3WGGA

Crystal structure of rsp in complex with alpha-nad+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding mode of the oxidized alpha-anomer of NAD(+) to RSP, a Rex-family repressor
pubmed doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 71
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wggA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wggA02
3R0AA 1JXSA 1HRDA 3KSDO 4OXYA 4GLLA 4CLHA 1S29A 1BIBA 1I2ZA 5JE8A 5IZCA 4FBGA 3EAGA 1IXCA 3TPCA 4ENMA 1K5HA 5U1PA 2OP1A 1EV7A 4I9NA 1FX7A 2GDZA 1VKOA 2E49A 4FW8A 4O59O 4UEJA 2O3TA 4XIYA 1ZJZA 4IXAA 4WX9A 3GW2A 2C6YA 3ROPA 3A4VA 1LDGA 2FSVA 3MZHA 1R37A 1K89A 2YV3A 3D7LA 3I6QA 4KTVE 4OGWA 4LN1A 4KWHA 2FNPA 1VTNC 1IHXA 4IRHA 1WNTA 2I3AA 2WDZA 3Q9UA 1SO8A 3B1JA 4J1SA 1LDMA 1Y8QA 4A5NA 1IUYA 4FJ2A 4KA4A 2F5DA 1E1LA 3BJAA 1QRRA 2EFNA 4BAYA 3I23A 3KP4A 3RU9A 1KA8A 1TBXA 2G7UA 5AYVA 3I1JA 4ND1A 3TL3A 4WCFC 3ZNNA 4BUCA 2OORA 3KYCA 4O0LA 4Z2YA 2PZJA 2WV0A 4A5OA 1U5CA 5HS6A 5AXAA 2BEOA 2RDPA 3MAJA 1IRGA 1S6YA 2IYPA 2WYVA 3DBHA 2C59A 4CMJA 4D43A 1ZRFA 1R0SA 4YRAA 3DFUA 1EBFA 1ODDA 3MWEB 1XLTA 4WLFA 3RUCA 3WOHA 4HOBA 3SFZA 3I59A 4U0YA 3DZFA 2P4WA 1DC5A 5E20A 3IQDB 4Z3DA 1LQ1A 3OH8A 4QECA 4DQUA 4A0XA 3REOA 2FMUA 4DA9A 4QUKA 5DDGA 5JCJD 3WLFA 3HRTA 3SJUA 1X13A 3AJRA 4RO0A 4CODB 5L4NA 4CM8B 3ZWWA 5A2QZ 1BBYA 1NHGA 1YBVA 2A9FA 5LEKA 1MD0A 2QM3A 3ZN0A 1HDZA 2IXBA 2Y93A 3INRA 5GY7A 3DZJA 4NBWA 4YCAA 4J1NA 2RHCA 4K6FA 4CMEA 4E3ZA 3IUPA 1Q2XA 2HDCA 2RQPA 3I71A 2X0RA 1ZSYA 4XA8A 3WNVA 3B73A 1QYWA 2Q46A 2RHRA 4DXHA 3PDUA 1PDNC 1K6JA 2A69F 1I1SA 1VKNA 4L9RA 2IJLA 1PZFA 2D8AA 4KUHA 1Q7CA 4HDUA 4M49A 3IKTA 1AWCA 2R00C 1EH6A 4M6XA 1ISFA 1P74A 1ZIDA 3S2FA 2FZEA 5ER9A 4NHEA 3GHYA 3B1FA 3AAFA 5CPBA 2NYXA 3DZGA 3NTRA 4PG8A 2IPQX 1MGOA 4JK1X 3RPQA 1VL8A 1FC3A 1H9BA 2DPHA 2EHDA 2P2SA 3DTYA 3F5QA 5TT1A 2NTVA 3TO6A 4B79A 4L0ZB 4BS9A 3K6JA 2YFQA 2HDHA 2GERA 2ZJ1A 4RCVA 4JIGA 3L6DA 1E5QA 4EJMA 1I2BA 3F22A 2PH3A 4WXCA 3ETDA 4BNKA 4R8HA 3BTSA 5ITVA 1TQIA 2RVCA 4GLOA 1O95A 3VODA 1H94A 1TXGA 4PCVA 1EUDA 1IAWA 1NPYA 4MINA 3RFTA 2EKLA 1OC4A 3HB4X 5L3DA 1QZZA 1BDBA 1EQ2A 1OMIA 1GADO 2C2XA 4K28A 3S2EA 3VHRA 4PLFA 2NQ8A 1EUZA 2X58A 1T6SA 2WTEA 1BMDA 3T1BA 3DMTA 4IGFA 1P2FA 1HE2A 4DPMA 1KVUA 5A5FA 3AI3A 4EZBA 1GXPA 3DBVO 1B16A 1RNLA 3HE3A 3D1LA 5KOIA 4XSZF 3ETGA 4AJNA 1WDKA 4JJIA 2X0NA 1J4AA 2IZ1A 4L18B 3ZMUA 2NV6A 2J3KA 3GUDA 2QX7A 3QPTA 5IT3A 1X15A 3WTTC 1PUEE 1DAPA 2X0IA 4Y6RA 3ASUA 1F14A 5CDUA 3I0TA 3NRVA 2JSCA 3EQLF 1GHCA 4MQ9F 5ILGA 2EV9A 1U2GA 3NTOA 4NBRA 5ICMA 1DFHA 3KYDA 4MIOA 3LFKA 2ET6A 1GYRA 1O7FA 2CWEA 2IZ0A 2JZYA 3PYXA 1YRLA 4XQEA 2ISZA 4QEDA 1IN6A 4MHGA 5ILVA 1HZZA 2C5AA 3V7CA 3AOEA 3ZDFA 2GZ2A 4RQTA 4BNLA 4C4OA 1ULSA 5J23A 3H7AA 1WDMA 2VBYA 1JLLA 1K6OA 2AQ8A 2JAPA 5DDIP 1KEPA 2AQIA 1U2DA 3MCVA 1FWZA 4M9ZA 4INAA 1FPQA 4R1HA 3BIOA 1X7DA 3OMLA 4CLOB 1YFHA 5JAMA 2HMWA 4IXWA 4ALKA 4TZTA 5ENVA 1K79A 2BI7A 4BB5A 1BW9B 4M71A 4CV1A 4XQGA 1P1JA 1DOHA 3PGJA 5CDTA 3RUDA 5DUIA 1VI2A 2F1KA 5LRRA 4Q48A 1U3WA 1EH8A 4XRFA 2A07F 1ULUA 4L76A 2HRBA 4OQZA 5DN9A 2YY7A 3U49A 1DFIA 5LGNA 3G73A 2V1UA 1G0NA 1UB9A 1OAAA 2XXJA 3D3WA 2M45A 1UZNA 2RH4A 3CUKA 1W5SA 5EQDA 5F5NA 4FX0A 1I5RA 4J43A 5CAEA 2VBXA 4QTZA 3SC6A 5CG2A 4FHTA 4U0JA 5CDGA 1Y9AA 2AE2A 1WI9A 5F21A 1O89A 2CFCA 1U2WA 4Y13A 1QR6A 4R1UA 3T8TA 2VTEA 4XYMA 4MP3A 4IJVA 2VZ8A 4E5PA 1LTHR 4WCDA 1X7HA 2CZCA 5CVUA 2OQGA 2GN6A 4YJGA 5G4KB 2QQ9A 1GQYA 4B3HA 3ORFA 2OHXA 3ZV4A 2EERA 5JO9A 4HBLA 5E8IA 3HSEA 2I9PA 5L3FA 4D46A 2ZCVA 5DNAA 5JAIA 4FJ1A 4LD5A 3BTOA 5COQA 4EUFA 5DOZA 1CQJA 5JFOA 3F5SA 4NDNE 5E18F 4IHSA 5KVQA 5A1TA 1NAHA 2DU9A 4HA8A 4E21A 4E2WA 1UP6A 4CM9A 3TL2A 4M1QA 4I7HA 3T4XA 4R41A 4BB6A 3DP7A 2Y0CA 2BHLA 1BTOA 3M9AA 1NXQA 4GWKA 1PJLA 3MZYA 3TO7A 3GFGA 2X5KO 4BQRA 3ONDA 1CQIA 3KYDB 4CMIB 5JLAA 3TDZC 5IG2A 1JA9A 2ESHA 3C1DA 1ZNQO 3ZWPA 4BNYA 5B12A 3VH4A 5K5OA 4CMBA 1W4MA 1XGOA 5HOOA 3CUQB 3J81Z 1ZN2A 3HDQA 3DZIA 4IDGA 5GZ3A 1YQXA 2PK3A 2QIOA 4F45A 3FNHA 5CEJA 3PZRA 1B8PA 5FI3A 4J1TA 1KETA 3RUIA 3MJSA 3PYMA 5JC8A 3VZSA 3D5LA 3I53A 3H2ZA 3F8CA 3WSVA 1Z7UA 5J8FA 3KOUA 4I5FA 5AONA 2YDYA 1HE5A 3EC7A 3LLVA 3E6BA 1IPEA 2BH9A 3NEUA 3NAQA 2EV0A 4LGVA 4L9TA 2OU2A 2UXNA 4CM6A 5CDSA 1X1TA 1GR0A 1MDMB 2DTRA 4I9HA 2CDBA 2P7VB 1FDVA 4MIYA 1SOVA 2CVOA 5F6FA 3TDUC 1U8XX 1X7GA 2O2SA 3C1OA 3RC7A 3C18A 5TJJA 1ZSNA 3D3WB 4NH4A 2ILTA 3AM4A 2PQ8A 3DTTA 3MJCA 2G17A 5KWEA 4DQXA 4UUVA 3WFJA 3I54A 3IS3A 3RIHA 3FXUA 2PFGA 1DRUA 3S2GA 3QOPA 2O48X 1E6UA 4NI5A 4L9JA 4ESBA 4PVCA 3TOXA 3W6JB 4HKTA 4CLXA 3WG9A 1IB6A 3SJ7A 4S04A 2O3SA 3DQPA 2H5LA 4R1SA 4GGOA 2DW4A 1B6AA 3BZUA 4J6FA 3DOCA 5JHUA 4OAQA 1FLIA 3CTMA 3EYWA 3WE2A 1UP7A 4H16A 3TZ6A 4L0YB 2A3SA 1S7AA 1SFXA 2PD6A 4WLNA 5A5EA 1Q1NA 1ZK0A 3MEQA 4XLPF 1BI0A 3JAMZ 1SMYF 1QV6A 4LGWA 3MJVA 3Q2KA 4HWKA 5K6AC 1T98A 3ZHYA 1O9BA 1PL7A 3JSAA 4EITA 4KUEA 3PPIA 2WTBA 4MPDA 2GRAA 2YHIA 2PH5A 3WX0A 3P9KA 1GU7A 2D2IA 1HE4A 3W8FA 1E1NA 3AFMA 1OMOA 1ZK4A 1ZREA 3ONFA 1ENOA 1RPNA 1T4DA 4UEOA 2QQBA 4MVJE 4CMIA 1GTMA 1WXDA 2BGLA 2H1SA 3FM3A 3G3EA 3WWYA 1ZHFA 4MNUA 1E1KA 2DI3A 2WC2A 3K73O 4ZYGA 1LJ9A 4E31A 2VTDA 3ZP5A 4WPGA 4B3IA 4YT8A 2VT3A 5ER6A 3GN2A 3I5UA 2QUFA 3ZWNA 1LSJA 4E5YA 8ADHA 5GZ1A 2O3FA 5EQFA 1YYVA 3JSOA 3IP3A 4KDEA 5C3MA 4CM9D 2DPDA 3CKYA 1TA4A 4GX2A 3RTRA 1DC6A 4L8VA 4ZJUA 1O7LA 5L7YA 3GZ4A 1SFEA 1LJ8A 1J75A 1O3SA 1I24A 2BMAA 5G0VA 1YL5A 1K3TA 4UNOA 2XAGA 2MLGA 3LU1A 2NU8A 5L3GA 4BMNA 3LT4A 4IMPA 3C7AA 4AJEA 3KLOA 1XELA 4HLYA 2ZQYA 5LDGA 4JBAA 3JQBA 1Y8RA 4WCFB 1KQ9A 3KEOA 3U4HA 1M75A 4E6PA 1LSOA 4YEDA 4Z9XA 3Q9SA 1EVJA 4Z6KA 3IJPA 4NJMB 4GGPA 3T7CA 1I36A 1MJ9A 4XSXF 3R6SA 3ZMVA 4WXHA 2KJCA 1KY4A 2PMUA 5G2OA 2DTDA 3QA9A 4OKNA 2XAFA 1Q7GA 4HP8A 4TQGA 1XGNA 1DJQA 3FWNA 3ZWBA 2QRKA 1XCVA 2MH2A 1HYEA 3E18A 4CQLB 2D0IA 2YV1A 1IULA 4RF4A 5HBRA 3IHUA 3E6AA 3H5AA 1BOAA 3NV9A 1X0VA 3O38A 3UF0A 4BKOA 2DT5A 1V3UA 4YFNF 2YHIB 4XGIA 4J1QA 3FF5A 4OIRF 3KZVA 4HV4A 2ZTMA 4GAEA 1G3YA 2L01A 1Q1HA 3V7RA 1CDOA 2HMUA 2AW5A 4JGBA 4LSMA 3WDSA 4RZIA 3TSCA 4Q3DA 3MOGA 3GY0A 5F3RA 2RH8A 1FBSA 4IZHA 2BF7A 3LT0A 1QV7A 2FOIA 2J3IA 2FPGA 1A7AA 3CZMA 5THKA 4R69A 2OFPA 3LK7A 1QBJA 2Q3EA 1K0UA 2FRDA 5TGDA 5F1RA 3H3FA 3QWAA 1UJMA 1C1XA 1M67A 2V6FA 4WLUA 3VDQA 3WNQA 3ETEA 4L0QA 1ZG3A 2WMDA 3AY3A 2QQAA 3QV1A 3PZBA 5K0ZA 1B7GO 4DQ2A 1BC7C 2UVDA 4D0PA 5L53A 3D4OA 4KQXA 4J9UE 4ND4A 3VTZA 3UAGA 1H9GA 4HFMA 2E48A 2WE8A 3QVSA 2ZKLA 3WTSC 1JN0A 1E3LA 4LK3A 5TQVA 4G6DA 1Z6RA 1V0JA 5T64A 4P9UA 4QO7A 1TW3A 1NVTA 1IRFA 4AJLA 1ZK1A 1H6AA 1OR7A 3ZQ7A 2HSDA 3JQGB 4LG0A 3F1LA 2K27A 1EMDA 2V6BA 3ABUA 1KS9A 4XEHA 4RLSA 1NVGA 4WASA 2PG4A 4KUMA 3QY9A 1LDDA 1ORRA 3UFXA 2RNJA 3U5TA 2QYOA 1AGNA 2OGUA 2VODA 2H09A 3RASA 1PGPA 2ZYAA 3SHFA 3E3VA 3RBVA 3VPHA 4D79A 5A03A 3PQKA 4O5OA 3L77A 4B4OA 3ADOA 4N5NA 5CG1A 2EV6A 3KFWX 1IZ0A 2D3TA 4HFNA 3L2CA 1S8NA 4YIIA 2OQRA 3DBLB 2HQRA 4W7IA 5KIAA 5A3VA 1DC4A 1JVSA 2J5PA 1LRJA 4XYBA 4AIKA 3AFNA 3KUXA 2H94A 1SD7A 4N5LA 1Z05A 1JU9A 1KGSA 1HBXG 1XKQA 3PFFA 1JKIA 5H83A 4ZQHA 3F72A 4HV6A 2TMGA 4B3JA 3GZNB 2EJRA 1AE1A 2VHXA 1ZG5A 4MVJH 3DBRA 2V9VA 5BT9A 5BSHA 2VRCD 2DFDA 4MDHA 1DFGA 3FNFA 1B14A 4MP8A 3AOEC 3IDSA 1KEUA 3HUGA 1A9YA 4FGWA 2H6CA 2NWQA 1YJQA 3CINA 4WLOA 5KJEA 3QPHA 4CPDA 2J8ZA 4PLCA 3WQRA 3ZMSA 3DF8A 1I2CA 4ESJA 2YQ4A 3DV8A 2JD0A 4D0RA 1ENPA 2P5UA 1FBQA 5EJ2A 2R3SA 4BO7A 4LCEA 1XDWA 4MKZA 4QO8A 3QP9A 4XYEA 4IJUA 2M30A 1H6DA 1WLYA 5H20A 4L4SA 1B3RA 3FR7A 5GZ6A 4U0KA 1K78B 2WYWA 3QVWA 1VJTA 2OBYA 3FHLA 1UZLA 3EZYA 1TLTA 1IXRC 1E92A 1JKFA 1GY8A 3FPCA 4R9RA 1XN7A 1PEDA 5AVOA 4RB3C 1F1ZA 2PZKA 1MG0A 2DPGA 1Y6JA 5CLSA 2HJRA 3W8DA 4ILKA 3R3SA 4OO3A 3P9IA 5FD6A 2ZFWA 2X7HA 1F0YA 5A2QK 1ZMOA 2JJYA 3IAHA 2LKPA 5D5VB 4Q5SF 4ZU3A 3SLKA 2R2GA 3H3JA 4LG0B 5MGBA 2A68F 4CQMB 1LNQA 5I7EA 3OFSA 1YE3A 4KN7X 4J91A 3MFKA 4XLNF 5CVVA 2BI8A 3OQ1A 4WF2A 1K6XA 5ITWA 3GLXA 4OIOF 5JYDA 4U7DA 4WXDA 2VHWA 4M6YA 5IXYA 3LA3A 1XHLA 5T8KC 2BRUA 3ZV3A 1SAXA 1MP0A 1EUCA 4R1TA 4NK5A 3ABTA 2OD5A 4DRYA 4DC1A 4DLAA 4OINF 4JN6B 4M73A 5BNTA 1ZRCA 5AIPA 2ZCWA 3M1LA 5ILOA 4RVDA 1T2FA 2BFPA 5JDCC 2AEJA 4D3DA 4E2YA 3SZTA 1STZA 2JPBA 1V8BA 4WK6A 4ALMA 2O3UA 2HLPA 3IP1A 1MKMA 3ZMZA 3GAZA 3HUDA 3QP6A 1I33A 1I0ZA 1NNUA 2RAFA 4L74A 4D44A 2IYOA 2CO5A 1GUFA 2PD3A 3RYPA 2V6MA 3K92A 2DVMA 4PCQA 4DBVO 4YT5A 1SD4A 1QYXA 1PGQA 3HN7A 3HSKA 2Z9OA 2Q4EA 2EFOA 3KE2A 3GDOA 3NT5A 2CDCA 4FR5A 4Q4ZF 3JD4A 4ZQEA 4MGRA 4HV5A 1GEEA 3IUSA 3O03A 4CR8A 5IF3A 4A5MA 3H9UA 4GVXA 5KNLA 4Q39A 2DBRA 1EEHA 1QKIA 3PYLA 1U8RA 5ICFA 1W73A 1TT7A 2AG5A 4CM4A 2XAJA 3UH1A 1GPJA 4I02A 1GFSA 4P8RA 3WGIA 3W4JA 2BLLA 4G94A 4J49A 4LRTB 4R5HA 5TNXA 3JQ8B 4ALLA 1Y8QB 5HVQC 4GSKA 3B1KA 1MC5A 4DQVA 3OJFA 1U3UA 3FWEA 2QZZA 3AM3A 3CJNA 1YW7A 3WGGA 2O03A 1YWGO 5KVRA 4EEXA 3LSYA 3GO5A 1S7CA 3MZ0A 2OMEA 1PJSA 5CVJA 3JQBC 4QXMA 3HWRA 4GCVA 4RV9A 5HA5A 1MZBA 1JQBA 1Q0HA 3KYCB 2E7WA 1AUPA 3LC1O 3Q1LA 3E5XA 4U0VA 4UULA 1KY5A 5D8KB 5LC1A 4CQMA 1QPMA 1WQ2A 3VFZA 3K1NA 5CVIA 4KNYA 1DIGA 1H2HA 3PJFA 1GL3A 4CM1A 1BI1A 1DB3A 2HOEA 3I59B 2QQ5A 3OIDA 4L4RA 2CUKA 4IMRA 3TKYA 4PG7A 3JQCA 3JSPA 4YAJA 3JTMA 4UXNA 2ZK7A 3M8FA 2BD0A 3PHLA 4WGGA 3PVZA 2HS5A 2XASA 1H6BA 3JYNA 4EJOA 5IZCC 2YSRA 3KP5A 1ZUD1 2DM6A 4UVIA 3ZN1A 1PS9A 5ADHA 1WKMA 2ZJ0A 2R7DA 3EK2A 9LDBA 2UXXA 3TZCA 1P1IA 4YAIA 3DDNA 3H9GA 3QVXA 4YWJA 4L9NA 4YAGA 2M87A 3PHIA 2G5CA 4XWYA 1QYCA 4Z0PA 1T2KA 2NU6A 3GGOA 3J80Z 5DZSA 3F8FA 5K1YA 1C0LA 2Y1DA 3KM0A 4YJHB 4IS3A 3VPXA 5G0WA 4Z3KA 3DHEA 4Q47A 2Q0OA 3GG9A 4CLRA 1ADFA 4L5JA 3ZW9A 1PJQA 3NDRA 3WXBA 1HETA 4WKGA 2LDBA 1YW9A 5CFZA 3O2PE 1O6ZA 2VE9A 2YW9A 1ZGAA 2HFHA 3ON5A 5FFXA 1PR9A 2Y1EA 4B4VA 2B36A 2XAHA 4UVBA 3OM9A 4GX5A 5CP8A 2UYYA 3DC2A 3LT2A 4M89A 2H6BA 1G6KA 1OYYA 3GFLA 3C7CB 1SNYA 3DAGA 3E03A 4RPKA 2VWQA 3WJAA 1W7PB 4LK0F 3KHUA 1C1DB 4OL9A 5DP1A 3ZWMA 3RKWA 1U3EM 4CM4B 1GCOA 3OICA 4ZQBA 2YU3A 3GAFA 5EINA 2EB7A 4F7ZA 2DAOA 4IDDA 5L7TA 3HNPA 4YAEA 5KJ6A 3R6DA 2HKIA 4N0BA 3PXXA 4XGKA 3J81K 3FXRA 2YFHA 2VOEA 1R66A 5L45A 5ICSA 5E1XA 1P1RA 3PHHA 5IAAA 3I3OA 2DAPA 2CG4A 3OJLA 5DCFA 2I66A 4AVPA 1H9AA 1BM9A 2PGDA 4HX4A 1DDNA 1VLLA 1KYQA 3C1TA 3TZKA 4BNTA 2DPUA 4BO8A 1JAYA 1ADGA 4A73A 1BN5A 5DD8A 3OQBA 4PZCA 3DKWA 4L4XA 1ZG1A 3BYZA 5LHGA 4BNMA 1B8UA 2Q50A 3PHJA 4DYDA 3D0SA 4FN4A 4DYVA 1DO8A 3A14A 5BSGA 1P4AA 4CDGA 3RSHA 1R36A 1UFMA 1ZYRF 2V79A 2A61A 3IC5A 8LDHA 3RIRA 2C7VA 4Y9DA 4A12A 1GDHA 1ONPA 2O3JA 4JP3A 1YH3A 2BFMA 2VOJA 2FE3A 3TQNA 1HKQA 3EVTA 4LB6B 1XSDA 4R68A 4WLVA 3TZHA 3UXYA 5LLQA 4BQAA 4ALJA 2BBYA 5CVRA 4EM1A 4CMAA 3HDHA 2W84A 4J2OA 3TWOA 3EVNA 2X86A 4U0WA 4RGRA 1HEUA 2GN9A 4BO4A 4QQRA 4BNGA 1Z6ZA 2VYVA 5DUKA 1LLQA 4CLOA 1WMAA 3IIEA 5IN5A 1YS6A 2AMFA 1BG6A 1NFQA 5HS9A 1GEGA 3JQ9A 4YJHA 4DPLA 3FNGA 1TTYA 3PDJA 4W9NC 4B7UA 1BW9A 4CLRB 1LDYA 1EK6A 1Z73A 4UV8A 1BRMA 3CDHA 1CRWG 4IS2A 4OMUA 4Z0HO 4P38A 4ND3A 1J0XO 1SEVA 2PR2A 5JNLA 2YZ7A 1K6IA 4YA6A 3ADPA 3PIIA 3F6OA 3PFIA 2W8ZA 3K1MA 3V2GA 4CLDA 2JD2A 3S2IA 4RGXA 3RC9A 4FOOA 4I2OA 1EVYA 4W7HA 2FP4A 3SEFA 1W7PA 2MH9A 1XDSA 2QHXA 4RGBA 5L4LA 1EFLA 1J7KA 4ZA2A 4CV3A 3B6ZA 3L0DA 1XEAA 3KO8A 3KEQA 4PFJA 4LLLA 2GN8A 3D5QA 4P4NA 4LMRA 1GVJA 5K5QA 3H4VA 2GYYA 3R3JA 1BHSA 3HDJA 2GZ1A 3NX4A 4JBIA 1QZYA 3E6CC 4FT8A 5BPDA 3O26A 4BNXA 4D41A 2BV6A 3GRKA 4YJGB 5G4KA 3S55A 4RGSA 2VC1A 1SCUA 2B69A 1E0DA 2P9GA 3LDHA 2JFGA 1IN8A 1YL6A 3I4FA 3X2FA 4BNNA 3GEMA 1L0OC 5JYEA 1Z74A 3KXDA 3EHEA 2VOOA 2XROA 2VCYA 4I8XA 4R9SA 4EJVA 6PAXA 1U1IA 2KIFA 3VPGA 1UXIA 3MTGA 5C7IO 2K86A 3V8BA 1D3AA 3HZZA 3WJ7A 1DSSG 3A06A 5GMOA 2HQNA 2WSBA 4E2ZA 1R6DA 2EJWA 4NQWA 1H93A 1YQDA 2R6JA 3JTGA 3AM5A 3RJ9A 2FBHA 2ZTUA 3JD2A 4J90A 3M2PA 2EGGA 4PRKA 1HYHA 2V6CA 4E2XA 1N92A 2BFOA 1DPRA 5FYDA 2O8XA 2TMDA 4D3SA 3ZU3A 4F6CA 2A92A 1M6WA 1GPDG 4EQQA 1WSUA 3C3WA 2Q2VA 4Y98A 4UUOA 3VVCA 4HBGA 5F1PA 4EUEA 5DCUA 3SVTA 1RM0A 1YONA 4LVCA 2IA1A 5TLSA 1IZ9A 1P44A 2FNAA 4TVBA 3CO7C 5TJ9A 5L9AA 1B4AA 1KC1A 3PIDA 5DOVA 3RD5A 3C7DB 2E1CA 2DTXA 4PLGA 3V1YA 4PLPA 4G8XA 1SD6A 4UAGA 2GSDA 1WAMA 3GNTA 5JW6A 1B9NA 4TSKA 1NQTA 5TJHA 3TO9A 1KVTA 3M2TA 2ZTLA 4W9NA 2OOSA 2WM3A 1FNNA 2WWRA 2EA4A 2HZTA 5A9TA 4BGUA 1YGYA 1D4FA 3ST7A 5F64A 4WLEA 1DIRA 2W2LA 3V7SA 1U5TB 1MDMA 1EE2A 1MG5A 5LDHA 2W2KB 1JHHA 2AS5F 3ZZNA 3ZU2A 2F5FA 2FU4A 1RKXA 2EGHA 1G1AA 2CY0A 3DMTC 3UN1A 3I9OA 3KB6A 4ITUA 3EMKA 4JP2A 4XBFA 3PLRA 2QZ9A 2I67A 5I9LA 3EZLA 3GNSA 2VBZA 1RUOA 4IDAA 1H0KA 2IDZA 3BA1A 4B7CA 2XIGA 2KJBA 3B02A 1ZXLA 5U4QA 3E5MA 1PTJA 1UXHA 5KJCA 1T2DA 4GQAA 2VYND 4HW0A 4IY1A 1NR1A 1XA0A 1KU3A 4DLLA 1ZXBA 1Z9CA 2VE8A 3RI3A 2PKRA 3NT4A 3GZ5A 3L6EA 1ZAOA 1R5GA 2CF5A 2RN7A 4Z0TA 3VC7A 5A3JA 3E5QA 1B3BA 1PJBA 3DB2A 4A2CA 3FI9A 5G0UA 3P2OA 4D45A 4EVIA 3COSA 1QGPA 3WTZA 2E1NA 1FF9A 2EEZA 3DQVC 2NVUA 5JMWA 2CNBA 2YHUA 4WEQA 3ZGYA 1YJ8A 3MTJA 3VZPA 4DMLA 2Z1MA 1T0FA 2VUSA 3ISPA 2DKNA 1F4KA 3F3XA 1B1BA 3AUAA 3ENKA 4GH5A 2GO1A 5IZ4A 1R12A 3ITKA 3WGHA 2X9VA 4GX0A 3IL2A 3D4PA 4AJIA 3QWBA 2VONA 3E5UA 5L3CA 2FR1A 3GF4A 2G7HA 1LRLA 4ZQFA 1BI3A 3L09A 1AXGA 2O23A 4LW8A 4HFRA 4BGVA 4PLZA 2VHZA 2HWVA 1R0LA 1EBUA 3AOGA 1QYVA 1UR5A 1A04A 3FF4A 3WMXA 4ZRNA 4I0AA 3MOIA 4OQYA 1PGOA 2DQRA 4FOSA 4J7XA 3HHPA 3H3UA 4WOJA 3ZNOA 1A27A 4YXFA 5HRUA 1U4SA 4RVGA 3RJ5A 4DBZA 4OM8A 4YQYA 3A28A 1GYPA 4MVJP 3WGTA 1XMKA 1CF2O 3OA2A 1LDKB 1DLIA 3HFGA 4WCGA 3FCOA 1T2EA 2P8TA 3GLQA 2A6EF 4MOWA 2QRJA 3GK3A 4RLHA 4YYZA 2NSDA 1D5VA 1EVZA 3PI7A 5BPIA 1ZW1A 2X8LA 2P4QA 3F4BA 4GMFA 4N18A 5A4DA 4YJFB 5HS7A 2IVMA 4FX4A 1LC3A 2W2KA 1Z1DA 2A5YB 3FPLA 3WIDA 4BVAA 2AHRA 3F46A 3TOAA 1NTOA 5DBIA 1VRWA 1T2AA 1SBYA 2Y75A 5TIIA 4IPAA 4TROA 3WBBA 1Y8RB 4KWIA 4MVJI 4K2EA 2W2LD 3KP6A 4HF2A 2Y48A 3GT0A 4JQCA 5I8ZA 1E3EA 4KIGA 1RM5A 5ERIA 1I3LA 2AE1A 1OYWA 3KSUA 2FXAA 3OQ6A 4MEYF 2Y67A 4GI2A 3DPTA 4NJMA 4U8GA 3TOZA 1RM4A 2PKQP 3KP2A 1OC2A 2UDPA 2ACJA 3OF2A 4CO8A 4RS8A 3QHAA 3KYBA 4NIMA 4KP7A 3ZMDA 2GAUA 4UVHA 4JCOA 1R00A 3OHSX 1J59A 1W4ZA 1USSA 4BL5A 3J7AO 4EYEA 2CVQA 4BO3A 4D0SA 2HR3A 3JD3A 4PGFA 4BNVA 3ZU4A 1FYKA 2EK5A 5C7OO 3UUWA 3I9NA 4PLWA 5TSDA 3R60A 3FRJA 1FDSA 3GVIA 2M5WA 5ILSA 1WWXA 3HRSA 4FFRA 2O50A 3JYLA 3V2HA 5F1KA 3ANMA 1JGSA 3AU9A 3ROKA 1GZ6A 2PMHA 4B09A 1IOLA 1DUXC 2O4UX 1U4OA 2PWZA 4G6QA 2VWGA 2ZB8A 3D0OA 5HM8A 1L3LA 2NTJA 3EW7A 1PJ2A 3T5XA 3U1DA 4H15A 2V65A 1XMAA 3QE3A 5HTOA 2VN8A 1R0KA 3ZHXA 3UW3A 1E17A 4AJ4A 5A05A 4XDYA 2VOPA 1P1HA 2CMDA 5D6FA 2VRCA 5LBQA 3GEDA 4J7UA 4N54A 5F1OA 3STHA 4HX5A 5FB2A 4ZHSA 2MA3A 5ILUA 3BMCA 3GPIA 2PJPA 3ZH2A 5HLIA 1TNSA 1BIAA 3O6BB 5DEQA 2J6IA 1LEHA 5D4RA 3GN1A 4KIBA 2V1XA 4EEZA 1KYZA 5JXWA 4CGZA 3TRIA 4GGGA 3ZWXA 3ZMTA 5IT9Z 3F8NA 3DHNA 4O5VA 1LXCA 1MB4A 4O1MA 4XJTA 2LSOA 4GBJA 5EMHA 2NNYA 2XPCA 4E32A 5JDIA 2LF7A 3HRUA 5D4SA 2A6HF 3FM5A 1M2WA 1OI7A 2O7SA 1NR7A 1G3WA 1TEHA 2XF8A 3HADA 3MJ4A 4YACA 4J4TA 3JQGA 3JQ6A 5E1WA 1UAGA 4PG5A 1FJHA 1HW1A 4A6EA 1YB5A 4CUJA 2XAQA 2P5VA 1OFGA 4D42A 1MA0A 5JC1A 4LLGF 2O3RA 3AU8A 3FZVA 3ENNA 1NP3A 4O3MA 5I7FA 5JCXA 3KCCA 4LRSB 3LA7A 5HLGA 4Y17A 3ROMA 3ONEA 4OXNA 3V8KA 1P3DA 1ZEMA 3EUHA 3HN2A 4BNUA 1HSZA 3OOPA 1E6EA 4YB8A 3V4GA 4AICA 5IDWA 1IY8A 1PL8A 1I8TA 2ZB3A 1YBAA 3FR8A 4NR0A 4CJXA 2PN6A 3SBOA 2RGVA 1P77A 1HDGO 3GMDA 4GKBA 3RWBA 5BR7A 1B0AA 3K9TA 4M9XA 5LHIA 2HKXA 5H6QA 3M6IA 1C14A 3IC7A 1UXJA 3JD0A 1R1TA 4HUJA 4RPHA 1S6LA 5MDHA 3DBRB 3UKOA 1DLJA 2I76A 3AUTA 1NFFA 3JQFA 4CM7A 5JBIA 2QZ8A 1NQOA 4YFXF 1F17A 4Z9YA 1CYDA 5BOXA 1W7PD 1NVMB 2E82A 4GWGA 4HDVA 5LHHA 1LEAA 1OKRA 3RKXA 4FB5A 4J0FA 4EV0A 3OSUA 2HYGD 4JX8A 2EW8A 3VPFA 3G3ZA 1ONVA 4U7BA 2OAZA 1D8AA 3B70A 5T57A 5A02A 4TWRA 4IIVA 2DBQA 1V3VA 4A0ZA 5ICGA 4HYEA 5IFLA 1XD7A 3O3KA 1SFUA 5JVTA 1YIOA 4NHJA 1UDBA 2C7GA 2X4GA 3F3SA 3I9JA 4M54A 5F5LA 3X2EA 4CR7A 1KERA 3L07A 3HTUA 3GQVA 4Q3NA 3WYEA 1MGTA 4I98B 4OIPF 1IUKA 1LA2A 3QSGA 3VH3A 4Q3AA 1T1SA 5KCZA 4J0EA 4GX1A 2X22A 1CGPA 1ENYA 4FD3A 5KVVA 4WE3A 3EUWA 5B4VA 3E5RA 4CICA 2DU8A 1UHWA 2VNAA 1NQAO 4BKUA 3M1AA 5HS4A 1MXHA 2DBZA 2FWMX 3VKUA 2VYNA 2Z3YA 4ZH4F 3PFWO 3VTFA 3QAHA 4IGEA 4B7XA 3N7UA 4FFOA 2O61A 3D64A 3QLJA 2ZMEB 4UVGA 1ZO8A 4HF0A 4EUHA 2O0YA 1HTBA 4L75A 3RFXA 4BO9A 3VAZA 1T4BA 4G5HA 3TZQA 1C3VA 1PSDA 2MBFA 3PK0A 2RCYA 1Q0QA 3RPUA 3T4EA 4JK3A 1YOVB 4RGUA 3C24A 1I3NA 5FFFA 4A2UA 3UICA 2YUTA 1XYGA 3LVFO 4II3A 5CEEA 2O3QA 1DP7P 3DZKA 1QLHA 3KZZA 3BMQB 5L51A 1T24A 4ALNA 1UAYA 1ZMTA 4E5NA 5TRDA 1ZKMA 2Y0DA 3RKUA 1ZH5A 3BMOB 3KLNA 4EGYA 1SEPA 4G65A 3ZI0A 3H9QA 3RKRA 1I10A 1Y1PA 2LDXA 3ABIA 5G4LA 5T67A 3C7JA 3GX4X 5D8LB 1LSUA 5H81A 3WMWA 3GZ6A 1ZSVA 3A1NA 4OOIA 1C0WA 3WTYC 3QWFA 4IQGA 3DPLC 3Q0EA 5ICEA 1R4MA 4M8SA 3V5NA 5EL0A 4XRGA 5KJ1A 4KFCA 3KSZO 1ONNA 2EXXA 9LDTA 4JBHA 2ELHA 1BDMA 2STTA 5FI5A 1YO6A 1K7AA 1NFRA 1WWKA 3P7NA 1Z45A 3KLMX 2W4QA 4NNJA 2QENA 4CHUA 3NRCA 3KZYA 3OIFA 4FFNA 4GPD1 4G2NA 3GR6A 4P5OA 4I0BA 1FSEA 4EGZA 5KVSA 5JMPA 3GHHA 2FMYA 3QP5A 1SPXA 4E0BA 2DBBA 4IJWA 4K1LA 4RB1A 1W6UA 2C07A 5BNFA 4ZYDA 4UREA 1GV1A 4XZ3A 3JQ8A 5TX7A 4CL3A 3Q11A 2Y0MA 4W6ZA 4BO0A 1I6XA 1DIHA 1L1FA 2JTVA 2VZ0A 3LQQA 2PLYA 4KOAA 1R4NA 4IPTA 4LLNA 4FDAA 2OBNA 2EJVA 4FGSA 3ICPA 3CXRA 3K0LA 4JROA 3WLEA 3H8VA 4LMPA 2AQKA 3H5NA 4E13A 4LCJA 1LLCA 2HU2A 1KC3A 4HF1A 2A4KA 1G3SA 2XKPA 2ZXJA 3W6ZA 2Y0EA 4RORA 2ZMEA 2GUGA 5BS6A 2XOXA 4GXOA 3ZPLA 4I5GA 3T7EA 1FDTA 3Q3CA 5CDYA 1B9MA 1PL6A 1EZ4A 2VUTA 2W98A 1ENZA 2WEKA 1FXSA 1Z7BA 1F5TA 5L95A 2VN2A 2EF1A 2VHVA 2B0LA 3FN4A 5DCMB 1YOVA 2FZWA 2EKQA 2NU9A 2LNBA 4TKMA 4BKRA 1TLHB 3QRWA 4ZGWA 1ID1A 4QX6A 4JNKA 1BXKA 4ESOA 4BH9A 3FMSA 3LSTA 2JCVA 2L4AA 1XDUA 3JQDA 5DCYA 5B4UA 5LGUA 1TI7A 4RPGA 4EMSA 3FTPA 2ZNZA 4G7ZF 1FDWA 3MWMA 4BOYA 2ZYDA 4Y8VA 3K1PA 3OETA 1OPCA 4Q9NA 3GVCA 4XR4A 1QLJA 5JCJA 4KMSA 4ASNA 1PQPA 3DAPA 4CMEC 3LQFA 5HDNA 1HLDA 3LA2A 4UVEA 3VKVA 3W4KA 4GSLA 2FOKA 1ZBQA 2B0JA 2Q1SA 2VWPA 4BNCA 4I5DA 3NQOA 1YS7A 1KVRA 1U3TA 1A71A 5E17F 1D1TA 4AIHA 2XHKA 3BXXA 2FRHA 3HG7A 3JQFC 4NFSA 4NZ9A 2HEOA 2HGCA 4G7HF 1C1DA 1E3WB 2B4QA 3G79A 4OMZA 2HAEA 2QW8A 4IQ8A 1DIAA 1W5TA 1PZGA 4NU5A 2NVWA 4RDHA 4WUVA 4YRDA 3WYCA 2X0LA 2HO5A 3ZV5A 1X14A 1ZCJA 1N8KA 3V8JA 1TT5B 4NMHA 1FSHA 1WZIA 2ZB7A 4B8XA 3DR3A 3E9NA 2HUNA 3W1VA 3WSWA 1R4NB 4AJKA 4GYGA 3PP8A 3DXFA 2DLLA 4WJZA 1VC2A 5L40A 2BELA 4DUPA 1O94A 4M9SA 3D4NA 3PWKA 1T25A 2GD1O 2WJPA 4MVJA 4ZQGA 2XGXA 4J4HA 2A35A 4I5EA 1E6WA 1LI4A 4IHTA 2NVBA 4NFHA 1GCUA 3BTUA 1R7JA 1DC3A 3IRRA 5IDQA 2BE5F 4ESFA 1P9LA 3F8MA 3LWFA 3KBOA 4S1VA 2E37A 3L00A 2XAAA 1X1EA 1YQGA 4HNHA 4LISA 4W4TA 4XIJA 1XGKA 2DLDA 1IZ1A 5DCMA 1HF3A 3JQAA 1HT0A 2GNAA 1R16A 2H6EA 4BV9A 5JDIC 2HTJA 4XR9A 1PS0A 2JKVA 2Z33A 1E3IA 1B2LA 1VPDA 5A9SB 3D3EA 4A0YA 1LQUA 1YW8A 5JR3A 5TF4A 2Q45A 4IDCA 2Z5LA 2Y1FA 2A94A 4CLEA 4OMYA 2D59A 5CJ9A 3VVBA 2EP7A 3CEAA 4CV0A 1FY7A 2BGKA 2PY6A 3KTDA 4IDEA 3GA0A 2EFPA 1MXFA 5FLXK 1PR3A 1JHFA 2BYVE 2Q2EA 2XVCA 1O57A 4U6QA 3WQQA 2Q4BA 1U7TA 4XJSA 1ISJA 4E5MA 5J6XA 2ADUA 4HX8A 2Q99A 1SMTA 3GVXA 4FFPA 4ROSA 4LJZF 4O6JA 1HW2A 5EEHA 3F47A 1R1VA 1E7QA 4RVHA 3RUAA 2D1VA 4KT5C 1HL3A 1KQ0A 3SQNA 4C7JA 2K4JA 2XUBA 3GC6A 2QWWA 1JW9B 2Y05A 4UUNA 4JLWA 1KVSA 3VOEA 5HDKA 1B59A 1NYTA 1V3TA 1FT9A 3PGXA 4N9IA 4ZZDA 1FYLA 2C5EA 4NG5A 4OU0A 1MJAA 4RZHA 3WTXC 1BC8C 1NHWA 2X4HA 3DONA 3OA0A 4TZKA 4LK1F 4CMCA 1LSSA 2VNSA 3ZW8A 3H92A 1UDAA 3QWIA 1E1MA 1OZAA 4RB2C 4MEXF 1BXGA 1HZJA 1WMBA 3RU7A 3WGYA 1HXDA 3NTQA 5EEGA 3M1EA 2OA4A 5JFRA 1BVUA 3C8MA 1WDLA 2C82A 3HRMA 2ZATA 3WU0A 2CSUA 3KV3O 1IN5A 1ISIA 3HFSA 5G0TA 3RYRA 4PLVA 5L7WA 4FCCA 3HOSA 1P4XA 4PGGA 1I3MA 1P0FA 2PGLA 4HFJA 4N9HA 4MIEA 1TQMA 3V1TC 1U6GA 1E2XA 2EW2A 1E5LA 5CHEA 4M72A 2CGPA 1QORA 3WR5A 4HY3A 5ICCA 4FS3A 1H0MA 4MVJG 3GYHX 3F8BA 2Q49A 1P31A 2X0JA 4KICA 2TDXA 1BSVA 3G17A 2GZWA 4RL6A 3JAMK 3U2RA 3QVOA 1GZ3A 5EIOA 5BSFA 2X6TA 1ADCA 1I3KA 4AG3A 3BY6A 2IRFG 3K5PA 5A9SA 3FTNA 3IOYA 4UUMA 1T38A 1F8FA 4EM0B 1H2BA 3NJ8A 3PJEA 4F3YA 1N5DA 3ZV6A 4UVAA 2OZPA 1MFZA 3TJRA 4KMUX 2KKOA 4YR9A 1IE3A 3ROUA 2UUPA 3L4BC 2RBEA 4OYRA 4BNZA 5B4TA 5E1ZB 3FNEA 1HDYA 1ZK3A 3GOHA 4XB1A 1Y7TA 1PJ4A 5CYVA 2E6UX 4KIFA 5HWSA 1PP8F 3DEUA 3HHGA 4CL8A 5FGMA 5HS8A 1Y81A 2NTNA 1U5TA 3BTVA 4ON0A 3E1KA 4DGSA 4GMGA 1LBEA 3GFIA 1UCRA 4BXUA 1YLFA 4MP6A 2I3GA 2K7LA 3EGOA 3RCBA 5I7VA 6LDHA 4A7PA 2Q2WA 2ZCUA 1PQWA 5TC4A 1YS4A 4AD9A 2R7FA 1K2WA 1VJ1A 5EESA 5DYMA 4EJUA 4TVOA 4D7AA 2XXBA 1UXGA 1LDEA 5K5RA 2J5OA 4II2A 3RROA 1NHAA 4R3WA 4IM7A 3U9GA 2OP0A 4XD2A 4I09A 1AXEA 4NB5A 2FF4A 5FWNA 1R23A 3OJEA 2PZMA 1FYMA 2FSWA 2D45A 2WWYA 2C20A 4R5MA 1C0PA 3GF2A 2X9GA 3DO5A 1GXQA 2M1BA 4TRNA 4WEOA 4AJJA 3WTWC 1HXHA 3DFGA 3LZ6A 2EG9A 2J5QA 2HMSA 2NVUB 3GGGA 3P2YA 4H7PA 3QWHA 2FBKA 1YXMA 1XQ1A 3E48A 4S05A 4BHPA 1BXZA 1N2SA 4R51A 1HW5A 1GUYA 1PIWA 5C7LO 3I9KA 4CM5A 3WICA 5KJFA 1KU2A 1QMGA 3OEYA 2GGSA 2HKOA 4RQUA 4KUGA 2W24A 3ECOA 3GFMA 1F8GA 3WB9A 2RKHA 2UAGA 1M76A 2F2EA 2GR9A 2P7CB 3G0OA 3TFQA 3ZWCA 1KEWA 3OEWA 4LMYA 2Y66A 4G7OF 1E7SA 1HKSA 2YV2A 4AJ1A 1BJAA 2PKQO 1N1GA 2PNFA 3CPSA 4R54A 4HAMA 4ENNA 5FF9A 2GXBA 1MX3A 5BMZA 4BGEA 4HQMA 2GZ3A 5D6EA 4KYWA 1P33A 3GVAA 3CMCO 3TQHA 3VOSA 4P9FA 3BROA 3ZWYA 4OJNA 2OO5A 3W8EA 5A04A 1DRVA 1QYDA 3LF1A 5U9CA 2B4TO 1X0XA 1GZ4A 2FN7A 3I52A 1KOLA 1V9LA 5DBFA 3BHMA 3M8EA 2PFBA 1EFKA 4WECA 4Y6SA 2W57A 4AJ2A 3Q5FA 3FXQA 2UV8A 1M66A 3W6UA 4AJHA 1JVBA 4XDZA 1ZRDA 1H5QA 4MO2A 4OIMA 4YJFA 4DMMA 1BVRA 3F6YA 1VSVA 4Y6PA 4EGFA 2JL1A 1KQ8A 4PG4A 2BGCA 5HLHA 5C37A 1N7GA 1E3SA 1LDJA 1WRJA 5FEUA 3QW2A 3FX3A 3OV8A 1RUNA 4J9VA 4TRMA 3PLNA 4J3FA 2GXGA 1O5IA 3D5TA 1XQ6A 3JCZA 4JJFA 2RIRA 1A4UA 3AY7A 2IRWA 4DIOA 2PBIA 4YTEA 5T8KA 4KQWA 4XB2A 3BMNA 2PEXA 3PTZA 5HDGA 4B4WA 3PQJA 2MD5A 3EDPA 4ENJA 1P1KA 3JQAD 3RC1A 3QJ5A 5LCXA 4O63O 4X54A 5LRSA 2LF8A 4IRIA 3MJTA 3K2EA 1CETA 2M8EA 3K31A 2FPIA 5D5WB 4NK4A 3LLSA 2CF6A 1XR3A 1B15A 4XGNA 1H9TA 3AUUA 3O8QB 2AQHA 2HJSA 2HK7A 3LF2A 1HQCA 4XRRA 3FBGA 1JKJA 1XIVA 1LVAA 1ARZA 1EE9A 1GD1O 1Z75A 4Q3BA 4MVJD 2ETHA 1LQTA 3CZRA 3TF5A 5H6RA 1ON2A 2DQ4A 4FIZA 4RPJA 1P92A 1RYEA 4Z9FA 4BNWA 1M6HA 2XRNA 4OKIA 5L4SA 1VSUA 1WPQA 2P4HX 1E7YA 2JFHA 1Z91A 3ZCXA 3AUSA 1LX6A 1LRKA 3NGXA 4EJTA 3RI4A 1UZMA 4LFUA 2WD7B 1PJCA 3L4SO 5B1YA 1CF7A 3BMCB 2NAZA 2B83A 1PP7U 4YVFA 3ZNQA 3GXOA 2D2WA 1IN7A 1E7RA 1PJ3A 4F46A 2JCYA 1U7HA 2EKPA 3PEFA 2ZBKA 2DO7A 2Q8KA 4BO5A 3EYYA 2DBVO 4AFNA 2KRFA 2UZKA 5I8WA 4BNHA 1O3TA 4A26A 4I9UA 3RDIA 2VRBA 3INTA 2VXZA 5TT0A 4BKPA 2G1UA 2NUAA 4A27A 4J16A 1PU2A 3R1IA 3BOQA 1I01A 2PZLA 4YQZA 5AXCA 2DUUA 3FBTA 2GN4A 2CYYA 1RM3A 1YKFA 4Y67A 4KN4X 3N97A 4TMFA 4UEKA 5IJZA 3ITDA 3W4IA 4MVJM 4MJLA 4IUYA 1TB4A 4ID9A 4UVCA 4PIVA 1KU7A 3BWGA 3E82A 4XYGA 2FMLA 1Z82A 1XSVA 4UHTA 4IF4A 2GASA 3NJ4A 5ENDA 1AHIA 4QSMA 4P22A 3RUEA 2VBWA 3H9JA 4EDFA 3P5SA 4BHCA 2P5YA 2EP5A 2D4AA 1U3VA 3VH2A 4AJOA 4L5IA 4BHTA 1Y0UA 4MKRA 1ML3A 2W90A 2F5EA 1Z6TA 2P6TA 4MQVA 3DBHB 1R5HA 4CMGA 1U9JA 1YG2A 1QO0D 1SMKA 3LQRA 1ZK2A 1EH7A 2CFXA 1VM6A 2OL4A 2QYTA 3R4KA 2HCTA 3QQPA 4J7CA 1V6AA 3RUFA 5I9MA 2EFWA 1PGNA 3NT2A 1VJ0A 2OZ6A 1MJBA 1HSTA 2CD9A 2AEMA 2IP2A 3IWFA 3MJEA 5ES3A 1SD5A 2KIMA 2QVOA 1J9IA 1HKTA 4BIIA 3GDFA 1U5TC 5BQTA 3HIFA 3P9CA 3GFJA 2COMA 4ND2A 5JI6A 2ESNA 4WWCA 1XG5A 2K02A 3K96A 1DAOA 3O9ZA 4IDBA 4IXTA 4TRJA 2B4RO 3RBZA 4B4UA 2PGJA 4EI2A 1Z7EA 2Y1GA 4WNCA 4BO2A 4EJ6A 5I7SA 5KK1A 5IDXA 5JS6A 3L4BA 3BP8A 2L02A 2Y1CA 3WTCA 3SXPA 3AW9A 4PZDA 5DT9A 1G6NA 2QRLA 4G81A 1HDRA 2GWRA 5E8GA 3H3ZA 4A10A 2I65A 3EY4A 3QIVA 2C2YA 1T26A 2PI0A 1WZEA 1X3UA 1U78A 1ISHA 3U3XA 2IEDA 2ZQZA 3ZU5A 3IMFA 1IYZA 4NBUA 3PQEA 4FC6A 4IJAA 4BHBA 3OECA 2NADA 3KLPX 1O0SA 2IW5A 3VDRA 3EDMA 1LDNA 1CJCA 4PG6A 5IT9K 1MUUA 1LU9A 5K6AA 2XKOA 3WYBA 2FHSA 5FO5A 3UCFA 5EN4A 1Y5MA 4CXFA 2PLAA 3ZNPA 7MDHA 1FP1D 1WVGA 4DL9A 4TV7A 3QVTA 3E9MA 1REPC 3JW4A 2SCUA 1QG6A 1IF1A 1PGJA 4ALIA 1OBFO 4YIFA 3UGKA 4IDFA 1F9NA 5DV5A 4DREA 4NU6A 3AWDA 3UCXA 4OXKA 4R16A 3RVDA 3WODF 5KTKA 3KP7A 3NKLA 3HTSB 3JQEA 1DRWA 3CLOA 1DDOA 5DF1A 5KKAA 1NASA 3A9WA 1U8FO 1W8DA 3FWZA 3HDYA 4XQ9A 3TFOA 4JQFA 3BMQA 3L9XA 5EERA 1R58A 2FA5A 4DTIA 3BPVA 3GDGA 2KIUA 2VYVD 4R4JA 5JPIA 1J49A 2DUWA 1ZVMA 3WIEA 3M7GA 3BMOA 4AL4A 3DWFA 4M74A 4ZRMA 4CR6A 4FPXA 2O6GE 2ZB4A 1O8CA 3GMSA 3ICCA 4J4BA 2EIHA 3HSRA 4QLCU 4FFLA 3SLGA 4BMSA 3BJ6A 1WP4A 1ZLKA 1YB4A 5H82A 3RC2A 2DK5A 4DVJA 3HSFA 2CW0F 3RKYA 1R4MB 1XU9A 1P6RA 1G3TA 2CQKA 2DFIA 1R15A 3PWZA 2O2YA 3N74A 2YX7A 3VZQA 5LGTA 1I27A 2ZIZA 2NQTA 2W25A 3W6KB 1NPTO 1QQIA 2NNLD 3PQFA 3HOTA 1UH5A 4BQPA 2P9CA 3J80K 4ZVVA 1XGMA 2L4MA 4GO1A 1JWBB 4R1NA 3PHGA 2ZO4A 4HX7A 2D5AA 3O4RA 1H6CA 4BNFA 1E77A 2HMVA 3V2UA 5BQFA 2P91A 3ULKA 4ENKA 4H0EA 1EVIA 4ZYEA 2Y99A 4BKQA 4DNCA 2POQX 1A4IA 4HNGA 2EV5A 1YTYA 4K26A 4WOKA 3BDDA 2X9NA 4CYDA 1JAXA 1G0OA 1I1GA 2QG4A 1PJTA 4PGHA 3WWZA 2OBPA 2F00A 4O6VA 1OYIA 1LEBA 3JYQA 1EDZA 2NRAC 4U5QA 3V8LA 2PD4A 3G49A 3E97A 1SC6A 4AWXB 2J3HA 3G1TA 4TKLA 2DC1A 4I1IA 5LEJA 1LDBA 2BGMA 3PQDA 4KZPA 3U0BA 5DP2A 1C0IA 1ZARA 2ZNYA 4W82A 4RDIA 1RZ4A 4XX0A 3MCZA 2VZ9A 2L54A 4NQZA 1HWYA 2V6GA 3GUCA 1HKUA 2H63A 1MV8A 4BYYA 1AHHA 2QYSA 3P7MA 3SX2A 3TNLA 4A0SA 4BNIA 4CZZA 1KYWA 1F06A 1XCBA 4MVJF 4YT4A 1LNWA 2NNNA 5ED4A 5FLXZ 4ONEA 4P4LA 4DLBA 3CE6A 3NEPX 3I4CA 4BGIA 4CUZA 2C54A 4ZICA 6ADHA 1QXSA 3Q6IA 2V7PA 1NPDA 2VC0A 2STWA 1L7EA 1TVEA 2V1DA 1ULYA 4U88A 1BWSA 4PDKA 2GQQA 1JDJA 3ERED 1PZEA 2EWMA 2IXAA 3R61A 4OIQF 3DEYX 2JCXA 3NUGA 4OSPA 5AOVA 4PRLA 1P1FA 4YPOA 3JYOA 3FHZA 4RB0A 4BO6A 3U9LA 2EWNA 1RWBA 3I58A 1G4DA 1GQ2A 2B37A 2JD1A 3VPSA 1R22A 1D3YA 3I64A 5D5UB 3WGOA 3UCEA 4WK8F 4A03A 1AN9A 2FY8A 4RJTA 3UHAA 3COAC 2X1HA 4ETSA 2JHFA 3AI1A 3WE3A 1UDCA 4YRBA 2Z95A 4FFMA 4FSHA 1E3JA 1YDWA 3TDKA 1LLUA 3MEXA 1FK8A 1DXYA 2ZTVA 3FMRA 3FMQA 1LLDA 1XU7A 2AEFA 3L9FA 1P0CA 3V1UA 3BJOA 1ONOA 1BGVA 3CUQA 1GV0A 1TW2A 2J3JA 2GA2A 4ZYHA 3ULQB 2AXQA 5T5QA 1QNTA 2AXLA 3F23A 3JQ9C 4WNIA 3ZHBA 2YQ5A 1YO5C 3T0YA 1XWFA 1E3WA 1HLPA 2HK9A 1SB9A 4YT2A 2IA0A 2HRZA 2J5KA 2NACA 1FP2A 3GUYA 1BI2A 2YX4A 3NYWA 3NDJA 1CIVA 1FDUA 2UUOA 4P55A 3FD8A 2B35A 3I6IA 1TT5A 3IRQA 2C0CA 3LAPA 4J2HA 4KMFA 2VQ3A 3BHJA 2P9EA 3WS7A 2WYUA 1T39A 1KU9A 1Q0LA 4RAZA 1MFPA 2HQ1A 3S1LA 5L3EA 3JYPA 5CPFA 5DBGA 4M87A 5AQ1A 3DZHA 2D5CA 4HADA 2YPRA 4Q3EA 3U62A 2VT2A 4G9YA 1CERA 2JT1A 2I99A 4CMHA 3CIFA 1KIFA 3ZWOA 4M55A 3RFVA 4HXYA 4L73A 1ZJYA 4QFDA 4EW6A 1J5YA 4RF5A 3G1UA 3OP4A 5THQA 5CEFA 2NS0A 4H3VA 3DHYA 2ISYA 3I9LA 2PV7A 3U4CA 1ZH8A 4PLTA 4JBGA 4UVDA 3RAJA 4E5KA 3CUOA 3F9IA 1RJWA 2ZKZA 4ZZLA 3JQAB 1EQUA 3JQ7A 3N58A 1WW8A 2B5WA 1EDOA 3GH3A 3WBFA 3QU3A 3VB2A 2GA1A 3GRPA 4MTDA 3F4LA 4XYLA 1DHRA 3ANNA 2UWMA 1E7MA 5T6BA 3WGQA 3LC7O 3C85A 4XQCA 3ANLA 5JY6A 1FOKA 3B20A 2LDUA 3VEPA 1S3JA 4IQ0A 4RVUA 4URFA 4CMKA 5IDYA 4XCVA 3P19A 5B37A 2Q2QA 3ZWAA 3U4DA 2JAHA 1T2CA 2JRTA 1LB2A 3INGA 2AA3A 2FSSA 5COBA 4BNJA 2G76A 3K9QO 4NPCA 2QBYB 4YG2F 1UHMA 2P5KA 5COAA 3UOGA 3FSRA 2P6SA 2Z5UA 1USTA 1ADBA 3E6DA 4NFYA 1D8KA 1ZLJA 1HDCA 3CUQC 1NBOA 2NU7A 3TOBA 2RC4A 2GIVA 3RUHA 4CQMD 2C29D 4Q3CA 3BHIA 2W85A 2F5CA 4PLYA 3PRJA 4ND5A 3CSDA 4KDFA 4CUKA 1QSGA 4QFCA 2NLOA 1ISMA 2IZZA 1J6UA 1JTVA 1PS8A 3AK4A 1PX0A 1I5ZA 3QU6A 3S2WA 3K2ZA 4Y15A 1DPGA 3F21A 1OOEA 2GPTA 1ISGA 3GEGA 5FD5A 3K2BA 3RJPA 3WQSB 4AJPA 1DJNA 5I9NA 1BXGB 1SOWA 3ROQA 2GCGA 1NAIA 3F6VA 3DOJA 2RV8A 2CVZA 4E30A 1TNTA 1JWAB 5FFZA 5DCWA 4S3MA 2WD8A 3AI2A 4DIBA 4WCFA 4FQ8A 2XV4S 3JTHA 4P96A 4R79A 2VUUA 3PWSA 3DOOA 1MC4A 1ZGJA 3AY6A 3BAZA 4BMVA 5J8CA 4E33A 1PQUA 3HJAA 3BPXA 2P68A 2O4CA 1UXKA 4E70A 2DQLA 3QRFF 1Q7BA 1SB8A 2B5VA 2Z1NA 1F12A 2IT0A 1D8JA 3I4PA 1C0KA 1L7DA 1N7HA 1ZFNA 4OHUA 1ZEJA 1GQQA 3JQ7B 3T8RA 1B8VA 3L9WA 4GKVA 4IJKA 4QWQA 4C7KA 3ZWVA 3LYLA 1IHYA 5A06A 3WU1B 4PZJA 1RI7A 3Q9VA 1KBZA 2YR2A 3GGPA 3GVHA 4QT0A 2Z99A 1CWUA 1P45A 4PVDA 1W0CA 4CQLA 3C1AA 1N9GB 1RIOH 4N7RA 3ASVA 3IKVA 2FEZA 1FMCA 3C3XA 1J2XA 2MC3A 3I5MA 4HLXA 4PN3A 1T1RA 3IWZA 1A7KA 3PJGA 4B8WA 1YVEI 5DD4A 5KKCA 2ZYGA 1DHTA 2R00A 2O7QA 4JXKA 4GYIA 1GAEO 3GVPA 4OSOA 4D3FA 3KETA 3HHHA 3EYIA 3DL2A 1PWZA 2DTEA 4RVSA 2QBYA 4EJ0A 2H27A 1GYQA 1YQAA 1KVQA 3U09A 2X5JO 3DXJF 4E4YA 3CO6C 2PTGA 3MQ0A 1JE8A 1CEQA 2I5PO 3H6KA 1DPUA 3GNQA 3CH6A 4NBTA 1C1XB 3ELKA 2E7XA 2FQ3A 3DAFA 3GG2A 2K4BA 3OJ0A 4AVYA 2X5OA 1FZPB 4IRGA 4IVNA 3LT1A 3HB5X 1V35A 3TGNA 2FR0A 4BV8A 1DIBA 3WGZA 1NM5A 4XKJA 3RQSA 4YFKF 3N4MA 2E4AA 3E6MA 5JAQA 4R01A 4MKXA 1EK5A 2D1HA 3R0IA 4NBVA 3SZPA 1XGSA 2IE0A 2ZJ2A 2G0TA 3LC2O 1VL6A 1Y9EA 3MWDB 3ZHZA 1NWCA 3L6OO 4UV9A 4P4GA 4RVFA 4CV2A 2WE7A 3ML6A 1V4RA 1E7WA 3HQ4O 1YDEA 4RF2A 5A9RA 1LUAA 2GF2A 3GPDG 4E12A 1YB1A 2CSOA 4IIUA 4DC0A 1R1UA 1HSOA 2H9IA 3OIGA 5L3ZA 1ON1A 1UP4A 1TQPA 1U5AA 1U28A 1HSJA 1XSEA 1UUFA 5TS3A 3PJDA 4LVUA 3DBLA 3GWZA 4B8ZA 4HZFA 1FBUA 4EBFA 5JO0A 2HK8A 4CM3A 2BKAA 1IW7F 1VE9A 1I32A 4GL4A 4A6DA 4GVLA 1NQ5A 3RBXA 4HQEA 1HDXA 3SC4A 2G82A 3VZRA 1N9GA 2MLKA 3SXYA 2FPPA 4I08A 1IXSB 2FBIA 4FC7A 4DPKA 2HMTA 1O3RA 3NGLA 1IL0A 3GZNA 7ADHA 4KTTE 5IXSA 2Q1TA 3CMMA 4EJWA 4OH1A 3WFIA 3BZ6A 4RPLA 4MTEA 2QLZA 1Y5RA 3I83A 4IZIA 1VL0A 4K9DA 4F6LA 1MLDA 2BFAA 4DWVA 4YJDA 1A5ZA 3WTBA 4DIFA 3DMYA 3WTUC 4K6CA 4YDRA 5G0SA 3VH1A 2Y1OA 2G9WA 1KEVA 4N5MA 3TN7A 3UVEA 5JDCA 3KP3A 3I9MA 2GLXA 3K8ZA 4TRRA 2FR8A 2EA2A 3Q2IA 2YDXA 5AXDA 2Q1UA 3H5RA 2VHYA 5AXBA 2VWHA 5AIQA 3L7WA 1HDOA 3E8XA 5C5IA 2JFFA 4LB5A 2X23A 1K78A 4M86A 1D1SA 3F1KA 3BMNB 3K30A 3ZN2A 1HYGA 1ZZEA 2PA3A 1DEHA 5JY1A 1A9ZA 4I01A 5K9ZA 5DULA 4BO1A 2OUIA 4ZD6A 3U4IA 5L3BA 2OXIA 4AIJA 5BNIA 2CDAA 3ECHA 2DK8A 1IN4A 2J5RA 4UUPA 1V3FA 3CTAA 2JHGA 2NM0A 2I6TA 3EETA 1D7OA 1HE3A 2YJZA 3H65A 2IEBA 3IJRA 4OOFA 1I30A 1P4WA 1SAYA 2DFVA 1O3QA 2IODA 1YL7A 3DFZA 3E9QA 3O8QA 4KDPA 2P5LC 1PWXA 3KRTA 4JJGA 5KVCA 1S7OA 2D1YA 3S8MA 3GEZA 3JD1A 3HYIA 1SZJG 1RYDA 4YBZA 1DBVO 5BSEA 3OBBA 2EFQA 3H2SA 2L3DA 1J5PA 4IBOA 4YAKA 4PLHA 4U6SA 2YYYA 3GFBA 4CM8A 1YBMA 1J0RA 1N1EA 2Y68A 2Q1WA 3Q9NA 4OOEA 3H9EO 5EPOA 1LC0A 3NDIA 4R3NA 1XB4A 4FJ0A 4U7WA 5JAZA 4L9VA 1GUZA 2AG8A 2HTSA 3K69A 5D5XB 2IA2A 2JPCA 1IPFA 1NX6A 4EM2A 1PZHA 2WD7A 3OJOA 4RAYA 3KVOA 4NJOA 1CF7B 1NWHA 1QP8A 4RF3A 3LAJA 1A72A 1XSXA 3WTVC 5TRTA 3DZBA 5IN4A 1AOYA 4W99A 3JV7A 4ZN6A 5JSFA 4PZEA 4LSWA 2HYFA 4IINA 1B26A 3R0JA 2OZUA
chains in the Genus database with same CATH superfamily
4CLHA 2QX4A 4J0HA 1MNDA 3WK5A 1TKBA 2XWSA 3FVRA 3HI6A 3OIYA 1O96A 2XRYA 1Y1RA 3H2IA 4FETA 1TM4E 4Q7EA 2GJKA 5IWAB 2VJDA 1G291 4ENMA 4RS3A 3CP8A 1Z6PA 2E5WA 2WHEA 3TPCA 2Q3JA 1EV7A 2FPXA 4I9NA 5FTMA 1VKOA 2CNLA 3P32A 4GE0A 4R2WA 4PCLA 4UEJA 4FILA 4XIYA 2ID6A 5AKHA 1OZFA 3G89A 2GYWA 2XT6A 1ODFA 1YI0A 3MZHA 1R37A 4HEJA 2MSKA 1TJPB 1XNJA 2PWPA 4KTVE 4OGWA 3WDMA 3ZJ4A 3ZJ5A 4EECA 2XCRB 2FNPA 4CG0A 5BR8B 3BGDA 2E5FA 2IP4A 4LE2A 3TTWA 1RESA 3AHEA 4PTZA 4EAQA 4BAYA 3CBQA 2V26A 3FXLA 1ABBA 3KP4A 2YJ6A 1KA8A 2G7UA 3ZNNA 1OLXB 4ND1A 2G8LA 2Q5OA 2GO7A 4M9CA 4U9UA 4A5OA 2GEVA 4P53A 4FWIB 1VQ4I 3DBHA 3MAJA 3W5JA 2WYVA 2HPHA 4XWWA 1G3UA 4XRSA 2C59A 3E23A 5YASA 1ZRFA 2AZXA 3WOHA 4DBRA 4F1WA 3MWEB 1XLTA 5C5DA 1EK0A 1FW8A 1R5JA 1XTJA 4A3MJ 2GCOB 4X8MA 5FLKA 2CLDX 1LQ1A 3EGDB 3HA3A 2EQRA 3DMGA 3KHSA 1ODKA 4HXEB 2KISA 2FMUA 4FU0A 4QUKA 3ZIAD 3FCYA 5L4NA 2VCHA 3A6FA 2XF5A 2V4JC 5DJ5A 1VQ9I 3JWGA 3Q7EA 4NZYA 1BBYA 2A9FA 2R66A 3U4GA 5BN5A 1QHFA 2Y93A 3INRA 3ZQUA 3PUVA 1O6FA 4YCAA 4J1NA 4AN4A 3D1NI 3R40A 1HBJA 4H35A 1FOWA 4QUBA 2R62A 3IUPA 3QYEA 2HDCA 3OESA 4LJ5A 1RKWA 1P61B 1IAQA 3VDMA 3B73A 3O9VA 4R2KA 4UNIA 4X60A 1PDNC 3TR6A 2VP3A 1K6JA 1I1SA 1VKNA 2NU6B 2Y8EA 2X15A 1LE8B 1M34A 3MS4A 4B40A 4B45A 5KTRA 5LXTB 4G8BA 4JLKA 2PRJA 4GNKA 4BUZA 4EG7A 1JYSA 2AJLI 1ISFA 2H65A 2ZBRA 1IQ0A 2KIQA 3HKDB 2PPLA 5AHKA 3LH5A 1I4LD 2I4NA 3NTRA 3Q8WA 5CPBA 2IPQX 1U0OC 3GP8A 1E79A 2P77A 5HUQA 3K09A 1NOIA 3DTYA 2HBZA 4DY6A 1CNEA 2LP4Y 1BX1A 2NTVA 3KJNA 2GAOA 5TT1A 3VR3A 2HDHA 1JYEA 1OIWA 2H8RA 5EWJA 1Z28A 2SICE 4OF4A 1XPRA 1FOXA 4LA4A 4RCVA 4X90A 2LGJA 3KVRA 4AZWA 3OKCA 1E5QA 3OYJA 1ST3A 1PAUA 1ULHA 2XWPA 4R7TA 1I2BA 1K63A 1CUXA 1BD3A 1T5LA 4UM7A 3LD9A 2EJUA 4X0EA 1OE0A 4QWWA 3V1NA 2R7TA 1C7IA 4P3OA 4Q15A 5ITVA 2MYPA 3ZK7A 4QM6A 2RVCA 1O6GA 2IF0A 3AONB 3MUFA 3PDIB 3FBIB 1H94A 1TXGA 1W34A 2XA2A 4PCVA 4NCIA 4H7EA 4IKPA 1IGNA 4YREA 3O4HA 1BDBA 2BI4A 1EQ2A 4K28A 4MVCA 4DV2B 3U7FB 5DWQA 4KXLA 4TT3A 2EH3A 4A23A 2FETA 2VP4A 5FOQA 1HE2A 3T0IA 3TLZA 4DPMA 4W1PA 3PSIA 1S72I 1H2AS 1UEJA 3PLAE 1XZCA 1EAMA 3N39C 4L0DA 5KAIC 3DBVO 3TIVA 3RARA 2FMXA 1I9GA 3EUFA 1B93A 1CUJA 1ZM2A 1ECCA 3D1LA 1J33A 3DV0A 3EA4A 3ETGA 3KL4A 4AJNA 4RTQA 2YWXA 2X0NA 3Q7RA 4DR6B 1ECLA 4W9RA 1PDWA 4A16A 5IT3A 2C7QA 3CF4G 3ASUA 1F14A 4L78A 3I0TA 3NRVA 3MA0A 5CDUA 2QF7A 4Z4CA 2WAQN 2EV9A 3NIWA 1TAHA 1HQYE 1ZH6A 2XZDA 1UKYA 2LP0A 1D6MA 3LFKA 2IZ0A 2HSWA 2J48A 4ZYLA 3ABZA 4XQEA 1IN6A 5ILVA 4IJMA 3N9IA 1TWGJ 2FX0A 3K7AJ 3K4LA 1WABA 3ZDFA 5J23A 3H7AA 5DDIP 2VBYA 1JLLA 1K6OA 3GUZA 4R1QA 3ZC3A 1U2DA 1WP9A 1KY3A 4M9ZA 1YFKA 2BR5A 2WHRA 2XKJE 3FSGD 2OPHA 4INAA 1FPQA 1E60A 2NXJA 5ADVA 1LE8A 1YFHA 1M34B 1JSXA 2EX1A 2HMWA 4NXNB 1XRLA 3ONWA 5ENVA 1K79A 1RXUA 2Y0PA 4KN8A 4ZMSA 1GZDA 1M1YB 4OQNA 2O8KA 4FE7A 4UCFA 1P1JA 4ERXA 3O31A 2I4LA 1V2GA 4G3XA 4JASB 4WK4B 4DKXA 2QRPA 2VQFB 3T3GA 4DB2A 1Y9ZA 1EH8A 1X8XA 2FEPA 2ZYSA 3NR2A 4FOTA 4NCNA 5ALYA 4BB5A 2NV2B 3U49A 1DFIA 5LGNA 2CFRA 1SPBS 1UFVA 2RH4A 5GPCA 3CUKA 4P58A 5EQDA 5HMLA 4J43A 2D6FA 1ZKDA 2PKYX 1MJFA 5KHAA 4U0JA 3NWSA 3GTOJ 2AE2A 1GRRA 5CFLA 5GVSA 3X1KA 3T8TA 2ZUBA 3JVDA 1Q21A 4XYMA 1IHOA 2RJ3A 3B6MA 4GBGA 2OORC 5DTJA 4E5PA 3LFUA 2C4MA 2YQZA 4F3NA 1Z13A 3IEXA 2R1VB 5HEKA 2QQ9A 4B3HA 1UHSA 3PF8A 2NG1A 2WOOA 2XQKA 3Q98A 2PKEA 3QOFA 1NP7A 3UB4A 4DM3A 4ARZB 4JI4B 1BMFD 4LWQA 2WM8A 3GMEA 5CA0B 4R3UC 5DLYA 3T1TA 3BTOA 5EJ5A 5DMXA 4BZQA 2DP4E 5JFOA 1GPKA 1JR3D 3F5SA 4UNRA 3ZHQA 3L8MA 4IHSA 2IITA 1EVEA 1NAHA 4HA8A 2HNBA 2PSEA 4RWZA 3M5DA 3DTVB 4ME6A 4M1QA 2C9MA 3NYQA 1TA0A 4BB6A 4A3CJ 2Y0CA 3FK7A 2LPMA 2OWEA 4N5LA 3T3EA 3RC8A 1G3IA 2QA5A 3MLBA 5ARDA 4WN9B 4XUCA 1L4NA 2X5KO 3RSSA 4BQRA 3ONDA 2WWFA 3A4CA 5JLAA 2ISSD 2LIPA 3ZWPA 4OI4A 3T3HA 4C05A 3E0QA 2HA7A 1VRCA 4CMBA 1W4MA 4B76A 5HKKD 1TADA 1E2GA 1K7YA 4DIQA 2QIOA 2OCYC 5IVDA 3STWA 3VR6A 5FI3A 4EVSA 3CCCA 5LFAA 4J1TA 5KX5B 2L82A 1CJUC 4K2AA 4YECA 1USVA 5F1YA 1JQLB 2D8MA 1A9TA 2CBGA 4FHEA 2I34A 3ORYA 5JC8A 3D5LA 2EGUA 4A69C 5DRTA 1I4WA 3D7KA 3MJRA 5JSQA 5J1SB 5CA1F 5AONA 3EC7A 3JATA 1HZZC 4W5WA 3E6BA 2BH9A 2HRDA 3NEUA 1M1YE 1ZZGA 1BZYA 4MQ4A 1TCBA 2CKMA 1CQZA 4G1EB 1X1TA 4BB9A 4WACA 5EA2A 4FWBA 3GGDA 3CC2I 2CDBA 2IOHA 3E0XA 4L2IB 1UK7A 4I4CA 4UHKA 4ZOCA 3RC7A 3TDUC 3KD3A 2WHXA 3OTOB 4C7VA 2ILTA 3I04M 3KSRA 2X9DA 1EDEA 1KP3A 2WPDA 4Y3UA 2G17A 1KJQA 5CAEB 2I8AA 3V9PA 4KXUA 3I54A 1SELA 2IQ5A 3HJTA 2PFGA 3WNDA 3S2GA 4EHNA 5G40A 3SEAA 5K6RA 4L9JA 1NUSA 4PVCA 1XMJA 3O2JA 3W6JB 1VECA 1ZUHA 2CVPA 4KCGA 4LRWA 1IB6A 2O5CA 4ZVRA 3VX4A 1YZUA 4D98A 2DX7A 4YI3A 2DW4A 1W5EA 3MHTA 1U7PA 4Q01A 4LWOA 3BFKA 3BXHA 4H60A 1FLIA 1DDGA 2L42A 3F9KA 3OZRA 4HWOA 4UMDA 1ANKA 4F21A 1SC1A 2VP6A 4ARZA 2YRFA 3EXEA 4P1WA 2WZCA 4UBIA 5A5EA 5D3ZA 5EQTA 1QIDA 3OPYB 4UTXA 3VTFA 2W8ZA 1QV6A 3IR6A 4XM0A 5AJWA 4HWKA 1FNCA 1Q1VA 3SR0A 2HA3A 1KH2A 4YFVA 1FEZA 1KOFA 1PL7A 4Y2JA 3ZHYA 1ZL0A 4AMVA 3C6XA 4TV9A 1TUIA 5CUQA 2FKNA 1U8AA 4ZOEA 3RHTA 3WX0A 2G06A 1QVAA 1GU7A 3OKFA 1BGXT 4BIMA 2CSXA 4KR3A 2Q8PA 4JZKA 3A6ZA 1OWOA 4L3OA 2HRQA 1KOJA 4NV1A 1ZK4A 4LV5B 1ZREA 5A3SA 1ENOA 1GG9A 1PDVA 1WU8A 4G37A 1IEQA 4L07A 5AVXA 2FWRA 4UEOA 5KQPA 2YZ2A 4G9EA 3LRTA 2WU0A 2CUJA 2Q6OA 3GLHB 3VR6H 2QTTA 1E1KA 2DI3A 3K73O 4ZYGA 4B3IA 1OXVA 4WPGA 2RE8A 2O19A 3N2IA 4F55A 3SIXA 5E0KB 1NVWQ 3H2KA 4KQMA 4OBEA 4E5YA 1FFCA 8ADHA 1FYXA 5GZ1A 4BVBA 4OGGA 3GRFA 5C7YA 1YYVA 3JSOA 1QCZA 2PX9A 2G4LA 4KDEA 3CKYA 4ZJUA 5IVHA 4H4KC 3RTRA 1DC6A 2QN3A 2FOXA 3WIVA 4RK6A 4L22A 2KZVA 1DINA 3M5PA 3GZ4A 2AOWA 2WWHA 5HLTA 1LJ8A 3AR5A 2KDZA 4CKBB 2GJSA 2BMAA 1OX5A 2JBAA 3FHNA 2VP9A 3W3AA 2ZXHA 5G0VA 3DLPX 1XDBA 5FX2A 1FL9A 1LB1B 4TT3D 5CJPA 2XT0A 3AFHA 1HUQA 1L7MA 3HPHA 5ALTA 1AKTA 3EVZA 4CTJA 8ATCA 4FGLA 1T5DX 2VJJA 4LDRA 4LF6B 1B23P 1XELA 4HLYA 5LDGA 5JAPA 4JBAA 2KT0A 3B7GA 1R4AA 1XKTA 2J9XB 3U4HA 4H3SA 1M75A 1CEYA 1O95C 1P29A 2OG2A 1FZTA 4YEDA 2H4XA 3Q9SA 1RMQA 3GBGA 2F1JA 4MGYR 1CSEE 4YP6A 5SY6A 1NNLA 4U8HA 3OD1A 3IHKA 4G84A 5TB5A 4WXHA 4Y9SA 3U7EB 2PMUA 2JFZA 3GP5A 2DA3A 1CZNA 5G2OA 2SHKA 5BXQC 4BJ3A 2RFLA 2XAFA 1Q7GA 1TGVA 2DRIA 2DCMA 4JOCA 5LQUA 4RMIA 3ZWBA 3CC4I 1HFKA 1I3QJ 4NF2A 3ZW8A 2D0IA 1PE0A 2AMLA 4D7AA 2Z6AA 1GT91 4RF4A 4B32A 3IHUA 4JOSA 2CLSA 1BE6A 4EZIA 3A0BC 3NV9A 1X0VA 2B3TA 4V3CA 2O8DA 2ERXA 4IGIA 2DT5A 3GCWA 4HLQB 4HNSA 2WIDA 5I7RA 4XGIA 5LP6C 3B8EA 2Q62A 5IJ9B 3OG9A 4BGDA 2OB2A 4GAEA 3O47A 2B2XA 2HMUA 4EI8A 5J2TB 1GILA 3JWJA 4LDAA 3IP8A 3GY0A 3R77A 2KDOA 1WZUA 1FBSA 3C6ZA 4IYRA 1WX1A 1IIBA 2BF7A 3DGEC 3LT0A 4IZHA 2WM2A 3TJMA 1KI6A 2R93J 2LMDA 1NW7A 2AN3A 2YXNA 3MUOA 4R69A 5THKA 2I8CA 3UG7A 3UW1A 2XWQA 3FUWA 4BQFA 4F3CA 3KALA 4GOKA 1XNRB 3IAM1 1AGXA 3A03A 3W5BA 1LW6E 4LGYA 1R64A 2JANA 2YICA 5TGDA 5F1RA 3EUAA 1QNLA 3QWAA 1VE1A 1C1XA 2V6FA 2QRZA 2X6YA 1Z4KA 1J06A 3SE7A 4L0QA 3AY3A 1E61A 3ITNA 3PFKA 3FUTA 2H0AA 4A8HA 1F6WA 1J9ZA 4PZYA 3SM9A 2WNHA 4IIBA 2LBFA 3D4OA 1PFKA 5G1PA 3UK7A 3VUEA 3ROXA 3OEHA 1H9GA 2FUG6 2H92A 2ZKLA 5LM3A 4LI3X 5ALIA 5HNKA 3H1PA 3MD9A 4G6DA 3MD0A 4C6HA 3NMUF 5GOZA 5TGTA 1T0HB 1A82A 4EKGA 2HSDA 1NK3P 2DYSH 4FXOA 1NQUA 3F1LA 3LXUX 1X2BA 1EMDA 1HMPA 4MEAA 3LIIA 2X8WA 4RLSA 2X7JA 1P8JA 1G42A 5ERGB 1LDDA 3C87A 4DV4B 1T8YA 1JEYA 1AGNA 1T5OA 1GVNB 2BFFA 1QOZA 2VYFA 4GF5A 3MHPA 4OJMX 4R8MA 3SHFA 2R8ZA 3VU8A 3VPHA 2WTUA 3RF7A 2HHAA 4B4DA 3UAZA 3BG5A 3CDIA 2N0SA 3IVRA 3M4OJ 1HC7A 3PQKA 4O5OA 2WW8A 3A27A 2L19A 2WAYA 1VSTA 5BN3B 5HP4A 4ZO4A 3CHYA 1HKHA 4YIIA 3IESA 3SXJA 4W7IA 1UBGA 3W8NA 1UJ8A 2FQQA 3LBAA 4Y3OA 1DC4A 4U5XA 3U26A 1FNSA 2J5PA 2FZVA 4RIEA 2O8FA 1LRJA 1IATA 2P9TA 2ZWVA 3F8WA 1KYYA 1UG0A 1ETUA 2CHVA 2HF8A 2ZI6A 1TC3C 3AFNA 3Q3HA 1KGSA 1HBXG 2FPPB 2YC2C 2E1PA 1OI3A 3AILA 4FYJA 1KI9A 1GGFA 1SC4A 2EQAA 4ZMRA 5LOVB 3ONVA 3TW7A 4HV6A 2TMGA 1R9TJ 1D6SA 4UB8C 1DV1A 1KMMA 2WU4A 1OZ0A 2X2EA 1J25A 3P0HA 2H2IA 4J0CA 2VHXA 4M9RA 5BP7A 3DBRA 5ADWA 4MDHA 1K8QA 1YRHA 2R7XA 1B14A 1FVFA 2P7IA 4MP8A 4MHOA 3HO1A 1MVOA 3LDFA 3HUGA 1A9YA 1AQYA 5JLWA 1MAHA 1WXIA 2Q0XA 5KJEA 3ND7A 5BVHA 1O77A 2J8ZA 3ASNH 3AR9A 1I7LA 3ZMSA 1I2CA 1SXGA 4ZVOA 3WQRA 3DV8A 1E1YA 3R6WA 3UKDA 2XMCA 3ZHCA 1T95A 1B43A 4H6PA 2VJ4A 1FBQA 1Q5PA 3MIZA 4GP9A 4I1VA 3RTDA 4MKZA 4CI9A 3CU5A 4XYEA 4I55F 5L6LB 2M30A 1H6DA 5H20A 3PB3A 4AZ3B 5E3LA 1QF6A 4U0KA 2OTJI 3RT1A 1CC1S 3FHLA 1UZLA 2ILVA 3M6UA 4FI3F 1JKFA 4IRMA 4K9MA 4R9RA 5CNIA 1CS4C 1PEDA 2FN4A 3ABOB 3HU1A 5K0FA 3LUPA 4WBSA 5H59A 1TJYA 2HJRA 4GL2A 1XLTC 3T1NA 3R3SA 4OO3A 2PWYA 5FD6A 2HJWA 5TVKA 1E94E 2VNIA 3SD7A 4E7IA 3AGQA 3CTPA 2LKPA 1L1QA 1GOTA 2OCPA 2YWEA 2OYSA 1CRZA 3HYLA 3WRXC 1ORKA 4ZU3A 5LMCA 621PA 2H8GA 4XLTA 5GP1A 2IV3A 1K8RA 2JEYA 4BC1A 5I7EA 1K7EB 1E3MA 2V9PA 2HADA 3OFSA 4KN7X 3D3KA 3QFTA 1MR3F 3TEDA 3LIPA 3MFKA 3BL6A 4JV5B 1GO2A 4WF2A 2BBTA 1JEYB 3GLXA 4OIOF 1SUIA 3TR5A 3PGA1 4YXWA 3VO2A 3ZI7A 2GB4A 2EU8A 4BP1A 1Z4IA 3RS2A 1QFXA 4CCLA 1XHLA 3OY7A 1X7ZA 1SAXA 4FE4A 4K5QA 2IU6A 3L7CA 1JYFA 1JSLA 2K85A 4K0KB 3ABTA 1G2OA 2M3AA 1LVUA 1Q1ZA 4KIWA 4DLAA 4OINF 5BNTA 3O92A 3T3MB 1VFNA 2Q1XA 2QVLA 2ZCWA 2B6NA 4P35A 5CCBA 3TP0A 3M4YA 4HRVA 4MW6A 2JPBA 2BBSA 4LV6A 2JDIA 1T4MA 3AETB 2FGJA 3GJ7A 3OY2A 4X92A 2O3UA 3Q2OA 4WUTA 2WA0A 1CJKC 3QPAA 1Z2EA 1MB9A 3U9TA 3WMGA 4OJTA 3QW4B 4FEGA 4YI5A 3K92A 2V6MA 4HRIA 1J39A 4KITB 2DVMA 4PCQA 1FTZA 2XUJA 1QYXA 1SUSA 2RGGA 3L84A 2Z9OA 1QH8B 4L85A 4NU8X 2Q4EA 1JEOA 1FU7A 4H6VA 4PZ9A 3OOEA 1DXQA 4BE7B 2CDCA 2JVKA 2VPWA 4FR5A 4I46A 4MGRA 1GEEA 3O03A 4MGHA 4Z86A 4ZQEA 4CR8A 5IF3A 4YK7A 3IUJA 1T9BA 3ADBA 2AKYA 1W0TA 1N8NA 2B82A 1U8RA 3SAJA 3GZTB 5EEAA 1D4OA 3IE0A 3CVVA 4LHZA 3U61B 1GFSA 4ZTJA 5A3QA 3W4JA 2BLLA 1KDRA 5KNLA 3S3OA 4HTAA 4RV4A 2IXGA 4FFWA 3B1KA 2W2XA 1IEVA 1MC5A 2DGDA 3OURA 2WWGA 4NS4A 4RHXA 2CNDA 4WAUA 1KI4A 5REQA 1V5EA 9ABPA 2GK4A 1YW7A 2O1XA 1YWGO 5FUVA 1FTWA 5KVRA 3W1WA 4EEXA 5AW7A 1S7CA 1ORIA 3MZ0A 5HA5A 1IO2A 1E59A 1MJNA 2E1RA 3KYCB 3D4BA 1Q0HA 3INYA 4QEKA 3C6QA 4CTOA 5C8VA 1RXVA 2BM9A 1MH1A 3E5XA 1NNSA 3P4UA 1QRAA 4O4JB 2FWAA 2FPMA 3KWJA 4BU0A 1KY5A 3IPRA 3PQ8A 1Q7TA 2BTOA 2O2IA 1PNRA 1JPVA 4CM1A 4EPWA 3QLTA 4YJ2B 3OIDA 9MHTA 1SY7A 1MPXA 2CBZA 3QOYA 3BWDD 1R8SA 3AUFA 3I39X 3TKYA 4ICIA 4IMRA 4OU5A 3JQCA 3JSPA 3GT3A 3QLVA 4LXXA 5ESWA 4A8JC 2B94A 2BD0A 3KTAB 4RIHA 3Q40A 4B6RA 3AP3A 1E0SA 1X7ZB 3HB9A 1RYBA 3M82A 4MS1B 5C32A 5IZCC 1XAGA 3DSRA 4Y2SA 1JSZA 5ADHA 4JJ7A 1ZOIA 1E8MA 3KEFA 3IAM6 4R7ZA 1C4XA 1CVIA 3M3HA 4QSHA 3QJYA 1TZKA 3NOVA 1JFSA 3DDNA 1SRRA 4JC5A 4EFLA 1Q0TA 3QVXA 3CSSA 2W82A 4GUAA 4RM3A 4OPMA