3WGGA

Crystal structure of rsp in complex with alpha-nad+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding mode of the oxidized alpha-anomer of NAD(+) to RSP, a Rex-family repressor
pubmed doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 71
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wggA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wggA02
3H65A 1Z05A 3MJ4A 3U49A 3UH1A 1G6KA 5JHUA 1OAAA 1VL0A 4EM2A 3KZZA 3WYBA 1G1AA 4IQ0A 1SFEA 1FBUA 5KVQA 1U2DA 4G2NA 1LC3A 1QLHA 2HK8A 5KOIA 4JXKA 1A7KA 3AW9A 4ALKA 2X5KO 5ICCA 4GSKA 1AOYA 3FTNA 3M8FA 3PZRA 4EMSA 3FWEA 1CQIA 5JE8A 5KJ6A 1J49A 2UWMA 4DNCA 1HEUA 3GN1A 5BQFA 3EUHA 2RBEA 5DBGA 5JAQA 1P1RA 2XASA 4BHPA 2TDXA 3QW2A 5DP2A 4UEJA 3IMFA 1Q1NA 2AQHA 3H9UA 5G0VA 2L4AA 3HSRA 3MAJA 2H1SA 2JCXA 3H3ZA 4RVSA 3UOGA 1PZFA 3VDQA 2VWQA 1L1FA 3DBRB 4R8HA 2VT3A 1IN6A 2Q2EA 4HX8A 2BMAA 4RGSA 1C1XA 1YDEA 3GVIA 2HK7A 3O26A 1B6AA 3PHGA 2W24A 4Q3BA 2HTSA 2H6EA 1BW9A 4LISA 4H15A 1G3YA 4P4GA 1JU9A 4ZRNA 4Z3DA 2P9EA 4RZIA 5ICFA 1B3BA 2ZYDA 3FD8A 4XLNF 3GFGA 5BS6A 2X7HA 2FBIA 5CP8A 4PGHA 4IRIA 1HW2A 1K6XA 2WE7A 3VFZA 4XYGA 4YQYA 5D4SA 3KLNA 3RC1A 3V1TC 2ZYAA 4CMKA 3L7WA 2O3FA 2QW8A 2V6FA 4Y67A 3S8MA 3GNQA 1ZSYA 3BA1A 4GKVA 3AJRA 5F1OA 4KQXA 4WKGA 2PR2A 2G76A 1S6LA 4AJOA 1A72A 4O0LA 2VC0A 2HTJA 2EV5A 2A3SA 1E7QA 1Z1DA 3G49A 2Y0MA 2F5DA 1E1NA 1MC5A 1MV8A 4AWXB 4TKLA 5BQTA 2NU7A 2RCYA 4H16A 4Y98A 4WCDA 2UVDA 1G3WA 2VYNA 5TT0A 4JLWA 4PZEA 2XAGA 2GIVA 4B7CA 3QVWA 4M72A 2VHZA 4MOWA 1FDWA 4RGBA 4ZZLA 4A03A 4OIOF 4HF2A 2MA3A 3BHJA 1DUXC 4ESOA 2O3TA 1MB4A 4WXCA 2DTDA 4TSKA 2EFPA 5TGDA 4A2CA 3EHEA 4CLRB 3ROPA 5JO9A 3ASUA 3E9MA 2OBNA 2OMEA 1FBSA 4HQMA 5E17F 2X6TA 2CSUA 3P2YA 4IIUA 1HE3A 1G4DA 4Y15A 3N7UA 1SCUA 1P44A 1ZREA 4WXHA 5EQDA 1ID1A 1VL6A 2C2XA 3BMNA 2ET6A 3FI9A 4S3MA 2L4MA 4YT5A 1E1LA 1U5TA 3ZNQA 4LLNA 2VNSA 2Y1FA 1T4DA 2FBHA 4Z6KA 5CEJA 1EUCA 4Y17A 5T5QA 1UXKA 3RU7A 4DL9A 2NNLD 2HDHA 4OMUA 2DT5A 2JCVA 1NP3A 1BI1A 3B1JA 3DTTA 2DBQA 4YVFA 5TJ9A 1QP8A 3T0YA 3I9KA 3W4IA 2G7UA 5E1WA 4IS2A 2B36A 3KSZO 4B3JA 3CLOA 1XCBA 4LSWA 4QECA 3GW2A 3E03A 5HS9A 2HKIA 3PK0A 4B09A 5AXDA 4A0XA 5E18F 1O94A 4JP2A 1TLTA 4HQEA 3ABIA 1K2WA 2QYTA 4OU0A 1LDMA 4XEHA 3WG9A 5I9MA 5BT9A 3F22A 2FSVA 2BRUA 4BQRA 2XAFA 3WIDA 4ZQBA 2Q49A 3JQGA 1QR6A 2DK8A 3CJNA 4MO2A 5TRTA 1ZEMA 4BO5A 5H20A 2BE5F 1YQAA 4B8XA 1JHFA 1GL3A 1HF3A 1UAYA 1GV1A 2C0CA 2NVUA 3AY3A 4J9VA 2BD0A 3A28A 4OSOA 4YJHA 3GAFA 3WE3A 3FM5A 2EWNA 2UZKA 3DO5A 2JZYA 1J6UA 3E6AA 2CY0A 3CH6A 3TWOA 5T67A 2WE8A 3QU6A 3RUFA 4ROSA 2QENA 3IKVA 2E82A 3PYLA 2H9IA 3QJ5A 2CVOA 4IRGA 2E6UX 3TDUC 4J1NA 3VPSA 4PCVA 3J81K 2IZ0A 1MDMA 3PQEA 4CMGA 5JCJD 5HS8A 2ZKLA 1YOVA 3N97A 5FFXA 4YTEA 3U4HA 4CQLB 2W57A 1I33A 1DC3A 4BIIA 1EVZA 2WWYA 1Y8RB 1QQIA 3RUEA 4DLAA 1KU3A 5KK1A 3NT4A 5IDQA 3E82A 2V1UA 1XWFA 4EW6A 2Q1SA 3VVCA 3F6VA 3LK7A 4OO3A 3BZUA 4W82A 2ZTMA 1IHXA 5FD5A 3FRJA 5U1PA 3D3WA 1R66A 3PRJA 1IRGA 1EQ2A 1UH5A 2J3JA 5A05A 4KDEA 2X4HA 1B7GO 1UP6A 4PG7A 1K6OA 2DFIA 3QU3A 1J4AA 2Y48A 1X15A 2XOXA 2Z1MA 2UV8A 1MP0A 3E6DA 1B9MA 5ENDA 3RC7A 2EV9A 4A26A 1A71A 4J6FA 4YR9A 4OOIA 1GFSA 2B5VA 2FN7A 2VYVA 2O6GE 3IIEA 1LEAA 1CEQA 3RYPA 2ZTVA 4P4LA 2QZ8A 5FLXZ 2STWA 4EJTA 1QZZA 3LF1A 3WGGA 2KJCA 4R3NA 4ASNA 4XGNA 5DZSA 5BNFA 3WXBA 1EH8A 1H9BA 3D1LA 2D1HA 4NFSA 5BSGA 4ZJUA 1QLJA 4GLLA 4NR0A 1XN7A 3EYWA 3F72A 1MDMB 1OI7A 4XJTA 1HW5A 2PZMA 3HN7A 3U0BA 5JR3A 4QWQA 4BO6A 1T1SA 4P22A 5JLAA 5A5EA 5B4TA 1SZJG 5TJJA 1T2DA 2O0YA 5JDCA 1P31A 2NTVA 1E2XA 1XSDA 1N2SA 1PJ4A 2VZ0A 1GEGA 3QIVA 3JQAA 4BQAA 3QP9A 3AM5A 4W99A 2YV3A 4WNCA 4NHJA 3ZV3A 3DAGA 5LEJA 3WTYC 2HMUA 2IRWA 3BZ6A 4EGFA 2IYPA 1Q2XA 5JFRA 1YJ8A 2W90A 4CV3A 2PN6A 4BO9A 1R0LA 5F6FA 2XXBA 1T38A 2O2YA 1AN9A 2JFGA 2Q46A 2FR8A 1Y6JA 5DOZA 3F5QA 3L07A 3T4XA 2BGCA 2IP2A 4YA6A 3GYHX 2X22A 2HRZA 3Q9UA 3QRWA 5CG1A 5ERIA 4ENNA 3O9ZA 4L4XA 4O3MA 1C0LA 3SVTA 1HDGO 3Q11A 2GA1A 3FM3A 4LMYA 5D5WB 1YL6A 3TZQA 1OYYA 4BNKA 4IDGA 4J0EA 1WDLA 1R4MA 1Q7CA 2CFXA 1P74A 1GVJA 1SOWA 2A9FA 2QIOA 4G65A 2G1UA 3MZHA 2UXXA 2V6GA 5JXWA 1O8CA 1ZUD1 4B4UA 3GRPA 2GASA 1E7MA 4CXFA 4UULA 2QX7A 1U3TA 2HSDA 2Z95A 1LB2A 3GDGA 4IGFA 4EJWA 4R5MA 4RVDA 1PJ3A 4S04A 4O63O 1Y7TA 2VOEA 2AXLA 1AE1A 4PLWA 3HUGA 1J59A 4XSZF 2DBZA 1BJAA 1SD4A 4CV2A 4ZYEA 2DAOA 4EJUA 1GPJA 1LDGA 3BMOA 3EQLF 4Q4ZF 2DFVA 1HT0A 4YG2F 3E48A 3QWBA 4FN4A 1R22A 3MJCA 1DDNA 2VRCD 2QQ5A 4CMIB 3FF5A 3VOSA 2GN6A 1EVIA 5KJ1A 1AXEA 2NU6A 2COMA 2OBPA 1HE5A 2ZKZA 3Q9NA 5FI5A 1M6WA 1ONPA 3ML6A 4N7RA 4BXUA 1U28A 4WX9A 4U5QA 5FWNA 1D5VA 1FF9A 2X4GA 2QUFA 1HDYA 1U5AA 1WW8A 3KXDA 4DPLA 1A4IA 5DBIA 3O8QA 3KZVA 2P4WA 1MG0A 4M86A 4JK1X 5IAAA 4AJ2A 3HOTA 2VT2A 2UUOA 2B4QA 2HMWA 5K0ZA 3L6DA 1O0SA 4L0ZB 1XDUA 1PJCA 2ZB7A 4B4VA 1PGOA 4YYZA 4UUVA 5ILVA 2JAPA 2Y0EA 2VRCA 1NFQA 2NADA 1DBVO 2FP4A 5EN4A 2AE1A 4GVXA 1X0VA 4LSMA 4QFDA 5L4LA 1HSZA 4FFNA 3RVDA 5A9RA 4KMSA 3FWNA 1L7EA 3Q5FA 3BMOB 4DRYA 1PUEE 1Z82A 1BM9A 1R6DA 2FMYA 3TO9A 4U7WA 5TSDA 3S2GA 1I5ZA 2FNAA 1NHWA 4GGOA 4Q3CA 4DIOA 1DAOA 3GG9A 3GX4X 3L4SO 1ML3A 2JPBA 3SHFA 1EE9A 3WTVC 1PS0A 1L3LA 2EJWA 4IJUA 4YJFB 1ZIDA 4IZIA 1J0RA 5H81A 2GR9A 5L3BA 1SAXA 1PQUA 4AJHA 3I52A 3JYOA 1ISHA 4EJVA 3NDJA 5A06A 2PTGA 3BMQB 3D64A 3HADA 1FDTA 2BBYA 2MC3A 2DPDA 1R1UA 1WDKA 3K9TA 3ETDA 3ST7A 1I01A 3RUAA 3S2IA 1PJ2A 1H0KA 3GZNA 2WEKA 1BDBA 5EINA 1YS7A 2V6CA 4WEOA 5CJ9A 2PD4A 2J5PA 4FGSA 2J5KA 5EQFA 4CM9D 4YT8A 1B8UA 1D4FA 2X0RA 2P9CA 5L3DA 4QX6A 4I5FA 4J4BA 1HSOA 1MFZA 3L00A 2WYUA 5GZ6A 2PV7A 4KN4X 5DUIA 1GHCA 4NDNE 4WUVA 5CVIA 2ZTLA 3KTDA 5E8GA 3GMSA 1R0SA 5C5IA 2STTA 3JYNA 2CQKA 1IXRC 1R4NA 1XG5A 4BNFA 1Y1PA 2P6SA 2NWQA 3M2TA 4ND5A 3WX0A 1I3LA 3F3SA 3ZWCA 3DQVC 1WPQA 2VHYA 4I01A 4N54A 3MOIA 4JJFA 4PLPA 2C7GA 3SZPA 1NFFA 2DBVO 1UR5A 3ITDA 5L53A 1EBUA 3DBVO 2RGVA 4J7UA 4GPD1 3L9WA 3C24A 2EG9A 3FNHA 3SXYA 1W5SA 4BNGA 3MJEA 5IXSA 3BPVA 4G7OF 3N4MA 1DOHA 1G3SA 1EE2A 5J8CA 2DAPA 2I6TA 3MJSA 5E1ZB 4TMFA 3R1IA 1TB4A 3D4NA 1B1BA 3JD2A 3GAZA 3VZRA 4EJ0A 2PFBA 1KU7A 1YOVB 3R0AA 3HB4X 4WGGA 1JGSA 2Q2WA 3ANNA 2AG8A 4AJKA 4CMEC 2ZIZA 1UXJA 1KBZA 5CFZA 1DC6A 1GQYA 1USSA 1HDOA 2EGHA 1T2EA 3LT4A 1UUFA 3Q3CA 3GFBA 2E1CA 1HE2A 2QQ9A 2PY6A 1YH3A 5J6XA 2ZJ0A 2KIFA 1PJQA 3BJ6A 3I83A 4GCVA 3ZN1A 3PQDA 3OV8A 1DRWA 4R1TA 4ILKA 3CE6A 4MVJD 2RNJA 2LDUA 2PLAA 1C14A 1OMOA 1QYXA 4J0FA 3RYRA 3COSA 2ZQYA 4HV6A 2Y0DA 4EEZA 2O4UX 5ICGA 4K6CA 4WLNA 4D41A 4U7BA 2ZCUA 3ICPA 3NTRA 4CM8A 1LTHR 3JQ7A 1BC7C 1ZLJA 2XAQA 2DKNA 4HX7A 4F7ZA 2VOOA 1E7YA 2YFHA 4GWKA 5T6BA 3OHSX 4M6YA 1FYLA 3V4GA 1XDWA 2X1HA 2XRNA 1QRRA 3FHLA 2EV0A 1U7HA 3TGNA 1TW2A 4LN1A 4Y8VA 3RUCA 4UUPA 2IYOA 3PTZA 1B2LA 5AIQA 1DIGA 1N92A 3IDSA 1SNYA 3EK2A 4IVNA 5G0TA 1H93A 3ROQA 4OHUA 1XCVA 2EKPA 3L0DA 5TJHA 1GZ6A 4G94A 1MZBA 1VJ0A 3EZYA 5G0WA 4D0RA 3BHMA 3E5UA 1E3WA 1XQ6A 1ZYRF 3C85A 4HFMA 4NI5A 1PU2A 5FEUA 3LT1A 3LSTA 1P45A 4PGFA 4R41A 2PWZA 1YG2A 4M9ZA 5LEKA 2GNAA 2Z1NA 3PWZA 1KETA 1PWZA 4WLEA 4PRLA 2K4BA 4YAJA 3RJ5A 2VBWA 1MKMA 4BUCA 3E5QA 2LDXA 4CMJA 4TVBA 1X1EA 1MJBA 1ULUA 4PIVA 1MX3A 2AQIA 4PG4A 1B26A 3JD4A 4IM7A 1N5DA 2R7FA 3ZQ7A 5D4RA 3GEZA 3CTMA 3GN2A 3FR7A 3QWHA 4JROA 2EA4A 1G3TA 2O2SA 3VH4A 4CMBA 5TLSA 5JAZA 4MTEA 3AOGA 1O95A 4IBOA 4IQGA 1ZZEA 1R23A 3P9IA 2FHSA 5U9CA 3GGOA 3MJVA 3WBBA 3OQ1A 2NVUB 1O3TA 4OYRA 3IC5A 1JWAB 2HQ1A 4FB5A 4K2EA 4K26A 4PRKA 4HWKA 3OA2A 1P1IA 1ZN2A 1WKMA 3H5RA 3EYYA 4PLTA 1O3SA 4MGRA 2POQX 1I1SA 1DHTA 1NHGA 1LDJA 1YB1A 5A9TA 3JAMZ 1B4AA 2D1VA 5TF4A 3V8JA 1I24A 3U4DA 3CINA 4GGGA 1E1MA 4ND4A 4PFJA 5F5NA 5CDYA 1E3WB 3U4IA 4Q3NA 2NU9A 5KCZA 4HADA 3I4PA 3ONDA 5BNTA 4GAEA 1Y8RA 3V8KA 1NX6A 3K2EA 2PK3A 5DCMA 3NEUA 1VSUA 3E5RA 1PJLA 3JQ6A 3REOA 3DEYX 4FOSA 3NT2A 1TA4A 2PFGA 3RPQA 3DV8A 2FBKA 3OQ6A 5G4KB 1B15A 1H5QA 2R2GA 1DDOA 3AY7A 1HWYA 1JE8A 1LLCA 4BMVA 3P9CA 2WD7B 1DC5A 5C7OO 1STZA 4G6DA 4Q47A 4II3A 1TVEA 4M73A 1E1KA 1CF7A 1JAXA 2TMGA 1NVMB 3I9MA 4I1IA 9LDTA 5IDXA 4G5HA 5LRSA 1DLIA 3KFWX 1ONOA 5I7VA 2G82A 1WWXA 2FWMX 4G7HF 3I59A 1VM6A 3K2ZA 3I23A 3R3SA 3V1UA 2QVOA 3LF2A 1R5HA 1UCRA 2VZ9A 4XKJA 4D44A 3V8BA 1QG6A 2FMUA 4NIMA 3ADOA 2ZTUA 3RU9A 1E3JA 4OM8A 3ZU2A 3W6UA 3O8QB 2OOSA 3F1LA 3ZWWA 3PZBA 1LSOA 4FW8A 4IPTA 3H3UA 4AJIA 1V4RA 1BI0A 5IT9Z 1PGNA 1U7TA 2CVQA 5IZCC 3ECHA 3WBFA 2V9VA 4IDEA 5HTOA 1E7SA 4HF1A 3H2SA 3VVBA 4AG3A 3K1MA 2QYSA 3GFIA 1PS8A 3CZRA 1E17A 2K27A 3JCZA 1BHSA 2G7HA 4R68A 4D3SA 2DQRA 4PDKA 3IJPA 4L0YB 2B0JA 3PGJA 1CRWG 4EJ6A 1KU9A 2IA1A 1FOKA 4CR7A 2B0LA 1T0FA 2AW5A 3FPLA 4D79A 1QNTA 2HGCA 4NB5A 3NUGA 4P8RA 4PG8A 1MUUA 4M74A 2BKAA 2YFQA 4K9DA 2L01A 1FYMA 1NAIA 1HZJA 1XEAA 3IAHA 3QHAA 1ADCA 2B4TO 3AU9A 4W7IA 2QWWA 3T4EA 1IF1A 2V6BA 1GZ4A 3TDZC 4WF2A 1DIAA 3E5XA 1NVGA 2H6BA 1K3TA 4FC6A 2EFWA 2VHXA 3ICCA 1ADBA 4B8ZA 1TQMA 1H94A 4TQGA 2Z99A 1DIBA 1KVTA 4B4OA 2XAAA 3I3OA 2VNAA 3COAC 2UAGA 1P1FA 4EJOA 4XIJA 3KP7A 3OECA 1P77A 1JLLA 4XR9A 4E2WA 1HXDA 5HDNA 2CW0F 2GZ1A 4PVDA 5JAIA 2ZFWA 1TLHB 2CWEA 4BOYA 4MVJA 2D4AA 3LZ6A 4HXYA 4XRRA 1ZCJA 2RH8A 2ZNYA 4M54A 2V6MA 2HKXA 3HNPA 1FMCA 3I9OA 4PZCA 3VPGA 4HNHA 3ZWOA 2EK5A 4E5NA 3ASVA 3DP7A 2WJPA 3W6JB 4B3IA 2CGPA 1XMKA 2NV6A 1D1SA 1TQIA 3JTHA 2VE9A 2O3QA 3HDHA 1P4WA 5JDIA 3HSEA 3GVHA 2EERA 1DC4A 3M7GA 2HMTA 2ZQZA 1P2FA 3WTSC 1GY8A 4KDFA 5DEQA 1PSDA 3HSKA 4DBVO 3AUTA 4F45A 1GQQA 2HCTA 3J80K 2DPGA 2ZJ1A 1IN4A 1E7WA 1K6JA 5IN5A 1BXGA 4RVHA 4KIFA 2WYWA 3IRQA 1QV6A 1UP7A 2HJSA 4P9FA 1Z73A 3F4BA 4CQMB 1F8FA 3H8VA 4KWIA 3R6DA 4YAKA 1C0KA 5DNAA 3V5NA 4PLYA 5A02A 4PLCA 3IWFA 3DZHA 2Z3YA 2DU8A 3VDRA 3VZSA 3W6KB 3KYDB 3MOGA 3TSCA 1EMDA 3UCXA 2A35A 4BL5A 3CUKA 5A9SB 3HRSA 4L18B 2PD6A 1UZNA 3DONA 3JV7A 5A3JA 3FBGA 3AUSA 1H2BA 2HRBA 4AL4A 2QZZA 5JMWA 2OZ6A 5I7SA 4O5OA 3A14A 3VHRA 2W2KB 4LCJA 4II2A 4PVCA 2DI3A 2NYXA 1BXKA 2YX7A 3TF5A 3ITKA 3PFWO 2CFCA 1LLDA 1YQDA 2H27A 4BKOA 2EFNA 5IFLA 1Z6TA 1DFHA 1A9YA 2PH3A 1XMAA 5ED4A 3PYMA 3CUQA 8LDHA 3QA9A 1T26A 1G0OA 4C4OA 5JO0A 1BBYA 3O03A 2I65A 1R5GA 2WWRA 3AUAA 4R1NA 3ABUA 4I8XA 4XYBA 4DLLA 1YBAA 1K78B 1KU2A 3DKWA 4OKNA 2K86A 2DM6A 2O3RA 4PLGA 4U0WA 3EMKA 4BNMA 5LC1A 5AOVA 3GNSA 1F8GA 4HX4A 5HDGA 3RCBA 2EKQA 2P6TA 3FXUA 1YYVA 1G6NA 4WNIA 3E9QA 3WODF 1ZGJA 5BR7A 2X5OA 3JQ8A 2NVBA 3FNFA 2A94A 3N58A 1UP4A 1YW8A 2YV1A 3BJAA 3DHEA 3DOCA 1FP2A 4YQZA 4BVAA 2TMDA 3R3JA 1P4AA 1YBMA 4EDFA 4QLCU 4I5DA 4J4TA 4HOBA 4WE3A 5IT9K 3RKYA 2LKPA 4JBAA 3ZN2A 4RCVA 2NNNA 3ZHYA 1P9LA 4Y13A 4M6XA 1LDEA 3ZMUA 3RBZA 4I7HA 3SZTA 4AIHA 3FXRA 1ON1A 3WR5A 5LHHA 4Z9XA 3VPXA 3P9KA 3DXJF 4BB5A 1KQ8A 5JFOA 4ALLA 1JAYA 3FNEA 1R36A 3JQAB 1WSUA 4FFOA 1I3MA 4J3FA 3EZLA 2NU8A 5GMOA 2QG4A 1TNSA 4PZJA 1OPCA 1VI2A 5HRUA 4RL6A 4F6CA 2ZMEA 4KA4A 2O3SA 4L0QA 4RO0A 4CYDA 5DDIP 3GY0A 1K89A 1MJ9A 2E1NA 2O03A 5D5XB 1LDBA 1KEWA 1NYTA 2NQTA 4ZQGA 5ILSA 4CMEA 4EZBA 4KZPA 1N9GB 1HBXG 2Q4BA 4O6VA 5IN4A 1YWGO 3B20A 3PJDA 3DL2A 4ZZDA 2AEMA 4U88A 2WSBA 5D5UB 4XYLA 4MIEA 4QFCA 3WU1B 3BAZA 3WGZA 1V9LA 3T8RA 1UFMA 1EK6A 2O3JA 5CVRA 5B4VA 1SEPA 4N5NA 4BQPA 1SMYF 1GV0A 1QYWA 3DHNA 1RWBA 3FXQA 4EUFA 1EDZA 3BYZA 3C1TA 3GZ4A 5MDHA 1T2CA 3FSRA 2GDZA 1Y8QA 2Q1UA 4TZKA 3V2UA 1QO0D 2KIUA 3CUQC 1KY5A 1CWUA 1E7RA 4PG5A 3KP2A 1FX7A 4KN7X 4R9RA 3CTAA 4CGZA 1R12A 3ZU3A 3HTUA 3OIFA 4EUHA 1SMTA 1SB8A 2IZ1A 3NV9A 1KEVA 3GR6A 2CF6A 1XSEA 4LGVA 4CODB 4PLFA 4IRHA 2JTVA 2LNBA 4A2UA 2UXNA 1ZXBA 1YLFA 1HSTA 1DLJA 3M2PA 4CLHA 4CMAA 3A9WA 1FBQA 4EI2A 5L3GA 5ER6A 3BMCB 2PJPA 2C59A 3RDIA 2Q99A 5F1RA 4FDAA 2PMHA 1KS9A 2O61A 1BVRA 1SOVA 2BHLA 4WPGA 4LGWA 3MJTA 5DOVA 1D8AA 4LD5A 3BTSA 4RZHA 4ZGWA 3WWZA 4GO1A 5L3CA 1V3VA 1HW1A 5ENVA 3GFJA 3AUUA 1BOAA 4CLRA 2J5RA 3MZYA 1W4ZA 5JYEA 3B02A 3RFTA 3RJ9A 4A5NA 2I9PA 3CZMA 1IZ0A 2R7DA 3NYWA 4XQEA 5IZ4A 3P7NA 4E2XA 1NWHA 2HAEA 3QV1A 1A04A 3R4KA 3GGGA 4E3ZA 3VC7A 1PP7U 2JAHA 4R1SA 3WQRA 4U6SA 4W9NC 1S7OA 1DP7P 3JQEA 3RSHA 1QSGA 3ZHXA 5L7WA 2J3HA 3BWGA 3QPTA 4KMFA 3OBBA 2Y1EA 1Q1HA 4HF0A 1ISGA 5IJZA 4IXTA 3F9IA 3CUOA 4F46A 1PGQA 5C37A 3F8NA 1SPXA 2M1BA 3TKYA 1YL7A 3GC6A 3BY6A 3E1KA 4DQVA 5A2QK 5IT3A 5BOXA 4NBVA 3F21A 5C7LO 1FDUA 1NTOA 2ISYA 1QYVA 4L9TA 2GPTA 1L7DA 1U5CA 4UVCA 4MVJE 5EPOA 5TC4A 4KFCA 1DEHA 1V3UA 1XGSA 2P7VB 1HTBA 4CM6A 1LBEA 2Y1CA 2VZ8A 3K2BA 2M5WA 1GTMA 4IQ8A 4BHBA 3ROUA 3VH2A 4YT2A 4A6DA 1R4NB 2P5UA 4AJ4A 3SJUA 3IL2A 4CV0A 1DXYA 1DFIA 4ZU3A 3B6ZA 1IW7F 3O6BB 4KTTE 1TEHA 4L74A 4YJFA 5B1YA 4M1QA 5T64A 1BXZA 3U5TA 2R00C 3WGTA 3WWYA 2VWHA 1JQBA 1ZRDA 1B3RA 3PWSA 1ZAOA 2WD8A 1USTA 2BFAA 4GX2A 1XU7A 4U6QA 5AXAA 3JD0A 1ZG3A 4D0PA 5HA5A 5TX7A 4UVAA 4RLHA 4ZICA 4M89A 2H63A 3FBTA 3MEXA 3ADPA 1RM0A 4J9UE 3ULKA 1IAWA 5JW6A 4FJ2A 2O50A 1EZ4A 1BRMA 4YPOA 3WGHA 4BNVA 3T5XA 1WRJA 3ZDFA 2HKOA 1NQOA 2HYFA 4N9HA 1UDCA 3H3JA 4BKQA 3N74A 4CJXA 4BHTA 1DPGA 4E4YA 4RB0A 4E2ZA 2OP0A 4LRTB 2FOIA 2QRLA 4Z9YA 2EP7A 3G0OA 4RB1A 1F12A 3LQQA 1HKTA 2B83A 3HWRA 3WGOA 1PS9A 2Q50A 4HYEA 2F1KA 4D43A 4AJ1A 4UHTA 3HN2A 1KYZA 3OIDA 2FNPA 1OMIA 3D4PA 3DOJA 3WGQA 2G9WA 1U78A 2W4QA 5JMPA 3PHIA 1I6XA 2R6JA 5COBA 3WJ7A 1HLPA 5F21A 3ZU5A 1H2HA 1O89A 3CXRA 2UYYA 1RYEA 1YS4A 1LLQA 1D3YA 4QQRA 3F46A 4Y6PA 4YXFA 3NRCA 5LLQA 3LYLA 3VAZA 1P1HA 5CDUA 4RV9A 1RYDA 4JGBA 4WLVA 2FMLA 3GRKA 4URFA 3R6SA 1QMGA 4U0VA 1I10A 2P9GA 2FU4A 3ECOA 4EUEA 3T7EA 1DRVA 1OYWA 3J81Z 3DBHA 3STHA 1KIFA 4BGUA 3WMWA 1I36A 4A6EA 1JTVA 3S55A 1FDSA 1IUKA 3RBVA 3R0JA 2NTNA 3PXXA 4BMSA 3QP5A 1BC8C 3D3EA 4Q39A 5DF1A 1HYEA 5JY6A 1PJTA 1E0DA 5CLSA 3BTVA 3GGPA 4IDDA 4YFNF 1KY4A 4MNUA 2ZK7A 3H2ZA 1P4XA 4GH5A 4RLSA 4XA8A 4ALNA 3ZMSA 3V2HA 2EHDA 4G6QA 4Q5SF 4I9UA 4BNXA 3RC2A 3LAJA 2WV0A 1EQUA 3HE3A 3KSUA 3AFNA 3WTWC 3KZYA 1EK5A 2X9GA 2BEOA 1FXSA 3K31A 3ENNA 3LC1O 3P2OA 3KYCB 2YYYA 4WLOA 5IF3A 3Q9VA 1JA9A 3GHHA 3ZWYA 4HZFA 1ZNQO 4RQUA 3R0IA 1ONVA 5BNIA 2XVCA 3GMDA 1Z6ZA 4GWGA 1H6AA 3KRTA 1PR3A 5JDIC 4NMHA 2GSDA 2Y67A 4RPHA 5COQA 4S05A 3B1FA 4ZQFA 3ZV5A 2HFHA 2HQRA 2GGSA 1OYIA 3JQFC 3OEYA 2CO5A 1AGNA 3FWZA 4TROA 3TZCA 5KTKA 1YIOA 2OP1A 3AOEC 3SEFA 2A68F 1W7PA 2IRFG 5L3ZA 3RBXA 4Z3KA 4AJLA 3IOYA 2AA3A 3OJLA 4HA8A 4MVJF 1ZSVA 3QY9A 5DT9A 2GERA 2BLLA 2Q8KA 5KVCA 3BOQA 3I5UA 1GCOA 2C2YA 2FR1A 1VKNA 5FB2A 1FYKA 2IDZA 1O6ZA 4HFNA 1BIAA 4QSMA 4YJGA 4E0BA 3EYIA 4OMZA 1WXDA 5LGNA 2F00A 4HY3A 4NU5A 1XGNA 2BFMA 1SB9A 3A1NA 4UVEA 2WDZA 1YW7A 5L4NA 5DUKA 3V7RA 5K9ZA 2AMFA 2OORA 3KLPX 5G0SA 1J5PA 1SD5A 1ZXLA 1KEUA 3WDSA 3F47A 3V7SA 1TT5B 2GN4A 3E9NA 4ZA2A 4HDVA 3I5MA 2DBBA 2M30A 2ZCWA 5ILOA 4GX0A 3GPDG 4MVJG 1UHWA 2KRFA 1ISJA 4GYIA 3RKRA 2YZ7A 3RIHA 2YHUA 4NQWA 3ZW8A 3W8DA 2RQPA 4FD3A 1HYHA 3I0TA 2M8EA 2HK9A 2W2LA 3HDJA 4U0KA 3LA7A 2QHXA 4CUKA 3KYDA 5D6EA 4RORA 4ESJA 1BGVA 3GUDA 1TT7A 5FYDA 1OZAA 2QLZA 4I2OA 4LK3A 4W9NA 1KA8A 4CM7A 1BMDA 2RN7A 4FGWA 3JD1A 1K5HA 2B4RO 3ETEA 1EV7A 3NX4A 4FR5A 5JYDA 1KC3A 1VRWA 3H4VA 1ZARA 2CYYA 2BYVE 5FLXK 3IKTA 4L9JA 1EUDA 1W8DA 3H6KA 3OICA 4HP8A 1G0NA 3AI2A 1U5TB 4YIIA 2Q2QA 1YKFA 3W4JA 4CUZA 4EM1A 5AVOA 1AXGA 3SLKA 1HDXA 4D45A 2GA2A 2BI8A 1W6UA 4QO7A 4ETSA 1ZFNA 4EM0B 2FZWA 1OR7A 5CHEA 3RD5A 4RVGA 1A7AA 5I7FA 1ZBQA 2QRJA 2GYYA 1A5ZA 1JVSA 4WEQA 5G2OA 1FP1D 5K5RA 1K7AA 4NQZA 3OJEA 4BNHA 3NRVA 4CQLA 2Y05A 1N1GA 2JFHA 4EV0A 5FD6A 4PLZA 2ZYGA 3PIIA 1P0FA 4KT5C 3RWBA 3S2FA 2B69A 4XZ3A 2VC1A 3ZWNA 1LQ1A 4A0ZA 4I09A 3ZP5A 2QRKA 4UVDA 3X2FA 3R60A 4ALJA 1NASA 4R3WA 4B7UA 1YQGA 4I9NA 3VZPA 1T6SA 2D5AA 4ITUA 1PTJA 1XKQA 3V2GA 5LGUA 3OF2A 1P92A 3DTYA 1GXPA 3TDKA 3ZHZA 4H0EA 1PJSA 4QUKA 3H3FA 5CPBA 1PEDA 2KJBA 2J6IA 3LT2A 4OMYA 4IY1A 3KLMX 4IXAA 2BI7A 1NXQA 3Q0EA 1VL8A 4JNKA 3UFXA 2DLLA 3BHIA 5FI3A 4R9SA 1GPDG 3OM9A 3OP4A 2PMUA 2A07F 4QXMA 1HL3A 3KE2A 3QOPA 1F9NA 5HLGA 2F5EA 2J3IA 2C5EA 3HJAA 4MPDA 3NEPX 4CLOB 4WCGA 2Z5LA 4FPXA 4KUHA 4D0SA 1JKFA 1L0OC 2VUSA 4AJJA 4CLEA 3G3EA 4CM4A 2PG4A 1UDBA 4BNLA 5DV5A 1I8TA 5A2QZ 2VOJA 2HS5A 4BNUA 2CDAA 4HV5A 5H83A 4MKZA 2PZKA 3UXYA 3PLRA 1LSUA 1O7FA 3IP3A 2OFPA 3ABTA 4UAGA 1IRFA 2HLPA 2PGDA 3QPHA 2FQ3A 3WQSB 2D5CA 3IQDB 1U5TC 4ZYDA 3HRTA 2CDBA 3GHYA 3OJOA 4MTDA 3GT0A 5DDGA 2DUUA 2Q4EA 3IHUA 5L7YA 4ND1A 4AICA 4DQ2A 3JYPA 3KUXA 3LC2O 3OJ0A 3KV3O 1YB5A 2YQ4A 3WSWA 1EVYA 1DHRA 1DJNA 4XCVA 5JCJA 1Z6RA 1FWZA 4IXWA 2MLGA 3WYCA 4BNWA 2DPHA 3GLQA 3M1LA 3ZH2A 2FXAA 5F3RA 5CVJA 4FT8A 3DDNA 3LLSA 3ZMTA 1NPDA 4NK4A 1U4OA 3VPHA 3UCEA 5JC8A 1XD7A 4I0BA 4IDBA 1J7KA 4XB1A 4CICA 4A0YA 2NRAC 3CSDA 5I8WA 4ON0A 3HFGA 2L02A 4P5OA 4BHCA 1A27A 4LW8A 3WU0A 1C1DA 2YDYA 4OL9A 3Q9SA 3JYQA 3NTQA 4ONEA 4F3YA 5A4DA 2C07A 3JQBC 3VKUA 4CM3A 2DTXA 1RM5A 1ZK4A 2BFPA 1AHHA 3U3XA 2JKVA 2JD0A 3DFZA 5IZCA 1ADFA 2E37A 2NQ8A 1IN8A 4FJ0A 4FJ1A 2XHKA 4I9HA 2NNYA 1DRUA 1I2CA 1EUZA 4OAQA 5IXYA 4MQ9F 2Y1GA 2PLYA 3E3VA 5G4KA 3TOZA 2EB7A 4LVCA 1OOEA 1FSEA 4ENJA 5BPDA 3HDYA 3OJFA 5F5LA 5KVVA 1BN5A 3C18A 4IJVA 4A7PA 2P68A 2YHIA 3HHGA 3BTOA 1DO8A 1WLYA 4DWVA 2HDCA 5KVRA 4R69A 4ZH4F 3QWIA 4J7XA 5CVVA 1U3UA 4FIZA 2XAJA 4G7ZF 2A6HF 1C1XB 1GDHA 2OO5A 2B35A 4A5OA 3GEMA 5EJ2A 4OINF 2VRBA 1GUZA 3AI1A 4KIBA 4FCCA 1IY8A 4XGIA 3HQ4O 1S7AA 2GD1O 1HZZA 1F17A 4ND3A 3Q2KA 1D3AA 5DCYA 3RKUA 3TFOA 3BJOA 2XPCA 8ADHA 3LLVA 2HR3A 2PEXA 5L3FA 4XIYA 3U9GA 2WC2A 3HZZA 5G4LA 1C0WA 1KVQA 1ZKMA 2DQLA 3MTGA 4N18A 4TRNA 1VJTA 2SCUA 3MWEB 5JBIA 4YAEA 5HLIA 3TQNA 3DFUA 2GZWA 1YE3A 2VTDA 1NFRA 4GXOA 2RAFA 3JQDA 2DQ4A 2GLXA 1VKOA 2ACJA 1I32A 1HRDA 2FRDA 2O8XA 4P96A 1RI7A 3GFLA 5JI6A 2D3TA 3ZNOA 3MWMA 2A69F 3LVFO 3T8TA 2D1YA 3RFVA 1PIWA 2AHRA 4RS8A 1F0YA 3NJ4A 3PP8A 4E12A 4IMRA 1H9AA 1Y81A 5K1YA 4LMRA 3ZPLA 2IA0A 1ZJYA 5KVSA 1IE3A 4L73A 3PGXA 1E3LA 4WK8F 1N9GA 3PJGA 4CMIA 1T25A 3CO6C 4MIOA 3PDUA 3F8BA 4CM1A 4C7KA 1YS6A 4E2YA 1QYCA 2EA2A 3K9QO 4MQVA 1WP4A 1H6CA 4Q9NA 4UVHA 4MKXA 4G8XA 1JW9B 4L9RA 3BMQA 5JVTA 3L09A 2EXXA 1MLDA 2UDPA 3OETA 3UN1A 4BNYA 3TO7A 3R61A 1Y8QB 1GZ3A 4J2OA 1Q7GA 2P2SA 4IDCA 4M87A 4PLHA 4PCQA 3E6MA 2EKLA 3WTUC 2AXQA 4IHTA 5I8ZA 2QM3A 2C29D 1LUAA 2HWVA 1YRLA 3UHAA 1WDMA 4WXDA 4LLGF 4AFNA 3ELKA 1BG6A 3L2CA 3TRIA 4HNGA 1YW9A 3UGKA 4ZYHA 1J5YA 4NG5A 3GF2A 5AXBA 4GYGA 3ZMVA 3PQFA 2HYGD 4BS9A 2HOEA 1V0JA 4EYEA 3E97A 4IS3A 1GUYA 3DPTA 3CPSA 4NHEA 2FR0A 5JY1A 2CVZA 1ZW1A 4RB3C 3MZ0A 4JQFA 2P5YA 5LHIA 4OH1A 1ZG1A 6LDHA 2ESHA 4YT4A 4NK5A 3GUYA 5TRDA 4B4WA 2EJRA 3QVXA 2AG5A 3HB5X 1H9GA 1BDMA 1RIOH 3H92A 1KQ0A 3GOHA 1QKIA 4NBTA 1NQTA 2IZZA 5E1XA 2OXIA 4AVPA 4BNIA 1UZLA 2VXZA 3GZNB 3I1JA 4M9SA 1NQAO 4JP3A 4YCAA 3F8FA 5EERA 1E3EA 2Q3EA 1YGYA 4GLOA 3WTBA 5HDKA 1E6WA 1ORRA 1PQPA 5DCUA 4C7JA 2I67A 2DPUA 3ONEA 2JT1A 4M9XA 4IHSA 2VHVA 3KLOA 1E6EA 4FC7A 3FF4A 1R7JA 1Y9AA 2IODA 1DSSG 1VSVA 3JQ9C 3M1AA 4GX5A 2W8ZA 4IUYA 3D0SA 2X0JA 2V1XA 4KYWA 4DIFA 1R37A 1QGPA 3QQPA 3AM3A 5KNLA 5HVQC 1MXHA 5FF9A 4BKRA 5LDHA 1RKXA 2ZATA 4JJGA 5LHGA 4E33A 2W25A 3CUQB 4AJNA 2HMVA 3FZVA 1IYZA 3RFXA 2HMSA 1C3VA 4HKTA 4ESBA 2W98A 2JPCA 3SX2A 4J91A 3JW4A 2GRAA 3ZHBA 1MA0A 2ZJ2A 1Z7UA 4M71A 4J1SA 4CHUA 1ZHFA 3L9XA 2FSSA 2EJVA 3DB2A 3VZQA 1QXSA 4CV1A 4R79A 3FHZA 3IRRA 1T4BA 4CL8A 3WB9A 2CNBA 3K1NA 3D7LA 1U9JA 4L5IA 4B79A 4BV8A 1NWCA 3AM4A 3AWDA 5I9LA 5KJCA 4OIPF 1K79A 4CL3A 1LEHA 1MFPA 1W7PD 3RIRA 4IIVA 5ITWA 4BO2A 1P33A 4U7DA 4IJKA 2HUNA 5EEHA 3NDRA 1SO8A 4ALIA 3ZV6A 1P1KA 3RAJA 3EC7A 1H0MA 5T8KA 3ISPA 1DB3A 1HDRA 3GK3A 4NH4A 3PHHA 4W7HA 4A10A 2OBYA 4DPKA 1DPUA 3H9JA 1X3UA 1T2KA 2YJZA 2X86A 1BXGB 3EDMA 4J43A 3WE2A 2VQ3A 3QVOA 2YQ5A 4IGEA 5E20A 4JX8A 2K7LA 3WYEA 3DFGA 2AS5F 1IXSB 1M66A 5I7EA 1LDNA 3LT0A 4J7CA 4RJTA 1DIRA 1ZMOA 4OGWA 3F4LA 3WTTC 2EGGA 4OOEA 4GKBA 1IHYA 2EV6A 4J1TA 3WGIA 5HM8A 3DBRA 4JBHA 4P38A 3U62A 3KBOA 3PIDA 1I27A 1J75A 3F5SA 3OOPA 3QWAA 4UUMA 1D8JA 2PI0A 2DW4A 2YX4A 1A9ZA 2B37A 2PH5A 2YUTA 3GVPA 3NGLA 1PZHA 1N1EA 1E3IA 1I3KA 3Q2IA 4DLBA 4MVJP 1P6RA 4YFKF 3DF8A 3KP4A 2W2KA 4YEDA 4R51A 4OXYA 3WIEA 2CD9A 3K8ZA 1KVUA 4EQQA 1ISFA 1EVJA 4FBGA 1ZGAA 2IW5A 1V8BA 4KTVE 4PG6A 4YJHB 1LDDA 1RUOA 1N7HA 2YV2A 4CZZA 4R5HA 3GQVA 2JHFA 4YAGA 4DC0A 1H9TA 1YJQA 4IDAA 1I0ZA 3PI7A 2P5LC 1ZMTA 2H5LA 4WOJA 1YVEI 3V1YA 3DBLB 3X2EA 1XGOA 1AUPA 1I1GA 1ZRFA 1V3FA 3CO7C 1VC2A 3H9QA 3WJAA 3RUDA 3QE3A 1B8PA 1DIHA 3TOXA 3KEOA 3S1LA 2FF4A 3FMSA 1TW3A 1UXHA 4NBRA 5ES3A 1REPC 2ILTA 2PGJA 3U4CA 4OQYA 4CLDA 3K73O 4TRJA 1FC3A 5DULA 1PGPA 5LRRA 4YFXF 3IUPA 4RF4A 1NM5A 5ADHA 4J1QA 1UAGA 5DCFA 1EH7A 1T1RA 2A4KA 1X7DA 3KOUA 4F6LA 3SJ7A 1Z9CA 1NVTA 1XYGA 3LC7O 2XAHA 2MBFA 4FOOA 4KUEA 4MVJM 4OQZA 2Z9OA 3DR3A 3U1DA 3LQFA 1IN7A 2PBIA 3GWZA 1ZO8A 2AQKA 5HOOA 2V1DA 2VYND 3FNGA 4FS3A 4GI2A 1NHAA 4MHGA 1PZEA 2CUKA 2VWPA 5KWEA 4U0JA 3JQFA 1HXHA 1LU9A 1PQWA 1JHHA 5A3VA 3TL2A 1Y5RA 5HWSA 3K96A 3ZMZA 2C5AA 2PNFA 3WICA 3PPIA 4PN3A 3FMRA 1OBFO 2JCYA 4HUJA 3VH3A 3WTXC 2X0NA 1Q0LA 3O3KA 2WD7A 4LVUA 3SQNA 4R54A 5TT1A 5BPIA 4KNYA 2X23A 2QBYB 3L6EA 1TT5A 5TS3A 4YAIA 1XHLA 3NAQA 2R00A 4UUNA 4JN6B 3I54A 4RGXA 2VN2A 1RNLA 1XSXA 1DFGA 1ZK2A 1RM3A 3BMCA 3JQ9A 4NJMA 4RPGA 3WLEA 2EWMA 5A1TA 1M6HA 1B16A 2EF1A 2IA2A 4TRMA 3MEQA 1X13A 3RJPA 1ISMA 2A92A 5THKA 3GPIA 4WK6A 1K6IA 1HLDA 4E13A 1IXCA 5H6QA 3AU8A 2PKRA 3B1KA 4IMPA 5KJEA 1KERA 3RQSA 2H94A 1RM4A 2GN9A 1GADO 1NR1A 2Q1WA 3BIOA 2P4HX 3MCVA 4HFRA 3FPCA 2ESNA 3HRMA 2GXBA 1PJBA 4D3DA 2MD5A 3NGXA 2I3GA 2OD5A 5A04A 4ID9A 3OFSA 1OKRA 1HSJA 2G0TA 3I53A 4NFYA 2RKHA 2A5YB 4L9NA 4E5MA 2VODA 3K1PA 4JK3A 2GZ2A 2X9VA 2C54A 5K5OA 4GBJA 3NJ8A 4P4NA 4MEYF 1UXGA 4BO7A 3INRA 3MCZA 4KOAA 4RVUA 4IF4A 5IDWA 1FK8A 4WCFC 2L54A 5CDTA 1I3NA 4WOKA 1T24A 3C8MA 4LK1F 3PFIA 2QZ9A 5MGBA 2HJRA 4DGSA 2PZLA 3U09A 4N9IA 1IZ1A 4BO4A 3M9AA 4YRAA 4IJAA 3DWFA 4YRBA 2VOPA 3H9GA 2I3AA 3CKYA 3GO5A 1SFXA 4M55A 4BB6A 2K02A 1B14A 2PA3A 1WNTA 1GD1O 2CZCA 3TOBA 2LDBA 2BH9A 2Y66A 3EY4A 4GSLA 3ZI0A 3JQ8B 3LWFA 2CDCA 1FY7A 1JXSA 1U3VA 4KP7A 3VKVA 4LB6B 4OIRF 1E6UA 1JDJA 2VCYA 1ONNA 4OIQF 1MGTA 3E6BA 1WVGA 2D2IA 3PJFA 4G81A 2JSCA 2HEOA 1HKUA 4U0YA 2EW2A 1IULA 4EEXA 3ZMDA 3INGA 3LA2A 1B8VA 3EAGA 3JD3A 4AJEA 4MIYA 2O4CA 3FR8A 2FA5A 1WI9A 4DA9A 4UVIA 1V35A 4XDZA 1I2BA 2KKOA 2GN8A 2NSDA 1LQUA 3VPFA 5K6AC 4E30A 1E3SA 1BIBA 3BMNB 3F8MA 2X9NA 3H7AA 3JTGA 3ZU4A 2F5CA 2RV8A 3LU1A 5ICEA 2IT0A 4BKPA 4HLXA 1IPFA 3EDPA 2CF5A 3TQHA 4NJOA 4OJNA 2OQGA 3GLXA 2BF7A 2OZPA 2X8LA 1Z45A 4RDIA 1RPNA 3DMTC 4DBZA 2QQBA 5LCXA 4TZTA 5T8KC 1LNWA 3NKLA 4HDUA 4TV7A 5L7TA 3C7DB 1JWBB 4B8WA 4GL4A 1P3DA 3A4VA 4E6PA 3D4OA 3DQPA 4XX0A 1PL8A 3BDDA 4GMFA 1LXCA 2X0LA 1OC2A 4TWRA 2X5JO 5THQA 3UVEA 5JAMA 3VTFA 3A06A 1FSHA 4Z2YA 1MXFA 1EH6A 1ENYA 4LB5A 4XYEA 1HDCA 5B4UA 3INTA 4L4SA 3ZN0A 1J9IA 3JAMK 1IPEA 4CLOA 3GF4A 3TZKA 1DPRA 1O5IA 4ZD6A 1H6DA 3RTRA 1BSVA 2PGLA 4R1UA 3QWFA 4CO8A 1M75A 3UICA 2C7VA 4PLVA 1LJ8A 3ZWVA 1KC1A 2WTEA 4YJGB 2G17A 3PQKA 5HS7A 1LRKA 3DAPA 4LMPA 3WFIA 3ZWMA 5CEEA 2VTEA 3JTMA 4MP6A 4NFHA 4WASA 1PX0A 2GUGA 2DK5A 2OL4A 4NPCA 3PVZA 4LRSB 3AFMA 4R01A 5G0UA 3RPUA 1SD6A 3KYCA 2D59A 2NTJA 3KETA 1TI7A 3NT5A 4L4RA 1XQ1A 4Y6SA 4UXNA 1QV7A 1ZG5A 2OGUA 2JJYA 4OIMA 4DUPA 1HKSA 4RB2C 1Q0HA 3OIGA 1QZYA 1M76A 4XQ9A 4XR4A 1C0IA 2P4QA 3IUSA 4HX5A 4MINA 3DBHB 4J90A 3BXXA 4RDHA 4YDRA 3RKWA 3ORFA 4RF2A 2J5OA 3DPLC 4BO0A 4HFJA 1OFGA 2MLKA 3F3XA 4R4JA 2DLDA 4X54A 3QLJA 1D1TA 3F1KA 4ZHSA 1F1ZA 1LDYA 1MG5A 2D45A 3ZCXA 2QYOA 1VE9A 4RVFA 3Q6IA 3EETA 1CETA 1O3RA 2XKOA 1ZJZA 3T1BA 2YR2A 1E77A 1LRJA 2FPGA 2FZEA 3W8EA 4BGVA 4JBIA 1WMAA 5L45A 2O7SA 2YW9A 3ZGYA 1U2GA 5COAA 4LFUA 3HHHA 1ULSA 1RZ4A 4J49A 2VBYA 1CJCA 1NBOA 4UV8A 3GZ6A 1R00A 1RJWA 2BFOA 2P7CB 5FO5A 2BGMA 2GZ3A 3DMYA 4H7PA 4B7XA 4CR6A 1CIVA 5L95A 2J5QA 1YO5C 3I9NA 3HYIA 4BH9A 1Y5MA 2IJLA 4KIGA 2F2EA 1T39A 4JQCA 3DBLA 4XSXF 4CQMA 1GXQA 3VH1A 2PQ8A 3TFQA 4EVIA 1CGPA 6PAXA 3TPCA 3MQ0A 1ENPA 2VN8A 3HFSA 4M49A 4MDHA 2CSOA 4MJLA 4XQCA 4Y6RA 1DJQA 3WSVA 3I59B 5H82A 3DEUA 1ZH8A 1N7GA 3OQBA 3ZWAA 1GYRA 3I4CA 4FQ8A 4W6ZA 3SLGA 4P9UA 4QTZA 3KVOA 5L40A 4QEDA 3RASA 1I30A 4P55A 2V65A 3L4BC 3KHUA 3EVNA 3OSUA 4DMMA 1MJAA 4DMLA 3KB6A 4KMUX 4CDGA 5CPFA 3L6OO 5L3EA 1R1VA 2Z5UA 1EEHA 3PQJA 1EBFA 2NLOA 2P91A 4KUGA 4XRGA 3MWDB 2MH9A 3VB2A 2RHRA 1U4SA 3QP6A 4I02A 4ENKA 4YJDA 3HG7A 1B9NA 3DC2A 4J16A 2AE2A 4CM9A 3FX3A 4CQMD 3KP6A 2F5FA 2PD3A 4KQWA 1ARZA 1W0CA 1O9BA 1FJHA 2NVWA 4ZVVA 3RI3A 1QBJA 4UV9A 3LSYA 4R16A 3RUIA 3F23A 1ULYA 1YFHA 2FRHA 1NAHA 2RHCA 4TRRA 5B37A 4K1LA 3I71A 3GUCA 1XU9A 1ZH5A 4MP3A 5GZ1A 3TO6A 3WTZA 3J80Z 1Z7BA 4RPLA 1KEPA 5KKAA 5J8FA 3KSDO 5DCWA 4D42A 3AAFA 3WFJA 3G3ZA 4MP8A 1LDKB 3I9JA 5ITVA 2I5PO 4GX1A 1MD0A 5I9NA 3TNLA 2ZBKA 3BP8A 3GH3A 4GQAA 3C7JA 5U4QA 4R1HA 1BW9B 2Y93A 4IZHA 5EESA 5BMZA 1BWSA 4UREA 1GEEA 4UEKA 1PL6A 1U8RA 1PZGA 4NZ9A 3M6IA 4QO8A 3S2EA 3GXOA 1FT9A 1UXIA 3UCFA 2Q0OA 1F06A 3RUHA 5CYVA 1D7OA 4UEOA 2DO7A 5EL0A 5JNLA 3BROA 1S6YA 2EFOA 4XJSA 1R0KA 4E5PA 1P0CA 1V3TA 1ZK0A 4Q48A 1LC0A 1ENOA 2IXBA 3VOEA 2IEBA 1R1TA 1FLIA 1PDNC 3DMTA 3DZGA 4EITA 4RF3A 2Q45A 4JBGA 2E7XA 3IJRA 4ZQHA 2M87A 4Z0TA 4CPDA 5KJFA 3GVCA 4WECA 1S7CA 1ZSNA 3K69A 2D8AA 2DC1A 3WMXA 2IE0A 3KO8A 3L4BA 5FGMA 3GDOA 1S8NA 2H09A 5A5FA 2ADUA 4WLFA 5C3MA 3ROKA 4CR8A 3KP3A 3IS3A 3FN4A 2XXJA 5K6AA 2JRTA 3S2WA 5ER9A 1WAMA 1R58A 1XB4A 1B59A 3P5SA 2FPIA 3DZIA 5BSFA 2JHGA 1X0XA 2IXAA 2OUIA 4IDFA 1FPQA 3HRUA 1LI4A 3ZV4A 5DN9A 4DYVA 2VWGA 1N8KA 3ON5A 4NBUA 4UNOA 2V79A 1MGOA 5F1KA 4HBGA 1V6AA 5A9SA 5ICMA 3TN7A 5JS6A 3G73A 1BI3A 2WYVA 1GYPA 1P1JA 2LSOA 4J2HA 5DP1A 3FMQA 1U3EM 3CEAA 1EFKA 5BSHA 1LX6A 2Y75A 2FEZA 2DBRA 2I76A 1RUNA 2ZO4A 1SMKA 1SD7A 5LBQA 3MTJA 3KEQA 5D6FA 4RAYA 4WJZA 1KGSA 1KQ9A 4RAZA 1OC4A 4AVYA 2YU3A 3O2PE 5HBRA 2EP5A 5K5QA 2O48X 2X0IA 4I0AA 3V7CA 2W2LD 1FNNA 2XGXA 1LQTA 4DC1A 4YRDA 4EJMA 3SXPA 2W84A 3WGYA 2O3UA 4OKIA 4L76A 3W4KA 3UW3A 3SBOA 4NJMB 2RH4A 3OMLA 4HW0A 2FPPA 1R15A 4FHTA 3GFMA 3KP5A 1J0XO 1ZK1A 1X1TA 3G1TA 4LCEA 4XWYA 3FCOA 2KIMA 5D8KB 3DXFA 3TZHA 2OQRA 3JQGB 1Z7EA 1YXMA 3D3WB 3ZNPA 1WWKA 4RPJA 1F4KA 1NNUA 1X7HA 2VUUA 4IJWA 1XELA 3AI3A 1QPMA 1H6BA 3ERED 2YDXA 3Q1LA 3G17A 3E18A 3QVSA 3PWKA 3K0LA 2WM3A 4YWJA 3RC9A 5L51A 1Z74A 1LVAA 1U6GA 4HBLA 4LLLA 3UAGA 5E8IA 3B70A 4L75A 1VJ1A 1D8KA 2AQ8A 5A03A 4CLXA 2V7PA 1EDOA 2AEFA 2A61A 1C0PA 2VE8A 1ZVMA 2X58A 3E8XA 4EBFA 4E5KA 1JN0A 1CF2O 4UUOA 2E7WA 3LA3A 1TXGA 3ANLA 4XBFA 4KWHA 1IZ9A 1WQ2A 2GF2A 5F1PA 3K6JA 3ENKA 4KUMA 3D5LA 2Q2VA 1FZPB 3JSPA 2Q1TA 3AOEA 1XGMA 3IWZA 3GEDA 1ODDA 3SFZA 1PGJA 4S1VA 3AY6A 2XF8A 5ICSA 3O4RA 4RPKA 2DVMA 4CM5A 6ADHA 3WNVA 4FFPA 4YACA 4Q3DA 1CF7B 5AONA 2NS0A 4DREA 4L9VA 5JC1A 4XLPF 2QQAA 4ESFA 4WLUA 1KYWA 5CVUA 1IUYA 5IG2A 2Z33A 2JL1A 2YPRA 2J3KA 1LSJA 1SAYA 3JQAD 3JYLA 1KOLA 4OSPA 4J4HA 3I64A 4L5JA 5JDCC 1W5TA 5TIIA 2G5CA 4BYYA 1YONA 2VUTA 2R3SA 3M8EA 1LA2A 1I5RA 1LJ9A 4MKRA 4RQTA 3IC7A 3JQBA 1HYGA 2RDPA 5TNXA 2VONA 3RKXA 4BGIA 4CM8B 4DIBA 1VLLA 2IVMA 4RGRA 3G1UA 2YSRA 3OA0A 3CMCO 2P8TA 4CUJA 4BV9A 4IINA 3ZZNA 5GZ3A 2OZUA 1NQ5A 3PDJA 5IDYA 2HQNA 3DHYA 1UZMA 4ENMA 2JD2A 4ALMA 1LRLA 2ZXJA 1PL7A 2ZCVA 3HSFA 3OH8A 4YBZA 3JSOA 4A73A 4DQXA 5BSEA 5CAEA 1PWXA 1ADGA 1XGKA 1KVSA 4DTIA 3GA0A 1TNTA 3WLFA 3PFFA 4E5YA 1YDWA 2Y1OA 3C1OA 3G79A 5LGTA 1Q7BA 3ZWPA 4Q3EA 2O23A 2ZNZA 1K78A 5DD4A 4AJPA 2RC4A 4FFRA 3C7CB 1TTYA 3C1DA 1K0UA 3CMMA 3GDFA 4CMCA 2FOKA 4HLYA 1T2FA 2Y99A 2C20A 5FFFA 1CYDA 4N5LA 4HV4A 3HDQA 4H3VA 3WOHA 3V8LA 1BI2A 2EW8A 2PKQP 2IEDA 3LDHA 4O1MA 2OU2A 2AEJA 2DUWA 1Y0UA 3AK4A 1T98A 4NNJA 3NDIA 2XKPA 3O38A 4QT0A 4Y9DA 3ZW9A 4WWCA 4GMGA 5H6RA 2NAZA 2I99A 3ZWBA 4UVBA 5EMHA 5DBFA 3J7AO 4YB8A 4IPAA 4PGGA 1TQPA 4A12A 2C82A 2DFDA 2RIRA 3NQOA 5FFZA 3ULQB 4ZRMA 4FFMA 1YBVA 3MFKA 4Z0PA 2ZB3A 4GVLA 5C7IO 3QSGA 3T7CA 3ZWXA 4CM4B 2EEZA 1UJMA 3DZFA 5HS4A 3WNQA 2VBXA 1YTYA 3F6YA 3HUDA 2RVCA 3CDHA 1Q0QA 3I6QA 5KIAA 3KCCA 3PEFA 2D2WA 4OOFA 4DVJA 5KKCA 4B3HA 4LG0A 3TJRA 5T57A 4FSHA 4BKUA 1WZEA 4NU6A 4NBWA 4BMNA 4BNCA 1HETA 1GR0A 3BTUA 4BO3A 3HTSB 1U8XX 4OXKA 4EGZA 5DCMB 3L9FA 1ENZA 1W4MA 2D0IA 3L77A 1M2WA 2JFFA 1AHIA 2XUBA 1S29A 1NPYA 1Z75A 3E5MA 1NR7A 3W8FA 2XIGA 2P5KA 3HOSA 2Y0CA 3JQCA 2H6CA 3H5NA 2GWRA 3ROMA 5JPIA 4BNNA 2YY7A 5ILUA 3DZBA 1QORA 3H5AA 1LEBA 1UDAA 4FX4A 4E31A 3HIFA 2L3DA 1XSVA 4TVOA 3UKOA 3W1VA 4K6FA 4DYDA 1U1IA 3K30A 4D46A 5B12A 2HU2A 3EGOA 4O59O 3SC4A 3LAPA 1YO6A 4BNZA 4BGEA 4O5VA 2GAUA 2XROA 1Y9EA 2OHXA 2UUPA 4XB2A 1E5LA 2ZB4A 3D5TA 7ADHA 3LQRA 3EVTA 4N0BA 1O7LA 1U8FO 3M1EA 1XLTA 3KM0A 3GNTA 4G9YA 1KYQA 1HDZA 3GEGA 2EIHA 2OA4A 1LLUA 2BGKA 3U9LA 1CERA 3TL3A 3DZKA 2HO5A 5AYVA 3RROA 3VODA 2ISZA 1VTNC 1AWCA 4MVJH 1SFUA 2DTEA 3GG2A 4XYMA 1SBYA 1LSSA 1X7GA 1XIVA 2M45A 1R16A 1XA0A 3IP1A 4D7AA 3CIFA 1ZK3A 7MDHA 2PZJA 4W4TA 2LF7A 2Y1DA 3VTZA 2VBZA 3BPXA 3QAHA 4E70A 4OXNA 4A0SA 4TKMA 2K4JA 1YQXA 2VHWA 1IOLA 1GCUA 4INAA 2J8ZA 4RF5A 5LDGA 4I98B 1IL0A 3DZJA 2EFQA 3W6ZA 4E21A 5CDSA 1O57A 2NUAA 5HS6A 2GXGA 4XGKA 3D0OA 1UB9A 3PLNA 4JJIA 3K5PA 4U8GA 2GO1A 4XD2A 4L8VA 2GCGA 3ANMA 3EUWA 5GY7A 3QRFF 4Q3AA 3LFKA 2BGLA 4E32A 3OEWA 1E5QA 1EFLA 1ZEJA 1Z91A 1ZLKA 4I5EA 1CDOA 3C3XA 1R4MB 4WCFB 1W73A 1F5TA 4O6JA 2E49A 1JVBA 2FE3A 1O3QA 3I6IA 4XQGA 3P19A 1BVUA 3PJEA 4BO8A 4DQUA 1B0AA 5L9AA 3I58A 4Z0HO 4PZDA 3DAFA 2I66A 4LJZF 4M8SA 4DXHA 1C1DB 1FDVA 1XR3A 1F14A 3WS7A 1WMBA 5JSFA 1J2XA 4BO1A 4XRFA 3EW7A 2WTBA 3GVXA 1JKIA 1SC6A 1VPDA 2E48A 1GYQA 3D5QA 3JSAA 4Z9FA 5CDGA 3RI4A 3PHLA 2ZMEB 4YIFA 1YL5A 4LK0F 1TBXA 4ZN6A 2BELA 2QBYA 3PHJA 1A4UA 1YB4A 2Y68A 5EEGA 4ZYGA 4ZQEA 1S3JA 3I9LA 4ND2A 2C6YA 1JKJA 4BAYA 5ILGA 4JIGA 3I4FA 1IN5A 2YHIB 3P7MA 4AD9A 1ZRCA 4I5GA 4UVGA 4XDYA 4EGYA 1U3WA 5AQ1A 1NPTO 2FSWA 1BTOA 1QYDA 3TZ6A 1W7PB 3FTPA 2WMDA 1HQCA 3JQ7B 3QVTA 1GUFA 4BNTA 1T2AA 4FFLA 3GZ5A 1PP8F 3K92A 1MC4A 2DU9A 5DYMA 1ISIA 1GAEO 1KVRA 2E4AA 3H9EO 4FX0A 3HHPA 4WCFA 5AXCA 5J23A 4GGPA 4I08A 4AIKA 1WZIA 1GU7A 2JD1A 2ZB8A 2XV4S 1X14A 1HKQA 2DTRA 4KDPA 2CG4A 2FY8A 1GQ2A 1HE4A 3C7AA 5TQVA 2VYVD 4LG0B 4K28A 4MVJI 3C1AA 5HLHA 3E6CC 2W85A 5AIPA 3PYXA 5JCXA 3F8CA 3TOAA 2NM0A 4CMHA 1UHMA 2ETHA 4D3FA 1I2ZA 5F64A 2CMDA 2NACA 3F6OA 2BV6A 2O7QA 4HAMA 4MEXF 2PKQO 3UUWA 3C3WA 5DD8A 1M67A 1E92A 1PR9A 3KYBA 4RGUA 2B5WA 3ETGA 4DPMA 2HZTA 1DAPA 3SC6A 5CEFA 2LF8A 2ELHA 3UF0A 4A27A 1ON2A 1CQJA 5L4SA 3GVAA 4AIJA 1LNQA 5D8LB 5D5VB 4KICA 9LDBA 2P5VA 1XDSA 4A5MA 1IB6A 3U2RA 3ONFA 3B73A 2IPQX 5EIOA 3DOOA 3ZNNA 3NTOA 4JCOA 2A6EF 2OAZA 3WQQA 5CG2A 2MH2A 4BNJA 2GQQA 3WTCA 1U2WA 1SEVA 3VEPA 4N5MA
chains in the Genus database with same CATH superfamily
3FIWA 3H65A 4ZVPA 3MJ4A 4JC4A 1PP4A 1SK8A 2X4IA 3EULA 3HU5A 4EBFA 3M9LA 4S1WA 1L6IA 4YMVA 4ZPXA 3WL7A 1SFEA 1FBUA 1X7XA 5EE3A 1U2DA 3DWGA 1LC3A 2H4WA 3KWFA 4J6EA 4GI7A 4AKSA 3QW4B 3LUBA 1V3QE 2X5KO 4Q03A 4RUKA 5KQGA 3PNQA 2Q9AA 4PCLA 1AOYA 3CNHA 2XD4A 3QUSA 1FVFA 4GVPA 3ND8A 2ADMA 3G5AA 5T4FA 4BWFB 4DM7A 1IG7A 3OIOA 4TMTA 5JAQA 1VKRA 4IP0A 2TDXA 5TEWA 1C7EA 3EXG1 3UJ9A 3GJ7A 2AQHA 2JANA 2QNIA 4DCGA 1L1RA 4O4LB 4EVQA 1TMOA 4EEFG 1G20B 2O07A 4KH1A 2H8GA 1L1FA 3ZX5A 2IE8A 4WN9B 5BT8A 1IN6A 3QLUA 4HX8A 3JZFA 4D8UA 4QTRA 1C9YA 1FOWA 3CCUI 2J7PA 2BMAA 3D7KA 4QRIA 4RGSA 1SCDA 3T7TA 3GVIA 3HEMA 1SC9A 3B6AA 2C5SA 1RLOA 2HK7A 3N2YA 1MOZA 3O26A 4BLTA 3D6HA 1ETXA 3DKYA 4H15A 4OLHA 2P9EA 4KXMA 2BFCB 5ICFA 5A6SA 2CKMA 2F9MA 1FFAA 2IUEA 3BFPA 3GFGA 3DVRX 2G88A 4EABA 1MO2A 1QG0A 5CP8A 1HW2A 1K6XA 1XQVA 2B0CA 3F6BX 4MRMA 4EWLA 3MGBA 1I6WA 3KLNA 1ZIPA 4ZZ0A 2Q62A 3QKIA 1TM3E 5GONB 4F86A 2V6FA 2BFBA 3K7EA 3GNQA 1TTQB 4QGSA 3P9PA 1T8TA 4Y2YA 1S6LA 3WKEA 4D7NA 1PFVA 1IBCA 2VVTA 4HRYA 5LIPA 4X00A 2ZROA 3BXOA 4S0XA 1MPXA 1LFPA 1Z1DA 2WAAA 3T1YB 4CEHA 1E1NA 5I8PA 4YHBA 5IBPA 3OS2A 2LXNA 4AWXB 2XUDA 4TKLA 1IZ8A 5AO9A 3O1IC 4PTYA 1T1JA 2B8NA 3RLFA 4KQ2A 3CT4A 2HNHA 1UOQA 1T6NA 4Y98A 2UVDA 4H35A 1G3WA 3ECCA 1BGWA 4CCOA 1UM8A 4MV4A 3NHJA 4B7CA 5K09A 1KEKA 1OREA 1ZJ5A 3ICEA 5JD5A 3D2AA 4R83A 1XVUA 2J0EA 3NXKA 5K3AA 2CNKA 4OIOF 3C7TA 4EB3A 1QFXA 5C8VA 1DUXC 1CKEA 1XRSB 3THWB 4JI4B 3G6KA 3ZD6A 4WXCA 3KELA 3BD9A 4G56A 4A2CA 4TPKA 3I5XA 1OZHA 1E2BA 2FCRA 3WY9A 2B78A 3ASUA 4BNDB 2ETVA 3E9MA 2OMEA 3P2YA 1KYVA 1POXA 5T6MA 3FMFA 1XRJA 3H84A 3N7UA 4B3RB 3PGMA 2ZJPF 1OLUB 3FMPB 4UQPA 3BB1A 5TQ2B 3FI9A 3PPYA 4J0HA 1MEOA 1FLAA 4TMXA 1N0WA 1SCAA 4PQYA 4Z6KA 4PC3A 3X1DA 1WS6A 1NGSA 3MCAA 3OO1A 4YUAA 1HV8A 4OMUA 2DT5A 1KORA 5KZMB 1NP3A 1BI1A 2HNAA 3DXXA 3EXG2 4M6WA 4YVFA 3WJ2A 3NOQA 2C9MA 2PKCA 4J75A 1W1IA 3K72B 3UW1A 4Y6LA 3KSZO 3W4IA 4MX8A 1XCBA 1T9GR 3E03A 3IQXA 3PDIB 2WP8J 3VR6H 2OHIA 5LQSA 4RTPA 3IH5A 2FEKA 1TUIA 1GIAA 4PQFA 4HRAA 3U4AA 3ZDXB 1QHYA 1ZGZA 3F22A 3O4GA 2XAFA 4ZQBA 1SULA 2WBMA 2VPZA 2PXCA 4V0RA 5TRTA 4BO5A 1ZEMA 1JJ6C 2BE5F 2C1ZA 2PRZA 5GJVC 1HF3A 5HIMA 3DPIA 4YJHA 2NVUA 4QWWA 5J3JA 2O6LA 1SOMA 3GIWA 2WYIA 4NV1A 4X41A 4YYEA 3A1VA 2FDRA 2JZYA 1NM5C 4J8PA 5T67A 3QU6A 1AKHB 1P6UA 3MTBA 2OBMA 1RKQA 3IKVA 2ECPA 821PA 4BEHB 2PEZA 1GNLA 4CG0A 6CHYA 3TDUC 4PBTA 2GSWA 5KSZA 5CCXA 4IDOA 2WVGA 1Z5NA 3PQEA 4OIFA 3B8EA 2WV9A 4TKZA 4JUIA 2ZKLA 2XF7A 3K2AA 5DHTA 3N97A 5FFXA 1XRNA 2AK3A 3O94A 3LPAA 4N4NB 3MTQA 2DLCX 1PLLA 2VJOA 5KSYA 1LV8A 1Y8RB 2ENWA 4XTRA 3S2SA 1MC1A 2HLNA 3LX4A 3OE5A 1NVVR 3D7SA 3O8LA 3NT4A 5LQNA 3R5XA 2V1UA 4UBOA 3TGWA 3Q9LA 1EFRD 2J87A 3LK7A 2X6OA 5ED0A 1NQWA 1YU6A 1JV2B 3BZUA 5FD5A 4AZ0B 5BPHA 3D3WA 4WSOA 2WF8A 4DZRA 4CTNA 4WIAA 3HLTA 4ERXA 3FH0A 3MK31 1AD2A 2X4HA 2IYUA 3DV0A 5AKYA 5B30A 2Y48A 5EMLA 4WMLA 1XPXA 1GKIA 5CNJA 1B9MA 1P7YA 3AF5A 2EV9A 1H23A 3DZ8A 5EWLB 4BCDA 1GFSA 2VYVA 2B5VA 4M8NE 4EFNA 4YR9A 1RPAA 2JLZA 5AUOB 1QIKA 4OQQA 5B1BH 3JRCA 3C6XA 3OHMA 4ZT2A 4C43A 3RIMA 2QZ8A 5FLXZ 2STWA 3Q7TA 4DDMA 2Y4OA 3BZBA 3OOSA 1QZZA 4KAXA 3WGGA 4KQMA 4ARUA 4ASNA 5DZSA 4HDSA 1EH8A 1H9BA 1UK6A 3D1LA 3R4CA 5JYBA 3AG1H 3GP8A 5BOVA 1N78A 3DVAB 3STTA 2ZYWX 3PLAE 1KYXA 2VPYA 4NR0A 1UOOA 3TQIA 1SCBA 1P7JA 1EFCA 2FN3A 1HW5A 2QVZX 3B2EA 521PA 1SC4A 2YZKA 2BHYA 3H11B 4D97A 1M54A 5FV4A 1T1SA 4BQNA 4RS4A 3LA6A 3UAWA 5A5EA 1G5FA 3LL7A 3HO1A 5B4TA 5AW5A 4BAGA 3L7NA 1MIOA 1U6KA 3AXSA 4UNRA 4KR7A 4HDAA 3W77A 1AU9A 5JQGB 2NTVA 1GPNA 4GMXA 3FXMA 2DOFA 1NYQA 1PJ4A 2VZ0A 3KWMA 4XGRA 4NC6A 4WBNB 3QP9A 2YV3A 1AZLA 4NHJA 5KAFC 2HMUA 1E2JA 1ZJ4A 4BU0A 3E2MA 4L3OA 5J5AA 1Q2XA 2EH3A 4KYUA 4ZKEA 2PN6A 1L5KA 2IGKA 5F6FA 4M1OA 2O2YA 4BO9A 1AN9A 1U2TA 1KKMA 2Q46A 3NUQA 2OCYC 5EWMA 4M9RA 2BGCA 4YA6A 2CEAA 3WWDA 2IIVA 3S1MJ 3BSWA 5LZ4A 2F55A 4GXTA 1U3DA 1C0LA 2MYUA 3Q11A 4US0R 1WJGA 3FGZA 1DG9A 1SN7A 1YL6A 3T7IA 1QBKC 4QOSA 1JEOA 4J0EA 3DLCA 2NU9B 3TZQA 1R4MA 5JV5A 4B3MB 2A9FA 1GVJA 4FE7A 4G65A 2QIOA 2RB4A 3SZRA 2UXXA 3VNBA 1THTA 3UJ3X 4FTHA 3PD0A 4BBSJ 3GRPA 4TWAA 5CB0A 2X48A 1TZMA 5EEAA 1LBSA 1SH7A 4NHOA 1NYLA 2GM5A 4UULA 1U3TA 3CLKA 2C3PA 2V26A 2Z95A 2VYQA 3GDGA 4MV3A 4R5MA 4RVDA 2IHBA 1PJ3A 1EX7A 4X24A 5DX1A 3ZTTA 1S4QA 5EXPA 3V4PB 2WZDA 3HUGA 1J59A 1CHNA 2ES4A 3BM5A 4X44A 3ZZ0A 4F2GA 1UKAA 2E1PA 3ZQLA 2RI6A 3BICA 4MDYA 4O4LA 4RHUA 4BVHA 4D8WA 2JA2A 4EJUA 1DJMA 2DFVA 2SHKA 1SXGA 1HT0A 3LT5A 3N0VA 4PINA 4S1TA 2LVSA 4MYRA 3MKYB 2VPWA 2GTHA 2GN6A 1EVIA 1AXEA 1H69A 3I1IA 4KO1S 4O1HA 3V00A 4Q4JB 1ZQ1A 2HRCA 2PUHA 1MENA 4FWIB 4EW2A 5FI5A 4N7RA 1NTRA 1D1PA 2OXRA 2X5XA 2VK8A 4CT4B 2OECA 3OCCA 4J16C 1U31A 2RI1A 1U5AA 1B8NA 1HDYA 1WW8A 3KXDA 1GA6A 2RDMA 3O9MA 3KB8A 4YGYA 1NG7A 1CB7A 2VDQB 3A2MA 5AI8A 1JXQA 3KZVA 4H0NA 4RQAA 5GPBA 3OQIA 2C7RA 3QWLA 1WXXA 3GEEA 4LV5B 3F7TA 2VT2A 4IIBA 3BDVA 4I3HA 4UZFA 5GTHC 2HMWA 1I4LD 3DZDA 3Q6MA 3GUUA 3H36A 3K0CC 3G23A 4MR9B 4P83A 5REQB 1O0SA 2PMFA 3UPTA 3RBAA 1QE0A 1PJCA 2SBTA 2ZB7A 3D0KA 2L9VA 1PGOA 1TADA 3VI4B 4EO9A 4PQRA 4HLCA 1VKHA 1PYDA 2JAPA 1X87A 2RKOA 5CFRA 4L5YA 5K1ZA 3ZQIA 4NXNB 2FP4A 1POWA 2Z8ZA 5EN4A 3E9DA 4L3WA 4Y2PA 1GU0A 4ZODA 5L4LA 2HYIC 4XX0B 1EX6A 3TTTA 1KAEA 1FRFS 5BUSA 2ZSJA 3FWNA 1L7EA 4FT2A 1QONA 5CNIA 2H1WA 1PUEE 3J7ZI 5LB4A 4KYVA 2QW0X 4TKVA 2W00A 4BZWA 1SVIA 2FMYA 3RGWS 2VDMB 3L2OB 4AYBN 3IB6A 3WKAA 5GZ3A 1CUSA 2J32A 4JXXA 1Z6XA 2JVJA 3BRQA 3W2HA 4B6EA 3GX4X 1ML3A 2HO4A 1G3UA 1M2NA 3OLQA 4RTRA 3T7KA 4RYLA 1H2AS 2VS1A 1CE8A 2Z2KA 4RGVA 1U2ZA 2VKTA 3HOUJ 2Y4NA 2ZT8A 4H7FA 4Y2UA 4YJFB 4AJHA 1A1VA 2OCCH 4EJVA 3BMQB 3PDHA 3D64A 5I7UA 3HADA 2OLKA 4JI1B 1WDKA 4OHXA 3VR3D 3PDWA 5ALNA 4LXTA 2NTEA 5FUVA 2WEKA 1BDBA 1Z17A 1J07A 2V6CA 2XUOA 1RQ2A 5CJ9A 1X80A 3GFSA 1IHPA 4WEOA 5FB3A 3TFWA 4ADSG 1DX9A 3OZAA 4MS4B 2P9CA 4HL6A 4QL3A 4QX6A 4I5FA 3SS7X 1TWAJ 4HAZA 4X85A 3L00A 1C4OA 4RA9B 1S2DA 5GZ6A 4E6PA 3ZE8A 3GJ5A 4KN4X 1BE6A 2WV7A 2Q5QA 3FVVA 4GIBA 4Y6GB 3KKZA 4I1PA 2HU8A 3GMSA 4G8CA 2O5CA 1URPA 1R0SA 1VHLA 3BWDD 3S93A 4GPEA 4S12A 2VDJA 4UB6C 1PUFB 2AS0A 2DFLA 2ZFUA 4K9MA 1BX1A 1C9JA 1U02A 3D7RA 4FDVA 4ND5A 1I3LA 3F3SA 3VSAA 1O58A 3DQVC 1T4CB 4JNCA 2G5GX 5GVRA 4N54A 1YDGA 2R7RA 2ORWA 4JJFA 5A5VA 4GICA 1M8FA 1GLVA 2VP5A 4YUVA 1P4SA 3FPHA 3C3KA 5HZMA 5L53A 3GJRA 4I2VA 5FFNA 3DKVA 3KAPA 3BE5A 5AK6A 1IM5A 2EG9A 4O2BB 1ZOIA 3CRRA 4PCAA 2X76A 1Y42X 4BNGA 3MJEA 5IXSA 1E60A 3QMWA 3BPVA 5EXTA 1MMDA 1Z3CA 1EK1A 1R0RE 2CK3A 1SUCA 2G80A 3DTVB 3L7CA 3MJSA 4TMFA 3QHQA 3R1IA 3TAXA 5DKFA 1EFAA 2F9LA 5BXQC 2R62A 3D4NA 3K1AA 4Z3OA 3JD2A 4K9OA 3QJGA 3V7UA 1C4WA 4DGQA 2XUKA 2WIDA 2PFBA 2OBLA 2GD2A 3U61B 2H4YA 2OQIA 3R0AA 1OCCH 3GTPJ 3LQ4A 4IUDS 1JGSA 2Q2WA 3ANNA 1FFBA 4IHKA 2P9FA 4Y2HA 1GQYA 1USSA 3ZZTA 4J94A 2A9OA 2I10A 4HRIA 2HNKA 1NMXA 1OU4A 1UUFA 3LT4A 3Q3CA 5HFJA 3L1IA 3RT7A 2ZJ0A 4KV9A 3BJ6A 1A2OA 1T8PA 3JZMA 3PQDA 2QX6A 4G0NA 4F12A 1CZNA 2RNJA 4LZOA 4S1OA 1CR6A 1G3RA 1B73A 1C14A 1ECFA 1FYXA 1OMOA 1SCKA 3HYNA 4HWSA 5E6UB 5F7ZA 2ZQYA 4HV6A 1WXWA 2H1LA 1FLVA 2Y0DA 4UHFA 4XVHA 5ICGA 4EI7A 4WLNA 4D41A 2VTBA 3NTRA 4CM8A 2Q6TA 2KWIA 4A93J 1VCOA 3KD2A 4G41A 4OGLA 4HTFB 1NBAA 4GWKA 3WGMA 4TSFA 2VOOA 2VKQA 3EGDA 4YRLA 5T6BA 1OH6A 3GZJA 5DGCA 3WNBA 4DLTA 1RAFA 1FYLA 4IOMA 1XDWA 3IE2A 2X1HA 4Y8VA 1QRRA 3RFUA 2EV0A 1U7HA 2BVMA 3AR8A 4K9RA 2D6FA 4BU1A 3PTZA 1XEWX 1RS0A 3E81A 5AIQA 4O4IB 4UXHA 5JZSA 5KX5F 3EK2A 1H93A 1MBGA 2APJA 3PXBA 1PVDA 5TJHA 1VJ0A 5G0WA 2VDPB 3BQZA 1XQ6A 1X1BA 1ZYRF 4JR0A 2H1IA 5AT1A 3WRVA 4HN9A 1RPZA 1YG2A 1FDIA 3BIXA 4R1OA 1EP9A 3T0GA 2Z1NA 1OLSA 3PWZA 4Q4AB 1I7QB 2OZEA 4YAJA 2ACKA 4MS3A 5IJXA 1MKMA 3N7AA 1Z8NA 2DWUA 3K70D 5LD2C 4AM3A 1Y89A 5FKOA 3EAFA 4URWR 5J58A 1ZI9A 3ETHA 4F7WA 4DUYB 1RWPA 2DOAA 4JROA 5TLSA 4ZU6X 1XUOA 2V9CA 3R44A 4Q82A 5JAZA 1O95A 4IQGA 4U2BA 4JZYA 1I6HJ 1KEEA 3K9HA 4KLNA 1GVNB 4M0DA 3MG9A 2ZZKA 2BI4A 1XZLA 3P5BA 1O3TA 5EKSA 4CKBB 3BEOA 3IC5A 3E15A 4OYRA 2RKWA 3BWCA 4K2EA 1N75A 4K26A 4FB5A 4E7IA 2X6QA 1P1IA 1FNMA 1FP4A 2G77B 2GKGA 4Q7EA 4Z54A 3H5RA 5JJKA 3NLLA 1E20A 4JJ6A 1DKMA 2BSXA 4N6NA 2YL2A 1YB1A 3V1MA 1B4AA 1KK2A 3U2QA 4GFBA 1NMYA 3KSRA 2RBKA 2C04A 3L43A 3LUAA 1XXHA 4F6RB 4GOND 1E3WB 3U4IA 1DV2A 5K05A 4D3XA 1J5EB 1YJ5A 4EO7A 4GAEA 1KMCA 3V8KA 4XX1A 1L4EA 1QTIA 4HQOA 4QYIB 1QIIA 3JQ6A 4MW0A 1U7PA 2VJMB 1MO5A 4LC1A 3LYAA 4CN9A 2PFGA 2XDWA 2FBKA 1J70A 1T3ZA 2A57A 2R2GA 2HU9A 1LWNA 1NONA 3H0CA 2RG7A 1BZYA 3U13A 5C7OO 4BMVA 3VAYA 4YECA 1DPFA 2WD7B 3ZLTA 5G1OA 3L46A 4Q47A 3CJRB 3WWOA 1D5WA 1NVMB 5A3QA 5K0LA 1N2JA 5I7VA 3KFWX 2G82A 5CHYA 1D2RA 4G7HF 1UPUA 3CGWA 3K2ZA 3ZQCA 2XQJA 2QP9X 2QVOA 2GAOA 1UCRA 2NPIA 1NW6A 2WUEA 2FWPA 3LF2A 3JAMA 4JR1A 3EWSA 3E53A 4OM8A 3T4PA 2CZQA 5NULA 3W6UA 2REOA 2JHAA 1W2WB 3ZHVA 2VJ5A 2XNDA 4LQLA 2NU6B 4UU0A 1BA2A 1W93A 3H3UA 5HHTA 1N9KA 1PGNA 4R2IA 2Q4TA 3ECHA 4J29A 5REQA 4IDEA 5IABA 4ND6A 2JIPA 5BR4A 2WJIA 4ESEA 4HAYA 5AVVA 2QYSA 4O4IF 2O5VA 4TLDA 3WHKA 2K27A 3DDHA 1USVA 1BHSA 2DQRA 3IJPA 3PR1A 5CYGA 3MN1A 3PGJA 2FZLA 4CT0A 4OP1A 1LNSA 3RS5A 4QJBA 1FOKA 1YITI 5IP6A 2AW5A 1T0FA 3FPLA 4BVEA 4MWOA 4RV4A 1XYVA 1KIMA 2CMFA 4MUHA 4P8RA 4PG8A 1ODJA 3F2VA 4IHYA 4LYEA 2BKAA 1Z4IA 2YFQA 2BVLA 4K9DA 2L01A 1BR2A 1VGRA 1FYMA 5K51A 3R77A 2BY3A 4LG3A 4B43A 1TPYA 3IAHA 4G0PA 4PYOA 4QLOA 4W7IA 2QWWA 1CNFA 3FI0A 1U0GA 4N4OB 2Z8YM 4W9MC 3GEBA 4YPFA 3TDZC 3GJ3A 4A8TA 3GL9A 1DQSA 2PZEA 4GFDA 2EFWA 2VHXA 2FZ5A 1R6UA 3C39A 1TQMA 2Z58A 4B8ZA 2Z99A 1W7AA 3O82A 2AUTA 3LDUA 3Q3GE 4JBNA 2HJWA 4OI0A 2VNAA 3THWA 2UAGA 3DTIA 3M6MD 3DEIA 5JCOC 4KPYA 1XD2A 4MS1A 1HXDA 4BQIA 1RRCA 5JAIA 2SKEA 2ZFWA 1TLHB 4IHXA 3HL4A 3U3DA 2C03A 4ZO9A 3RVRA 4DEXA 1KXJA 2D4AA 5JT1A 3IBSA 1ZCJA 2RH8A 4XRRA 5JWRA 2ZNYA 3BG9A 1VJCA 3PFYA 2XT9A 1EFRA 3LSRA 1UKCA 2EK5A 3L0OA 1CX9B 4UHEA 4HPJB 5AM3A 2FOWA 4IO0A 1QX3A 1D7AA 2ZRBA 1GGFA 3TW6A 1W5BA 2WJPA 3QVGB 4B3IA 4B2PA 2VE9A 3HDHA 4H6PA 4KC0A 2B63J 2EERA 3G13A 4LJAA 2IGOA 3M7GA 5C3EJ 1JE1A 1MH4A 3QLUC 4K2AA 1TM7E 1THZA 5DEQA 1PSDA 3JWHA 3N0RA 4JVMA 4AECA 3HSKA 4DBLE 1US8B 5ERGB 1EVEA 3IUBA 3MMZA 1SUWA 3AUTA 4JL5A 1GQQA 3FVRA 5MF6A 3J80K 2DPGA 5J2TB 1E7WA 4FVTA 2HI3A 4KIFA 4AS3A 4D82A 2QMZA 1L7OA 2WYWA 1AQIA 1RBMA 1UP7A 4XJVA 3FCSB 4CKEB 1B00A 5FO1A 4NYIR 5DNAA 4D4IA 1BHJA 1JJVA 3MCTA 1BWRA 4LZPA 1X8JA 4PLCA 5A02A 2EBUA 2PGOA 4R3UC 2Z3YA 1NZDA 3VZSA 3ZGZA 3W6KB 1P8JA 1W88B 5BVGB 1H4QA 1UBNA 1Z22A 4O4HF 2WVHA 2BY0A 3HRSA 2NZ2A 2O5EA 2XDAA 3JV7A 2L17A 5MHTA 1OBOA 4RM2A 2BFWA 2CL6X