ A;  3IK7 A;  4TVE A;  3F8U A;  2OAD A;  3I69 A;  1YF1 A;  2H70 A;  2VCZ A;  1A23 A;  5IMV A;  1R26 A;  4EC0 A;  2PPT A;  4XS4 A;  1GSU A;  3C71 A;  1N2A A;  4RI6 A;  1RQM A;  4NV5 A;  2VLT A;  5C04 A;  4HEA 2;  1ZOF A;  1K0D A;  1XXU A;  2AB6 A;  2F51 A;  5GAN D;  4K6X A;  1ERV A;  3QAW A;  3DRN A;  3EVI A;  3IXR A;  3A2X A;  5D9W A;  1MD3 A;  4GRF A;  1FB0 A;  2HI7 A;  1TXX A;  2CAQ A;  5DAL A;  2FHE A;  1OKT A;  4HDE A;  3VI5 A;  6GSU A;  2FWG A;  2TIR A;  5ECN B;  3NZN A;  4I5Q A;  3S9F A;  1SD8 A;  3IA1 A;  1G6Y A;  3EWL A;  3LG6 A;  3EU4 A;  1QGV A;  3D21 A;  1UN2 A;  4HUA A;  1QXH A;  2H6X A;  5B8A A;  3WD6 A;  4NAX A;  1TK5 B;  2GZY A;  1X5C A;  22GS A;  4MF5 A;  4ZL7 A;  4AJ6 A;  3F4T A;  2EIQ A;  4XTS A;  4HU7 A;  1BAY A;  3M0F A;  3RDW A;  1THO A;  4MMM A;  4ISD A;  3DIE A;  3IRA A;  3RBT A;  1AXD A;  3TKS A;  3GRX A;  5G1K A;  2X8H A;  4OMV A;  3M3M A;  4DSS A;  2LTK A;  4YAV A;  2DBC A;  2V1M A;  3KCM A;  3ZVJ D;  4KX4 A;  3E0U A;  1ERT A;  2P5Q A;  1M2A A;  5ECR B;  3A2V A;  3TRP A;  2YWM A;  4MPF A;  2IFQ B;  5CAX A;  2AV4 A;  1SJI A;  4GSS A;  2E0Q A;  2H76 A;  1MDI A;  1MDJ A;  4KCE A;  1PD2 1;  1KBN A;  3HDC A;  2MMN A;  3PR8 A;  1EV4 A;  2YWI A;  1VF1 A;  1GLP A;  1X5D A;  4YQV A;  4N10 A;  3TOT A;  3M9J A;  2H1A A;  2CVB A;  4OD7 A;  4TR3 A;  4DVC A;  4AJ8 A;  4MDC A;  4OFT A;  4RI7 A;  4KDU A;  1H75 A;  1USB A;  4PX1 A;  2WS2 A;  4HOJ A;  5IOW A;  2XPD A;  2CZ3 A;  3GV1 A;  4MH2 A;  2GTU A;  5ELG A;  3UBK A;  5JWR B;  4HZ2 A;  1HYU A;  4MJE A;  3DVW A;  5ABR A;  4KCA A;  2L6C A;  4ZIJ A;  2M80 A;  1PX6 A;  3UAR A;  3GH9 A;  5D9T A;  3KH9 A;  1T4Z A;  2GDR A;  6GSX A;  1M2D A;  5IQY A;  5IMA A;  2GQL A;  2NVL A;  1B4P A;  5IIZ A;  1BED A;  3TRQ A;  1GTB A;  3TJB A;  1GTA A;  3FZ5 A;  3D4M A;  2VCQ A;  3NOF A;  1FG4 A;  1OC9 B;  4OO5 A;  3LQ7 A;  5DAK A;  3DWV A;  2GSS A;  1B4Q A;  1O85 A;  4V1A p;  1LU4 A;  3D0Z A;  1U87 A;  3VK9 A;  5D93 A;  4V2L A;  2LJK A;  2C80 A;  1B8X A;  3GSS A;  1EP7 A;  1XOB A;  4I6X A;  4PNF A;  4GTU A;  1S3A A;  2CT6 A;  4GSN A;  4WR5 A;  4TR1 A;  1TP9 A;  2L5L A;  4XS4 B;  5EY6 A;  1CQG A;  2LV3 A;  4E8E A;  3GIX A;  4OFM A;  4EO3 A;  1GUH A;  2LKU A;  4KA0 A;  2DJK A;  1J9B A;  1F3B A;  2F9S A;  4F82 A;  2G2Q A;  1HNA A;  4JBB A;  1Z3E A;  3Q19 A;  4POM A;  5KN1 A;  2J23 A;  4CW9 A;  2DML A;  2AYT A;  1GSS A;  4PQI A;  4TXO A;  3JCM L;  5IMC A;  3IDV A;  14GS A;  1XW9 A;  3U5R E;  2BJX A;  2YWO A;  4TR0 A;  2VCW A;  2GST A;  4ILF A;  2FWE A;  2NTO A;  2L4C A;  5J9C A;  1A2M A;  3F6F A;  1B48 A;  5HR1 A;  2LRN A;  2R3X A;  1FHE A;  2B5Y A;  2GZZ A;  5IMD A;  1PMT A;  3TJG A;  4N11 A;  2YP6 A;  3ERG A;  1OE8 A;  2OA7 A;  2VAF A;  10GS A;  3H8Q A;  2K8S A;  3EE2 A;  3MWH A;  2HZE A;  3LSZ A;  1EEJ A;  3CYN A;  1G7O A;  1XZO A;  2L59 A;  2KHP A;  2IN3 A;  1FVK A;  5H5S A;  1GUL A;  2B5E A;  5A4V A;  5L71 A;  1XBS A;  3FW2 A;  3TKS C;  2K6V A;  3WT2 A;  2N5B A;  3EYT A;  3FRC A;  1YY7 A;  2I81 A;  4X0X A;  4ECC A;  3ME7 A;  2F3M A;  1N8J A;  2HE3 A;  2MMA A;  4V2N A;  4WR4 A;  5J4U A;  1V40 A;  5KN0 A;  4I97 A;  4KDY A;  3HVS A;  5A5K A;  4KSM A;  1LJR A;  1DBY A;  1V57 A;  3UAP A;  3VI7 A;  1BQ7 A;  4EE0 A;  1WP0 A;  3QOU A;  2DMM A;  2JZT A;  1EGO A;  2ALB A;  2YV7 A;  4G19 A;  3ZRE A;  4L5L A;  3V1W A;  3M8N A;  3FEU A;  3DXB A;  1F37 A;  5D9X A;  5G31 A;  4MCU A;  1FOV A;  4FIW A;  4MJA A;  1X9W B;  4ZXG A;  2K8V A;  1A2J A;  2DJ1 A;  3VFI A;  4BL7 A;  4ML6 A;  1R7H A;  3TKP A;  4RUV A;  3F3Q A;  8GSS A;  3HVV A;  1OVN A;  4XRA A;  2R6K A;  5AGY A;  1O6J A;  5HR0 A;  2O85 A;  2H0G A;  3QAG A;  3KEB A;  3J7Y k;  4L8E A;  1TRS A;  5J5N A;  2H75 A;  4MAB A;  2PBJ A;  5IPG A;  1M2B A;  3QDN A;  2X8G A;  2YN1 A;  3APO A;  3TKS E;  4MZW A;  3CSI A;  4GCI A;  4BWQ A;  3VLN A;  1XCC A;  1V2A A;  2H6Z A;  3KMN A;  5A4W A;  5F07 A;  2DIZ A;  3LGC A;  1Y6E A;  2QSI A;  5EPF A;  3UIW A;  3H4K A;  2X99 A;  4GST A;  5G30 A;  1EOH A;  1PQN A;  2C0E A;  4J2F A;  2YNX A;  5IO2 A;  5DCG A;  3KJY A;  5FHI A;  2H71 A;  3E3E A;  3IK9 A;  2V32 A;  3EMX A;  1OC8 A;  3UBL A;  1PRX A;  1FB6 A;  4WBJ A;  5EL8 A;  5ID2 A;  4RQX A;  1ACV A;  4KUN A;  1M0U A;  2FA8 A;  4IN0 A;  1SKR B;  5COH A;  1GP1 A;  4YQU A;  3DYR A;  3O76 A;  4EDZ A;  4TXV A;  3RAZ A;  2L6D A;  2CVK A;  2TRC P;  3ZLP A;  2VCT A;  2DJJ A;  3KMO A;  2IME A;  1YQ1 A;  4POL A;  3KTL A;  2L5O A;  1E2Y A;  4CDO A;  2E7P A;  3ZL5 A;  2CV4 A;  5IMZ A;  4TXO B;  1THX A;  5D9V A;  2HRF A;  4L5O A;  1SKW B;  4OWY A;  1Q4J A;  1O7U A;  4MK3 A;  4BVY A;  5KN3 A;  3D5J A;  2VCV A;  1TK8 B;  5B8B A;  3TB2 A;  1TDI A;  3TOU A;  2QGV A;  1WPI A;  3I43 A;  3GTU A;  4XCS A;  2H6Y A;  1TTZ A;  4KB3 A;  2LRC A;  3ME8 A;  3Q6O A;  3VUR A;  1F3A A;  1OAZ A;  1KNG A;  3GNJ A;  4GQC A;  3GUR A;  4I2T A;  1JLV A;  3P2A A;  1KTE A;  4WET A;  1T1V A;  5G5E A;  2V6K A;  4MA9 A;  1GTU A;  4WEY A;  5F0G A;  2VL2 A;  4F0B A;  1K3L A;  2WJU A;  2C1Y A;  2JSZ A;  2WZ9 A;  5AIV A;  4AGS A;  1MD4 A;  2RLI A;  4PNG A;  3O3T A;  3GX8 A;  1VF4 A;  1GNE A;  4FYU A;  3KTB A;  4HZ4 A;  1VGL A;  1H4O A;  2I1U A;  4MH3 A;  3L9U A;  1BJX A;  1G7E A;  1SJZ A;  2PVQ A;  2YZH A;  1Z7P A;  2VCX A;  4ZIL A;  5ECO B;  2HLS A;  3IBH A;  2C3Q A;  2LNS A;  1ZCP A;  2YWN A;  3M1G A;  4EUY A;  1GNW A;  1K0N A;  2M72 A;  4G9H A;  3ZIT A;  2DJ3 A;  3UVH A;  3FR6 A;  4MJB A;  1K0O A;  2GGT A;  4G10 A;  4IQA A;  3GKN A;  4MF6 A;  3W6G A;  4V2M A;  1I5G A;  1V98 A;  2VOC A;  4QQ7 A;  3ZTL A;  2XPE A;  4MF7 A;  4OO4 A;  1SD9 A;  5G5F A;  3D4T A;  3MDK A;  4IKH A;  1ST9 A;  2H0I A;  5GZZ B;  4OCE A;  1KEB A;  4J56 E;  4ECJ A;  3F6D A;  1QQ2 A;  5ENU A;  1TRV A;  3KM6 A;  5AIX A;  3L9V A;  3GN3 A;  3ISO A;  3MAK A;  5JCW A;  1Z5Y E;  3LYP A;  3F3R A;  3C73 A;  1URM A;  4K7O A;  2MMZ A;  2KUC A;  1GLQ A;  3CTG A;  4HJM A;  2LJA A;  2RUF A;  4EXJ A;  3HA9 A;  4KAE A;  2PWJ A;  2YZU A;  3N9J A;  4BVX A;  5CP1 A;  3GMF A;  3ZRD A;  2CQ9 A;  1K3Y A;  3QR6 A;  6GSY A;  5F06 A;  1J0F A;  2PUK C;  4IP6 A;  4EVM A;  5ECL B;  4MP4 A;  2GZP A;  3TCO A;  2ZCT A;  4HQZ A;  1TOF A;  1JHB A;  1A8Y A;  1SL0 B;  2JZR A;  5CNW A;  4D73 B;  1FAA A;  5ECQ B;  1NM3 A;  2O87 A;  3SWL A;  3UEM A;  2C3N A;  3HY2 A;  2MMO A;  4F0C A;  2P5R A;  3FK8 A;  1DE1 A;  2IMK A;  1TU8 A;  4IVF A;  1W4V A;  4MPG A;  1WMJ A;  1AQX A;  2FLS A;  4QL7 A;  1MDK A;  5ELA A;  2VLU A;  2A2R A;  2H8L A;  3PIN A;  2XHF A;  2NBS A;  1AUC A;  2HXK A;  1Y25 A;  5F8B A;  4X43 A;  2XBI A;  1XVQ A;  2FCH A;  1HQO A;  1Z9H A;  1ERU A;  2LNT A;  4EL1 A;  5HQP A;  3A5W A;  5ECI B;  1TRW A;  3DEX A;  2QKE A;  3HJO A;  1XWC A;  2DJ0 A;  4QL9 A;  3QFB C;  1X9S B;  4PQ1 A;  1XWG A;  2N5F A;  3GKX A;  1K0B A;  3BD2 A;  3GTU B;  4PXO A;  5CRG A;  1SK2 A;  3F0I A;  2I4A A;  1ABA A;  1OKD A;  4O5R A;  1I9D A;  2P31 A;  6GST A;  2VO4 A;  3VPQ A;  3ZML A;  5DCH A;  1JZO A;  3QFA C;  5GSS A;  2CZ2 A;  3G9B A;  5DAL B;  1ILO A;  1QK8 A;  3HZ8 A;  4DEJ A;  5LNK e;  1QFN A;  6GSS A;  4L0U A;  2WDU A;  2H72 A;  3D6I A;  4Q5Q A;  4FYC A;  1GSF A;  3GH6 A;  5GAP D;  3LOR A;  2VL2 C;  2K18 A;  1F9M A;  2PU9 C;  1A8L A;  4Q5N A;  2MBT A;  2OBI A;  2RII A;  3DVX A;  3GX0 A;  4PGT A;  1U88 A;  4AF2 A;  1UA5 A;  2H30 A;  1GUK A;  1ZYE A;  1AW9 A;  4F9Z A;  2FNO A;  1BYE A;  3LYK A;  3LEF A;  4E8H A;  4IJ3 A;  1XVW A;  4DSS B;  3ERW A;  4N30 A;  4OCF A;  2FY6 A;  5G2Z A;  3M9K A;  4JZQ A;  3HHV A;  5DBQ A;  3PGT A;  1A0F A;  2VLV A;  4ECI A;  4LLR A;  5HFK A;  1AQV A;  3FKF A;  4OFN A;  4NWY A;  4O7H A;  1PL1 A;  2OE1 A;  4GF0 A;  1JLW A;  3HZ4 A;  2VM1 A;  11GS A;  5B6N A;  2H73 A;  1X0R A;  2PGT A;  1OC3 A;  2RM6 A;  1R5P A;  5DJL A;  1B9X C;  1FW1 A;  2JAD A;  3FZA A;  2KLX A;  5D96 A;  6GSV A;  2KP2 A;  2C3T A;  5DJM A;  2YPM A;  5J9B A;  3W8J A;  2FGX A;  3TGZ A;  1R4W A;  4DSQ A;  16GS A;  5LD0 A;  3P8W A;  2GVP A;  2FA4 A;  3LJR A;  4WXT A;  1TK0 B;  2M46 A;  2H1B A;  3IAS 2;  3GHA A;  1G6W A;  1WRY A;  3HCZ A;  4XIH A;  2C0F A;  3FR9 A;  2XC2 A;  2JZS A;  1DUG A;  1B9Y C;  1VF2 A;  4MLY A;  3F4S A;  3WGE A;  4PQH A;  1PSQ A;  1PN9 A;  4IJI A;  1SYR A;  4LL4 B;  5CRE A;  1PA3 A;  3QPM A;  5HFI A;  1TKD B;  4LL1 B;  4ECB A;  5AIS A;  3IE3 A;  1DSB A;  2IFQ A;  2MZC A;  2LQO A;  2IIY A;  4BWS A;  2R4V A;  2HZF A;  3CRU A;  1M9B A;  4NPB A;  3CTF A;  1PX7 A;  3FHK A;  2IMF A;  3QMX A;  2AUV A;  1A0R P;  5IO0 A;  2O7K A;  2H01 A;  2HFD A;  3RHB A;  1JZW A;  3ZMK A;  4ZBB A;  4Q5F A;  5DAK B;  2HSH A;  1QUW A;  3IHQ A;  4JRR A;  3IPZ A;  3VPT A;  2C0G A;  3KP9 A;  2PN8 A;  1WJK A;  2DLX A;  1AQW A;  18GS A;  3KD0 A;  4G2E A;  13GS A;  2F8A A;  2RUE A;  3HJM A;  2VUP A;  2GSQ A;  2OKA A;  5DDL A;  3Q18 A;  1U3A A;  4TR1 B;  1NHY A;  4ZL8 A;  4GWR A;  3APS A;  2V2G A;  2FD3 A;  4POB A;  4ACS A;  1MEK A;  3VWU A;  5LCZ A;  1SJ6 A;  1XWA A;  2MYG A;  1FVJ A;  2BMX A;  1Q98 A;  1ON4 A;  1V58 A;  2B6M A;  4O32 A;  2CAI A;  3BBY A;  1SKS B;  4IHU A;  1RK4 A;  2IMD A;  5ECP B;  2OBK A;  2E2M A;  4IQ1 A;  3WGD A;  1JZD A;  3CSH A;  1GUM A;  1T00 A;  3KIJ A;  4K1F A;  1XW5 A;  4RQR A;  5H5R A;  4ZBA A;  4L0W A;  5IMF A;  2CA8 A;  1R5A A;  3UMA A;  2NDO A;  2G0F A;  2HNL A;  4P3Y B;  2DC5 A;  5EVO A;  3HVX A;  4LMV A;  2WRT A;  1CQH A;  2LQQ A;  4KND A;  3H93 A;  4EF0 A;  6GSW A;  4JED A;  5DQY A;  2DJ2 A;  1HNC A;  4TR4 A;  1C72 A;  2JU5 A;  3ED3 A;  12GS A;  1SL2 B;  2F8F A;  5ECS A;  2GS3 A;  4PUF C;  2LS5 A;  1JFU A;  5JCU A;  3FY7 A;  4NV2 A;  5IOX A;  2ZUP A;  1PKW A;  2HZE B;  3GL3 A;  2PVO C;  1AAZ A;  4I2U A;  5ECK B;  4ZB8 A;  1M7T A;  2GQK A;  5INY A;  3TKQ A;  4YH2 A;  2OJL A;  9GSS A;  1YF0 A;  1TU7 A;  2LRT A;  3TKR A;  1K0M A;  1PL2 A;  4XRD A;  2YV9 A;  3E9J B;  1XIY A;  4KGI A;  4JR6 A;  1GSD A;  1TRU A;  2L57 A;  2B1L A;  1T8E B;  4GLT A;  1PGT A;  1NW2 A;  4GQF A;  1HNB A;  3KP8 A;  1HD2 A;  3L9S A;  4V1A g;  5HR3 A;  4FH8 A;  2X64 A;  5B6M A;  4H86 A;  3C1S A;  1NHO A;  1GL8 A;  4HU9 A;  5CRD A;  2OE0 A;  3LFL A;  1IYI A;  3KXO A;  2CX4 A;  19GS A;  4MZB A;  1XWB A;  4EDY A;  4KE3 A;  4HJ2 A;  4WKW A;  1G0T A;  1EWX A;  2IWT A;  3GKK A;  1SK0 A;  3G7I A;  1S3C A;  2H1D A;  2GT6 A;  5DVB A;  3ERF A;  1T4Y A;  2XBQ A;  3VWX A;  4BPY A;  3UL3 A;  5JWQ B;  2TRX A;  4JE1 A;  2O89 A;  1O81 A;  1OYJ A;  2YJH A;  4TOP A;  3ZYW A;  7GSS A;  4K8M A;  1ERW A;  4ZL9 A;  1O8W A;  1XPV A;  1SYX A;  1FO5 A;  4N0Z A;  2CX3 A;  4MJC A;  2A4V A;  3BCI A;  2X8C A;  2WFC A;  4Q5R A;  3EU3 A;  3F9U A;  2PMT A;  1WIK A;  2R2J A;  2GSR A;  3WYW A;  5FT3 A;  1DE2 A;  3MNG A;  3L0H A;  4O92 A;  4TRX A;  3CRT A;  3A2W A;  1X5E A;  1YZX A;  3HJP A;  1U3I A;  2Z9S A;  1EP8 A;  3FZ9 A;  5D73 A;  5KEJ A;  5FWG A;  1EZK A;  3CBU A;  4YQM A;  3F4R A;  1IYH A;  5ECH B;  2O8V B;  4HS1 A;  1ZZY A;  2R37 A;  1EOG A;  4IP1 A;  3IR4 A;  1WE0 A;  4I8B A;  4NHZ A;  2VL3 A;  4ML1 A;  2C0D A;  5ID2 B;  2GLR A;  4ZB9 A;  2WUL A;  2LJR A;  2VD0 A;  3QAV A;  2B1K A;  3TRX A;  5ECM B;  3IV4 A;  5IM9 A;  1QMV A;  1F2E A;  4FYB A;  5E4W A;  3IAM 2;  3NIV A;  5JWO B;  2GT5 A;  1Z6N A;  3WGX A;  2I9H A;  5DQS A;  1O8X A;  2B3S A;  3ZIJ A;  3P7X A;  3ZIV A;  2B5X A;  2AHE A;  4KH7 A;  2MBS A;  4ID0 A;  2E2G A;  5C00 A;  5F05 A;  17GS A;  1GH2 A;  1XFL A;  2JL4 A;  5CYY A;  1S3D A;  2H1G A;  3DML A;  3EMP A;  3H79 A;  5JCG A;  3ZFB A;  2OAC A;  4YAP A;  1XWK A; 
#chains in the Genus database with same CATH topology
 4FO5 A;  1K0A A;  20GS A;  4NMU A;  1RW1 A;  4IBP A;  3BCK A;  3SBC A;  1Z6M A;  3HYP A;  2DKH A;  4XS1 A;  4Z2T A;  4HI7 A;  1K3O A;  5CRH A;  4K0G A;  1BG5 A;  3BOA A;  2VIM A;  1SK1 A;  2VL9 A;  1GSY A;  3GFK A;  4WF5 A;  3APQ A;  4TN8 A;  4F2I A;  2HYX A;  1ZGN A;  2P0G A;  1ZL9 A;  3GA4 A;  3EIN A;  4EKZ A;  2V41 A;  2BTO T;  5CO3 A;  5CRW A;  3R2Q A;  5AN1 A;  1OE7 A;  3RHC A;  3WT1 A;  3TJJ A;  4TW5 A;  1K0C A;  3FZ4 A;  4LA1 A;  4IS0 A;  4XHM A;  2I3Y A;  2ES7 A;  4K7N A;  2GQM A;  3C7M A;  5B7C A;  2HSY A;  4IEL A;  1TI1 A;  3UVT A;  1UC7 A;  2WGR A;  2WB9 A;  4CHS A;  1VF3 A;  1TI3 A;  3QD9 A;  3TJK A;  4WF4 A;  2OE3 A;  4IW9 A;  1YDK A;  1PKZ A;  1FOH A;  1TJD A;  3VWW A;  3KH7 A;  2A2S A;  2HRN A;  1EEM A;  2ON7 A;  1XOA A;  2D2Z A;  3I9V 2;  5G1L A;  1SU9 A;  3RPN A;  1SL1 B;  5IPH A;  3R3E A;  2EIR A;  1YEX A;  4X1U A;  3US3 A;  3DKS A;  3GST A;  4DSR A;  5E59 A;  3OR5 A;  2AJQ B;  4ULX A;  5KN2 A;  3BJ5 A;  3GKM A;  1J08 A;  2H74 A;  1XW6 A;  1A2L A;  1EV9 A;  2LUS A;  3DD3 A;  4N0V A;  3PPU A;  4LMW A;  1Z7R A;  2AAW A;  2C8U A;  4PUA A;  3CXG A;  2KOK A;  4KDX A;  2H66 A;  4HQS A;  3FR3 A;  3K8N A;  5HR2 A;  3TJF A;  4POK A;  4NXI A;  2HRA A;  1M3J A;  3U6V A;  4PTS A;  1V9W A;  2L4Q A;  3EC3 A;  3CSJ A;  4NHW A;  2H19 A;  3C1R A;  3IC8 A;  5BRT A;  3FYG A;  1A24 A;  3ZFL A;  1YKC A;  3RPP A;  1M99 A;  4AJ7 A;  2C4J A;  3D22 A;  4KSO A;  2WCI A;  3LWA A;  1X9M B;  2RM5 A;  1T3B A;  2LST A;  1GRX A;  2ZNM A;  1BX9 A;  4JR4 A;  3TDG A;  2IL3 A;  5GST A;  5J41 A;  2J9H A;  2A2P A;  2IPA A;  3GL5 A;  2B7K A;  4ZBD A;  3KGK A;  4MZC A;  3EUR A;  4K9Z A;  2VM2 A;  3ZVJ A;  1GSQ A;  1YKA A;  2R5G A;  1UVZ A;  3QCP A;  1WWJ A;  3HD5 A;  2QC7 A;  2PER A;  1MTC A;  2DSA A;  1AIU A;  4XS6 A;  3H1N A;  2V6O A;  3IC4 A;  4J57 E;  3G7Y A;  3L4N A;  4F03 A;  1YEP A;  3MSZ A;  3C8E A;  2B7J A;  3LXT A;  1YJ6 A;  4CY8 A;  3W8S A;  1ML6 A;  5HFG A;  1ZYQ B;  4GXZ A;  3G7J A;  1LBK A;  3GUS A;  2LEG A;  3LXZ A;  1O73 A;  2JSY A;  5A4U A;  3HVN A;  2NPB A;  1U6T A;  4KW6 A;  2JAC A;  1VRS D;  5J3R A;  2IMI A;  1JZR A;  2DIY A;  3PH9 A;  2YJ7 A;  1T7P B;  3DGQ A;  4ZB6 A;  2KP1 A;  5H5Q A;  3CMI A;  1GSE A;  3J7Y b;  3GYK A;  2YAN A;  1GWC A;  2EIO A;  3N5O A;  2FUG 2;  2K9F A;  3UJ1 A;  3F63 A;  1W89 A;  3I6A A;  3HXS A;  2IJY A;  2VD1 A;  2REM A;  4TKY A;  4WBR D;  3VWV A;  3CQF A;  3IOS A;  3A3T A;  2YCD A;  4PUR A;  2CVD A;  5D8I A;  3Q74 A;  4JU5 A;  4D73 A;  4K7I A;  4Z7X A;  3HKR A;  1GTI A;  2HT9 A;  4IGJ A;  1AC1 A;  2EC4 A;  3UOM A;  3P90 A;  1OC9 A;  1WOU A;  2YOI A;  3L78 A;  4K2D A;  2ON5 A;  1F6M C;  1M3I A;  1TW9 A;  4BA7 A;  1SEN A;  4K0N A;  1M9A A;  2FWF A;  1NSW A;  3AY8 A;  3TUE A;  2FWH A;  3ZZX A;  1EGR A;  1ZMA A;  4HSC X;  2H0H A;  3O6T A;  1E6B A;  2N5A A;  3KZQ A;  3IK7 A;  4TVE A;  3F8U A;  2OAD A;  3I69 A;  1YF1 A;  2H70 A;  2VCZ A;  1A23 A;  5IMV A;  1R26 A;  4EC0 A;  2PPT A;  4XS4 A;  1GSU A;  3C71 A;  1N2A A;  4RI6 A;  1RQM A;  4NV5 A;  2VLT A;  5C04 A;  4HEA 2;  1ZOF A;  1K0D A;  1XXU A;  4G0I A;  2AB6 A;  2F51 A;  5GAN D;  4K6X A;  1ERV A;  3QAW A;  3DRN A;  3EVI A;  3IXR A;  3A2X A;  5D9W A;  1MD3 A;  4GRF A;  1FB0 A;  2HI7 A;  1TXX A;  2CAQ A;  5DAL A;  2FHE A;  1OKT A;  4HDE A;  3VI5 A;  6GSU A;  2FWG A;  2TIR A;  5ECN B;  3NZN A;  4I5Q A;  3S9F A;  1SD8 A;  3IA1 A;  1G6Y A;  3EWL A;  3LG6 A;  3EU4 A;  1QGV A;  3D21 A;  1UN2 A;  4HUA A;  1QXH A;  2H6X A;  5B8A A;  3WD6 A;  4NAX A;  1TK5 B;  2GZY A;  1X5C A;  22GS A;  4MF5 A;  4ZL7 A;  4AJ6 A;  2R0C A;  3F4T A;  2EIQ A;  4XTS A;  4HU7 A;  1BAY A;  3M0F A;  3RDW A;  1THO A;  4MMM A;  4ISD A;  3DIE A;  3IRA A;  3RBT A;  1AXD A;  3TKS A;  3GRX A;  5G1K A;  2X8H A;  4OMV A;  3M3M A;  4DSS A;  2LTK A;  4YAV A;  4FQU A;  2DBC A;  2V1M A;  3KCM A;  3ZVJ D;  4KX4 A;  3E0U A;  1ERT A;  2P5Q A;  1M2A A;  5ECR B;  3A2V A;  3TRP A;  2YWM A;  4USS A;  4MPF A;  2IFQ B;  5CAX A;  2AV4 A;  1SJI A;  4GSS A;  2E0Q A;  2H76 A;  1MDI A;  1MDJ A;  4KCE A;  1PD2 1;  1KBN A;  3HDC A;  2MMN A;  3PR8 A;  1EV4 A;  2YWI A;  1VF1 A;  1GLP A;  1X5D A;  4YQV A;  4N10 A;  3TOT A;  3M9J A;  2H1A A;  2CVB A;  4OD7 A;  4TR3 A;  4DVC A;  4AJ8 A;  4MDC A;  4OFT A;  1PFO A;  4RI7 A;  4KDU A;  1H75 A;  1USB A;  4PX1 A;  2WS2 A;  4HOJ A;  5IOW A;  2XPD A;  2CZ3 A;  3GV1 A;  4MH2 A;  2GTU A;  5ELG A;  3UBK A;  5JWR B;  4HZ2 A;  1HYU A;  4MJE A;  3DVW A;  5ABR A;  3A5I A;  4KCA A;  2L6C A;  4ZIJ A;  2M80 A;  1PX6 A;  3UAR A;  3GH9 A;  5D9T A;  3KH9 A;  1T4Z A;  3MYD A;  2GDR A;  4G0L A;  6GSX A;  1M2D A;  4CY6 A;  4EIP A;  5IQY A;  5IMA A;  2GQL A;  2NVL A;  1B4P A;  5IIZ A;  1BED A;  3TRQ A;  1GTB A;  3TJB A;  1GTA A;  3FZ5 A;  3D4M A;  2VCQ A;  3NOF A;  1FG4 A;  1OC9 B;  4OO5 A;  3LQ7 A;  5DAK A;  4K5S A;  3DWV A;  2GSS A;  1B4Q A;  1O85 A;  4V1A p;  1LU4 A;  3D0Z A;  1U87 A;  3VK9 A;  5D93 A;  4V2L A;  2LJK A;  2C80 A;  1B8X A;  3GSS A;  1EP7 A;  1ZYN A;  1XOB A;  4I6X A;  4PNF A;  4GTU A;  1S3A A;  2CT6 A;  4GSN A;  4WR5 A;  1ZYP A;  4TR1 A;  1TP9 A;  2L5L A;  4XS4 B;  5EY6 A;  1CQG A;  2LV3 A;  4E8E A;  3GIX A;  4Z2U A;  4OFM A;  4EO3 A;  1GUH A;  2LKU A;  4KA0 A;  2DJK A;  1J9B A;  1F3B A;  2F9S A;  4F82 A;  2G2Q A;  1HNA A;  4JBB A;  1Z3E A;  3Q19 A;  4POM A;  5KN1 A;  2J23 A;  4CW9 A;  2DML A;  2AYT A;  1GSS A;  4PQI A;  4TXO A;  3JCM L;  3LW9 A;  5IMC A;  3IDV A;  14GS A;  1XW9 A;  3U5R E;  2BJX A;  2YWO A;  4TR0 A;  2VCW A;  2GST A;  4ILF A;  2FWE A;  2NTO A;  2L4C A;  5J9C A;  1A2M A;  3F6F A;  1B48 A;  5HR1 A;  2LRN A;  2R3X A;  5KOX A;  1FHE A;  2B5Y A;  2GZZ A;  5IMD A;  1PMT A;  3TJG A;  4N11 A;  2YP6 A;  3ERG A;  1OE8 A;  2OA7 A;  2VAF A;  4EIQ A;  10GS A;  3H8Q A;  2K8S A;  3EE2 A;  3MWH A;  2HZE A;  3LSZ A;  1EEJ A;  3CYN A;  1G7O A;  1XZO A;  2L59 A;  2KHP A;  2IN3 A;  1FVK A;  5H5S A;  1GUL A;  2B5E A;  5A4V A;  5L71 A;  1XBS A;  3FW2 A;  3TKS C;  2K6V A;  3WT2 A;  2N5B A;  3EYT A;  3FRC A;  1YY7 A;  2I81 A;  4X0X A;  4ECC A;  3ME7 A;  2F3M A;  1N8J A;  2HE3 A;  2MMA A;  4V2N A;  4WR4 A;  5J4U A;  1V40 A;  5KN0 A;  4I97 A;  4KDY A;  3HVS A;  5A5K A;  4KSM A;  1LJR A;  1DBY A;  1V57 A;  3UAP A;  3VI7 A;  1BQ7 A;  4EE0 A;  1WP0 A;  3QOU A;  2DMM A;  2JZT A;  1EGO A;  2ALB A;  2YV7 A;  4G19 A;  3ZRE A;  4L5L A;  3V1W A;  3M8N A;  3FEU A;  4Z2R A;  3DXB A;  1F37 A;  5D9X A;  5G31 A;  4MCU A;  1FOV A;  4FIW A;  4MJA A;  1X9W B;  4ZXG A;  2K8V A;  1A2J A;  2DJ1 A;  3VFI A;  4BL7 A;  4ML6 A;  1R7H A;  3TKP A;  4RUV A;  3F3Q A;  8GSS A;  3HVV A;  1OVN A;  4XRA A;  2R6K A;  5AGY A;  1O6J A;  5HR0 A;  2O85 A;  2H0G A;  3QAG A;  3KEB A;  3J7Y k;  4L8E A;  1TRS A;  5J5N A;  2H75 A;  4MAB A;  2PBJ A;  5IPG A;  1M2B A;  3QDN A;  2X8G A;  2YN1 A;  2QA2 A;  3APO A;  3TKS E;  4MZW A;  3CSI A;  4GCI A;  4BWQ A;  3VLN A;  1XCC A;  1V2A A;  2H6Z A;  3KMN A;  4BIK A;  5A4W A;  5F07 A;  2DIZ A;  3LGC A;  1Y6E A;  2QSI A;  5EPF A;  3UIW A;  3H4K A;  2X99 A;  4GST A;  5G30 A;  1PN0 A;  1EOH A;  1PQN A;  2C0E A;  4J2F A;  2YNX A;  5IO2 A;  5DCG A;  3KJY A;  5FHI A;  2H71 A;  3E3E A;  3IK9 A;  2V32 A;  3EMX A;  1OC8 A;  3UBL A;  1PRX A;  1FB6 A;  4WBJ A;  5EL8 A;  5ID2 A;  4RQX A;  1ACV A;  4KUN A;  1M0U A;  2FA8 A;  4IN0 A;  1SKR B;  5COH A;  1GP1 A;  4YQU A;  3DYR A;  3O76 A;  4EDZ A;  4TXV A;  3RAZ A;  2L6D A;  2CVK A;  2TRC P;  3ZLP A;  2VCT A;  2DJJ A;  3KMO A;  2IME A;  1YQ1 A;  4POL A;  3KTL A;  2L5O A;  1E2Y A;  4CDO A;  2E7P A;  3ZL5 A;  2CV4 A;  5IMZ A;  4TXO B;  4O5U A;  1THX A;  5D9V A;  2HRF A;  4L5O A;  1SKW B;  4OWY A;  1Q4J A;  1O7U A;  4MK3 A;  4BVY A;  5KN3 A;  3D5J A;  4O5Q A;  2VCV A;  3IHG A;  1TK8 B;  5B8B A;  3TB2 A;  1TDI A;  3TOU A;  2QGV A;  1WPI A;  3I43 A;  3GTU A;  4KF9 A;  4XCS A;  2H6Y A;  1TTZ A;  4KB3 A;  2LRC A;  3ME8 A;  3Q6O A;  3VUR A;  1F3A A;  1OAZ A;  1KNG A;  3GNJ A;  4GQC A;  3GUR A;  4I2T A;  1JLV A;  3P2A A;  1KTE A;  4WET A;  1T1V A;  5G5E A;  2V6K A;  4MA9 A;  1GTU A;  4WEY A;  5F0G A;  2VL2 A;  4F0B A;  1K3L A;  2WJU A;  2C1Y A;  2JSZ A;  2WZ9 A;  5AIV A;  4AGS A;  1MD4 A;  2RLI A;  4PNG A;  3O3T A;  3GX8 A;  1VF4 A;  1GNE A;  4FYU A;  3KTB A;  4K2X A;  4HZ4 A;  1VGL A;  1H4O A;  2I1U A;  4MH3 A;  3L9U A;  1BJX A;  1G7E A;  1SJZ A;  2PVQ A;  2YZH A;  1Z7P A;  2VCX A;  4ZIL A;  5ECO B;  2HLS A;  3IBH A;  2C3Q A;  2LNS A;  1ZCP A;  2YWN A;  3M1G A;  4EUY A;  1GNW A;  1K0N A;  2M72 A;  1S3R A;  4G9H A;  3ZIT A;  2DJ3 A;  3UVH A;  3FR6 A;  4MJB A;  1K0O A;  4BL7 B;  2GGT A;  4G10 A;  4IQA A;  3GKN A;  4MF6 A;  3W6G A;  4V2M A;  1I5G A;  1V98 A;  2VOC A;  4QQ7 A;  3ZTL A;  2XPE A;  4MF7 A;  4OO4 A;  1SD9 A;  5G5F A;  3D4T A;  3MDK A;  4IKH A;  1ST9 A;  2H0I A;  5GZZ B;  4OCE A;  1KEB A;  4J56 E;  4ECJ A;  3F6D A;  1QQ2 A;  5ENU A;  1TRV A;  3KM6 A;  5AIX A;  3L9V A;  3GN3 A;  3ISO A;  3MAK A;  5JCW A;  1Z5Y E;  3LYP A;  3F3R A;  3C73 A;  1URM A;  4K7O A;  2MMZ A;  2KUC A;  1GLQ A;  3CTG A;  4HJM A;  2LJA A;  2RUF A;  4EXJ A;  3HA9 A;  4KAE A;  2PWJ A;  2R0G A;  2YZU A;  3N9J A;  4BVX A;  5CP1 A;  3GMF A;  3ZRD A;  2CQ9 A;  1K3Y A;  3QR6 A;  6GSY A;  5F06 A;  1J0F A;  2PUK C;  4IP6 A;  4EVM A;  5ECL B;  4MP4 A;  2GZP A;  3TCO A;  2ZCT A;  4HQZ A;  1TOF A;  1JHB A;  1A8Y A;  2UZ8 A;  2X4A A;  1SL0 B;  2JZR A;  5CNW A;  4D73 B;  1FAA A;  5ECQ B;  1NM3 A;  2O87 A;  3SWL A;  3UEM A;  2C3N A;  3HY2 A;  2MMO A;  4F0C A;  2P5R A;  3FK8 A;  1DE1 A;  2IMK A;  1TU8 A;  4IVF A;  1W4V A;  4MPG A;  1WMJ A;  1AQX A;  2FLS A;  4QL7 A;  1MDK A;  5ELA A;  2VLU A;  2A2R A;  2H8L A;  3PIN A;  2XHF A;  2NBS A;  1AUC A;  2HXK A;  1Y25 A;  5F8B A;  4X43 A;  2XBI A;  1XVQ A;  2FCH A;  1HQO A;  1Z9H A;  1ERU A;  4BVY B;  2LNT A;  4EL1 A;  5HQP A;  3A5W A;  5ECI B;  1TRW A;  3DEX A;  2QKE A;  3HJO A;  1XWC A;  2DJ0 A;  4QL9 A;  3QFB C;  1X9S B;  4PQ1 A;  1XWG A;  2N5F A;  3GKX A;  1K0B A;  3BD2 A;  4PXO A;  3GTU B;  5CRG A;  1SK2 A;  3F0I A;  3EPT A;  2I4A A;  1ABA A;  1OKD A;  4O5R A;  1I9D A;  2P31 A;  6GST A;  2VO4 A;  3VPQ A;  3ZML A;  5DCH A;  1JZO A;  3QFA C;  5GSS A;  2CZ2 A;  3G9B A;  5DAL B;  1ILO A;  1QK8 A;  3HZ8 A;  4DEJ A;  5LNK e;  1QFN A;  6GSS A;  5BMU A;  4L0U A;  2WDU A;  2H72 A;  3D6I A;  4Q5Q A;  4FYC A;  1GSF A;  3GH6 A;  2HSM A;  5GAP D;  3LOR A;  2VL2 C;  2K18 A;  1F9M A;  2PU9 C;  1A8L A;  4Q5N A;  2MBT A;  2OBI A;  5KOW A;  2RII A;  3DVX A;  3GX0 A;  4PGT A;  4YKG A;  1U88 A;  4AF2 A;  1UA5 A;  2H30 A;  1GUK A;  1ZYE A;  1AW9 A;  4F9Z A;  2FNO A;  3FMW A;  1BYE A;  3LYK A;  3LEF A;  4E8H A;  4IJ3 A;  1XVW A;  4DSS B;  3ERW A;  4N30 A;  4OCF A;  2FY6 A;  5G2Z A;  3M9K A;  4JZQ A;  3HHV A;  5DBQ A;  3MIX A;  3PGT A;  1A0F A;  2VLV A;  4ECI A;  4LLR A;  5HFK A;  1AQV A;  3FKF A;  4OFN A;  4NWY A;  4O7H A;  1PL1 A;  2OE1 A;  4GF0 A;  1JLW A;  3HZ4 A;  2VM1 A;  11GS A;  5B6N A;  2H73 A;  2X49 A;  1X0R A;  2PGT A;  1OC3 A;  2RM6 A;  1R5P A;  5DJL A;  1B9X C;  1FW1 A;  2JAD A;  3FZA A;  2A4H A;  2KLX A;  5D96 A;  6GSV A;  2KP2 A;  2C3T A;  5DJM A;  2YPM A;  5J9B A;  3W8J A;  2FGX A;  3TGZ A;  1R4W A;  4DSQ A;  4MNN A;  16GS A;  5LD0 A;  3P8W A;  2GVP A;  2FA4 A;  3LJR A;  4WXT A;  1TK0 B;  2M46 A;  2H1B A;  3IAS 2;  3GHA A;  1G6W A;  1WRY A;  3HCZ A;  4XIH A;  2C0F A;  3FR9 A;  2XC2 A;  2JZS A;  1DUG A;  1B9Y C;  1VF2 A;  4MLY A;  3F4S A;  3WGE A;  4PQH A;  1PSQ A;  1PN9 A;  4IJI A;  1SYR A;  4LL4 B;  5CRE A;  1PA3 A;  3QPM A;  5HFI A;  1TKD B;  4LL1 B;  4ECB A;  5AIS A;  3IE3 A;  1DSB A;  4BVX B;  2IFQ A;  2MZC A;  2LQO A;  2IIY A;  4BWS A;  4X4J A;  2R4V A;  2HZF A;  3CRU A;  1M9B A;  4NPB A;  3CTF A;  1PX7 A;  3FHK A;  2IMF A;  3QMX A;  2AUV A;  1A0R P;  5IO0 A;  2O7K A;  2H01 A;  2HFD A;  3RHB A;  1JZW A;  3ZMK A;  4ZBB A;  4ICY A;  4Q5F A;  5DAK B;  4A5P A;  2HSH A;  4G0K A;  1QUW A;  3IHQ A;  4JRR A;  3IPZ A;  3VPT A;  2C0G A;  3KP9 A;  2PN8 A;  1WJK A;  2DLX A;  1AQW A;  18GS A;  3KD0 A;  4G2E A;  13GS A;  2F8A A;  2RUE A;  3HJM A;  2VUP A;  2GSQ A;  2OKA A;  5DDL A;  3Q18 A;  1U3A A;  4TR1 B;  1NHY A;  4ZL8 A;  4GWR A;  3APS A;  2V2G A;  2FD3 A;  4POB A;  4ACS A;  1MEK A;  3VWU A;  5LCZ A;  1SJ6 A;  1XWA A;  2MYG A;  1FVJ A;  2BMX A;  1Q98 A;  1ON4 A;  1V58 A;  2B6M A;  4O32 A;  2CAI A;  3BBY A;  1SKS B;  4IHU A;  1RK4 A;  2IMD A;  5ECP B;  2OBK A;  2E2M A;  4IQ1 A;  3WGD A;  1JZD A;  3CSH A;  1GUM A;  1T00 A;  3KIJ A;  4K1F A;  1XW5 A;  4RQR A;  5H5R A;  4ZBA A;  4L0W A;  5IMF A;  2CA8 A;  1R5A A;  3UMA A;  2NDO A;  2G0F A;  2HNL A;  4P3Y B;  2DC5 A;  5EVO A;  3HVX A;  4LMV A;  2WRT A;  1CQH A;  2LQQ A;  4KND A;  3H93 A;  4EF0 A;  6GSW A;  4JED A;  5DQY A;  2DJ2 A;  1HNC A;  4TR4 A;  1C72 A;  2JU5 A;  3ED3 A;  12GS A;  1SL2 B;  2F8F A;  5ECS A;  2GS3 A;  4PUF C;  2LS5 A;  1JFU A;  5JCU A;  3FY7 A;  4NV2 A;  5IOX A;  2ZUP A;  1PKW A;  2HZE B;  3GL3 A;  2PVO C;  1AAZ A;  4I2U A;  5ECK B;  4ZB8 A;  1M7T A;  2GQK A;  5INY A;  3TKQ A;  4YH2 A;  2OJL A;  9GSS A;  1YF0 A;  4YKF A;  1TU7 A;  2LRT A;  3TKR A;  1K0M A;  1PL2 A;  4XRD A;  2YV9 A;  3E9J B;  1XIY A;  4KGI A;  4JR6 A;  1GSD A;  1TRU A;  2L57 A;  2B1L A;  1T8E B;  4GLT A;  1PGT A;  1NW2 A;  4GQF A;  1HNB A;  3KP8 A;  1HD2 A;  3L9S A;  4V1A g;  5HR3 A;  4FH8 A;  2X64 A;  5B6M A;  4H86 A;  3C1S A;  1NHO A;  1GL8 A;  4HU9 A;  5CRD A;  2OE0 A;  3LFL A;  1IYI A;  3KXO A;  2CX4 A;  19GS A;  4MZB A;  1XWB A;  4EDY A;  4KE3 A;  4HJ2 A;  4WKW A;  1G0T A;  1EWX A;  2IWT A;  3GKK A;  1SK0 A;  3G7I A;  1S3C A;  2H1D A;  2GT6 A;  5DVB A;  3ERF A;  1T4Y A;  2XBQ A;  3VWX A;  4BPY A;  3UL3 A;  5JWQ B;  2TRX A;  4JE1 A;  2O89 A;  1O81 A;  1OYJ A;  2YJH A;  4TOP A;  3ZYW A;  7GSS A;  4K8M A;  1ERW A;  4ZL9 A;  1O8W A;  1XPV A;  1SYX A;  1FO5 A;  4N0Z A;  2CX3 A;  4MJC A;  2A4V A;  3BCI A;  2X8C A;  2WFC A;  4Q5R A;  3EU3 A;  3F9U A;  2PMT A;  1WIK A;  2HRK A;  2R2J A;  2GSR A;  3WYW A;  5FT3 A;  1DE2 A;  3MNG A;  4K5R A;  3L0H A;  4O92 A;  4TRX A;  3CRT A;  3A2W A;  1X5E A;  1YZX A;  2QA1 A;  3HJP A;  1U3I A;  2Z9S A;  2R0P A;  1EP8 A;  3FZ9 A;  1XG8 A;  5D73 A;  5KEJ A;  5FWG A;  1EZK A;  3CBU A;  4YQM A;  3F4R A;  1IYH A;  5ECH B;  2O8V B;  4HS1 A;  1ZZY A;  2DKI A;  2R37 A;  1EOG A;  4IP1 A;  3IR4 A;  1WE0 A;  4I8B A;  4NHZ A;  2VL3 A;  4ML1 A;  2C0D A;  5ID2 B;  2GLR A;  4ZB9 A;  2WUL A;  2LJR A;  2VD0 A;  3QAV A;  2B1K A;  3TRX A;  5ECM B;  3IV4 A;  5IM9 A;  1QMV A;  1F2E A;  4FYB A;  5E4W A;  3IAM 2;  3NIV A;  5JWO B;  2GT5 A;  1Z6N A;  3WGX A;  2I9H A;  5DQS A;  1O8X A;  2B3S A;  3ZIJ A;  3P7X A;  3ZIV A;  2B5X A;  2AHE A;  4KH7 A;  2MBS A;  4ID0 A;  2E2G A;  5C00 A;  5F05 A;  17GS A;  1GH2 A;  1XFL A;  2JL4 A;  5CYY A;  1S3D A;  2H1G A;  3DML A;  3EMP A;  3H79 A;  5JCG A;  3ZFB A;  2OAC A;  4YAP A;  1XWK A; 
#chains in the Genus database with same CATH homology
 4FO5 A;  1K0A A;  20GS A;  4NMU A;  1RW1 A;  4IBP A;  3BCK A;  3SBC A;  1Z6M A;  3HYP A;  2DKH A;  4XS1 A;  4Z2T A;  4HI7 A;  1K3O A;  5CRH A;  4K0G A;  1BG5 A;  3BOA A;  2VIM A;  1SK1 A;  2VL9 A;  1GSY A;  3GFK A;  4WF5 A;  3APQ A;  4TN8 A;  4F2I A;  2HYX A;  1ZGN A;  2P0G A;  1ZL9 A;  3GA4 A;  3EIN A;  4EKZ A;  2V41 A;  2BTO T;  5CO3 A;  5CRW A;  3R2Q A;  5AN1 A;  1OE7 A;  3RHC A;  3WT1 A;  3TJJ A;  4TW5 A;  1K0C A;  3FZ4 A;  4LA1 A;  4IS0 A;  4XHM A;  2I3Y A;  2ES7 A;  4K7N A;  2GQM A;  3C7M A;  5B7C A;  2HSY A;  4IEL A;  1TI1 A;  3UVT A;  1UC7 A;  2WGR A;  2WB9 A;  4CHS A;  1VF3 A;  1TI3 A;  3QD9 A;  3TJK A;  4WF4 A;  2OE3 A;  4IW9 A;  1YDK A;  1PKZ A;  1FOH A;  1TJD A;  3VWW A;  3KH7 A;  2A2S A;  2HRN A;  1EEM A;  2ON7 A;  1XOA A;  2D2Z A;  3I9V 2;  5G1L A;  1SU9 A;  3RPN A;  1SL1 B;  5IPH A;  3R3E A;  2EIR A;  1YEX A;  4X1U A;  3US3 A;  3DKS A;  3GST A;  4DSR A;  5E59 A;  3OR5 A;  2AJQ B;  4ULX A;  5KN2 A;  3BJ5 A;  3GKM A;  1J08 A;  2H74 A;  1XW6 A;  1A2L A;  1EV9 A;  2LUS A;  3DD3 A;  4N0V A;  3PPU A;  4LMW A;  1Z7R A;  2AAW A;  2C8U A;  4PUA A;  3CXG A;  2KOK A;  4KDX A;  2H66 A;  4HQS A;  3FR3 A;  3K8N A;  5HR2 A;  3TJF A;  4POK A;  4NXI A;  2HRA A;  3U6V A;  4PTS A;  1V9W A;  2L4Q A;  3EC3 A;  3CSJ A;  4NHW A;  2H19 A;  3C1R A;  3IC8 A;  5BRT A;  3FYG A;  1A24 A;  3ZFL A;  1YKC A;  3RPP A;  1M99 A;  4AJ7 A;  2C4J A;  3D22 A;  4KSO A;  2WCI A;  3LWA A;  1X9M B;  2RM5 A;  1T3B A;  2LST A;  1GRX A;  2ZNM A;  1BX9 A;  4JR4 A;  3TDG A;  2IL3 A;  5GST A;  5J41 A;  2J9H A;  2A2P A;  2IPA A;  3GL5 A;  2B7K A;  4ZBD A;  3KGK A;  4MZC A;  3EUR A;  4K9Z A;  2VM2 A;  3ZVJ A;  1GSQ A;  1YKA A;  2R5G A;  1UVZ A;  3QCP A;  1WWJ A;  3HD5 A;  2QC7 A;  2PER A;  1MTC A;  2DSA A;  1AIU A;  4XS6 A;  3H1N A;  2V6O A;  3IC4 A;  4J57 E;  3G7Y A;  3L4N A;  4F03 A;  1YEP A;  3MSZ A;  3C8E A;  2B7J A;  3LXT A;  1YJ6 A;  4CY8 A;  3W8S A;  1ML6 A;  5HFG A;  1ZYQ B;  4GXZ A;  3G7J A;  1LBK A;  3GUS A;  2LEG A;  3LXZ A;  1O73 A;  2JSY A;  5A4U A;  2NPB A;  1U6T A;  4KW6 A;  2JAC A;  1VRS D;  5J3R A;  2IMI A;  1JZR A;  2DIY A;  3PH9 A;  2YJ7 A;  1T7P B;  3DGQ A;  4ZB6 A;  2KP1 A;  5H5Q A;  3CMI A;  1GSE A;  3J7Y b;  3GYK A;  2YAN A;  1GWC A;  2EIO A;  3N5O A;  2FUG 2;  2K9F A;  3UJ1 A;  3F63 A;  1W89 A;  3I6A A;  3HXS A;  2IJY A;  2VD1 A;  2REM A;  4TKY A;  4WBR D;  3VWV A;  3IOS A;  3A3T A;  2YCD A;  4PUR A;  2CVD A;  5D8I A;  3Q74 A;  4JU5 A;  4D73 A;  4K7I A;  4Z7X A;  3HKR A;  1GTI A;  2HT9 A;  4IGJ A;  1AC1 A;  2EC4 A;  3UOM A;  3P90 A;  1OC9 A;  1WOU A;  2YOI A;  3L78 A;  4K2D A;  2ON5 A;  1F6M C;  1TW9 A;  4BA7 A;  1SEN A;  4K0N A;  1M9A A;  2FWF A;  1NSW A;  3AY8 A;  3TUE A;  2FWH A;  3ZZX A;  1EGR A;  1ZMA A;  2H0H A;  3O6T A;  1E6B A;  2N5A A;  3KZQ A;  3IK7 A;  4TVE A;  3F8U A;  2OAD A;  3I69 A;  1YF1 A;  2H70 A;  2VCZ A;  1A23 A;  5IMV A;  1R26 A;  4EC0 A;  2PPT A;  4XS4 A;  1GSU A;  3C71 A;  1N2A A;  4RI6 A;  1RQM A;  4NV5 A;  2VLT A;  5C04 A;  4HEA 2;  1ZOF A;  1K0D A;  1XXU A;  4G0I A;  2AB6 A;  2F51 A;  5GAN D;  4K6X A;  1ERV A;  3QAW A;  3DRN A;  3EVI A;  3IXR A;  3A2X A;  5D9W A;  1MD3 A;  4GRF A;  1FB0 A;  2HI7 A;  1TXX A;  2CAQ A;  5DAL A;  2FHE A;  1OKT A;  4HDE A;  3VI5 A;  6GSU A;  2FWG A;  2TIR A;  5ECN B;  3NZN A;  4I5Q A;  3S9F A;  1SD8 A;  3IA1 A;  1G6Y A;  3EWL A;  3LG6 A;  3EU4 A;  1QGV A;  3D21 A;  1UN2 A;  4HUA A;  1QXH A;  2H6X A;  5B8A A;  3WD6 A;  4NAX A;  1TK5 B;  2GZY A;  1X5C A;  22GS A;  4MF5 A;  4ZL7 A;  4AJ6 A;  2R0C A;  3F4T A;  2EIQ A;  4XTS A;  4HU7 A;  1BAY A;  3M0F A;  3RDW A;  1THO A;  4MMM A;  4ISD A;  3DIE A;  3IRA A;  3RBT A;  1AXD A;  3TKS A;  3GRX A;  5G1K A;  2X8H A;  4OMV A;  3M3M A;  4DSS A;  2LTK A;  4YAV A;  4FQU A;  2DBC A;  2V1M A;  3KCM A;  3ZVJ D;  4KX4 A;  3E0U A;  1ERT A;  2P5Q A;  1M2A A;  5ECR B;  3A2V A;  3TRP A;  2YWM A;  4USS A;  4MPF A;  2IFQ B;  5CAX A;  2AV4 A;  1SJI A;  4GSS A;  2E0Q A;  2H76 A;  1MDI A;  1MDJ A;  4KCE A;  1PD2 1;  1KBN A;  3HDC A;  2MMN A;  3PR8 A;  1EV4 A;  2YWI A;  1VF1 A;  1GLP A;  1X5D A;  4YQV A;  4N10 A;  3TOT A;  3M9J A;  2H1A A;  2CVB A;  4OD7 A;  4TR3 A;  4DVC A;  4AJ8 A;  4MDC A;  4OFT A;  4RI7 A;  4KDU A;  1H75 A;  1USB A;  4PX1 A;  2WS2 A;  4HOJ A;  5IOW A;  2XPD A;  2CZ3 A;  3GV1 A;  4MH2 A;  2GTU A;  5ELG A;  3UBK A;  5JWR B;  4HZ2 A;  1HYU A;  4MJE A;  3DVW A;  5ABR A;  3A5I A;  4KCA A;  2L6C A;  4ZIJ A;  2M80 A;  1PX6 A;  3UAR A;  3GH9 A;  5D9T A;  3KH9 A;  1T4Z A;  3MYD A;  2GDR A;  4G0L A;  6GSX A;  1M2D A;  4CY6 A;  4EIP A;  5IQY A;  5IMA A;  2GQL A;  2NVL A;  1B4P A;  5IIZ A;  1BED A;  3TRQ A;  1GTB A;  3TJB A;  1GTA A;  3FZ5 A;  3D4M A;  2VCQ A;  3NOF A;  1FG4 A;  1OC9 B;  4OO5 A;  3LQ7 A;  5DAK A;  4K5S A;  3DWV A;  2GSS A;  1B4Q A;  1O85 A;  4V1A p;  1LU4 A;  3D0Z A;  1U87 A;  3VK9 A;  5D93 A;  4V2L A;  2LJK A;  2C80 A;  1B8X A;  3GSS A;  1EP7 A;  1ZYN A;  1XOB A;  4I6X A;  4PNF A;  4GTU A;  1S3A A;  2CT6 A;  4GSN A;  4WR5 A;  1ZYP A;  4TR1 A;  1TP9 A;  2L5L A;  4XS4 B;  5EY6 A;  1CQG A;  2LV3 A;  4E8E A;  3GIX A;  4Z2U A;  4OFM A;  4EO3 A;  1GUH A;  2LKU A;  4KA0 A;  2DJK A;  1J9B A;  1F3B A;  2F9S A;  4F82 A;  2G2Q A;  1HNA A;  4JBB A;  1Z3E A;  3Q19 A;  4POM A;  5KN1 A;  2J23 A;  4CW9 A;  2DML A;  2AYT A;  1GSS A;  4PQI A;  4TXO A;  3JCM L;  3LW9 A;  5IMC A;  3IDV A;  14GS A;  1XW9 A;  3U5R E;  2BJX A;  2YWO A;  4TR0 A;  2VCW A;  2GST A;  4ILF A;  2FWE A;  2NTO A;  2L4C A;  5J9C A;  1A2M A;  3F6F A;  1B48 A;  5HR1 A;  2LRN A;  2R3X A;  5KOX A;  1FHE A;  2B5Y A;  2GZZ A;  5IMD A;  1PMT A;  3TJG A;  4N11 A;  2YP6 A;  3ERG A;  1OE8 A;  2OA7 A;  2VAF A;  4EIQ A;  10GS A;  3H8Q A;  2K8S A;  3EE2 A;  3MWH A;  2HZE A;  3LSZ A;  1EEJ A;  3CYN A;  1G7O A;  1XZO A;  2L59 A;  2KHP A;  2IN3 A;  1FVK A;  5H5S A;  1GUL A;  2B5E A;  5A4V A;  5L71 A;  1XBS A;  3FW2 A;  3TKS C;  2K6V A;  3WT2 A;  2N5B A;  3EYT A;  3FRC A;  1YY7 A;  2I81 A;  4X0X A;  4ECC A;  3ME7 A;  2F3M A;  1N8J A;  2HE3 A;  2MMA A;  4V2N A;  4WR4 A;  5J4U A;  1V40 A;  5KN0 A;  4I97 A;  4KDY A;  3HVS A;  5A5K A;  4KSM A;  1LJR A;  1DBY A;  1V57 A;  3UAP A;  3VI7 A;  1BQ7 A;  4EE0 A;  1WP0 A;  3QOU A;  2DMM A;  2JZT A;  1EGO A;  2ALB A;  2YV7 A;  4G19 A;  3ZRE A;  4L5L A;  3V1W A;  3M8N A;  3FEU A;  4Z2R A;  3DXB A;  1F37 A;  5D9X A;  5G31 A;  4MCU A;  1FOV A;  4FIW A;  4MJA A;  1X9W B;  4ZXG A;  2K8V A;  1A2J A;  2DJ1 A;  3VFI A;  4BL7 A;  4ML6 A;  1R7H A;  3TKP A;  4RUV A;  3F3Q A;  8GSS A;  3HVV A;  1OVN A;  4XRA A;  2R6K A;  5AGY A;  1O6J A;  5HR0 A;  2O85 A;  2H0G A;  3QAG A;  3KEB A;  3J7Y k;  4L8E A;  1TRS A;  5J5N A;  2H75 A;  4MAB A;  2PBJ A;  5IPG A;  1M2B A;  3QDN A;  2X8G A;  2YN1 A;  2QA2 A;  3APO A;  3TKS E;  4MZW A;  3CSI A;  4GCI A;  4BWQ A;  3VLN A;  1XCC A;  1V2A A;  2H6Z A;  3KMN A;  5A4W A;  5F07 A;  2DIZ A;  3LGC A;  1Y6E A;  2QSI A;  5EPF A;  3UIW A;  3H4K A;  2X99 A;  4GST A;  5G30 A;  1PN0 A;  1EOH A;  1PQN A;  2C0E A;  4J2F A;  2YNX A;  5IO2 A;  5DCG A;  3KJY A;  5FHI A;  2H71 A;  3E3E A;  3IK9 A;  2V32 A;  3EMX A;  1OC8 A;  3UBL A;  1PRX A;  1FB6 A;  4WBJ A;  5EL8 A;  5ID2 A;  4RQX A;  1ACV A;  4KUN A;  1M0U A;  2FA8 A;  4IN0 A;  1SKR B;  5COH A;  1GP1 A;  4YQU A;  3DYR A;  3O76 A;  4EDZ A;  4TXV A;  3RAZ A;  2L6D A;  2CVK A;  2TRC P;  3ZLP A;  2VCT A;  2DJJ A;  3KMO A;  2IME A;  1YQ1 A;  4POL A;  3KTL A;  2L5O A;  1E2Y A;  4CDO A;  2E7P A;  3ZL5 A;  2CV4 A;  5IMZ A;  4TXO B;  4O5U A;  1THX A;  5D9V A;  2HRF A;  4L5O A;  1SKW B;  4OWY A;  1Q4J A;  1O7U A;  4MK3 A;  4BVY A;  5KN3 A;  3D5J A;  4O5Q A;  2VCV A;  3IHG A;  1TK8 B;  5B8B A;  3TB2 A;  1TDI A;  3TOU A;  2QGV A;  1WPI A;  3I43 A;  3GTU A;  4KF9 A;  4XCS A;  2H6Y A;  1TTZ A;  4KB3 A;  2LRC A;  3ME8 A;  3Q6O A;  3VUR A;  1F3A A;  1OAZ A;  1KNG A;  3GNJ A;  4GQC A;  3GUR A;  4I2T A;  1JLV A;  3P2A A;  1KTE A;  4WET A;  1T1V A;  5G5E A;  2V6K A;  4MA9 A;  1GTU A;  4WEY A;  5F0G A;  2VL2 A;  4F0B A;  1K3L A;  2WJU A;  2C1Y A;  2JSZ A;  2WZ9 A;  5AIV A;  4AGS A;  1MD4 A;  2RLI A;  4PNG A;  3O3T A;  3GX8 A;  1VF4 A;  1GNE A;  4FYU A;  3KTB A;  4K2X A;  4HZ4 A;  1VGL A;  1H4O A;  2I1U A;  4MH3 A;  3L9U A;  1BJX A;  1G7E A;  1SJZ A;  2PVQ A;  2YZH A;  1Z7P A;  2VCX A;  4ZIL A;  5ECO B;  2HLS A;  3IBH A;  2C3Q A;  2LNS A;  1ZCP A;  2YWN A;  3M1G A;  4EUY A;  1GNW A;  1K0N A;  2M72 A;  4G9H A;  3ZIT A;  2DJ3 A;  3UVH A;  3FR6 A;  4MJB A;  1K0O A;  4BL7 B;  2GGT A;  4G10 A;  4IQA A;  3GKN A;  4MF6 A;  3W6G A;  4V2M A;  1I5G A;  1V98 A;  2VOC A;  4QQ7 A;  3ZTL A;  2XPE A;  4MF7 A;  4OO4 A;  1SD9 A;  5G5F A;  3D4T A;  3MDK A;  4IKH A;  1ST9 A;  2H0I A;  5GZZ B;  4OCE A;  1KEB A;  4J56 E;  4ECJ A;  3F6D A;  1QQ2 A;  5ENU A;  1TRV A;  3KM6 A;  5AIX A;  3L9V A;  3GN3 A;  3ISO A;  3MAK A;  5JCW A;  1Z5Y E;  3LYP A;  3F3R A;  3C73 A;  1URM A;  4K7O A;  2MMZ A;  2KUC A;  1GLQ A;  3CTG A;  4HJM A;  2LJA A;  2RUF A;  4EXJ A;  3HA9 A;  4KAE A;  2PWJ A;  2R0G A;  2YZU A;  3N9J A;  4BVX A;  5CP1 A;  3GMF A;  3ZRD A;  2CQ9 A;  1K3Y A;  3QR6 A;  6GSY A;  5F06 A;  1J0F A;  2PUK C;  4IP6 A;  4EVM A;  5ECL B;  4MP4 A;  2GZP A;  3TCO A;  2ZCT A;  4HQZ A;  1TOF A;  1JHB A;  1A8Y A;  2UZ8 A;  2X4A A;  1SL0 B;  2JZR A;  5CNW A;  4D73 B;  1FAA A;  5ECQ B;  1NM3 A;  2O87 A;  3SWL A;  3UEM A;  2C3N A;  3HY2 A;  2MMO A;  4F0C A;  2P5R A;  3FK8 A;  1DE1 A;  2IMK A;  1TU8 A;  4IVF A;  1W4V A;  4MPG A;  1WMJ A;  1AQX A;  2FLS A;  4QL7 A;  1MDK A;  5ELA A;  2VLU A;  2A2R A;  2H8L A;  3PIN A;  2XHF A;  2NBS A;  1AUC A;  2HXK A;  1Y25 A;  5F8B A;  4X43 A;  2XBI A;  1XVQ A;  2FCH A;  1HQO A;  1Z9H A;  1ERU A;  4BVY B;  2LNT A;  4EL1 A;  5HQP A;  3A5W A;  5ECI B;  1TRW A;  3DEX A;  2QKE A;  3HJO A;  1XWC A;  2DJ0 A;  4QL9 A;  3QFB C;  1X9S B;  4PQ1 A;  1XWG A;  2N5F A;  3GKX A;  1K0B A;  3BD2 A;  3GTU B;  4PXO A;  5CRG A;  1SK2 A;  3F0I A;  3EPT A;  2I4A A;  1ABA A;  1OKD A;  4O5R A;  1I9D A;  2P31 A;  6GST A;  2VO4 A;  3VPQ A;  3ZML A;  5DCH A;  1JZO A;  3QFA C;  5GSS A;  2CZ2 A;  3G9B A;  5DAL B;  1ILO A;  1QK8 A;  3HZ8 A;  4DEJ A;  5LNK e;  1QFN A;  6GSS A;  5BMU A;  4L0U A;  2WDU A;  2H72 A;  3D6I A;  4Q5Q A;  4FYC A;  1GSF A;  3GH6 A;  2HSM A;  5GAP D;  3LOR A;  2VL2 C;  2K18 A;  1F9M A;  2PU9 C;  1A8L A;  4Q5N A;  2MBT A;  2OBI A;  5KOW A;  2RII A;  3DVX A;  3GX0 A;  4PGT A;  4YKG A;  1U88 A;  4AF2 A;  1UA5 A;  2H30 A;  1GUK A;  1ZYE A;  1AW9 A;  4F9Z A;  2FNO A;  3FMW A;  1BYE A;  3LYK A;  3LEF A;  4E8H A;  4IJ3 A;  1XVW A;  4DSS B;  3ERW A;  4N30 A;  4OCF A;  2FY6 A;  5G2Z A;  3M9K A;  4JZQ A;  3HHV A;  5DBQ A;  3MIX A;  3PGT A;  1A0F A;  2VLV A;  4ECI A;  4LLR A;  5HFK A;  1AQV A;  3FKF A;  4OFN A;  4NWY A;  4O7H A;  1PL1 A;  2OE1 A;  4GF0 A;  1JLW A;  3HZ4 A;  2VM1 A;  11GS A;  5B6N A;  2H73 A;  2X49 A;  1X0R A;  2PGT A;  1OC3 A;  2RM6 A;  1R5P A;  5DJL A;  1B9X C;  1FW1 A;  2JAD A;  3FZA A;  2A4H A;  5D96 A;  2KLX A;  6GSV A;  2KP2 A;  2C3T A;  5DJM A;  2YPM A;  5J9B A;  3W8J A;  2FGX A;  3TGZ A;  1R4W A;  4DSQ A;  4MNN A;  16GS A;  5LD0 A;  3P8W A;  2GVP A;  2FA4 A;  3LJR A;  4WXT A;  1TK0 B;  2M46 A;  2H1B A;  3IAS 2;  3GHA A;  1G6W A;  1WRY A;  3HCZ A;  4XIH A;  2C0F A;  3FR9 A;  2XC2 A;  2JZS A;  1DUG A;  1B9Y C;  1VF2 A;  4MLY A;  3F4S A;  3WGE A;  4PQH A;  1PSQ A;  1PN9 A;  4IJI A;  1SYR A;  4LL4 B;  5CRE A;  1PA3 A;  3QPM A;  5HFI A;  1TKD B;  4LL1 B;  4ECB A;  5AIS A;  3IE3 A;  1DSB A;  4BVX B;  2IFQ A;  2MZC A;  2LQO A;  2IIY A;  4BWS A;  4X4J A;  2R4V A;  2HZF A;  3CRU A;  1M9B A;  4NPB A;  3CTF A;  1PX7 A;  3FHK A;  2IMF A;  3QMX A;  2AUV A;  1A0R P;  5IO0 A;  2O7K A;  2H01 A;  2HFD A;  3RHB A;  1JZW A;  3ZMK A;  4ZBB A;  4ICY A;  4Q5F A;  5DAK B;  4A5P A;  2HSH A;  4G0K A;  1QUW A;  3IHQ A;  4JRR A;  3IPZ A;  3VPT A;  2C0G A;  3KP9 A;  2PN8 A;  1WJK A;  2DLX A;  1AQW A;  18GS A;  3KD0 A;  4G2E A;  13GS A;  2F8A A;  2RUE A;  3HJM A;  2VUP A;  2GSQ A;  2OKA A;  5DDL A;  3Q18 A;  1U3A A;  4TR1 B;  1NHY A;  4ZL8 A;  4GWR A;  3APS A;  2V2G A;  2FD3 A;  4POB A;  4ACS A;  1MEK A;  3VWU A;  5LCZ A;  1SJ6 A;  1XWA A;  2MYG A;  1FVJ A;  2BMX A;  1Q98 A;  1ON4 A;  1V58 A;  2B6M A;  4O32 A;  2CAI A;  3BBY A;  1SKS B;  4IHU A;  1RK4 A;  2IMD A;  5ECP B;  2OBK A;  2E2M A;  4IQ1 A;  3WGD A;  1JZD A;  3CSH A;  1GUM A;  1T00 A;  3KIJ A;  4K1F A;  1XW5 A;  4RQR A;  5H5R A;  4ZBA A;  4L0W A;  5IMF A;  2CA8 A;  1R5A A;  3UMA A;  2NDO A;  2G0F A;  2HNL A;  4P3Y B;  2DC5 A;  5EVO A;  3HVX A;  4LMV A;  2WRT A;  1CQH A;  2LQQ A;  4KND A;  3H93 A;  4EF0 A;  6GSW A;  4JED A;  5DQY A;  2DJ2 A;  1HNC A;  4TR4 A;  1C72 A;  2JU5 A;  3ED3 A;  12GS A;  1SL2 B;  2F8F A;  5ECS A;  2GS3 A;  4PUF C;  2LS5 A;  1JFU A;  5JCU A;  3FY7 A;  4NV2 A;  5IOX A;  2ZUP A;  1PKW A;  2HZE B;  3GL3 A;  2PVO C;  1AAZ A;  4I2U A;  5ECK B;  4ZB8 A;  1M7T A;  2GQK A;  5INY A;  3TKQ A;  4YH2 A;  2OJL A;  9GSS A;  1YF0 A;  4YKF A;  1TU7 A;  2LRT A;  3TKR A;  1K0M A;  1PL2 A;  4XRD A;  2YV9 A;  3E9J B;  1XIY A;  4KGI A;  4JR6 A;  1GSD A;  1TRU A;  2L57 A;  2B1L A;  1T8E B;  4GLT A;  1PGT A;  1NW2 A;  4GQF A;  1HNB A;  3KP8 A;  1HD2 A;  3L9S A;  4V1A g;  5HR3 A;  4FH8 A;  2X64 A;  5B6M A;  4H86 A;  3C1S A;  1NHO A;  1GL8 A;  4HU9 A;  5CRD A;  2OE0 A;  3LFL A;  1IYI A;  3KXO A;  2CX4 A;  19GS A;  4MZB A;  1XWB A;  4EDY A;  4KE3 A;  4HJ2 A;  4WKW A;  1G0T A;  1EWX A;  2IWT A;  3GKK A;  1SK0 A;  3G7I A;  1S3C A;  2H1D A;  2GT6 A;  5DVB A;  3ERF A;  1T4Y A;  2XBQ A;  3VWX A;  4BPY A;  3UL3 A;  5JWQ B;  2TRX A;  4JE1 A;  2O89 A;  1O81 A;  1OYJ A;  2YJH A;  4TOP A;  3ZYW A;  7GSS A;  4K8M A;  1ERW A;  4ZL9 A;  1O8W A;  1XPV A;  1SYX A;  1FO5 A;  4N0Z A;  2CX3 A;  4MJC A;  2A4V A;  3BCI A;  2X8C A;  2WFC A;  4Q5R A;  3EU3 A;  3F9U A;  2PMT A;  1WIK A;  2HRK A;  2R2J A;  2GSR A;  3WYW A;  5FT3 A;  1DE2 A;  3MNG A;  4K5R A;  3L0H A;  4O92 A;  4TRX A;  3CRT A;  3A2W A;  1X5E A;  1YZX A;  2QA1 A;  3HJP A;  1U3I A;  2Z9S A;  2R0P A;  1EP8 A;  3FZ9 A;  5D73 A;  5KEJ A;  5FWG A;  1EZK A;  3CBU A;  4YQM A;  3F4R A;  1IYH A;  5ECH B;  2O8V B;  4HS1 A;  1ZZY A;  2DKI A;  2R37 A;  1EOG A;  4IP1 A;  3IR4 A;  1WE0 A;  4I8B A;  4NHZ A;  2VL3 A;  4ML1 A;  2C0D A;  5ID2 B;  2GLR A;  4ZB9 A;  2WUL A;  2LJR A;  2VD0 A;  3QAV A;  2B1K A;  3TRX A;  5ECM B;  3IV4 A;  5IM9 A;  1QMV A;  1F2E A;  4FYB A;  5E4W A;  3IAM 2;  3NIV A;  5JWO B;  2GT5 A;  1Z6N A;  3WGX A;  2I9H A;  5DQS A;  1O8X A;  2B3S A;  3ZIJ A;  3P7X A;  3ZIV A;  2B5X A;  2AHE A;  4KH7 A;  2MBS A;  4ID0 A;  2E2G A;  5C00 A;  5F05 A;  17GS A;  1GH2 A;  1XFL A;  2JL4 A;  5CYY A;  1S3D A;  2H1G A;  3DML A;  3EMP A;  3H79 A;  5JCG A;  3ZFB A;  2OAC A;  4YAP A;  1XWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...