3WGGA

Crystal structure of rsp in complex with alpha-nad+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding mode of the oxidized alpha-anomer of NAD(+) to RSP, a Rex-family repressor
pubmed doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 71
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wggA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wggA02
1IUYA 1X0XA 3R4KA 1GEGA 1YWGO 3ITDA 4N7RA 4NB5A 1MC4A 2PQ8A 2HQNA 2QQAA 3R1IA 4J1TA 4KICA 3CMMA 3BHMA 2EB7A 4ND2A 4CMCA 3ANMA 3F3XA 4H0EA 1T2AA 3BHJA 4DQUA 3DOOA 3VKVA 1CF2O 3D4NA 2O3JA 5A4DA 1E1MA 2GD1O 2WC2A 3TF5A 1LC0A 2H63A 5DNAA 2O4UX 3IMFA 4NQWA 5AVOA 4K28A 5KTKA 1EBUA 1PGJA 2OXIA 3B70A 4K26A 3S1LA 1E0DA 2FPGA 2MD5A 2GXGA 1DO8A 4KUHA 1B9MA 4ESOA 2VBYA 2GYYA 4LW8A 4AJ2A 3P2YA 4TRJA 3KCCA 3G73A 1XR3A 2QW8A 4R41A 2ESNA 4R5HA 3DOJA 5L3CA 1N7GA 5G0TA 4Z3KA 4G9YA 1B3BA 4HFNA 3JQ9C 1B8PA 3G1UA 1SFEA 4KOAA 2G0TA 1E7RA 1T2KA 2IRWA 3UOGA 3NTOA 1SC6A 4LK3A 4ZN6A 2NQ8A 3IUPA 4FJ0A 4MVJG 2P4QA 1S6YA 1V8BA 2CSOA 1R66A 3S2GA 2XAQA 2Q1SA 3CUKA 3K96A 4A0ZA 1BXGB 1ORRA 3GZ4A 5JDCC 3L6OO 4D7AA 1S7CA 3DBVO 2HZTA 3RC7A 5JC1A 5G0WA 2LSOA 4PDKA 2O3SA 3WIEA 2Z1NA 2NLOA 2A94A 3PEFA 1H0MA 2FA5A 3R0AA 3WXBA 4CUJA 2C6YA 3F4LA 4L4XA 1CGPA 1SMTA 1GTMA 4R69A 1BDMA 4DIBA 2XHKA 3Q9SA 4J0FA 4YRBA 3KETA 2GASA 1XMKA 2FBKA 2PH5A 3UH1A 3WYEA 1ARZA 3BY6A 4HKTA 3D1LA 3KZZA 1MXFA 1QLHA 3OH8A 3PPIA 5G4LA 3UCEA 4BNHA 1YLFA 3DXJF 3RKWA 1JKIA 1NTOA 4R79A 1W7PB 3ECOA 4Y15A 1DEHA 2UXNA 4J43A 4JBGA 1FX7A 5ITWA 4DWVA 1DIGA 1T6SA 3C7JA 3FNHA 5B37A 4O0LA 3WR5A 4IF4A 5IT3A 3ROPA 5JO9A 2EEZA 2A3SA 5CJ9A 1OC2A 2BE5F 3TO9A 1NQOA 3QVTA 4CM3A 1K78B 1Q1HA 3VPSA 5CVUA 1I24A 1QO0D 2AG8A 3EVTA 3DMTC 3CH6A 2P7CB 4IXWA 2HK8A 5JFRA 3OP4A 4DMMA 1I3NA 2QZ8A 1M6WA 3LQFA 4DC0A 3I53A 4FIZA 1Z6RA 1EDZA 1XDSA 5FB2A 2B4QA 2VRCD 4UREA 3PTZA 4AJ1A 3IOYA 4XYBA 5CPBA 4DXHA 1VJ1A 2EFOA 2O0YA 4AFNA 3HOSA 2BH9A 4CZZA 1Y5MA 1N9GB 2JZYA 2FSSA 2COMA 3GY0A 4CV0A 1BXGA 3JTGA 4UVGA 3NGLA 1P1FA 3WFJA 2WE7A 4CV1A 3NYWA 2YV3A 1ISJA 4JQCA 4KUMA 1KYZA 3J7AO 1ZARA 3MQ0A 1ZKMA 4YQZA 1P92A 1J0RA 3HRTA 4L9TA 1QYVA 1R6DA 2GN9A 5B12A 4LLNA 5A04A 3OECA 1FSEA 3GAFA 4G8XA 2QWWA 2STWA 3FBTA 1KU3A 2E1CA 4PZDA 4KIBA 1NX6A 4JBAA 2NTVA 3IP1A 4R5MA 5BPDA 1DHTA 1JXSA 5TJ9A 1KEUA 3H9UA 4XIYA 3DONA 4AJNA 4BNZA 2P68A 1LJ8A 1QR6A 1O95A 4D0RA 1ZGJA 4FC6A 4BO3A 2OO5A 1LI4A 1ZH8A 1Y81A 1O6ZA 4RVDA 1S7OA 1ZG3A 4AJJA 1U3VA 3VPFA 2H09A 5HLGA 1IZ9A 5LEKA 2STTA 4U0WA 1P44A 3GNQA 4F3YA 2LF8A 1PIWA 4O3MA 1SD7A 2DPHA 1IE3A 3IUSA 4GQAA 3IDSA 4ALIA 2M8EA 4Q3BA 3W4JA 3LAJA 2ACJA 2VUSA 3H9JA 4DMLA 1T4BA 4RB3C 4ZQFA 3BMCA 3ROUA 3SZPA 1ZRFA 4NU5A 4FD3A 1R0KA 3D64A 4FOSA 3P5SA 4F6LA 2P9CA 3DP7A 4I0BA 1I3LA 2F5DA 2EW8A 2H1SA 3AFNA 1U9JA 2ILTA 3AOEA 2KKOA 3FI9A 3QA9A 2YYYA 4OGWA 2HLPA 3R6DA 3EDPA 5HDKA 4U0YA 3H3JA 1Z05A 3ULQB 4EJUA 5CDYA 2Y99A 3F47A 4HWKA 1ON2A 4BL5A 1Y8QB 1HYEA 3E48A 3F8FA 3E6DA 2HO5A 1YW8A 3MWMA 2GNAA 1ULYA 2JSCA 4LFUA 1HKTA 5KVRA 2D2IA 3DZBA 2JPBA 3LFKA 2VONA 4XJTA 4FC7A 2B4TO 4R68A 2Y0CA 5GZ1A 2HKOA 4NPCA 3PQKA 3WU1B 2O7SA 1EUCA 3SFZA 5JPIA 1T38A 5FD5A 1HDRA 2JCYA 2VTEA 4PLVA 5KVVA 3ZWVA 3Q9UA 2PK3A 5G0SA 2MH9A 1UP4A 4CMBA 5T8KA 2L3DA 2VOPA 1LQUA 3ZHXA 4EYEA 3GGPA 5COAA 5H83A 1MV8A 2K7LA 1HDGO 4NH4A 3DKWA 3V5NA 2O03A 3RWBA 2DPUA 4R51A 1FDWA 1OZAA 1SCUA 1CERA 5E1WA 1T1RA 4CQLA 2HDCA 4HLXA 1CWUA 4KFCA 1Z7UA 5JC8A 3VDRA 2WDZA 4IUYA 4MP6A 5CEFA 2GR9A 3I9LA 1PU2A 3KTDA 5TSDA 2FOIA 4LG0A 2F5EA 1ENPA 3BTSA 3JQAD 5J6XA 1BC7C 4BXUA 3T1BA 1TEHA 3FRJA 5DULA 4DPLA 1PJTA 3S2FA 1E92A 3A1NA 3ETGA 1U5TB 5DCMB 3ZU2A 1DRVA 2XASA 3W6UA 1ISFA 5TT0A 4CMAA 1BI2A 2Y0DA 3GQVA 5JLAA 3EDMA 3N74A 3O9ZA 4IMRA 3KOUA 3TOXA 3JCZA 3V2GA 1KQ0A 2HSDA 4FOOA 4E5NA 4ZQBA 4E5KA 1NVTA 1DUXC 3JAMK 1GADO 1Y7TA 5FFFA 2C5EA 2OOSA 3UVEA 3BIOA 3M1LA 4WCFB 3HTUA 1QYWA 3E9QA 4CLRB 4Z0PA 2TMDA 5L45A 2WTEA 4YG2F 4MVJF 4BOYA 3DBRA 4FS3A 2UZKA 4HDVA 4WEOA 2WD7B 3Q1LA 2R7FA 2ZKZA 1LRKA 4HQMA 3UFXA 3OICA 3T0YA 3PLNA 1YQDA 5F64A 2PKQO 5LRRA 1XGKA 4CLOA 4EGYA 1Z82A 2PI0A 3NTRA 3L2CA 3N58A 3WGIA 2VN2A 1RM5A 2BF7A 1DAPA 1BSVA 4OMZA 3GRPA 4L4RA 5BSEA 5MGBA 3TDZC 3V7RA 1LQTA 3DHEA 5BS6A 1VSVA 3M2TA 3KZVA 3JQGA 3OMLA 4FDAA 4R3WA 4U6SA 4ZQEA 1ZXBA 2P9GA 3EETA 4I7HA 3C1OA 1WZEA 3VZQA 2JJYA 2Q1WA 1KC1A 2VNSA 2AEFA 1DDOA 4GYGA 4CLXA 4IINA 3O38A 4XQGA 4YJHA 1SEVA 2QZ9A 5FF9A 4PCVA 3FR7A 1UAGA 2OZUA 3E3VA 3M2PA 1FYMA 1MLDA 3DO5A 3P9IA 1HE2A 1HKUA 1VI2A 3GFBA 4M8SA 2XAGA 4Z3DA 4DPKA 3RUEA 5BNIA 3LF1A 3PDJA 3H5AA 5F1PA 3ZWXA 1TLHB 4ESBA 1KYWA 3A14A 4UVEA 4XSZF 1HWYA 1PJLA 4IY1A 3H6KA 3U2RA 4CM6A 3FX3A 2PR2A 4QLCU 1XSEA 4J4BA 1B16A 3LDHA 2VZ9A 4G81A 1SB8A 4F7ZA 2PWZA 5JYDA 3FWEA 2FF4A 4JNKA 5HS6A 3E1KA 4XBFA 4D79A 2KJCA 3WLFA 5JSFA 1SFXA 1ONVA 1S8NA 2Q4EA 1A4IA 1VL8A 1QSGA 3K2BA 3C3WA 3ASUA 4HFMA 5L3DA 3RU9A 3UN1A 3W4KA 4C4OA 3RBZA 5A9RA 1GUZA 3WWYA 1DRUA 5CVIA 2ISYA 4LSMA 4TVBA 1DLJA 2EHDA 5DCWA 1BDBA 1T98A 4CLHA 2Y67A 3K2EA 3ONEA 3RCBA 3ZMDA 4RVFA 3RIRA 3BWGA 1STZA 1HSTA 1FDUA 2PKRA 2VUTA 4FSHA 1EDOA 1LEAA 3L0DA 4YJDA 2OZ6A 2H9IA 5HVQC 5E8IA 4JGBA 2DTDA 1OKRA 2FXAA 4L9VA 3WTWC 4BNKA 3JYOA 2E48A 4I01A 4P22A 3M6IA 4BKUA 2CWEA 2DAOA 4ZJUA 5K6AC 4AVPA 1HYHA 2DPDA 4TKMA 1B59A 1N1EA 3KUXA 4YBZA 3QOPA 2VYVD 4CQMD 3QV1A 5ILOA 2AMFA 2D0IA 3ZNOA 3I71A 1E7SA 4L76A 4NFHA 3D3WB 1LU9A 1N92A 3AM3A 1REPC 2QQ5A 5ICCA 1WWKA 1ZSYA 4JK3A 3WX0A 5DCUA 4CM1A 1SD4A 5CDTA 2BFMA 4D3DA 2FHSA 1UHMA 1A9YA 5A2QZ 3V8KA 1W8DA 2UV8A 2MBFA 1TVEA 4TKLA 3LC1O 4ASNA 1NQ5A 4HF1A 4EEXA 5HLIA 3C8MA 2DLLA 2IA2A 1FOKA 3ZWMA 3L09A 1JU9A 1KVUA 4FFOA 4P4NA 1IPFA 2YDYA 1BVRA 3L77A 1F1ZA 5TT1A 2E7XA 4W9NC 2OA4A 4PZJA 1ENYA 2PD4A 2BELA 5L4SA 3HSFA 4HUJA 4URFA 3EMKA 1BBYA 1RNLA 4GVXA 2BEOA 5I7EA 4MTDA 4UVCA 5T67A 1RI7A 5L7YA 4RPLA 1KERA 3GG9A 4GX0A 5EERA 3OOPA 2X6TA 1XN7A 1ZAOA 1E5LA 4MIOA 2A6HF 2O61A 1IRGA 3WGTA 1U5TA 4TWRA 4H15A 1DFIA 2RIRA 3Q3CA 4IDBA 4J9VA 4R1SA 4RB2C 2VOJA 4MVJD 3PZBA 1QNTA 2HYFA 1YBVA 1J6UA 3UKOA 4OOIA 4ND3A 3FHLA 3EY4A 4GLOA 4ITUA 3JQCA 2IRFG 2F2EA 5I7VA 1XGNA 4IXTA 1W7PA 2GXBA 1K6XA 2EG9A 3U5TA 2NNNA 2OBYA 2C59A 5EESA 4KDEA 1TW2A 2RV8A 1PS9A 2AEJA 1PP7U 1E7YA 4OAQA 2B5VA 5COBA 4E2YA 3FXRA 1BWSA 2K4BA 3E97A 2GN6A 2NVWA 1ISMA 4ND1A 1WW8A 1G3TA 3P7MA 1EK6A 2O2YA 3MZ0A 4GAEA 1MDMA 3QWIA 4LMPA 4AJIA 4BV8A 4L0ZB 2V6CA 5JAMA 5FI5A 1Q7GA 1PZEA 4HF0A 2DBBA 1TTYA 3RQSA 3HSRA 1XA0A 4OINF 1ISGA 1G4DA 1I5RA 2PD3A 2QYTA 5JDCA 2IZ0A 1IAWA 1DOHA 5H6QA 4H16A 5JNLA 4PLFA 3H5NA 1NYTA 4L73A 2P9EA 5A5EA 4TVOA 5A9SA 3QVSA 3B73A 4OSOA 4U0JA 4I9NA 3WJ7A 1UUFA 1UXGA 2DK8A 3FNEA 4U5QA 1EUDA 4JLWA 2VXZA 3PWKA 4XDZA 5L3ZA 4ID9A 2G5CA 3AM4A 4FBGA 1AXGA 3W4IA 5TGDA 5HLHA 1FXSA 4W6ZA 2ZCWA 2Q0OA 3RUCA 1F5TA 1C0PA 3NDIA 4HNGA 5JAZA 3JD0A 3S2EA 2YFHA 5HS7A 5DCYA 2V7PA 3RKYA 1A27A 4IDDA 4D42A 3L4BA 1Q1NA 1PSDA 4YDRA 1P4AA 4U0KA 1GYRA 2CD9A 2JCVA 3GGGA 2NU9A 3NT4A 3TZQA 2E82A 4BNGA 1YBMA 2TMGA 4MKXA 5MDHA 3K92A 3GR6A 1T2CA 4RLSA 3TOBA 5KNLA 3ZH2A 2H6BA 4LVCA 4B3HA 3FMQA 5GZ3A 1KA8A 2VBZA 3VOEA 2DFDA 1J49A 4MVJH 4CMIA 1H9AA 3ZMVA 1ZJZA 3QPTA 2XROA 3AU8A 3PI7A 3OHSX 4DGSA 1B3RA 5HS8A 3JV7A 4WNIA 1P1KA 1PL6A 1YJQA 3MJTA 1J75A 3O8QB 3FBGA 3ZV4A 1E7QA 2CSUA 2JFFA 2G9WA 4ENKA 1AE1A 1NR1A 4XCVA 3JQDA 4E5YA 4UV9A 3AI1A 5IAAA 1ZFNA 4XQCA 4B3IA 3N97A 3FN4A 3KLMX 1XCBA 3HB5X 2ZK7A 1MG0A 1EE2A 4HV5A 4KTTE 2JD0A 4E5PA 1R1TA 5JE8A 4RVGA 1J9IA 2HMWA 1M2WA 3N7UA 3DBLA 4BNMA 4ZRMA 2AEMA 2AHRA 1LEBA 1MP0A 3TZCA 2XPCA 5KKAA 2RHRA 3HZZA 4RL6A 3REOA 3I9OA 3AY3A 5ICMA 4G6DA 3PJDA 4X54A 4N9IA 2ZB3A 3WWZA 1Q2XA 1XIVA 4MVJM 4G7HF 4BO5A 2CUKA 3OEYA 4YJGA 1V3VA 5EQFA 4CM8A 3KFWX 3BJ6A 5L3FA 1LSUA 3ZWBA 3D5QA 4BGIA 2VZ0A 1PP8F 1FSHA 3CSDA 1WSUA 1L0OC 3ETEA 4HYEA 8LDHA 1J0XO 1U4OA 1V35A 4CMKA 4KWIA 1CRWG 2Z3YA 1BRMA 2VHYA 3SC6A 3SC4A 4HW0A 5I7SA 3WJAA 1V6AA 3TOZA 2X58A 2HQRA 1RYDA 5IN4A 4KMFA 4F45A 4WEQA 4G5HA 1EFLA 3GUYA 2HU2A 1G3WA 5JDIA 4A5NA 1PGQA 4I08A 1CDOA 4ALLA 4FB5A 1I10A 2FNPA 4OIPF 3PJGA 1HDYA 3HWRA 5IT9Z 4IJKA 3QY9A 2O4CA 4D41A 4CM4B 3PHJA 2EJWA 1P33A 4TRMA 3P9CA 2BHLA 1U5CA 3V8LA 1YL5A 2HS5A 1PQPA 2UUPA 4JBHA 4FCCA 3CE6A 2M5WA 2H94A 3DZGA 3LA7A 3EGOA 3CEAA 1MX3A 1UP6A 1YOVA 3K5PA 3R3SA 5FGMA 4QO8A 4R54A 3TPCA 5KKCA 3K1MA 4DNCA 4IZHA 1U4SA 5THKA 3T5XA 3Q9VA 5LHHA 3ADPA 2PFGA 3GG2A 3KXDA 3GVAA 2I9PA 3Q0EA 4IDCA 4BNFA 2Q3EA 4EM0B 2OBPA 1M66A 1USTA 3EUHA 2QYSA 3KYDB 3ZU4A 1C1XB 2BMAA 3WMWA 1P4XA 3K1PA 1PGOA 2FPPA 4EZBA 3F21A 2VE9A 2P5KA 1CF7B 4CDGA 3QVOA 3ULKA 3ZN2A 5H6RA 2XAHA 3GFJA 1ZLJA 3WODF 4CM8B 1LSSA 2FQ3A 1D8AA 2QZZA 4UUNA 2BGKA 4DUPA 4XKJA 5D8KB 5DZSA 3WGZA 1CETA 2E49A 3I9KA 2O7QA 4IZIA 1QYCA 4IDGA 3H4VA 2GZWA 3RYPA 1WMBA 5LHIA 2I66A 4RZHA 3HHGA 4M6YA 1CIVA 2C5AA 3BJAA 1F9NA 3STHA 4N5MA 1B8VA 4CQMB 1BXKA 1HW5A 2L02A 3NQOA 4A2UA 1B0AA 3I54A 3M1AA 3R60A 1ID1A 2DFVA 2EGGA 2PKQP 3KP4A 2DTRA 3F6YA 2QX7A 1BW9B 2VT2A 3HHPA 3GEDA 1NPDA 4MVJP 1HL3A 2C54A 3KM0A 1K5HA 1AN9A 3WBBA 1E7MA 3JQGB 3GDOA 1HTBA 2JRTA 3I59A 4S05A 4DYVA 4E2WA 4MTEA 4FJ1A 3IC7A 5LLQA 1T2DA 3H3UA 2VHWA 4WLEA 4Z0TA 4BO1A 1Y9AA 3AUSA 1WKMA 3GZ5A 2LDUA 4RAZA 3LLVA 2EA2A 4UUOA 1WPQA 4CL3A 2IA1A 2UDPA 3KLPX 2FEZA 5CVVA 5K6AA 5EMHA 1XDUA 3TO6A 3RC1A 1YB1A 2A35A 5AIPA 2PGDA 4KMSA 1DC3A 3WQSB 4A0SA 1KEWA 2VWGA 4FPXA 2JL1A 1I5ZA 1XU7A 4R1UA 4B09A 1C0LA 5ER9A 4NQZA 4DQXA 1U3TA 4ZQHA 5JYEA 1B2LA 1XLTA 2GDZA 4IJVA 4J2HA 2J5QA 2W25A 1U3UA 4NBVA 4WNCA 1V9LA 4NBUA 1Z73A 3WYBA 2D5AA 1TXGA 2YV1A 1P77A 2YFQA 2Z1MA 1BI0A 2A69F 2G7UA 5K5RA 3QWBA 4AVYA 5E18F 3I6IA 7MDHA 3EAGA 4OXKA 2NUAA 4YFXF 4L0YB 1A9ZA 3F22A 3JYPA 2JAPA 4M72A 4OSPA 2KIFA 1EE9A 5F1KA 1Y6JA 1ZEJA 4DPMA 4J7CA 1DPUA 4YFNF 1YQXA 4EJOA 1KY4A 4EI2A 2XAFA 1ZMOA 2ZMEA 4WK8F 4N5NA 4XEHA 1HDXA 3EW7A 5ICFA 3LWFA 2Q8KA 3ZN0A 4KQWA 4E30A 4AIJA 2NU8A 3WGYA 1GZ6A 5LBQA 1GFSA 1BC8C 4BKPA 2FOKA 1BI3A 3EYYA 4OKNA 4YAJA 1H2HA 2Y1FA 4GX2A 5HRUA 4PG6A 2OORA 3GXOA 2D4AA 4UNOA 2X5KO 1R4MB 4P9FA 2GGSA 2I3AA 4UHTA 1D8JA 2WTBA 4WLOA 1W6UA 3HN7A 3HG7A 4N18A 1LJ9A 4XRFA 3DOCA 1BGVA 3I58A 3RUHA 1KIFA 3NEPX 2GPTA 1UXKA 4WLNA 3U49A 4K9DA 4W99A 2IT0A 2PNFA 3LU1A 1EH7A 4ILKA 3TDUC 5HWSA 1M6HA 1R58A 1EVJA 1NASA 1ZUD1 2RKHA 2HOEA 3MAJA 4WLFA 4A0XA 3UICA 3CO6C 3NRVA 2H27A 1NNUA 4RLHA 1IXSB 1ISIA 3I5UA 4U7DA 3AJRA 2ZTVA 1N9GA 2X5JO 3AUTA 3PFWO 3WYCA 1LC3A 4MQ9F 4IQ0A 4WKGA 1FDTA 1C0WA 3WE2A 1PR9A 1XEAA 3JSPA 2AQKA 1XHLA 3GH3A 4FW8A 3QRWA 4BH9A 2DK5A 1H93A 1PEDA 1JWBB 3OA0A 4M1QA 1KVTA 1HZZA 1PQWA 1SNYA 1ZIDA 2DTEA 1W4MA 3FD8A 2QRLA 3MJVA 4RB0A 1B4AA 3HNPA 5DF1A 1QORA 4LG0B 5ILVA 4QX6A 1RWBA 4A6DA 1ON1A 4BO7A 1JDJA 3AOEC 2Q46A 2HJRA 2GN4A 1IRFA 2QRJA 1P4WA 4NIMA 1KQ9A 5ER6A 2HDHA 2RAFA 2W2KB 2D45A 2W2LD 2W24A 3JQBA 1K78A 4BB6A 1NFRA 3JSOA 1R15A 3ONDA 4JCOA 4XGKA 3DMYA 1HSZA 2X9VA 4BNWA 1I32A 1O89A 1KS9A 3O3KA 4GXOA 5DEQA 1ZW1A 3DZHA 3ZWNA 2XV4S 3LK7A 4Z2YA 4W82A 3F8BA 2FNAA 4OJNA 2CQKA 4L9NA 2HFHA 4IHTA 5KJ1A 3HDJA 4O6VA 3E5UA 4PLZA 3U1DA 3GF4A 4PLPA 1V3UA 2DT5A 4JXKA 2A4KA 4BV9A 2WM3A 3DZJA 4JIGA 2J3IA 4Q3EA 1QLJA 2CVZA 4ESJA 3E5RA 4Y6RA 3RIHA 3BJOA 4TRRA 5T64A 3T4EA 3ZWAA 1TW3A 1EQ2A 1YGYA 2P5UA 1TNSA 1VRWA 1I0ZA 1UFMA 3GGOA 3LSYA 1PWXA 4ZZLA 4XIJA 4GL4A 3RI4A 2A61A 1IZ0A 3E18A 3U4CA 1IY8A 1OYIA 1QQIA 3CZMA 4GMFA 2KRFA 5KK1A 2Q49A 1NAIA 3I9MA 4II3A 1F8FA 5I7FA 1PJ2A 3DEUA 1C3VA 3ZU5A 4N54A 2PMHA 4R9RA 5U4QA 2RH4A 3LYLA 4CM4A 2BKAA 5HS4A 5KOIA 3SLGA 4PZEA 1IN6A 5B4UA 2EKLA 5JS6A 1GPJA 1J5YA 2VHZA 4Y8VA 2D59A 3L4BC 1AUPA 1DFHA 3E6BA 2VC1A 2ELHA 2HJSA 2V6BA 2BI8A 2WD8A 2RN7A 2Q4BA 3GNSA 4HLYA 4XRRA 2EKPA 3CJNA 3GAZA 1UDAA 3G3ZA 3KRTA 5EIOA 1GZ3A 3RPUA 4WOKA 4M55A 5T57A 4DA9A 1DC5A 3VKUA 5DUKA 2H5LA 2VNAA 5KJ6A 3HADA 1O9BA 1XSVA 4M9ZA 1YO5C 3LSTA 4XLNF 3AY7A 3MTGA 3PRJA 4Q3DA 4INAA 5TRDA 5F6FA 3GWZA 1J4AA 3AM5A 2DVMA 3SX2A 4XLPF 1TNTA 4E31A 3I3OA 4QECA 1WDMA 1YXMA 5AXCA 3P2OA 3W8EA 1EEHA 2L4AA 4AD9A 2EXXA 4MIEA 2D5CA 1PJSA 2Y68A 1ZK3A 2ZATA 3HRSA 5J23A 5IZCA 3PIIA 4XGIA 1MKMA 3NV9A 4E0BA 1MFZA 1I01A 3LC7O 4AJOA 4XYLA 3HSKA 2L54A 3JQ6A 4TZTA 3D0SA 4FFLA 1H6BA 4KDFA 2ZKLA 4R8HA 2PH3A 5K1YA 2IVMA 5JBIA 1ZK1A 3D3WA 4WWCA 1K0UA 2XXJA 4QUKA 2C07A 3ZI0A 4HV4A 4IIUA 2YU3A 3HE3A 1ZSNA 4BQRA 4NDNE 4MIYA 3ZWYA 4ALNA 3W8DA 3FF5A 2FPIA 3ZHYA 3QE3A 2Y1OA 3B1JA 1G0OA 2ZJ1A 2VN8A 3BA1A 3VZSA 3FMRA 4WCFA 3C7CB 5B1YA 3L9FA 3AW9A 1Z6TA 2CW0F 1K2WA 2DUUA 4LB6B 1XQ6A 1YQGA 4KZPA 5F3RA 3WNVA 2M87A 1YL6A 1K6JA 2WD7A 3R3JA 2XIGA 1BTOA 4II2A 3DV8A 3KYCB 4NBTA 4OXYA 1R7JA 4A73A 1GV1A 3NX4A 3VEPA 1E3SA 1GDHA 5L4LA 1LLDA 1RPNA 2MLKA 3ROQA 2LDXA 4WXCA 2KJBA 3RU7A 5CDGA 4B7UA 4BO4A 4XA8A 1WAMA 4XYMA 2F5CA 4PIVA 5JCJA 5JMPA 1LRJA 4YVFA 3UXYA 1RM3A 1E3EA 3F3SA 2BGCA 2CFXA 3HUGA 4LMRA 2PY6A 3L7WA 2O50A 5BPIA 1GL3A 3IP3A 3LQRA 2EV0A 2K02A 2ET6A 1EMDA 1A4UA 4F46A 5L7WA 5J8CA 5IG2A 4S1VA 1K89A 3ZGYA 1S3JA 2V79A 3WE3A 2V6MA 3KYBA 5I9MA 2PJPA 1F06A 4YT2A 1B15A 2IEBA 2CDAA 2JD1A 2VHXA 1LLCA 3I52A 3QW2A 3ZMSA 4IS2A 3OIGA 2HEOA 1DJNA 1WWXA 3V1TC 1ZG1A 3UHAA 1KU9A 2PGLA 3TFQA 1FP1D 3F9IA 1DB3A 3DPTA 2ZNYA 2GA1A 5JVTA 3OIDA 5KVCA 5LC1A 2A07F 5TX7A 4MGRA 5HDGA 2MA3A 1MUUA 2W90A 3GUDA 3FWZA 2NYXA 3O2PE 3H9QA 1E1NA 5DDIP 4CM9A 1UHWA 3I0TA 1YFHA 3C18A 2JD2A 1MB4A 4JJIA 4OH1A 4R16A 4YT5A 5F5LA 1DJQA 3E5MA 3ZMUA 4KDPA 1E3IA 3CIFA 4K1LA 3EK2A 4HA8A 5DUIA 4P8RA 3ADOA 5CPFA 2CVQA 3H9EO 5JCXA 1BOAA 5KJCA 2F1KA 5A1TA 2IP2A 3GEZA 3RYRA 4XX0A 2B69A 2Q2WA 3JQAB 3QQPA 3TRIA 4BGEA 4OIQF 4BAYA 5FLXK 3LA2A 3Q6IA 5IDYA 2WWRA 4XR9A 1RKXA 4O59O 3PQJA 4QFDA 3ZNPA 3ONFA 3Q11A 2Z95A 4J3FA 5LDHA 3VFZA 4P9UA 3HFGA 4N9HA 1EVIA 2YJZA 4WCGA 4PLHA 4AIHA 1PJ3A 1FP2A 1SOVA 2YQ4A 3ST7A 4C7KA 3DFGA 4AWXB 5A9TA 3WQQA 5D6FA 2FR8A 2DQRA 3UW3A 2NVUB 3DFZA 5K5QA 5CVRA 2EP5A 3TKYA 4J4HA 4PCQA 2QQ9A 4NHJA 3OV8A 3OFSA 4YRAA 4XYEA 1I2CA 3W1VA 4B79A 5FFXA 1YDWA 2C29D 2ZB4A 3BMOB 3FR8A 5IXSA 1P31A 3DL2A 3TN7A 1J59A 3R0JA 1I8TA 2VYVA 3U0BA 4YRDA 3ELKA 4NNJA 3H2SA 1QZZA 2CO5A 5TRTA 2F5FA 5TJJA 2EV9A 3HDHA 2O8XA 5L3GA 1TA4A 4LMYA 5D5XB 4IXAA 4E3ZA 1U8RA 4RZIA 1PQUA 2J5RA 1EVYA 3K2ZA 1ML3A 3IC5A 4EQQA 2OGUA 4A12A 3E9MA 9LDBA 4J2OA 4BKOA 1IHXA 2R2GA 1NQTA 3NUGA 4OO3A 5ES3A 2GZ1A 5HA5A 5LEJA 3L9WA 1O7FA 2K4JA 2XAJA 3D5LA 1YQAA 2DBZA 2VUUA 2IXBA 3ANNA 3FPCA 4IDFA 4NJMA 1R1UA 1BIAA 3WS7A 4BNXA 2X0IA 4AJEA 2AQ8A 2ZIZA 3GA0A 2QENA 5HDNA 2DPGA 4GPD1 3RUAA 3ABTA 3V7CA 3VTFA 2OP1A 2ZYDA 4Q39A 4Q48A 5CEJA 1G3YA 4WCDA 3GNTA 2G76A 3TQHA 3GLQA 4BB5A 3IL2A 1H6AA 1YJ8A 1YS4A 5FFZA 1I1SA 1Z75A 2GZ3A 3NJ4A 4J16A 5EINA 4DL9A 3ZMZA 1DC4A 1DBVO 2R3SA 1DXYA 1K7AA 2CDBA 2JT1A 2JPCA 2J8ZA 2X5OA 4UULA 4W4TA 1O7LA 2BD0A 4LLLA 5F1OA 4ZD6A 4EITA 2Z5UA 3DF8A 1VC2A 1XU9A 3D4OA 3KV3O 3RAJA 2PZMA 3GZ6A 3Q5FA 1U7TA 3JQ8A 3PJEA 4CUKA 1FZPB 1YB5A 2PG4A 1YL7A 4NMHA 3W8FA 3EHEA 1PL7A 3EZLA 1PZFA 4LRSB 4WXDA 4WUVA 1TBXA 1XCVA 1HZJA 1ZJYA 3B20A 3C24A 3QJ5A 2YX7A 3LQQA 1C1DA 4G94A 2XOXA 4Y98A 3V8BA 2J5PA 3RJ9A 3I59B 3AWDA 5LRSA 2Q2QA 4M86A 1JQBA 3DMTA 4NK5A 4RPKA 5T6BA 4D3FA 4XB2A 2DUWA 3BROA 1W5TA 1ADGA 2J5KA 4OXNA 1SBYA 2PN6A 3T8TA 2X4HA 3JD3A 3QP6A 3BTOA 1I30A 3VB2A 3TSCA 1X0VA 1Z7EA 2PZJA 4PG4A 3DAFA 2J3JA 3LA3A 1M76A 2X7HA 2JKVA 1BHSA 3C7DB 4RV9A 5A3JA 5I9NA 3CUQB 1RUNA 4D45A 1ZLKA 4NU6A 4Z6KA 4RORA 2YHUA 4B8ZA 4WXHA 4CLRA 3HJAA 4HX7A 4RAYA 3GVXA 3JQFC 2H6CA 3KB6A 1YTYA 1AHIA 2B0JA 2OAZA 3GVHA 4A10A 2HRBA 2P6SA 2B0LA 1YB4A 2UVDA 3GPIA 1RJWA 3PWSA 5J8FA 2QBYB 4RF2A 3Q9NA 5DBIA 4UEOA 1IXRC 2IEDA 3DBHA 4MQVA 3HUDA 1Z7BA 4CJXA 4I1IA 4CLEA 1UAYA 2FP4A 3EC7A 3JQAA 1WP4A 5D4SA 4L5JA 3WTVC 4BMSA 4BNCA 1ZGAA 4YFKF 4G7OF 4O5OA 5CHEA 3MJCA 3RVDA 3OM9A 2QYOA 2DTXA 4Q4ZF 5IF3A 1TQIA 1JAYA 1LNQA 4RDHA 3TZKA 2FE3A 2GWRA 2DM6A 3DZFA 1H2BA 4G2NA 1KOLA 5BSGA 4KYWA 4WECA 2M45A 1NPTO 2JAHA 5DDGA 2Z5LA 3S2WA 2D2WA 1X14A 3QVXA 3I23A 3RUIA 4TRNA 5TQVA 1ZRCA 1N1GA 4XB1A 3I4PA 2EGHA 2HTSA 3A9WA 3IRQA 1O94A 1WXDA 4RVSA 2QLZA 1XDWA 4MVJE 3VODA 1E77A 2CF6A 3GLXA 3VH4A 3QHAA 3EYWA 4DLBA 4R1NA 3QU6A 3WB9A 4BUCA 5TF4A 1K6IA 4KIFA 4OOFA 5I9LA 1I3KA 3K0LA 3INRA 4YB8A 1QZYA 1PS8A 2O48X 3HFSA 3GFGA 4AJ4A 1G6KA 2Q2EA 3WGGA 3H5RA 5IDWA 4BIIA 1SMKA 4CPDA 3IWFA 5DT9A 1F17A 5AXDA 4ZHSA 4YR9A 2J3KA 2B5WA 5D4RA 3PFIA 3F8CA 3IQDB 3KYDA 4Z0HO 2Y0EA 2LF7A 2RNJA 1YDEA 3MZHA 2VZ8A 4PLWA 3RBXA 1B14A 1CF7A 5G0UA 5JAQA 1Y5RA 3GVPA 2KIUA 4RF4A 2X1HA 4NJMB 2AQIA 1VM6A 4IGFA 4NFSA 4OHUA 4I09A 4OIMA 4CM7A 1H9GA 1WQ2A 1U28A 3ZHZA 1LDDA 1G1AA 1IXCA 3TDKA 3ERED 4I2OA 4IJAA 2YPRA 1VKNA 3F5QA 3FZVA 2BV6A 2VCYA 4MHGA 2Y75A 1Y8RB 3C1TA 3COSA 2AE1A 4LISA 3OA2A 3ISPA 4Y6PA 4J6FA 4IRGA 1UJMA 4IIVA 1OPCA 1LDGA 1G6NA 2YSRA 4YAIA 5IZ4A 8ADHA 3D7LA 4KA4A 3E03A 4OYRA 4CMJA 4FX0A 3SXPA 3KBOA 4RO0A 4JROA 4CHUA 3VZPA 2FMYA 1NWHA 2GERA 5JO0A 1U8XX 2BFPA 3VVBA 1GAEO 3WMXA 1HF3A 1U1IA 3KSDO 3DDNA 1F8GA 1V3FA 1MC5A 1ULUA 1EK5A 4CLDA 2Q1UA 2DO7A 4BNTA 1GU7A 3HRUA 3FHZA 4GX5A 4MVJI 4B7XA 4BO8A 4DVJA 4FHTA 3GO5A 1F14A 4L0QA 4JBIA 4GX1A 3WTUC 3BXXA 4H7PA 3RC9A 3RFTA 2YY7A 1ZK2A 4WF2A 3QVWA 4D43A 2L01A 4BGUA 4A5MA 3GFLA 1UXJA 4HFJA 2I3GA 4UV8A 4IRIA 5D5UB 2P5YA 5ADHA 3I9JA 2IYOA 3K6JA 3MOIA 2FSWA 1PZHA 2QG4A 3GK3A 3ZZNA 1FLIA 2FN7A 3BZUA 3E6CC 4MO2A 2ESHA 3AI2A 1CJCA 1HXHA 1P3DA 3P9KA 1GUYA 3I6QA 5FO5A 1OOEA 3JQ9A 3PHGA 3ZV3A 4CR8A 2VBXA 4HNHA 6ADHA 1E6WA 2FBHA 4BHTA 3ENKA 1OAAA 5B4VA 1J7KA 3CO7C 1HE4A 1N5DA 3HOTA 4XD2A 1FMCA 1XQ1A 1DIHA 2FZEA 4MP8A 3SZTA 4EEZA 4YT4A 4CICA 1CQJA 1YONA 4NK4A 4Q3AA 2VQ3A 4MKZA 4CQLB 3SQNA 1NVMB 4YPOA 1E7WA 3PHLA 3F6VA 3P7NA 4IQGA 1SD5A 4YXFA 4IPAA 4AG3A 3O03A 1KGSA 2I67A 4NJOA 4XZ3A 4YIIA 3HB4X 2AG5A 2GZ2A 4IGEA 2FWMX 4Y9DA 5ENDA 5C7OO 4RVHA 4MDHA 3OJ0A 4P5OA 5EN4A 2R00C 4ZA2A 5DCMA 1LLQA 4W7HA 1U2WA 2DU9A 1R36A 1KETA 3V4GA 4HZFA 2J6IA 4EUFA 3U09A 5ILGA 2RC4A 4EJ0A 2SCUA 2HQ1A 2D3TA 1VL6A 1P74A 3ABUA 4WK6A 1VPDA 1LDBA 2G17A 3GHYA 2HMTA 1JVSA 1QYDA 4LCJA 4Z9FA 1LSJA 2QVOA 1LA2A 3VVCA 1FT9A 1TQMA 1GEEA 1R4MA 2GUGA 1XWFA 2WMDA 3I83A 4BO9A 5A06A 5K0ZA 5ED4A 1VSUA 4ZYGA 5TNXA 4B4VA 3PYXA 1GPDG 5ICEA 4XWYA 2EFQA 3IKVA 4CYDA 3IHUA 3RSHA 1HRDA 3RTRA 4QWQA 1V3TA 2BLLA 3J80Z 4BNUA 3GT0A 1H94A 3DBRB 1UR5A 2UYYA 2X23A 4J1QA 1SMYF 1YBAA 2Q45A 3VPHA 3FSRA 1U5AA 2DQ4A 3F4BA 4XRGA 4FFNA 4IVNA 1RM4A 5BSFA 4AJHA 1GY8A 4CR6A 4XYGA 5CYVA 1O3TA 2YHIA 5DD4A 4TZKA 2FZWA 1AOYA 1HYGA 1O57A 2UXXA 4WCFC 3LAPA 3QPHA 4RB1A 1EUZA 1IN4A 4J4TA 3J81K 3EYIA 4BHBA 3MEXA 1PWZA 2VYNA 1B8UA 1IN5A 2P4HX 3JQ7A 5BMZA 1UZNA 3H92A 4YJFA 2C2YA 3K30A 1NP3A 1KVSA 3DXFA 2UAGA 3DQPA 4G6QA 4R3NA 3RROA 4CMGA 4QXMA 5D8LB 4RGXA 4JQFA 1AGNA 3RJPA 5ERIA 1YOVB 3IAHA 4MINA 4NZ9A 1MJBA 2QRKA 4J7UA 1NR7A 5I8ZA 4MPDA 4OIOF 4UEKA 3F72A 1QXSA 3PQDA 1QRRA 4GGOA 1QV6A 2Y93A 4J7XA 5JCJD 4AL4A 3HN2A 3K9TA 4ND4A 4LGWA 2I65A 3PJFA 3CDHA 4G65A 4LD5A 3GN1A 2X8LA 3JTMA 1KU7A 3OETA 3ROMA 3NRCA 5A05A 1HDZA 2CF5A 4PRLA 3GEGA 1Y1PA 1RIOH 1ADFA 5FLXZ 3LT4A 4L18B 4MVJA 5E8GA 1OYYA 1Z9CA 2C7GA 2Y66A 4E5MA 1W0CA 4Y67A 5JY6A 5BQFA 5BR7A 4M9SA 4A5OA 3Q2KA 5L4NA 3WOHA 1WVGA 2HK9A 3UCFA 1ZSVA 4E4YA 4I8XA 4EM2A 4L5IA 3U4DA 1NBOA 1DP7P 2CVOA 1BW9A 3FM3A 1LX6A 4HBGA 4ZQGA 2VWPA 1A71A 2DLDA 1A7AA 3H2ZA 3RBVA 3OJEA 2XKPA 2I6TA 1S6LA 5D5WB 4BNIA 5JFOA 4YJFB 4BVAA 3K73O 1VTNC 1JN0A 3QAHA 4XQ9A 3M8FA 3WGHA 3KYCA 4B3JA 3GPDG 3ICPA 4DQVA 5TJHA 3K1NA 3R61A 4RCVA 1UDCA 1R0SA 3PDUA 4J9UE 3DB2A 2QUFA 3B1FA 2GIVA 2Z9OA 5EQDA 3BMQB 1TB4A 1DSSG 4GMGA 2Y1CA 3JW4A 3PQFA 1HETA 3B1KA 2Z33A 1FNNA 5E20A 1NHAA 1PL8A 4IRHA 1BMDA 4J1SA 4U7WA 3V1YA 4Y13A 1LUAA 3V2UA 1PZGA 3AY6A 1PGNA 1XELA 3I4FA 3PVZA 3R0IA 2M1BA 5IFLA 2PEXA 4HV6A 4BKRA 3KSUA 4BO2A 4EJMA 5KVSA 1FPQA 1H5QA 3EZYA 1ONNA 3BMOA 1E2XA 4MKRA 3ZWPA 1U5TC 3ZWCA 1WRJA 2GSDA 1D4FA 1U2DA 3F1LA 2RDPA 3GVCA 3H8VA 4O63O 4GH5A 5DOZA 5FYDA 2P6TA 1ENOA 3NAQA 3O8QA 1SO8A 1I27A 3T8RA 3TJRA 1Z91A 4C7JA 4DIOA 2M30A 3WTSC 1IW7F 1Y9EA 1GUFA 2NVBA 2OL4A 4IPTA 5JMWA 1HKQA 4PGGA 1U7HA 3AUAA 4BNLA 3SLKA 1PGPA 3DQVC 4RGRA 2QM3A 2B83A 3H7AA 2WWYA 2QBYA 1U6GA 2DQLA 2JHGA 4PGFA 1DAOA 4D44A 5THQA 4BNJA 1U3WA 4HFRA 4U0VA 4YCAA 1D8KA 4EDFA 1WNTA 2X22A 4RGSA 4XGNA 3OQ6A 1P0FA 3MOGA 3KZYA 5CP8A 2VHVA 2VE8A 4LRTB 1NHWA 1R23A 2B35A 2JTVA 3I1JA 1DLIA 1S29A 4YJGB 4LK0F 1MA0A 2EJVA 1OI7A 1T0FA 3AU9A 3HDYA 2F00A 1ZXLA 3FTPA 3HSEA 4GO1A 2Y48A 3L6DA 3LT1A 3RUFA 4PG8A 2LDBA 1MGTA 5GZ6A 4PFJA 2HMVA 2EFPA 2VWQA 3ANLA 3UGKA 3KP3A 1O3SA 4HXYA 3DC2A 3IS3A 2W98A 1LLUA 2NAZA 3J81Z 2RQPA 2L4MA 2E6UX 3FF4A 3E5XA 4I5DA 4A2CA 2EFNA 5JI6A 1TT5B 3GZNB 4ZRNA 3PXXA 3OBBA 4CODB 3O4RA 4XDYA 1GQYA 4Q47A 1LDJA 4A7PA 4JJGA 4TSKA 3CKYA 2HUNA 5LCXA 6PAXA 1B9NA 2XRNA 3M8EA 3FMSA 3CZRA 2NU6A 3VC7A 3BPVA 3KEQA 2CMDA 4ALJA 5EEGA 2V6FA 3EUWA 1NHGA 2ZB7A 1E6EA 5JXWA 4EJVA 1LB2A 1HE3A 5JHUA 2FR1A 3G49A 4IDEA 4Y6SA 4YACA 5AOVA 3TZ6A 4YYZA 1K3TA 5T8KC 4IHSA 4KN7X 4O5VA 4LK1F 3AI3A 3TO7A 1JKFA 2O3QA 3BYZA 1E17A 2AS5F 1ULSA 4ZZDA 5FD6A 4WGGA 1HXDA 3RKXA 4CM9D 1F4KA 5I8WA 3BP8A 3F46A 3TL2A 4A0YA 1Z1DA 1NFQA 4OQYA 2DKNA 2JCXA 2QIOA 1P1HA 1YE3A 4PGHA 1XKQA 1ZNQO 3GOHA 4FR5A 4EGZA 2WSBA 4WE3A 1D1TA 2PA3A 1C14A 3JD2A 3OQ1A 2NU7A 1BG6A 1RM0A 2FSVA 2ZTMA 4NR0A 5IN5A 3HRMA 2BYVE 2O23A 1DPRA 4RDIA 4EV0A 2POQX 5GY7A 1HE5A 1Q0LA 1YKFA 4A6EA 2LNBA 2CYYA 1LNWA 4OU0A 1X7HA 3CUOA 3GMSA 4DIFA 2D8AA 3DEYX 2Y1DA 4G7ZF 3GC6A 4B4WA 4D0PA 1JHFA 1JA9A 3C1DA 3I64A 1JTVA 3NT2A 5HM8A 3INTA 4NG5A 1AXEA 2VYND 5G2OA 5AQ1A 2A92A 2FBIA 4IJUA 5AXBA 3ICCA 4KNYA 3A06A 4P4GA 5IJZA 1YG2A 3ZNNA 2PZKA 4CV2A 2P5VA 4GGPA 3M1EA 4IQ8A 2IA0A 4Z9XA 1Q0HA 2AXQA 4RS8A 3VDQA 4IMPA 4OOEA 2C0CA 5CG2A 1IN8A 2ADUA 2E1NA 2PD6A 3E6MA 1E3LA 2EF1A 2ZQZA 3E9NA 1C1DB 3ZQ7A 1USSA 5G4KA 3ASVA 2Q50A 4EGFA 2E4AA 3K31A 4MP3A 5HTOA 2GF2A 2IZZA 1MD0A 4BO6A 4M9XA 4RGBA 1SFUA 3COAC 1MGOA 1TI7A 1WZIA 3MTJA 4UVDA 2BRUA 1QV7A 5BNFA 3PFFA 3VTZA 2C20A 4OM8A 5B4TA 3GX4X 2EFWA 1BI1A 4H3VA 3UF0A 2QQBA 1BM9A 5L3BA 2PGJA 1S7AA 3IRRA 5ICSA 3QWFA 3WG9A 4YIFA 4TMFA 1YYVA 3GRKA 1FYKA 4BNNA 1ZH5A 1HDOA 5K9ZA 4BHCA 3PGXA 1VE9A 3RUDA 4L8VA 3ZDFA 1EH6A 2PV7A 1GD1O 1LDMA 1NVGA 4OMUA 1ZG5A 4FGSA 4EM1A 2ZYAA 4R1TA 5T5QA 3G0OA 4I5GA 2YW9A 3ZW9A 1MJ9A 2V1XA 5F21A 5FI3A 1B6AA 4B8WA 2ZMEB 4PLTA 3S55A 7ADHA 1KBZA 5K5OA 2O2SA 4BQAA 1R0LA 2GRAA 4EJ6A 1VJ0A 1L7DA 5L7TA 3VZRA 3K8ZA 5DBGA 4B4UA 4M71A 1Q0QA 2K86A 2X4GA 1GR0A 4JP3A 5DCFA 1LSOA 4HX5A 4E70A 2IODA 1ZO8A 1GQ2A 3ZN1A 5HS9A 4W9NA 1LDYA 4MEYF 4ETSA 4NFYA 5L40A 4FFMA 3RPQA 1DHRA 4RJTA 4D0SA 1WDLA 3NTQA 2VRBA 1EQUA 1LBEA 3N4MA 4EJTA 2Z99A 1YS7A 5JR3A 4LB5A 3FNGA 1I3MA 2B37A 4CMEC 1JE8A 1ISHA 3B02A 1T26A 2Q2VA 1KU2A 2ZCUA 4HOBA 3FWNA 1H6CA 3H3FA 3RC2A 2LKPA 3SBOA 4HY3A 5CAEA 1PDNC 4PN3A 2C82A 2TDXA 3FXQA 4QO7A 4A03A 1FC3A 3QP5A 1SPXA 2GCGA 3E6AA 4ON0A 4UVAA 2WYWA 2YX4A 3KO8A 2MLGA 3OSUA 6LDHA 1IL0A 1U2GA 1JVBA 5KVQA 3FXUA 1R4NB 1ZHFA 1CQIA 3NEUA 5HOOA 1LXCA 4AJLA 3TZHA 1B7GO 1L3LA 1QKIA 3KEOA 1BXZA 1C0IA 3QP9A 4XQEA 3U3XA 2ZJ2A 4GVLA 4BKQA 2CDCA 4I5EA 4QFCA 2GAUA 3CTAA 1MJAA 3HIFA 1IF1A 1LRLA 4PRKA 2X9GA 3WU0A 3Q2IA 4GGGA 4Q3NA 4ALKA 4BMVA 1QPMA 1ADCA 2P4WA 1ZREA 1XSDA 2I5PO 3AK4A 2NS0A 2NTJA 4S04A 4WLVA 1IULA 2DAPA 5EJ2A 3PZRA 4I02A 3QWHA 2AQHA 2YUTA 1O0SA 3DBLB 3H65A 5JAIA 5DOVA 1UP7A 5JY1A 4Z9YA 2RGVA 2CGPA 3VPGA 1ONOA 5FEUA 1XB4A 4CGZA 1B26A 4XR4A 2EKQA 1KEPA 4IBOA 5TC4A 3TNLA 4GKVA 1JW9B 4QSMA 4WOJA 3I4CA 3OIFA 3WSWA 1IHYA 2WJPA 2YR2A 2W2LA 3JSAA 4U8GA 1ODDA 2XKOA 3DFUA 3U4HA 5DV5A 1IZ1A 4UVHA 1FYLA 4GSKA 1ZK4A 3WBFA 4ONEA 1B1BA 3UUWA 1E1LA 3DTYA 3PWZA 4KN4X 1GHCA 1Y8RA 3DBHB 4BQPA 2VBWA 4RGUA 1R37A 3GMDA 3ITKA 1FBUA 1X3UA 1YVEI 4M54A 2PMUA 2QHXA 3JQBC 4WLUA 4DC1A 4AIKA 1GCUA 3ECHA 3WQRA 2NADA 1ZCJA 1PUEE 1R12A 2HR3A 3OJFA 4PLGA 3WFIA 2H6EA 3B6ZA 1T1SA 3LC2O 1UZMA 1OFGA 4UUMA 4ZICA 3ZP5A 1EZ4A 2ZFWA 5BQTA 3NDRA 4MJLA 4DBVO 1X13A 1P1JA 1Z6ZA 3U62A 4YT8A 1A5ZA 1QG6A 3HDQA 3CMCO 4CMEA 1DPGA 1JLLA 1MFPA 1NXQA 1P9LA 1FWZA 2FMUA 2NVUA 2OP0A 4YA6A 3T7EA 3IKTA 3NJ8A 1PTJA 3GVIA 4ENJA 4JP2A 2B4RO 2P8TA 2XVCA 1A7KA 4WX9A 2RH8A 2HGCA 2IW5A 3M9AA 3NDJA 3EVNA 2FMLA 4Q9NA 3V8JA 3TWOA 3V1UA 4EUEA 1ZVMA 1N2SA 2Y05A 3KE2A 4KQXA 2IJLA 2ZNZA 1RZ4A 2PBIA 3JYNA 3PK0A 2FU4A 1LDKB 5IT9K 2J3HA 1NAHA 5AXAA 1MXHA 2ZCVA 3VH1A 2WYVA 2VWHA 3RKRA 4IJWA 3ZMTA 2AA3A 1Z74A 2GO1A 2NTNA 1O8CA 1X7GA 2JHFA 1I36A 3BMNA 4E33A 4L75A 2R7DA 2IXAA 2Y0MA 3TOAA 1K6OA 4XJSA 3WTCA 1QMGA 4KUGA 5L51A 3EQLF 1MDMB 1YO6A 5C5IA 5FWNA 3UCXA 1TLTA 5E1XA 1ZBQA 2HCTA 3JTHA 5HBRA 2CNBA 2OD5A 1VKOA 3H3ZA 2OZPA 4UUPA 3F6OA 2P2SA 3MWEB 3GFIA 3CXRA 1P0CA 4JN6B 1E3JA 1GZ4A 4GSLA 2PZLA 2XAAA 3S8MA 1BN5A 3WIDA 3INGA 3MJ4A 5AIQA 2CY0A 4YQYA 3GFMA 1HDCA 3KP2A 2HTJA 4N0BA 2A6EF 2E7WA 4ZYEA 2A5YB 2BI7A 4XSXF 2AW5A 1JGSA 3ZU3A 3X2EA 1A72A 4F6CA 1EV7A 4NBWA 2Q99A 3FM5A 4I9HA 3ZW8A 2WYUA 1ZMTA 3BDDA 1K79A 1EH8A 3L00A 3ML6A 3O6BB 1EFKA 1Z45A 3JQEA 4R1HA 4UUVA 3JD4A 4BNVA 2PTGA 4KWHA 4ESFA 1EVZA 1O5IA 4PVCA 4PLCA 5F5NA 4EMSA 3JQ7B 3CUQC 5BOXA 3E5QA 1CYDA 1XD7A 1W5SA 1BJAA 1HLDA 2DBQA 3LZ6A 2RBEA 3PHIA 5KWEA 3KP5A 5E1ZB 2YQ5A 3WTTC 3E82A 3HQ4O 3K9QO 1DIRA 1SD6A 2EERA 3GEMA 4J90A 3W6ZA 3BAZA 3KLNA 4PLYA 4JJFA 2VOOA 3DHNA 3OJOA 1NM5A 3O26A 1UCRA 4FGWA 3VAZA 4GYIA 1LEHA 3H9GA 3FPLA 3L6EA 4RVUA 3WGQA 3OQBA 4A27A 4CV3A 4RPGA 4HADA 3WNQA 3L4SO 1FY7A 5EL0A 3M7GA 5ENVA 3VHRA 5L3EA 2X0RA 3J80K 4LLGF 5H20A 4KUEA 4OL9A 2NNYA 4KMUX 5AYVA 4J1NA 5D6EA 1XGSA 2EW2A 5LHGA 2R00A 5L95A 3LF2A 3RI3A 2D1VA 4E32A 3GYHX 4O6JA 2C2XA 2C7VA 4IM7A 2O3FA 1P45A 4M74A 1ZYRF 1IB6A 1PS0A 2OHXA 2PLAA 3G17A 3QLJA 4HDUA 4L74A 1SEPA 4MEXF 1P2FA 3L07A 5G0VA 4D3SA 2V1UA 2Y1EA 2BBYA 1DDNA 2RHCA 2V6GA 3G1TA 4AICA 1EBFA 4GKBA 4JK1X 1BIBA 1ENZA 3DAPA 4FN4A 4L9JA 4YAGA 2ZTUA 1D3AA 4UVIA 4K6FA 5TLSA 3U9GA 4PG7A 2EV6A 2EK5A 4WJZA 1LVAA 5CLSA 4RF5A 1Y0UA 2DBVO 3S2IA 2HWVA 2CG4A 5EEHA 4U88A 1T24A 4B4OA 4CM5A 3VOSA 1L7EA 4K2EA 3SXYA 2R6JA 3DZIA 2XGXA 4BO0A 2W8ZA 2K27A 1ONPA 1X1EA 2EJRA 2V9VA 1C0KA 1J5PA 4EJWA 1JWAB 3WGOA 1DFGA 1Y8QA 2EWNA 4B7CA 4PVDA 4DLLA 4CQMA 4J49A 5A5FA 4CL8A 5ILUA 3ENNA 2JFGA 3IWZA 4CLOB 2X0LA 5U9CA 5U1PA 1A04A 1FBQA 1GXQA 2HKXA 5ICGA 2OMEA 1T25A 2A9FA 1W4ZA 1U78A 2NNLD 4FFRA 1KY5A 1IPEA 2Y1GA 1TQPA 3C85A 2J5OA 2I99A 2PLYA 3PHHA 3LT0A 3V2HA 3KLOA 1N8KA 1TT7A 4P55A 5KIAA 2IZ1A 1RYEA 2YZ7A 3IJPA 2UUOA 5DP1A 4DQ2A 3DAGA 4LJZF 3U4IA 5GMOA 1V4RA 1YW7A 2EA4A 1ADBA 1SOWA 2FR0A 4K6CA 1WDKA 5JDIC 5CVJA 1HBXG 4WASA 2O3RA 5TS3A 3GDGA 1OR7A 3PGJA 5LDGA 2W4QA 3JQ8B 2XXBA 3UAGA 3TFOA 3PYLA 3K69A 1OMIA 1F12A 3RD5A 4CUZA 1DIBA 1H9TA 3F8NA 2W57A 2G1UA 1XMAA 4HQEA 2VT3A 2EP7A 2JFHA 4CMIB 1HT0A 5F1RA 1JKJA 3PQEA 3ZWOA 3OJLA 1X1TA 3RFXA 3AUUA 4OMYA 1AWCA 3BOQA 1KC3A 5C37A 1KVRA 3FTNA 3DTTA 4RPJA 3BPXA 4W7IA 1R1VA 1NWCA 2AXLA 1E3WA 5A2QK 3AAFA 4DLAA 3ROKA 1H0KA 1G0NA 4N5LA 2WV0A 1SB9A 1UDBA 5DN9A 3QWAA 4P4LA 2IPQX 3ZCXA 4FT8A 3C3XA 2EIHA 3BTUA 4MOWA 2OQGA 3GN2A 4EUHA 4AJKA 3WTXC 5COQA 2HRZA 1XYGA 5IXYA 2VC0A 4CO8A 2XUBA 3SVTA 5ILSA 3HTSB 3OEWA 2DI3A 3X2FA 1OC4A 1YH3A 3MCVA 1T2EA 3OF2A 3MFKA 3IJRA 5DP2A 1JAXA 2MH2A 1PJQA 2ZQYA 3VH2A 2ZTLA 2I76A 1HW2A 3BZ6A 4HP8A 3LVFO 5E17F 3FNFA 4R4JA 5C3MA 1HW1A 3F23A 3KP7A 4GWGA 1IUKA 4E13A 5DYMA 1X7DA 4HAMA 5TIIA 2DW4A 4NHEA 1HSOA 3F5SA 2GQQA 1I2ZA 1XG5A 1P6RA 4YTEA 5C7IO 1M67A 2V1DA 4UVBA 5D5VB 4GCVA 2D1YA 2DU8A 3W6JB 3E8XA 5C7LO 1N7HA 3T7CA 1RUOA 5DD8A 1F0YA 5BT9A 1QGPA 1R16A 2OFPA 3LLSA 3V7SA 1OMOA 1PJ4A 3QU3A 4HX8A 3QRFF 1LDNA 3ABIA 4GI2A 2W84A 3WSVA 2NRAC 5KJFA 2ETHA 4Y17A 4ZU3A 1KYQA 4FJ2A 1R4NA 4M73A 4A26A 2ZBKA 1NPYA 2ZO4A 1GYQA 4BS9A 5ITVA 4ZH4F 1M75A 3MZYA 3GW2A 3AFMA 1UB9A 1D7OA 4BMNA 1PR3A 1I1GA 4KP7A 3T4XA 4ZYDA 1DC6A 2GN8A 1E5QA 5DBFA 1KVQA 2YDXA 5IDXA 1R5HA 1W73A 4LVUA 2X0NA 2HAEA 3RDIA 3ZV6A 5CG1A 1ZEMA 4B8XA 4ENMA 3VH3A 1YRLA 4QTZA 2KIMA 3KHUA 3BMQA 2G82A 4PG5A 5H81A 2MC3A 2PFBA 3RASA 1VL0A 3MWDB 2X0JA 1V0JA 1E1KA 1LQ1A 5IDQA 2A68F 4HF2A 1C1XA 4EW6A 3WDSA 2OUIA 3CUQA 1NQAO 1UZLA 2FY8A 2ZYGA 3WTBA 3A28A 4BGVA 3BMCB 1W7PD 2HYGD 1ZK0A 3HYIA 4YWJA 4FFPA 4QT0A 1LTHR 2UWMA 3KVOA 2O3TA 4MNUA 2RCYA 2EWMA 3C1AA 3RJ5A 4AJPA 2DFIA 1FK8A 3LT2A 4Q5SF 3QIVA 4NI5A 4ROSA 4ALMA 1SZJG 1HQCA 1GCOA 1KEVA 1YS6A 2NSDA 4J0EA 4I9UA 2X9NA 3WTYC 3D3EA 4RQUA 4DREA 4ZYHA 2VOEA 4LSWA 1OYWA 4HBLA 2V65A 2HK7A 3QSGA 4M89A 3WLEA 2OBNA 4I98B 1WI9A 3CLOA 5H82A 1E6UA 1NFFA 1HLPA 5CFZA 1DIAA 4DYDA 3RKUA 3TL3A 4BHPA 5KCZA 1T2FA 3CINA 5L9AA 3JAMZ 4O1MA 5CDSA 2D1HA 5AONA 4YJHB 3BTVA 5L53A 2BGMA 3ZHBA 4KIGA 1FJHA 1PX0A 2EV5A 3KP6A 2ZB8A 4S3MA 4U6QA 1MZBA 4BYYA 1J2XA 1L1FA 4HX4A 1WMAA 3CTMA 4GWKA 4IDAA 2DBRA 2NV6A 1O3RA 2BGLA 1P1IA 3DR3A 3G79A 2AE2A 3GUCA 3I5MA 2P91A 2P7VB 1ZN2A 2YHIB 1T39A 4TROA 1I33A 2VTDA 3R6SA 1GXPA 1T4DA 2HMSA 4EVIA 3D5TA 2W2KA 4E2ZA 1XGOA 5IZCC 5JW6A 4E2XA 3W6KB 1IN7A 4R01A 3ON5A 4ZGWA 1ZZEA 3SJUA 4E6PA 4WPGA 3TGNA 1Q7BA 4KTVE 1WLYA 4M87A 4CR7A 4YEDA 4J91A 4QQRA 5A02A 3DHYA 4DBZA 2GA2A 1AHHA 3JD1A 4E12A 3BMNB 1D5VA 2W85A 4RPHA 3JQFA 1IYZA 2YV2A 4L4SA 2NQTA 2BFOA 3JYQA 1FDVA 2HMUA 4OQZA 2O3UA 3WICA 1MG5A 1QYXA 1R5GA 5BSHA 3ZV5A 1XGMA 4U7BA 4FQ8A 4UEJA 4E21A 5BNTA 3ZNQA 1U8FO 2CZCA 1G3SA 1GVJA 1R00A 1PJBA 1OBFO 2OU2A 2O6GE 2NM0A 3WTZA 1GQQA 1QP8A 2IDZA 2XF8A 3G3EA 9LDTA 3A4VA 3JYLA 3SEFA 4ZVVA 4CXFA 1YW9A 3MJEA 1BVUA 4I0AA 1U3EM 2IYPA 1O3QA 4BNYA 4FX4A 4M49A 1GV0A 1Q7CA 1UH5A 4IS3A 4R9SA 4YAKA 3ZWWA 2P5LC 1XSXA 1FBSA 1YIOA 4PZCA 2VRCA 3F1KA 3DPLC 1SAYA 5EPOA 5LGNA 2WE8A 3PYMA 4RQTA 1P1RA 4D46A 2NWQA 5CDUA 3ORFA 3RFVA 3ETDA 1JHHA 4TQGA 1TT5A 3GZNA 4OKIA 3SJ7A 1CEQA 1VLLA 1R22A 3C7AA 3PIDA 2ZXJA 5LGTA 1UXIA 1VJTA 4RF3A 3U9LA 2WEKA 3FCOA 3VPXA 3F8MA 2DC1A 5A3VA 3DZKA 3SHFA 3NT5A 4L9RA 2CFCA 2E37A 4KT5C 4P96A 2HKIA 4YAEA 1IOLA 2FRDA 3D0OA 3DWFA 4P38A 3HHHA 3D4PA 4GBJA 4LCEA 3I9NA 2Q1TA 5LGUA 2B36A 2VODA 1LDEA 1D3YA 3L9XA 5A9SB 4ND5A 4OIRF 1HEUA 1X15A 3GDFA 4GLLA 4LN1A 1FDSA 4UAGA 2GLXA 3MJSA 1GYPA 4CMHA 1E3WB 2NACA 1ZRDA 2ZJ0A 3MEQA 3NGXA 4QEDA 1I6XA 5KJEA 2RVCA 3ZPLA 1SAXA 4UXNA 4LGVA 4NBRA 4EBFA 1DRWA 2ISZA 1H6DA 4M6XA 1HKSA 3TQNA 1I2BA 3AOGA 3GHHA 2G7HA 2BFAA 2IE0A 3P19A 1UXHA 2X86A 1FF9A 1H9BA 1PJCA 3BHIA 3NKLA 1D1SA 4DRYA 5G4KB 4Q3CA 4JX8A 1KQ8A 4DTIA 2OQRA 4TV7A 3KSZO 4I5FA 3MCZA 3IIEA 5A03A 1HSJA 3CPSA 3PLRA 2FRHA 3PP8A 5CEEA 1QBJA 4ENNA 3GF2A
chains in the Genus database with same CATH superfamily
4GG1A 3ITDA 4C3UA 3R4KA 1GEGA 2XMSA 3KK0A 4H18A 1Z0IA 4NB5A 3OT5A 3RARA 1MC4A 4WA7A 3CX6A 3R1IA 3RBAA 3HL4A 1KJJA 4ENTA 2JHCA 1WW3A 4D6YA 3HB7A 3LTEA 4TT3A 5HM6A 4CMCA 2DFEA 3K20A 5E3IA 3SEAA 5IY5H 1T2AA 3VSAA 3KIOA 1QDUA 1UJ2A 2R5WA 3DOOA 4DQUA 5A4DA 2O3JA 3W5HA 2GQ0A 3ES9A 4ER7A 4RADA 1MMSA 4F3NA 1LC0A 1WB4A 3O1IC 1G2PA 3IMFA 5DNAA 4G5FA 3TF5A 4NQWA 2WB2A 3AJEA 1Z0DA 1KO5A 4FHEA 1PGJA 3K4KA 1IZ7A 1NMXA 1WCWA 1WEKA 2ZE8A 3FETA 3GWGA 3DKXA 3PX3A 4K26A 4PV7A 2MGQA 4RXMA 3R7SA 4ESOA 2GYYA 4TRJA 3DE1X 4DR5B 3KCCA 3G73A 5CD9A 2CXUA 2ESNA 2R4GA 1UOQA 2ZRBA 2FQQA 4GGMX 4R5HA 3R9XB 1K4KA 3RUPA 1UDXA 1BR1A 4KOAA 2G0TA 1XZ8A 2IRWA 1OX4A 3NTOA 3WBJA 4LJ9A 2GEBA 4K0KB 2UKDA 3N2KB 4OUKX 3T1YB 4FYXA 3U21A 1XD9A 4JT2A 1YE5A 3FK7A 2DDAA 2CSOA 1JILA 1K1EA 3K96A 3CT6A 5BMVF 3GD5A 1CP2A 3FYUC 4QPJC 1XAHA 2EFEB 1CIPA 2V9ZA 3DBVO 3K0CC 2IHKA 2GS9A 4YALA 3RABA 3S32A 3IV9A 5G0WA 2LSOA 1N1MA 1XAJA 2Z1NA 3IDAA 5AI6A 5FTLA 5I4KA 3ELBA 2FA5A 4CUJA 1CGPA 4IHJF 4JR1A 4R69A 4DIBA 4UCWA 3FUVA 1YRAA 4DBLC 2ZANA 4U2EA 8GPBA 1Y6GA 3OTGA 1XMKA 5EPEA 4M0UA 2OG2A 1QH8B 1Z0UA 1C81A 4BYMA 1P6QA 3KZZA 2M9MA 3PPIA 4QOJA 4BJ6C 4D7NA 3DXJF 2MMCA 3RKWA 5JXGA 1E96A 4R79A 2LPMA 2G7MC 1KOJA 1W7PB 5DPMA 5C2JB 3V34A 2AXTC 3QYBA 2UXNA 4J43A 1MBJA 1RKVA 4KPGA 3NHLA 4R1QA 2F9LA 3OKAA 3QU5A 3WR5A 4DWVA 4MUNA 5IT3A 5FFNA 3ROPA 5JO9A 3TI7A 4PXYA 2NPIA 1BD4A 1UBRS 5GADJ 2BUAA 2OHOA 5H59A 3VPSA 2DJ5A 2VJKA 3W78A 1AU9A 1I7QB 3UNGC 3K7EA 4FHDA 3KQUA 5HBGA 2P7CB 1W4LA 1TU3A 5JFRA 4HXFB 4DC0A 4F1JA 3KHTA 3PNBA 4FIZA 1Z6RA 3P97A 4UDXX 3JY6A 1NR5A 2OWEA 2PX0A 2D1FA 2H48A 2X1DA 2EFOA 2BMFA 3NTLA 3TLKA 1ZUNA 3OCCA 5K03A 1ZJ6A 2BH9A 4CZZA 3GY0A 3PUHA 2COMA 2Q0XA 3QNUA 5J59A 4DXDA 3USZA 4UOQA 3DKYA 2R7WA 1QAMA 2C2ZA 3A1WA 1ISJA 5CW1A 2IGKA 4KUMA 1PK9A 1V96A 1KYZA 1D2GA 3BR0A 3FPAA 3HA3A 3M3PA 3OPYB 2XRMA 3R5KA 4JWKA 1X1BA 5LDDC 3MQ0A 1ZKMA 3NIWA 4L9TA 2EIXA 3HRTA 4YQZA 3I5YA 8MHTA 1FSEA 2QWWA 4PUSA 3FBTA 4IR7A 3DT8A 5FWYB 1NX6A 3PGKA 3GMIA 2V8OA 2JJQA 3F96A 4RSHA 5IPAA 1QE5A 1E63A 1Z2NX 4ZO9A 3ZD9A 3ZCTA 2F8LA 4ER0A 5IVKA 1C9MA 2RGRA 1QR6A 5FAKA 1SVMA 1Z62A 1WD5A 1XP8A 2I7TA 3ABZA 4FC6A 1MEJA 4PAOA 1I5EA 3AJDA 2FEMA 4RVDA 4Y2YA 1RP7A 1YRYE 4Q02A 5F77A 4AJ1A 2AOUB 1VIDA 3T5MA 3VPFA 4JJ6A 2Z8YM 1WF6A 1RE1A 2YV5A 4G0PA 4DKXA 5LEKA 3DNMA 2J67A 3B7WA 1CRQA 2BR5A 1QDLB 3AX6A 1PIWA 3IP8A 1SD7A 9MHTA 3IUSA 4INJA 4E14A 4GQAA 4W5TA 4FINA 3TM4A 2VUSA 2ZXUA 4F4HA 1W5EA 3FMVA 2HLDA 4RB3C 1KDRA 2JFUA 2R0QC 3BMCA 1GL6A 3KQMA 4OJMX 4P33A 4QOHA 4RQAA 5IXJA 4F6LA 4AQ7A 3P5SA 4I0BA 1I3LA 3NC0C 1L4NA 3Q0UA 4ND8A 2KQUA 4D9NA 1FRFS 1DPFA 5DSZA 2CU7A 3EDPA 2ORIA 2NTYC 3P52A 2W4IA 2JIQA 5CDYA 7MHTA 4D82A 1L5VA 4BN5A 3EB9A 1U0NA 3DOEA 3LUBA 3PQ4A 5K4HA 1TJ5A 3A0BC 3E48A 2C2BA 4OHPA 3E6DA 2HO5A 2ZJ7A 4U4AA 5CVDA 5AW2A 4OP3A 1U31A 1HKTA 4BJTA 3NM4A 2C1XA 2XCOA 4FC7A 4YY3B 4I0WB 5IJWA 3OFND 1Q0ZA 3WDKA 2HKOA 1N0WA 1WJCA 2WABA 2WY8Q 3PQKA 4ZVRA 5JPIA 3SFZA 1JQ3A 1U7OA 2FOXA 4WRRA 2ZI7A 1RMTA 1XBTA 2OVBA 1YV9A 5MN4A 4IIJF 3FGNA 2H92A 3W2WA 3HM5A 4UOEA 3Q9UA 4FYWA 1J8DA 1UP4A 1VP3A 2LKDA 4CMBA 1OAOA 2NZ8A 4EYEA 1KKMA 5COAA 3GAMA 2K7LA 1QK3A 2JEZA 1ULHA 2PPLA 3V5NA 4DIFA 5BWCA 4YCNA 2KRHA 3SJMA 2Z2ZA 2PANA 4R51A 3SYMA 4ZJYA 1C41A 1JEQB 1CERA 1Z2CA 2OK8A 4JWTA 5E1WA 3MMZA 5HIKA 2HDCA 4HLXA 1CWUA 2FDXA 2VDOB 4RDXA 3DKKA 5JC8A 2HLNA 5BW6B 1QTNA 1T8YA 3I9LA 3NH9A 1WABA 5TB5A 4KXUA 1PLLA 3AP3A 5HCUA 1CLEA 3UXEA 4AYWA 4CW7A 4Q1CA 3JQAD 4DPLA 1BC7C 4BXUA 1G5TA 2ENUA 2PZBA 3BXEA 3CURA 1PJTA 1T3SA 1G6HA 5FULA 5IMBA 3WO1A 3ZQJA 4EM6A 1YZLA 3VR2D 1PF7E 1VG0B 1IWOA 1H3EA 1M0EA 3IAEA 3DUFA 2OXFA 3L0ZA 2VEOA 5FLXA 4Y2HA 4D02A 2YCLA 2BRUC 4PSDA 4OA8A 3N8NA 1YCFA 2TCTA 4CMAA 2QMOA 3F9KA 3IAS2 1JG2A 3O9ZA 1CJKC 3KYJB 3KOUA 3ZOKA 3OYMA 2O6LA 2XKJE 3OVMA 1RKBA 4R83A 2NGRA 4E5NA 3FW1A 3LWBA 3TTUA 3C6KA 2IF2A 2BCGY 2HCRA 3D5EA 2C31A 3DKPA 1GKKA 1TM3E 3JAMK 4XB6B 5K0BA 3UVEA 2C5EA 2OOSA 3BIOA 1HQKA 4QQNA 2ZVDA 4JR0A 2BY3A 1NF2A 2C2WA 2H52A 3QGMA 4NH0A 4Z0PA 1L5LA 3VAAA 4QREA 3ZY4A 5CCDA 4ETWA 1LB1B 1J90A 4YG2F 2A88A 4JYCA 3K6GA 4W8OA 2MYNA 2R7FA 2ZKZA 3Q1LA 4NMMA 3JRHA 2AB0A 3ZV6A 4AY6A 3OJXA 3OICA 4IWNA 4R6WA 1LPOA 2A0UA 1YZFA 2MSDB 5F64A 3IAM1 4NU0A 1TJNA 3QEOA 4CLOA 2H8WA 1Z82A 4DF3A 4A1FA 3NTRA 4O8ZA 1K5DA 4EVRA 2VN2A 2XBMA 4M3FA 1K08A 2BIFA 2CJJA 2GZAA 1KK3A 3V7RA 5BS6A 3M2TA 1GGHA 5FOUA 4D3YA 4DDHA 1TTQB 4ZQEA 4F96A 1XUOA 4KISA 2XHEA 4H1WA 1Y6IA 3EETA 3OPYA 1WZEA 3ROXA 2KBFA 5J1UA 4G1EB 2Q1WA 4W5JA 3WK9A 1KC1A 3D4BA 4IFTA 2AEFA 3BKWA 4COKA 1YJBA 2Q41A 5EUCA 3O38A 4XQGA 5A5DA 1SEVA 1ADYA 2HSGA 1ACMA 2KW5A 5C8XA 3RVPA 1VI2A 3GFBA 1TYDE 5GAJA 1NVEA 4XIDA 2QAIA 1ZQ9A 5BNIA 3HYNA 1R9JA 3PDJA 1K9SA 3ZWXA 1BOFA 1DAKA 3CRNA 5L45A 1M72A 1R8SA 4YCBA 3RYFA 4UVEA 1PJLA 4HSRA 3H6KA 2PR2A 4KFRA 2MD0A 1VL5A 4H1TA 3RFFA 2G6BA 4MKFA 2VZ9A 4G81A 5IP5A 5MHTA 1SB8A 4F7ZA 3TR6A 2Q8PA 1LI5A 1UPCA 1S2NA 4WZ6A 4D79A 1Z0KA 2DA5A 3M1YA 1X19A 1EWTA 3WLFA 5ADWA 1S8NA 4DV0B 1A4IA 4N01A 4RACA 4LBYA 3C3WA 1Y6ZA 3ASUA 2X8JA 1N2GA 4HFMA 1F4LA 3W4KA 3RBZA 5A9RA 1LF5A 2V59A 1GUZA 1EA5A 5CVIA 4EKNB 4JT9A 2EHDA 2X6YA 1RFGE 2JARA 3QVLA 4LZPA 1BDBA 4B83A 4S0HB 5FJIA 3ZWKA 3K2EA 1E0EA 4CLHA 2JVGA 1I7LA 1EESA 3DTKA 4DY4A 2VUTA 1ZKGA 1XTIA 1YNSA 3MC1A 2OZ6A 2H9IA 3B3AA 2CW5A 2I2DA 1NTCA 2TSYB 3IMEA 2FXAA 2JGNA 2N1MA 3QBDA 3S28A 521PA 1U0GA 4EFKA 2E48A 2QVXX 2WWFA 3UHOA 4P22A 4COOA 4DNPA 4BPBA 4WJKB 5KPJA 4AVPA 2DPDA 4TKMA 1AV7A 5ILOA 4LF7B 2VXBA 1AMOA 4M99A 3ZD7A 1IUFA 4Q03A 3E4CA 5BRNA 3UJAA 2YY6A 4RTPA 1F6WA 4NVRA 2R6AA 1NVAA 2ZSEA 1N92A 1FIPA 4XMYA 2RIPA 1ZSYA 2SKDA 2H0RA 3BUSA 1RCUA 5CDTA 5CLHA 3HP4A 1SG6A 2PEZA 1BA3A 1L4GA 1GZHB 3OZXA 5FPHA 5JNWA 3DFKA 3IMGA 2ZIWB 3THOA 4U7TB 1KTIA 1BHJA 3GEEA 1WJGA 4QJ3A 2BMDA 2ZITA 2W11A 2A9VA 1JU9A 1YC5A 3OEHD 2J3DA 3QKTA 3IR7A 4HWPA 3HY4A 2OZKA 4ISBA 4RTSA 2WWHA 5TT1A 1D1AA 2XGMA 2E7XA 2QNRA 4W9NC 3QEAZ 3S7TA 1V8PA 2WAXA 4XLEA 4M6WB 2P77A 2L82A 3EMKA 2OXIA 1ETQA 2XPVA 2Y3IA 1KQPA 4EPRA 1XK7A 4CTMA 4JI0B 3IAAA 4OMCA 3V4PB 5LJIA 3EXG1 1T3TA 2Z04A 5E7IA 1KERA 5EERA 3I8OA 2PUFA 3OOPA 1H3FA 5JT1A 3AFHA 1JA1A 2AFHB 3E05A 3Q41A 1N1DA 2OFOA 4MIOA 1AKTA 4PU0A 3TLGA 1U5TA 3ZXSA 1Y42X 3F6RA 4TWRA 2A7QA 1DFIA 2JFYA 1IJWC 5DWDA 1HDIA 4IDBA 4PEVA 1KEZA 1MT0A 4NCJA 2HYFA 5EZYA 3ZGLA 3KELA 5AVRA 4ND3A 3FHLA 1F1BA 1RYBA 1Z39A 2XUKA 3JQCA 3QLEA 4M36A 4Q1AA 1ACLA 1G8FA 1K7XB 5IJ9A 4MVCA 1H23A 2FKNA 1SOAA 3EMVA 3ZGNA 1W88A 4GU5A 2AEJA 4GKAA 5G02A 2BJVA 4XGQA 5ANRB 4DV1B 4HPXB 2WZCA 3FXRA 4DG8A 1BWSA 4E2YA 3E97A 1SOMA 1TF2A 2NVWA 1ISMA 3IOEA 2VL8A 1GZDA 1WW8A 3OIOA 4KGVA 4ND1A 5HDBB 1EK6A 1TWHJ 1FB5A 2O2YA 3B9BA 1AUXA 3KC2A 3NGMA 3NUZA 3Q0TA 4L0ZB 2V6CA 2EIJH 1G41A 3A1UA 4GMHA 5EG5A 5FI5A 3TQSA 2AYZA 4EMUA 1PZEA 2DWCA 1CDEA 2GBLA 2DBBA 3HSRA 1M7GA 3EWSA 3TDNA 1ISGA 4Q82A 4KYTA 1Z17A 4UOZA 2CNWD 1FFEA 4CYMA 3R3WA 4GYYA 2P9EA 4MWEA 1JHDA 3II6X 4CN8A 2A7XA 3IULA 3QVSA 4U0JA 3A01B 1K8RA 3PCTA 3OOSA 2Q62A 2PSJA 4L0CA 5D85A 5CCXA 4LJRA 3JR9A 4JLWA 1U8UA 2C0PA 2AC2A 3PWKA 3URMA 1T9BA 1JJ6C 2G5CA 5BSMA 3ROTA 2K7FA 5JTTA 5TGDA 3DV9A 1QRAA 2Q3FA 4XN0A 2ZM6B 3NDIA 3KJNA 1DJLA 1LPSA 3LGXA 2YFHA 3KQHA 3EOBI 1OGIA 2A9JA 1E1RA 4AZ3A 2ZI3A 4S1NA 2XJ4A 1WR8A 4LS3A 4TXLA 3VNBA 3VXKA 2HCFA 1KFJB 2BTQA 1BL0A 1MEOA 3CH4B 3TZQA 2NU9A 3NT4A 2EKZA 4IO1A 4BNGA 1OV4A 1EA7A 3JAWB 4MKXA 4B74A 4HQ0A 2VK2A 3UANA 5KNDD 5HNFA 3BXPA 3GR6A 3I3SR 4PJ0C 4ZEVA 4B3HA 3OX2A 4N8DA 1KA8A 5FRMA 1I0LA 4XAQA 1RWMA 3THYB 2DFDA 2ZWPA 2QT9A 3CVJA 1T5DX 4MVJH 4O8CA 4B80A 4DJFC 4KYIB 3Q3GE 1CFJA 3JALB 3PI7A 5HS8A 2PKXA 1PR6A 2F59A 3JV7A 1DX4A 4UTXA 4WNIA 5EXPA 3RG2A 3SZRA 1XI2A 4EW3A 3KAJA 4MRRA 3TSOA 2CSUA 4LA4A 4XCVA 5B3AA 1AZLA 3CWZA 3M6XA 3H16A 1N3IA 3JQDA 1E8DA 1UJ5A 3WB1A 1Z4PX 1DMSA 1KRHA 3ENVA 3HA7A 1CY1A 1MORA 1MX1A 1NV8A 1ZFNA 3N0TA 4KMOA 5I3CA 5JS1A 1S7EA 3N97A 3D8NA 4FLEA 4RETA 1WUTA 5AHKA 1MG0A 3AUYA 1M1XB 3DLHA 4DRXB 5JE8A 1J9IA 5DH9A 4HZIA 4BNMA 2EZIA 1YZGA 2AEMA 1LEBA 1OI4A 1PFKA 2XPCA 1HTWA 1W7AA 4KIUA 3HZZA 1EEXB 1SUAA 3K2QA 4W5HA 3RIGA 5FJ8J 4G6DA 4X54A 4AB1A 3AXTA 4DCJA 5BWOA 2ZB3A 1YVPA 3WWZA 1JT0A 1Q2XA 1XIVA 4GM0A 1TO1E 3JAMA 2BUCA 5MFZA 3OEYA 4YJGA 3K2AA 5EE5B 5EQFA 1RYNA 4CM8A 2J3QA 1UBCA 3JX9A 3MWJA 1JKOC 1WUKS 2V96A 3ZDYB 2PL9A 3QLUA 3R7WA 4CA0A 2VDRB 2A57A 2IYNA 3CWCA 3ETEA 3UAOA 5ABPA 4HYEA 3OOYA 1J0XO 1F7UA 4WZAA 3LLUA 1QG2A 1YRBA 3MT7A 1RWOA 4HS4A 3JAKA 4KWIA 1BRMA 1S9DA 1K3FA 1YHYA 4QASA 3WJAA 5IN4A 4R2IA 2HQRA 1REQB 1JQAA 2VXCA 5HIIA 5KWSA 1CE8B 3P4YA 2CSXA 3TW8A 1W5BA 4I81A 1OU4A 3MW8A 1EFLA 3FI0A 5E3JA 3LDFA 3FKQA 1CY7A 2CL6X 4NFLA 1FDRA 4FQGA 2WUEA 1Z77A 1I10A 4P3XA 5I45A 3E7WA 1HDYA 5KU1A 2BL4A 4X9XA 5B7NA 1RTTA 1GA1A 3E22B 4IJKA 4EI7A 1P5JA 5FKKA 3QX3A 1GPBA 2EJWA 3TQOA 2Z3WA 1J2RA 3AEXA 3U3JA 4A2WA 1UOEA 1LFBA 1YL5A 4Y2VA 2M5WA 3TGWA 4BRZA 3E5NA 4QO8A 5KX5B 4P84A 4F56A 5FGMA 1R9NA 3TPCA 1AKQA 3IEIA 5AR1A 5THKA 3Q9VA 1LV8A 5KOHB 4IGKA 3GG2A 3ONVA 2R5YA 3GPBA 2I9PA 1QV9A 3IAM6 4BNFA 1TKBA 4Y9UA 1M66A 1C7ZA 2XXAB 1EFRA 3KYDB 3EUHA 2QYSA 2W2MA 3MKYB 1C1XB 1CV2A 2IP4A 3H4TA 3QV2A 2OPTA 1I6HJ 1PGOA 2CXRA 2EKBA 4JSRA 4C4YA 4EHAA 3C5VA 1BDJA 3QVOA 5T4EA 4F4DA 3LV8A 1CW2B 4LHVA 4B3BA 4EENA 3AW8A 1UELB 2XAHA 1CR6A 1M1UA 1RU3A 1X7YA 3U7IA 4ESEA 3EA5A 5LQNA 3HOVJ 3OJCA 3TD9A 3ABMH 2FQ3A 4UUNA 2BGKA 2J6HA 1GKIA 2BGNA 1CETA 2WHXA 3I9KA 2CLEB 1UKAA 1X2MA 4QQFA 2CHGA 1ZKDA 1JTXA 5BYBA 1B72A 1DV1A 1SEUA 5FHRA 5CLFA 1FU7A 1RAEA 2C5AA 3BJAA 2L2QA 2FPWA 3DDZX 2GJ9A 4AKIA 2QD4A 1B8VA 4E1VA 4DCTA 4CYCB 2WINI 3I54A 5LU9A 1K92A 2EGGA 4DN6A 3AEUA 3KP4A 3I2YX 1X80A 1EB9A 1XMSA 4IDOA 3WIEA 2JGDA 1HFEL 5GINE 2V26A 2ZDHA 2H4XA 1BA2A 3EH2A 2N1BA 3GEDA 4MVJP 3I2JA 2C54A 3KM0A 3AVOA 2Q5OA 3WBBA 3K4LA 1RR7A 1DQYA 1UQRA 1XRMA 2BR3A 2R97A 2VDPB 5IKEA 2GEVA 5EJAA 3H1TA 3DXYA 3HCEA 4E2WA 4ETNA 4MTEA 1JPNA 1T2DA 1WU8A 1QC5B 2VHWA 4UMVA 1QPGA 4Z0TA 2ZU0C 4KGZA 2ZJOA 4HLNA 3R8XA 3T4UA 1N6OA 3C87A 3IR6A 4HYTA 2P69A 3T3GA 4BIMA 3ETCA 4TYYA 3AUSA 3LLVA 3ZX4A 1L5QA 2EA2A 1RMYA 3KJIA 3QFHA 4BMPB 1AT1A 5EMHA 3GRZA 3TO6A 3STTA 5CYFA 1P19A 2XITA 3E2MA 1JYSA 4R8MA 3WQSB 4A0SA 4UAJA 2VKDA 2FX5A 2VWGA 3GROA 3KTAB 3SR4A 2W00A 4BLUA 2IYUA 1TCVA 1XU7A 3ZDQA 4B09A 3WG7H 2IBMA 3OSZA 4DA6A 4S1WA 4I46A 1TM1E 4BAUA 2R7TA 2GPJA 1V1RB 2DCMA 5HIAA 3RREA 1DKPA 4FSDA 4MV5A 2XUQA 2XYVA 3D7KA 3BWXA 4MJXA 1V9LA 1FX0A 2CLHB 4XVHA 4YPVA 4P6VF 5A2GA 2IGTA 1W0JD 2Q6VA 1P77A 1R4AA 1YNOA 2CYBA 3BGIA 1BI0A 2A69F 3QWBA