3WGGA

Crystal structure of rsp in complex with alpha-nad+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Binding mode of the oxidized alpha-anomer of NAD(+) to RSP, a Rex-family repressor
pubmed doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 71
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wggA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wggA02
3H9JA 1IPEA 1L7DA 4C7JA 4D0RA 1ISGA 2CVQA 2Z5LA 2Y67A 3ZHBA 1I1GA 2VOEA 3FTNA 5ADHA 4AIJA 2POQX 3OICA 4CLHA 4BNIA 3ICPA 3KVOA 3DZGA 1EV7A 5IN5A 1QQIA 2PEXA 4JP2A 4BO4A 2VNSA 3DL2A 2LKPA 2J3KA 3P5SA 3RAJA 4GI2A 2B36A 5H20A 1OPCA 4MVJF 3H9EO 2CZCA 2AA3A 4KIGA 2YHUA 1K2WA 1SAYA 3DC2A 4DQVA 3QU6A 1REPC 4IPAA 4MGRA 1J6UA 1X13A 2OGUA 3MQ0A 4IGEA 4TWRA 3IWFA 4ZHSA 1NVTA 1ZARA 2QIOA 1JHFA 4XIYA 2IXAA 2NTNA 5DBIA 4RGUA 3HOSA 1WP4A 2X8LA 3WXBA 2F5FA 3I6QA 4NBVA 3GVXA 3RIHA 5LHIA 3PDJA 1O94A 4J6FA 4QX6A 4U0VA 2DFVA 3NEUA 3TQNA 1LQ1A 3H9UA 4BQAA 3P9CA 1E5LA 4L73A 3OH8A 5JC8A 5JAQA 4M74A 3UGKA 3FMQA 3QQPA 3R6SA 3F5QA 2X86A 4K2EA 3D0OA 3Q9NA 1TEHA 5ICGA 2I6TA 4HFNA 5ES3A 3BJOA 2AQIA 3N58A 1R36A 1P77A 4NU5A 3DEYX 4TMFA 5BNTA 4OH1A 1KY4A 1IXRC 3RBZA 3QAHA 4ZICA 1VPDA 2PGJA 3WNQA 5JO0A 4HADA 2YZ7A 1W7PB 3CTAA 1BM9A 2DLDA 4BNLA 1RYDA 1X0VA 4RGXA 2PZKA 3U2RA 1WW8A 3CZMA 3DBHB 1D8AA 4LK0F 1XQ1A 1YS7A 1DO8A 1XWFA 4ZYHA 4R69A 2H6CA 2XOXA 4Y8VA 4CM4B 4ID9A 3BHMA 3L4BA 4ZZLA 1ZSYA 1UZNA 3IMFA 4HX8A 3KZYA 2RQPA 5JI6A 1LLDA 5A2QK 3AU8A 1JAYA 4B4UA 2B35A 4RB1A 1Z6ZA 2I5PO 1M76A 3B6ZA 4H16A 4WF2A 2ZTLA 2QENA 5ITWA 4BNXA 4M6YA 1DPUA 1IPFA 1ON2A 1RI7A 2CDCA 4NBWA 5ICSA 1O3RA 2VRCD 4RB3C 3ZN1A 3VPFA 3I53A 1QR6A 4C4OA 3I58A 1S8NA 2R7DA 1Q2XA 2YJZA 2X22A 1IHYA 4OKIA 4DLAA 3GT0A 1GCOA 3K96A 5EJ2A 3PGXA 3L0DA 1ONVA 3BOQA 3AU9A 1T4DA 2C59A 2FN7A 4JBIA 5A04A 2H9IA 1OZAA 4MP6A 1W7PA 4RV9A 3RPUA 2Y0DA 3FWEA 2HK9A 4MOWA 2ZYAA 4FW8A 5TNXA 4I8XA 5BQTA 3HTSB 3LLSA 2CVOA 5D6FA 4KUMA 5L3CA 1P1RA 1A9YA 2XAGA 4W7IA 4DUPA 4G2NA 2PR2A 1H9GA 1CETA 2ZKLA 5L7YA 4RVSA 1D3AA 3TZHA 2YX7A 2ZMEA 5COQA 3HJAA 4UVBA 5K0ZA 4NR0A 1X0XA 2W2KB 1SNYA 4JJGA 3ZNNA 5HTOA 1CF2O 1V3TA 4HFRA 1QV6A 2O7QA 3VZSA 2IDZA 4EJ6A 3AK4A 4WLVA 1IN7A 1H9BA 2ZJ0A 1ZBQA 4CQMB 3DPLC 1FP2A 4Q3DA 3U09A 1SD4A 3QWIA 1EH7A 4II3A 5DV5A 1U5TB 1ZNQO 3GNTA 1HLPA 2Y68A 1C14A 3L4BC 4KZPA 1IN8A 3IKVA 3D1LA 5TF4A 3KETA 1XGOA 3FXQA 3B1JA 1U4SA 3S2FA 4BNNA 4MJLA 3R6DA 4DRYA 2Z3YA 2X5KO 1VJTA 2H5LA 2X4GA 5KTKA 1M75A 1MC5A 1VI2A 2AXLA 2D1VA 1DIRA 2NVWA 3LC2O 3MWEB 1J7KA 3V8LA 2RAFA 2C5EA 3QE3A 4WNIA 4HKTA 1UCRA 2GN9A 9LDTA 4FFRA 2CSUA 5KJEA 1VJ0A 3K2ZA 3GK3A 1VSVA 1ZUD1 3EY4A 3A1NA 4RPJA 3M1LA 2QRKA 4XGNA 3ZGYA 3Q5FA 3T8RA 1TB4A 1U8RA 1CF7B 1HYGA 3Q3CA 3RU9A 4LG0A 2AXQA 3KSDO 1E7MA 2VHVA 4LN1A 4PG7A 4PLCA 4U5QA 3L9FA 5IFLA 2RC4A 4BO2A 1A4UA 1O95A 3RD5A 3WGGA 1QYCA 1MDMB 3H8VA 1HSJA 5TJHA 3ABIA 3R3SA 3WS7A 5K1YA 4GKBA 4S05A 3PDUA 2F5CA 4KA4A 4LMPA 2PMUA 1U5TA 3QVWA 1GUYA 1NVMB 2VZ8A 2Z9OA 3H5AA 4KN4X 1GHCA 4PGFA 2E82A 2BELA 1CGPA 2HEOA 5IZ4A 4CLDA 3BMNB 3PHLA 3PZBA 3RBVA 3HHHA 4ILKA 4OQZA 2VODA 2QZ8A 4XR4A 1PGQA 4YG2F 1F06A 2FPGA 2HMUA 5FEUA 3ON5A 4W6ZA 4Q3BA 3A9WA 1SMKA 4MVJP 4YCAA 3K8ZA 5U4QA 4BKQA 1WNTA 4WE3A 4D41A 1DC4A 4ZA2A 3OM9A 5IZCA 4E21A 5D8KB 2D5AA 4HF2A 5GMOA 3WDSA 3ZI0A 4MIYA 3LAJA 5COBA 5AXAA 3ENNA 3UHAA 4YPOA 5DNAA 2PNFA 2Z33A 3NV9A 2B0JA 3DF8A 4FFOA 5B4VA 3PYXA 1DB3A 3N97A 2A9FA 3OIGA 4IDCA 4BV8A 2Y99A 4R1HA 5HS9A 1DBVO 1UP7A 3T7CA 3ZWNA 3I4PA 5A2QZ 1DP7P 2ZIZA 4BGUA 3MTJA 2QYOA 2B37A 3JCZA 4Z2YA 2G7HA 1I3LA 3E5RA 1E7QA 2HK7A 3PI7A 5ED4A 1B16A 3VPGA 1JWAB 1UJMA 3FWNA 5BSFA 4Z0HO 3ZU2A 3F3XA 4EI2A 2XASA 2YX4A 3BP8A 4N9IA 3DPTA 2F5DA 2GZ1A 2X5OA 3CXRA 5EMHA 2FNAA 1FXSA 2X23A 1PGPA 4IJVA 4WWCA 1N5DA 1KBZA 3H4VA 3TOBA 1B1BA 1JVBA 1R4MB 2VYNA 1PQPA 2IXBA 5E17F 1F4KA 2W8ZA 4IHSA 2GNAA 4L76A 3DZKA 4F45A 1ZJZA 3L4SO 4KFCA 4HQEA 1E5QA 2ZB3A 2QZ9A 4AFNA 2HWVA 4D0SA 4PG4A 3P2YA 1H0KA 4XDZA 1GYPA 3DQVC 3K73O 2W90A 2W57A 3G73A 3BJ6A 2NU9A 3TZCA 4CM9D 2FA5A 2C2XA 3TSCA 2XAFA 3UOGA 4FX4A 1A71A 4XJSA 1YJ8A 3DP7A 3RSHA 1NXQA 1TVEA 1V0JA 4II2A 4FC7A 3TNLA 4E5PA 2A35A 2GZ2A 3X2EA 1R1VA 1ZEJA 4E2ZA 3J80K 4U7DA 2YUTA 4UHTA 4KWIA 3WG9A 1MG5A 1FNNA 1ZRFA 2VC0A 4Z3KA 1ZYRF 5BQFA 5FF9A 1HDYA 1GPDG 1C0IA 3H7AA 4BNKA 2Z99A 2VONA 1P4AA 3G1UA 1GAEO 3A4VA 1FT9A 2W24A 1LDNA 4OIQF 3L6DA 1K6JA 4PLTA 4AJ4A 4AJIA 1T0FA 3U9GA 3IRRA 1P1IA 3WGOA 3WX0A 4L9TA 3AM5A 4BVAA 4FOSA 3UICA 3DTTA 1MG0A 3U9LA 2FRDA 2Y1CA 5IN4A 1A7AA 2WEKA 5T57A 1M66A 2H94A 3VH3A 4P22A 4PLWA 4HXYA 4BNHA 4IRGA 5L95A 1TT7A 1RWBA 2H27A 2A3SA 3NTRA 1KQ0A 1LEAA 2XPCA 2HRZA 1TLHB 2EJVA 3FNFA 3Q1LA 4I5DA 1TLTA 4CM1A 3ZN0A 3GVCA 3OOPA 1VE9A 2OBNA 2Q1WA 3FNGA 3FRJA 5CPFA 2IEBA 3VOEA 3LSYA 3DZHA 1O3QA 2I76A 2CVZA 3HDQA 3LT2A 4QQRA 4FFLA 1W8DA 1W4MA 1I0ZA 1FBQA 2NNYA 1L7EA 1MLDA 2F1KA 1PJ2A 2YV1A 4RPKA 3TWOA 4A7PA 4LCEA 5MDHA 2GN4A 5AONA 3KB6A 3E5UA 1NASA 3ZWOA 3RFVA 5CVVA 4MKXA 1WI9A 1MP0A 4MTDA 4M9ZA 1FZPB 3SC6A 4DMMA 4L0ZB 1RPNA 1N1GA 2PGDA 4PVDA 1F17A 4D45A 4JROA 2HJRA 4E32A 1ZK1A 1T38A 2VYVD 4J1TA 1MJ9A 4EGYA 1EVYA 5TT1A 1WDLA 1U8XX 3TJRA 4A26A 5AIQA 5BOXA 1DIBA 4ALNA 5FLXK 4JIGA 4HDVA 2X0JA 4HV6A 1YOVB 1OR7A 3PHJA 1YIOA 2DKNA 3V1UA 4IIVA 4KICA 3MJSA 3E9NA 4LW8A 5G4KB 5TQVA 3PQDA 1U28A 2HZTA 2CDBA 1C3VA 1I5RA 2CUKA 3DFUA 1LC0A 3GUDA 4IJWA 2LSOA 3MEQA 3WLEA 2C29D 1X3UA 1NAHA 2B5WA 3ENKA 2GLXA 3WTVC 2RIRA 4GH5A 4S3MA 5A5FA 3GEMA 1ADFA 1KERA 3HDYA 2PK3A 5DF1A 5JDCA 4PFJA 2P5UA 2HDCA 2M1BA 1U3VA 4PRKA 4R1UA 4B3HA 5TC4A 1SOWA 3ZW8A 3GGGA 4CR6A 4EGFA 3KLPX 3KP4A 3F6OA 1YBMA 2JZYA 1SFUA 3WGYA 4W9NA 3ZU3A 3PTZA 1XDSA 3HRTA 4BNFA 2C7GA 1C0LA 2XUBA 2PTGA 3QU3A 1BHSA 1RM4A 2P4QA 3KO8A 2NTVA 3AUSA 3JQAA 1KQ8A 4IZHA 4OIPF 3OETA 3V2UA 3R3JA 3P9KA 3WYEA 4ZD6A 5A06A 4FR5A 4ZQBA 4K6FA 2MC3A 1YOVA 3FM3A 1N7GA 2JCVA 1UXIA 5FYDA 1W7PD 4UNOA 4FBGA 4I9UA 2GASA 4RF2A 3ULQB 5G4KA 4Q39A 3M1AA 1B4AA 3QVSA 4TVBA 2OOSA 4F7ZA 3F21A 3W4JA 5B1YA 1PJ4A 3UCEA 3TO6A 3QSGA 4OU0A 1KU2A 3FF5A 3O6BB 1BXGA 2UAGA 1P92A 1FOKA 4LGWA 1VL0A 1YGYA 3AFNA 3ERED 3I3OA 4G94A 3I4FA 2OXIA 3ZHZA 3LQFA 1YL6A 4TRNA 1UZMA 1EK6A 1SFEA 2A68F 1DOHA 1AUPA 3ZZNA 5J6XA 1PQWA 3CSDA 1B14A 3HNPA 3OSUA 3Q6IA 4HWKA 5F21A 1IUKA 1NTOA 2QRLA 2E37A 3L77A 3I5UA 3UKOA 4XLPF 3IL2A 1P45A 4YAIA 2OL4A 4RB2C 2IW5A 3ROPA 1LA2A 2GA2A 1NHWA 3JSPA 4ND2A 1GFSA 2GZWA 2PFGA 2I99A 3RUEA 3S8MA 5CVRA 5CVJA 3I9JA 4EEXA 5JDCC 3D0SA 1G0OA 2FSVA 5HBRA 2LF7A 3K1PA 2C20A 1QNTA 1CDOA 4Y17A 2PD6A 2V6FA 3MCZA 2FU4A 1LRKA 3EW7A 5BSGA 3LU1A 1ZH8A 4W9NC 4G9YA 2MD5A 1DXYA 1Z73A 2DBQA 4BO6A 4G7OF 1PGOA 4MDHA 3ZWCA 4AL4A 4EJUA 3UCFA 2HDHA 3AW9A 3JQ7B 4Q5SF 4GVLA 4RORA 1WAMA 4ESOA 4BO7A 1F8FA 3L09A 1GY8A 3GPDG 5H6RA 4LVCA 3V2GA 4BNGA 3KTDA 2EIHA 5IG2A 3MJTA 3ZWAA 1LDGA 1XCBA 4HBLA 1YW7A 1U7TA 2AHRA 3P7MA 3PIIA 2Y1DA 3IS3A 3WTBA 1YS4A 3GYHX 2OZUA 2MLGA 3GRPA 5JPIA 5EEGA 2VE9A 2DPUA 1JU9A 4HF1A 4QFDA 5ILGA 5AXCA 2A61A 4DIOA 4L8VA 5LGNA 4BAYA 4I09A 3FMSA 5J8FA 3VC7A 1HE3A 1JTVA 3F4LA 2O03A 5JC1A 1H0MA 2ELHA 5H83A 5A5EA 1ZFNA 3IHUA 3QPHA 1B15A 3IP1A 5JNLA 4ND5A 1DC3A 2PG4A 4DC0A 1HW1A 2OMEA 1RYEA 4KOAA 4YAGA 3I59B 4GX5A 1LJ8A 3ITKA 1V3UA 3OIDA 2BGKA 5FLXZ 4KP7A 4M55A 5KIAA 5ILSA 2ZCVA 3PJDA 3KRTA 1DHRA 2GN8A 4EYEA 3ZMDA 5HLHA 4FFNA 1U5CA 1AHIA 4KQXA 1V6AA 1KIFA 2G82A 4CV0A 1B6AA 4UREA 3D7LA 3DEUA 2L3DA 5F3RA 4YWJA 4CMJA 4YT8A 1WLYA 1I3NA 2QZZA 3JQDA 4J16A 2PBIA 2UDPA 4KUHA 1BMDA 4FIZA 3CO6C 4PLGA 4Q3NA 1EBUA 4OMZA 2X9NA 2ZJ1A 3FI9A 2OP1A 5D5VB 2PZJA 1P1FA 2BI8A 4IS3A 4QFCA 1WMAA 4A0XA 3GGPA 2CG4A 2STWA 3K1NA 2YFHA 2P5KA 1HDOA 5IDXA 4TKLA 4N5NA 1GL3A 3Q11A 4JJIA 3LDHA 3I23A 3PRJA 2IP2A 1Y8QA 2CFCA 4GLOA 1MGTA 4TSKA 1L3LA 1UHMA 1HZJA 2YU3A 2A92A 1IL0A 3GFJA 3V7RA 1DAOA 1N9GB 2VYND 1PS8A 4O5VA 3QLJA 1R0SA 2VNAA 1YBAA 1HSOA 4MPDA 2DBBA 3IKTA 3QP5A 3F22A 1R12A 1UXGA 2ZYGA 1WZIA 3GC6A 5JR3A 2EA4A 4GX1A 2BI7A 3F5SA 3COSA 1RUNA 5B4UA 2H6BA 5TJJA 3PHIA 1BIAA 3G1TA 4PLYA 3U4CA 3BPVA 4AVYA 4LRSB 4W7HA 3PZRA 4BQPA 4Y98A 1R0KA 5KJCA 2B4TO 4Y15A 3RPQA 1LRLA 3B20A 1LBEA 1LXCA 3PWZA 1AGNA 5DD8A 2UYYA 4TROA 5HS7A 2WDZA 4QO7A 3EDMA 1NQOA 1BN5A 5HVQC 5ICEA 1P0CA 5KVQA 3VVCA 1VSUA 1C1XA 2NM0A 1YWGO 2UXNA 5AYVA 1FYMA 2JAPA 4ND1A 5DZSA 1W5TA 2JD1A 1NR1A 1K7AA 1GPJA 3S2GA 4CJXA 3C1OA 4JP3A 3QRWA 4GGPA 4NPCA 3VHRA 1FDWA 3ITDA 4MVJI 5H82A 4BOYA 1E3WA 3JYPA 5JW6A 3BHJA 1O89A 5JS6A 4BO3A 4CUJA 3GWZA 2G76A 2RBEA 3A14A 2V6GA 5GZ3A 3KXDA 4M71A 1KYWA 3VZRA 1ULSA 4WCFA 4ZQGA 3HSFA 5L51A 3JW4A 5LGTA 2IVMA 2EFQA 3BTOA 3GN2A 5D4RA 1BGVA 3AOGA 3EVTA 2A6EF 4JBHA 4RZHA 3WYBA 4CM7A 3EAGA 1V9LA 1ZKMA 2DTEA 2IZ0A 2P68A 2NUAA 3D5TA 1LB2A 3KV3O 3H3ZA 1R15A 1R16A 1UP6A 3BMQB 4NU6A 4UVIA 1E7YA 4EZBA 4A12A 6PAXA 5ILOA 3I5MA 1X7DA 4XSZF 1S7AA 1IZ9A 1PJQA 1K3TA 4HF0A 4I5EA 3I52A 4BYYA 4G7HF 4BNYA 5G0VA 1R23A 2X0RA 3I9MA 3G17A 5J8CA 3I71A 3I9NA 2HQ1A 4NQZA 4HFMA 3GUYA 4NFHA 3WSWA 4OJNA 2CNBA 4CR8A 2EK5A 2IYPA 3KM0A 5COAA 5T8KA 1ONPA 2RH4A 4Q4ZF 1Z91A 3Q2KA 3GVIA 1IAWA 2NV6A 1XLTA 3V8KA 4CM5A 3BYZA 4J4BA 5IZCC 1I2CA 1PP8F 1FDUA 4LMYA 4NFSA 1NPDA 2QBYB 2BFPA 1R7JA 4TZKA 1RM3A 4W4TA 2H1SA 1OYWA 4RPLA 4DREA 1U1IA 3WNVA 2YW9A 3L2CA 1PWZA 2OO5A 2EP7A 3GMSA 1ISHA 2XHKA 2A07F 1E3EA 1I32A 3PLNA 4IPTA 4WKGA 2OD5A 2C54A 1KEPA 3ULKA 5C7IO 3ZMZA 5AVOA 4BNWA 3JQ6A 2JKVA 3P19A 2D0IA 4WXHA 3RTRA 2VUUA 1XKQA 3RWBA 3CKYA 1YG2A 4M73A 3FSRA 5TX7A 2STTA 4FSHA 3TPCA 5L3ZA 3WLFA 4GCVA 2GSDA 1IOLA 4WCFC 4XB1A 3LT0A 2Q4BA 1J0RA 3HUGA 1IULA 1W5SA 5K5OA 3RC1A 3GUCA 2ZB4A 1FY7A 3HQ4O 1T24A 1XEAA 4KWHA 3B02A 4JBAA 1GDHA 4MIEA 1EQ2A 3BTVA 5CDTA 3BROA 1XIVA 2W25A 1EE9A 2PKRA 4BNZA 3A28A 2EKLA 3VZQA 4B3IA 4R01A 1U3UA 4CDGA 1I6XA 4XA8A 4HNGA 1QYDA 2K4BA 1TA4A 3CMMA 3GFBA 1GZ4A 3GZ4A 3NTQA 4J1QA 1U2WA 4GX0A 4J9UE 2C6YA 2JD0A 1O3SA 2GRAA 2ZQYA 4YAEA 4DIFA 3UH1A 5G0WA 2OQRA 4XX0A 5JY6A 1E7RA 2GAUA 1ADCA 2EF1A 1GUZA 1XGKA 1UFMA 3JQGA 1BI2A 1GXQA 1EQUA 2IE0A 2FOIA 4IDGA 4WK6A 2EV0A 2YY7A 4KUGA 4YQYA 1PL7A 5L3FA 1KVRA 2WYWA 3JSAA 3GAFA 4AJ1A 1Z7BA 2FHSA 1BSVA 1K5HA 4XEHA 4EM0B 2KKOA 4MNUA 3O38A 3JAMK 4XSXF 1U8FO 1I3KA 1P3DA 2AS5F 3O3KA 5A1TA 4KIBA 1DPRA 2GXGA 1TI7A 1Z45A 3ECOA 4R1SA 1IW7F 3TOAA 2XF8A 2X0LA 3WTZA 1EBFA 2OFPA 1OC2A 1CQJA 1J59A 2FMYA 1T2AA 1QG6A 4KDFA 3WIDA 4NJMA 1NQAO 5CVUA 3L9WA 4ITUA 4E13A 5A02A 1NBOA 2HOEA 2OBYA 4MVJA 1LLCA 4M8SA 2VOPA 1XGMA 3MCVA 1D8JA 2DFIA 2OZ6A 1J9IA 4RJTA 3HTUA 1USSA 2L4AA 4GO1A 3KE2A 3RQSA 3E03A 4ENJA 4TRMA 5CP8A 4B7CA 1CIVA 3HSEA 4HOBA 3IJPA 1I2ZA 5I8ZA 2Q8KA 1JVSA 2X6TA 4OGWA 2PV7A 3JQ8B 4JXKA 1QRRA 2JPBA 3AWDA 2V9VA 3CUKA 3EYWA 4O0LA 1YBVA 2Q2VA 2YSRA 3G49A 1TW3A 4L0QA 1XGSA 4XBFA 1ZIDA 2EKQA 4FFMA 4OSOA 5JDIA 3GLQA 1FYKA 4UXNA 1MXFA 3BPXA 1JA9A 1N92A 1KY5A 2DQ4A 3GZNB 4ALMA 1MFZA 2R2GA 4L74A 2WWYA 1FBUA 3KYCB 4D0PA 3SX2A 3V1YA 1IE3A 2AEMA 3BTUA 1FP1D 4H15A 5CHEA 4JX8A 1YW9A 1KVUA 1WDMA 3DZBA 5L4SA 1GZ3A 3MOIA 2O61A 1CERA 2MH9A 4KMFA 3GPIA 5ENVA 5THQA 1P6RA 4MVJG 4HX4A 3SQNA 2Q1UA 5A9RA 2VHWA 1EUZA 4XGKA 4EJTA 2O7SA 4YEDA 4IJAA 2RV8A 4IQ0A 2XAAA 5A9TA 1YL7A 1HKUA 1E3JA 1E77A 4GX2A 4M9SA 3TZKA 4Q47A 3TZQA 3DV8A 2VOJA 3B1FA 4Z9XA 4HA8A 2ZMEB 4BHTA 1PR9A 2IA0A 4IRIA 2VZ0A 3QV1A 4PLFA 1ZMOA 3VVBA 2D4AA 3RKRA 3DKWA 2XROA 1WDKA 2TMDA 3M8EA 2Y1EA 3GHYA 3JQ8A 3RJ5A 1NQTA 3GVPA 3RU7A 1UDAA 1C0KA 5D6EA 1RM0A 3JQCA 4FGWA 2PLYA 1KU3A 4AIKA 1Z7EA 2X9GA 4NH4A 4QEDA 3GZNA 4B79A 4CMBA 5TLSA 4WK8F 1UZLA 1SD7A 3K2BA 3NDRA 4NMHA 1RUOA 4CODB 1IB6A 3OQ6A 2PZLA 1NFQA 3KYCA 4FC6A 4IY1A 4XQGA 1XA0A 3FPCA 4IXTA 3FBTA 1HXDA 1R5GA 2BF7A 2X0IA 4HX7A 3STHA 5IDWA 3TOXA 4QTZA 1PP7U 3ZWWA 4ND3A 3FXUA 4WCDA 1SEVA 5JDIC 3ZV5A 2VN2A 2DPGA 3WU1B 3KEQA 1PJSA 3ZWBA 1IXCA 3ASUA 3OA0A 1IHXA 1J4AA 2ESHA 2C5AA 3PP8A 1P4WA 1B3RA 2Y0CA 2BMAA 1LDDA 3RVDA 4GWGA 3QWBA 1YVEI 2KIFA 4WLOA 5FGMA 4LG0B 1G3SA 1WSUA 1KYZA 1B7GO 5CAEA 1KEVA 5HLGA 1A72A 3FWZA 1YRLA 1G3WA 1AE1A 3FCOA 1PS9A 1YE3A 3EUHA 3BMCA 3HWRA 2SCUA 3ZU5A 3R4KA 4RF4A 4DLBA 5KJFA 2QQAA 3CH6A 1SFXA 5JYDA 3DDNA 1W6UA 4XD2A 1UP4A 3KP3A 1MD0A 2VBZA 3HADA 3HB4X 4RPGA 1QYXA 2GZ3A 3MZ0A 1R5HA 1XQ6A 2P8TA 3AI1A 1S7OA 4GWKA 3WBFA 4J7UA 1E1LA 2C2YA 2QW8A 1GV0A 4CMIB 1NWHA 2RCYA 4CGZA 2CW0F 3LT4A 4XDYA 2P9EA 1LVAA 1YDWA 2FPPA 1DHTA 2JHGA 3IIEA 1GU7A 3PGJA 1I33A 1T98A 3GEZA 4DBZA 3JAMZ 2V6CA 3U49A 5T8KC 4UUNA 4HZFA 4KMSA 1A04A 4D43A 3RUDA 2Q45A 3IC5A 4I5FA 4HV5A 2ZTMA 1BXKA 5D5WB 2VZ9A 4WOJA 4E30A 3LF2A 3T5XA 3OMLA 2P2SA 3OA2A 4EBFA 5EINA 3AY7A 3JTGA 3REOA 4JQFA 1YB5A 2D3TA 4A73A 1U3WA 2FR1A 4P96A 3JQFA 1PZEA 3MJCA 5LHGA 4YACA 4GQAA 3PVZA 5FFFA 2GIVA 1ISFA 1NM5A 4FHTA 1DC5A 2NVUB 4P55A 2Y75A 1ULUA 4ZYGA 1P1KA 1WWKA 2W84A 2O3UA 3LAPA 3U4HA 4QSMA 3BAZA 1BVUA 3VH2A 5CDGA 1ZK2A 2QQ5A 4YJHA 1SD5A 1K6XA 4CMIA 4CLOA 2M8EA 3AUUA 3JYNA 2D45A 4NHEA 4IS2A 4YBZA 4AJPA 4CV3A 2D1YA 1K79A 2HCTA 4OIRF 1R6DA 5DT9A 3OQ1A 3E18A 4EJMA 1ZGAA 3JYLA 5DN9A 4L9RA 2L54A 3VTZA 1LLUA 4R41A 2XXJA 3COAC 3CINA 2OHXA 5DBGA 4P4NA 4A0SA 4B4VA 1X15A 4LD5A 4BH9A 1D1SA 1HE2A 4EUFA 3GZ5A 1QLJA 3ZQ7A 5LCXA 5JY1A 2PMHA 3KEOA 5FD6A 1ZLJA 2C7VA 5TGDA 1H9TA 1NHAA 4E2WA 3I54A 4J3FA 5HDKA 2GO1A 2JFGA 3GG2A 4YYZA 1UB9A 5DDIP 2AQ8A 2VQ3A 4QWQA 1DFIA 4UEJA 4U6QA 1HLDA 4OM8A 4DWVA 1HKSA 5CYVA 1ENPA 1WVGA 1DIHA 2NVUA 4HW0A 3NYWA 2HS5A 1SMYF 4GKVA 5I7VA 4A27A 2D8AA 5JMWA 1SAXA 2HMVA 3MWDB 3ZWMA 1I01A 1ZG5A 2GR9A 3WOHA 4YT4A 4TRJA 3JQBA 1Q7BA 4U88A 5BPDA 3QY9A 3JQFC 4Q3CA 4GMGA 4Y6SA 3VOSA 1GEEA 4FOOA 3OF2A 2J5RA 2O4CA 1QYVA 3GF4A 3WJ7A 3PQKA 4F3YA 1ZH5A 3K92A 4O5OA 1XMAA 4DQ2A 4DYDA 3I9LA 4WEQA 2ZFWA 4ALKA 1ZLKA 3F9IA 1XSEA 1NNUA 1H2BA 2EFOA 4YIFA 3E6AA 2DTRA 5DYMA 4M86A 2DUWA 3F8MA 5F1RA 4E33A 2YHIB 3JYQA 2EFWA 4BKOA 1UDBA 4I08A 5TSDA 2VT3A 3GFMA 4BO8A 4YIIA 1LDBA 2CYYA 2HYFA 1O6ZA 4KDPA 1FC3A 4LB5A 1JKJA 3WMWA 3FM5A 5BPIA 2GXBA 1I27A 1SBYA 1G0NA 3ETGA 2LF8A 2PKQP 4N54A 1I8TA 4NG5A 5I7FA 3E6DA 1A4IA 2WD7A 4I0BA 3CE6A 3WMXA 5EQFA 5K6AA 5FI5A 1ZCJA 1ENYA 1GQQA 4FN4A 1KC1A 3PQFA 2QX7A 2EGGA 4J1SA 1B8PA 2GYYA 4XQCA 3F8BA 1IRFA 3ZMTA 5DOVA 4WX9A 1S6YA 4ROSA 2K02A 1XYGA 4M72A 3ROQA 3JV7A 5DP1A 3PYMA 3GAZA 4L75A 1YS6A 3ZH2A 3GNQA 3D5QA 1RM5A 4BO1A 5AQ1A 2PGLA 2HYGD 4KIFA 4ZH4F 2ZB7A 3M9AA 1SPXA 4UUMA 4IDFA 1B59A 2NU7A 1J5YA 5F5NA 2WD8A 3HRUA 4HBGA 4DBVO 1P44A 1UHWA 1Z75A 1XDUA 2YHIA 1KVQA 3H9GA 3JQBC 2HKOA 3ZNOA 2P5VA 4O63O 2XRNA 3M7GA 1EFLA 3FTPA 4IQ8A 2FSWA 4M1QA 4GGGA 4WECA 2BYVE 1Y7TA 5JLAA 2W98A 1XB4A 3U4IA 3ABTA 3K1MA 3I6IA 1BI0A 1EVZA 1U2DA 1ZSVA 1SD6A 3ETDA 1W0CA 1ZW1A 3TDUC 2ACJA 1N7HA 2H63A 3NT5A 3R61A 4NDNE 4A10A 4AIHA 4ALIA 4U0YA 3WTTC 5ER9A 4ZVVA 1YQDA 2P7CB 3DMTA 1T4BA 4CQLA 4B7UA 2OU2A 2QQBA 1PJ3A 2FMUA 4U7WA 3KSUA 3DOCA 3BY6A 5GZ1A 3AI2A 3K5PA 4YQZA 4E3ZA 3SLGA 2MLKA 1Y9EA 5GZ6A 3H6KA 4CMAA 1DLJA 2BGLA 3DFZA 2HR3A 5FB2A 5DEQA 2LNBA 1PU2A 4D3SA 1WPQA 2JFHA 1H6AA 3GEGA 3GLXA 3LFKA 4W99A 4AJEA 1YQGA 4UVDA 3TZ6A 5K6AC 4ND4A 4RVGA 5D4SA 1E3LA 1LSUA 2X7HA 3JQAB 3KYDB 3ZCXA 1EMDA 4PZJA 1HTBA 2DK8A 1YH3A 4LLLA 3GH3A 4JGBA 3RUHA 3BZ6A 4Z9FA 4B4WA 1XMKA 4DPLA 4UEKA 1E6UA 3WGQA 2PFBA 1ZG3A 4L18B 3CZRA 3MJ4A 5EESA 1MB4A 3HRMA 2GF2A 1ZXLA 2V1UA 4FS3A 3WQSB 4AJNA 1M6HA 4B8WA 2E48A 2ZKZA 1V35A 1FJHA 1UH5A 5THKA 1BXGB 3KUXA 5CG1A 1ULYA 2PJPA 2QLZA 3HRSA 1LNWA 4JK3A 2B83A 1CRWG 1ZK3A 5F1OA 3V8BA 5DCMA 1YXMA 2EFPA 2HKXA 2QWWA 2Z5UA 3W4KA 1HDXA 2DTDA 3H92A 3HUDA 1Q1NA 3X2FA 4DXHA 2DLLA 1T2KA 4NBRA 1YO5C 3VB2A 3IAHA 1OMIA 3AI3A 2QM3A 2JCYA 3NGLA 3ML6A 5ERIA 1AOYA 3ZW9A 5HDGA 1NP3A 1H6DA 3GQVA 4CZZA 1I5ZA 3DMTC 3RUAA 4IHTA 1YQAA 1XHLA 3VDRA 3KYDA 3DBVO 4N9HA 1Y9AA 3DWFA 3KYBA 1Y0UA 3BDDA 2VWHA 3ZMSA 2J5QA 5AXBA 2GERA 3PXXA 1Y5RA 4PCVA 4PCQA 3DAPA 5HS4A 1EEHA 2RDPA 4EMSA 1ZMTA 5JO9A 5BT9A 3GVHA 3OJOA 1UAYA 4MQ9F 3W8EA 1B9NA 4PG8A 1KU7A 2BGMA 3CO7C 1JN0A 2CMDA 4F6CA 5K9ZA 1D7OA 1I36A 2DUUA 3TRIA 4Z6KA 5IXSA 4CMGA 4BXUA 4G7ZF 4ENNA 3H9QA 4GLLA 2MBFA 2EP5A 3IUSA 3QJ5A 5TRDA 1DFGA 2BKAA 2ZJ2A 1EZ4A 3LZ6A 4H3VA 3TFQA 3WR5A 4RLHA 4H0EA 5B12A 4I9NA 3E82A 1RNLA 3F3SA 5CDSA 5DBFA 3GF2A 4O6JA 1LRJA 2UVDA 2O3SA 3NT4A 2R00A 4BNJA 1QZYA 1DC6A 2DI3A 1D4FA 5E1XA 4Y9DA 5L3EA 3GR6A 1TNTA 3ZWVA 2LDBA 3ELKA 3JD4A 2VE8A 5ICCA 2NU6A 4H7PA 4IXWA 3KLMX 3SVTA 3GDFA 4XB2A 2MH2A 2WV0A 2HAEA 1MC4A 1AWCA 5ENDA 5A3VA 1DPGA 4G6DA 5DCYA 2UXXA 3R0JA 4MO2A 4Z0PA 2RHRA 4J2OA 4IDBA 4JLWA 3NRVA 3KFWX 1PL8A 1Y8RA 2JPCA 1R66A 2VN8A 4CICA 3JYOA 4TVOA 4YB8A 3W6JB 4EDFA 4YJDA 1EUDA 1R1UA 2RVCA 3EMKA 5GY7A 3EK2A 4IDEA 3NX4A 1FDSA 3UN1A 1T25A 3C1TA 4MEXF 5BR7A 3ISPA 5LRSA 3KBOA 4OXNA 4XJTA 1Z82A 2ZATA 2Y0MA 3GW2A 4R4JA 2FXAA 4R9RA 3WTWC 4RLSA 4CPDA 3IDSA 1ZRCA 2CF6A 4A0ZA 2V6BA 4XGIA 3WTUC 3N4MA 3DZFA 1TNSA 4WXDA 2BEOA 3J81K 3DBLB 2WE7A 1J75A 2IT0A 4J4HA 5DCWA 2Z1MA 4E12A 5A4DA 5LDHA 1S29A 4R5HA 5JCJA 2CY0A 4U0JA 3V2HA 1BC8C 4GSLA 5BSHA 1LU9A 4BNUA 3ROUA 5L3BA 2VBWA 1J0XO 1Y8QB 3RJ9A 1B9MA 2EW8A 4PG6A 4KNYA 2Z95A 4NB5A 1KU9A 3JSOA 1E1NA 4RDIA 3FPLA 1DRVA 1EVJA 2R00C 3LWFA 1XGNA 4PVCA 2WTEA 4N0BA 1E6WA 3D4PA 3GGOA 2NS0A 2TMGA 2ZTUA 1GUFA 2EV6A 4PDKA 1SC6A 2PH5A 4WLUA 1PZHA 2GD1O 2XKPA 2JD2A 1LDJA 3LT1A 3WJAA 2PI0A 1H93A 4NQWA 1JLLA 2ILTA 4Y6PA 4YA6A 1R00A 2IA1A 1GVJA 1YQXA 2PWZA 1BBYA 4XLNF 4A2UA 4WEOA 1R0LA 1HKQA 3FZVA 4TV7A 1NQ5A 3ANMA 3DBLA 3PQJA 3WTSC 3G3EA 2XKOA 4A5NA 3HFGA 1OC4A 4Y6RA 1NFFA 1V3FA 2ZO4A 5L45A 1GXPA 3MFKA 4XCVA 1JHHA 3CUQA 1C1XB 2UZKA 2HRBA 1XR3A 1SMTA 4NZ9A 3I1JA 4A0YA 2YYYA 4D42A 4ZN6A 1H9AA 2E1NA 3WU0A 1O0SA 3OIFA 4Q48A 4PLZA 3EZLA 5IDYA 4I5GA 3RFXA 5HS8A 2FR8A 3GXOA 1FLIA 1DIAA 1JGSA 1Q7GA 2IODA 5JFOA 1E3WB 1NR7A 1O5IA 2G1UA 3LK7A 3UF0A 4RDHA 3E5XA 4YFNF 1GR0A 4MTEA 2PH3A 1EE2A 2JL1A 3OJLA 4CLRA 1JKFA 5TT0A 1NX6A 3I9OA 4CYDA 1DDOA 3D3EA 4ON0A 4WCFB 3M2TA 1HL3A 4I02A 3JTMA 4L4XA 2EWNA 2M45A 1U3EM 1T26A 2X5JO 4PIVA 2Q3EA 2PY6A 3VPXA 3TF5A 5L40A 3W8DA 1Y1PA 4K9DA 1HYEA 2IRWA 4WPGA 1TQIA 4PG5A 3FR8A 3UAGA 2ESNA 3O4RA 5A3JA 5CEJA 1K0UA 1V8BA 4NIMA 3ZV4A 5LEKA 2Q50A 4OKNA 3V7SA 8ADHA 1MKMA 1PGJA 1HDZA 2EXXA 3ST7A 5KWEA 3E97A 2HGCA 1UXHA 1YO6A 1GV1A 2E49A 1E1KA 1WKMA 1UUFA 2AQHA 4UVCA 4NBUA 4CO8A 2J3JA 2P9GA 3E8XA 3NDJA 4FCCA 5CPBA 3UXYA 4PZDA 2ZBKA 1XD7A 3NJ4A 3RC7A 1N1EA 3P2OA 5L7TA 2CWEA 1R37A 1HDCA 2V7PA 4UULA 1Z05A 1VL8A 1VRWA 4HY3A 1QSGA 2O2SA 3DTYA 2AE1A 4CMKA 3I64A 2NNLD 3GFGA 2XV4S 1DFHA 1P1HA 3CEAA 3JQ9C 2V1XA 3ZP5A 5JE8A 1B3BA 3CUQC 2NQ8A 2AG8A 7ADHA 3RKWA 1Z9CA 1DJNA 1LTHR 2VOOA 2NADA 4OIOF 1MXHA 5JVTA 2HFHA 3WE2A 3HHPA 3WE3A 1U7HA 3HSKA 4RQUA 1M6WA 1X14A 1P33A 2BLLA 2I3AA 1OOEA 2L4MA 2YQ5A 3QVOA 4YAJA 5KVVA 5TIIA 1EH6A 5H81A 1T2FA 4BNMA 1NFRA 2Q1SA 4J2HA 4AJ2A 2AW5A 4HQMA 1SB9A 1YKFA 4YXFA 3DBRB 3TGNA 2WSBA 1Z6RA 3GZ6A 5A9SB 5KNLA 1X1TA 4IVNA 3GX4X 4B09A 1DAPA 3INGA 5LLQA 3U1DA 1VJ1A 1HSTA 1MJAA 3TFOA 3BTSA 1OKRA 3J81Z 1P0FA 3C3XA 2GUGA 3ONDA 4CM8B 3HDHA 2JT1A 5CLSA 3DHEA 5IT9K 3LC7O 4IBOA 3L7WA 3SZTA 2NYXA 3HN7A 2Z1NA 4NI5A 4CLEA 2VRBA 4R8HA 4K1LA 3ZNPA 5I9MA 3WODF 3PJGA 8LDHA 2DPHA 1U6GA 3ZN2A 4EQQA 3CPSA 4YRAA 1WMBA 1KGSA 1NPTO 3EZYA 2WC2A 4QECA 4A5OA 5H6QA 1ISIA 4R5MA 1TTYA 3FHLA 3LC1O 2BHLA 4AJOA 2O0YA 1J5PA 2B4RO 3OECA 4IF4A 1ARZA 4PLHA 3L00A 4HAMA 4JK1X 3RJPA 1PZGA 3JQGB 3KZZA 2WMDA 1PJBA 4J43A 3O9ZA 3PHGA 2O8XA 2Q2QA 2E6UX 3WBBA 3DHYA 5F64A 1ZSNA 3DBRA 4B8XA 3W1VA 2BBYA 3BHIA 3PPIA 4ZGWA 4FJ1A 1PDNC 1RJWA 3AOEC 1L0OC 5T5QA 4AWXB 3PQEA 4BMVA 1QO0D 2G9WA 3M1EA 2VT2A 1YB4A 9LDBA 3BMOA 3U62A 2P5LC 2BFOA 1PJLA 1XSDA 2EEZA 1Q7CA 3B70A 4CV2A 3KZVA 4CM8A 5JAIA 1PS0A 1IZ1A 5AIPA 3H65A 3E9MA 4AICA 4UUVA 2Q0OA 1EUCA 2FMLA 1FWZA 4NJMB 4KMUX 1DJQA 4DMLA 5E20A 3ZU4A 6LDHA 2EG9A 3JQAD 3DAGA 4GYGA 3C8MA 1KVSA 1I10A 1ZAOA 4ESFA 4MQVA 3KP7A 4FT8A 4BQRA 1E7WA 1A5ZA 3E1KA 3CUOA 4E6PA 3NGXA 2DBZA 1PGNA 2Y1OA 1FX7A 4YT5A 4WJZA 3LA7A 2DU8A 1B0AA 3EHEA 1C0WA 4BNCA 1P2FA 1VTNC 5T67A 2HQRA 1F12A 3M6IA 4O6VA 4RCVA 3PIDA 5FFXA 2B69A 5LC1A 4I98B 2KRFA 4FDAA 4TQGA 4CM9A 3ANLA 3QHAA 3QWFA 1C1DA 5T64A 4BHCA 2EHDA 5JXWA 5MGBA 1E17A 3IC7A 2RGVA 1FSHA 2WJPA 4I1IA 4OMUA 3WWYA 2YQ4A 3FN4A 3TL3A 4ZZDA 1O3TA 3FHZA 4NHJA 1SCUA 4L9JA 4IINA 3T1BA 5DD4A 1GZ6A 1XCVA 4OIMA 5JAMA 1LI4A 4INAA 4OHUA 5A03A 4KYWA 4S1VA 3E6BA 2R6JA 4HP8A 1X1EA 3F6VA 4J1NA 1VLLA 1PJCA 2VUSA 1KYQA 1HE4A 2UWMA 1EVIA 2JCXA 2Y05A 2QG4A 3H2SA 4WASA 5CEFA 2FE3A 4JQCA 3EDPA 2ZXJA 2D59A 4BGEA 1KS9A 3U4DA 4MVJH 4UV9A 3T0YA 2FPIA 1H6BA 3Q9UA 4WNCA 2NWQA 1QZZA 3RFTA 3E5QA 4LJZF 3GFLA 4HV4A 1K6OA 3QRFF 2G0TA 3MAJA 2UUPA 3VDQA 3E6CC 1DEHA 2JFFA 4E2XA 3QP9A 2F5EA 3C3WA 3O03A 3L6EA 1YJQA 2X0NA 2P5YA 3ICCA 5FFZA 3FBGA 2FEZA 3EQLF 4CL3A 2IZZA 1YONA 3ANNA 4MVJE 1HSZA 4I01A 4NK5A 2I66A 2NRAC 4Z3DA 4EITA 2AE2A 2QYSA 4QO8A 1SZJG 5JCJD 2CFXA 4JJFA 5G0UA 4CUZA 1HE5A 1Q1HA 1G1AA 4YFKF 2HLPA 5J23A 2CD9A 2EA2A 5HA5A 4UVHA 4ALJA 1F14A 5IT9Z 3SEFA 3WWZA 2A5YB 2VYVA 2B0LA 4D7AA 2OZPA 2YFQA 2GA1A 2O6GE 3HZZA 3MJVA 4GPD1 5AOVA 4IRHA 1YB1A 5CDUA 4MEYF 1BDMA 2Q4EA 1Y81A 3K69A 4J90A 3VTFA 3BMCB 1FBSA 3PJFA 1VL6A 2WYVA 3GO5A 1GADO 1STZA 1A9ZA 4UVGA 3VKVA 4BL5A 4CLXA 3G0OA 1Z6TA 1ZN2A 5KKAA 4DIBA 1WWXA 1Q0QA 1Y6JA 3HHGA 5KVCA 3ABUA 3JD2A 1WRJA 4FGSA 4JN6B 5KOIA 2FBIA 3J7AO 1U5AA 4NNJA 3RI3A 4TZTA 3EYIA 3GDGA 3OQBA 4K26A 3CTMA 4A2CA 5C7OO 5IDQA 1KC3A 1ADGA 1LX6A 3K6JA 1ZK0A 3VEPA 5JSFA 1A7KA 3QVTA 1IF1A 2BFAA 3HIFA 2DBVO 4E5MA 2WYUA 2QYTA 5HRUA 4KTTE 4N5LA 4L5IA 4X54A 1NHGA 1SO8A 3PEFA 1YL5A 3C24A 3RUIA 3AAFA 1Q0LA 3RC2A 4BNTA 5CJ9A 4FB5A 1ON1A 1HRDA 3ADOA 3S1LA 2GCGA 3ZV3A 2J6IA 2FZEA 4BNVA 2FQ3A 1U78A 3QA9A 2HTSA 2BGCA 4I0AA 1BTOA 2I9PA 5EPOA 3BXXA 3F46A 2ETHA 1I24A 3UW3A 3QP6A 5JYEA 4R3WA 3KP6A 2VWPA 2IZ1A 4ZU3A 3WTXC 3AY3A 5LBQA 2RH8A 4BIIA 4D46A 3KHUA 3B1KA 5F1PA 5KJ1A 4E5NA 4QUKA 4P5OA 4FPXA 4NK4A 2M5WA 3NAQA 4YTEA 2O2YA 1B26A 4RVFA 5BNIA 2RHCA 3W6ZA 3AUAA 2EW2A 4WXCA 3DBHA 4S04A 3Q2IA 2K86A 2E1CA 4NFYA 4KDEA 4YJHB 1K78B 4IGFA 4RGBA 4CLOB 3F47A 2EFNA 4CM4A 3FNHA 4OOIA 2EB7A 3AY6A 2QVOA 3PFWO 1MX3A 4N5MA 3DQPA 3O26A 2DAPA 2X1HA 2B5VA 1DIGA 2PD4A 2QHXA 2Y1GA 4HUJA 4IJKA 3S55A 3U0BA 1E7SA 2BH9A 3HG7A 2NVBA 1XSVA 4XYLA 4A6EA 4J49A 3Q0EA 2MA3A 1LJ9A 2GN6A 2XAJA 5T6BA 1YW8A 3QVXA 1KOLA 2PZMA 3H3UA 1J49A 4HNHA 5ICMA 2COMA 2KIUA 5LGUA 3H2ZA 2FNPA 4XWYA 3QIVA 3P7NA 5DP2A 4MKZA 3TN7A 4BB6A 3ZWYA 1E3IA 1DSSG 5DUIA 5E1ZB 4I9HA 5KVSA 5U9CA 3I0TA 2E7WA 1YYVA 4M54A 5KKCA 4QLCU 2VUTA 3H3JA 4RB0A 1E6EA 2ZQZA 2V1DA 1LDMA 1U9JA 4NJOA 2O3JA 3W6UA 3CJNA 4W82A 3GA0A 3TL2A 3K9TA 4J9VA 3QPTA 1YLFA 4U8GA 3GFIA 4LISA 1K78A 3F8NA 5G4LA 1BC7C 3O2PE 4ENMA 2QRJA 2PD3A 2RKHA 2W2KA 5EQDA 3E6MA 4DLLA 2O4UX 2VC1A 2WTBA 5CFZA 3BZUA 2W85A 1QPMA 1ONNA 1QMGA 3UVEA 5CVIA 1D1TA 3TQHA 3EYYA 1F5TA 2A4KA 3T4XA 4CQMA 1Z74A 2PN6A 2EGHA 4YRDA 1C0PA 3PK0A 4CL8A 2DPDA 3HN2A 2VBXA 3MEXA 2XXBA 1FDVA 2KJBA 3RASA 4YT2A 3ZPLA 2LDUA 2F00A 4BS9A 1ISJA 2ZB8A 5DCUA 3E5MA 2P6SA 1S7CA 1MZBA 1LQUA 5U1PA 1UXJA 2WD7B 1HKTA 3GEDA 3TOZA 4E4YA 4P4GA 1MA0A 3FR7A 3HE3A 1MJBA 2A94A 4MIOA 1JAXA 3WTCA 1X7HA 2AQKA 1OI7A 1NYTA 3MWMA 4YJGB 2I67A 3HOTA 1CQIA 3CIFA 1I1SA 3AJRA 3OJ0A 4B8ZA 4WCGA 1K6IA 5IF3A 2NAZA 1G4DA 4MP8A 4XRRA 3GDOA 4AG3A 2DT5A 5CEEA 1EDZA 1RKXA 1LC3A 1FPQA 2OQGA 4GYIA 2GPTA 1H5QA 3T8TA 1O7LA 1CF7A 4LSMA 1S6LA 2EJWA 4KN7X 3WB9A 4BGIA 3F72A 3E48A 5L3GA 2DBRA 4GSKA 4F46A 2P4WA 3PYLA 3I9KA 1O8CA 4CM3A 1MDMA 4DYVA 3GN1A 3K9QO 1HBXG 4PLVA 4HLYA 2KIMA 1F0YA 4E5YA 4AVPA 4D79A 2C82A 4PRLA 2W2LA 2IJLA 1DRWA 1Y5MA 3WGTA 5IAAA 3SJ7A 2NLOA 2XGXA 3DZJA 2HMTA 2DU9A 3AFMA 3HYIA 1TQPA 4PGHA 1LEBA 1ZEMA 3BMNA 3H3FA 2K4JA 2DQRA 3AM3A 2HO5A 1T2CA 2HKIA 5LRRA 2AEFA 2YPRA 3EETA 2J3HA 3GG9A 4PZEA 4F6LA 1MV8A 3WFIA 2V79A 1UR5A 3LF1A 3WSVA 4CQLB 3G79A 1I30A 4YJGA 3RKUA 2JSCA 3V7CA 1U5TC 4ETSA 2HJSA 3V5NA 4ZJUA 1Z1DA 2IPQX 4Q9NA 1UAGA 1MUUA 1LUAA 3LQQA 1B8VA 1FK8A 3GMDA 4RVHA 1KVTA 3D64A 1GD1O 5EN4A 1ID1A 3NJ8A 1MGOA 4RAYA 2RN7A 4J91A 4P9UA 2K7LA 3MJEA 2IYOA 2HMWA 2EWMA 3BJAA 3K0LA 2O3QA 1BW9B 3U3XA 5DULA 3C85A 2NQTA 3EVNA 4N18A 2Y0EA 4B4OA 3WICA 3U5TA 1PL6A 4N7RA 3WGHA 5ILVA 1DLIA 5JHUA 1UXKA 5DDGA 3HB5X 1XELA 1DRUA 2O3TA 1EK5A 1S3JA 4IDAA 4XKJA 3NEPX 4RGSA 3VH4A 3VKUA 3F4BA 1NVGA 4LCJA 4LSWA 1Z7UA 4ASNA 2DFDA 3NTOA 3PFFA 4WGGA 2RNJA 2QQ9A 3SZPA 2FF4A 2DVMA 3W6KB 2JAHA 1ZGJA 2VHYA 3NT2A 2NU8A 3VH1A 5HDNA 4G81A 4A03A 4GMFA 2CO5A 3SFZA 1JQBA 2GDZA 3SBOA 4EVIA 4CMHA 2OBPA 1QLHA 2FP4A 1XG5A 5DCMB 3PJEA 4D44A 5FI3A 1R4MA 3TDZC 3NUGA 3UFXA 3ZDFA 5L4NA 3RBXA 5KVRA 1YFHA 3INTA 4IIUA 4I7HA 1BOAA 5DUKA 5CG2A 2JHFA 4BUCA 1VKNA 3ORFA 4B3JA 3ZHXA 1IN5A 2GGSA 2Q1TA 1EH8A 4G65A 2FY8A 1AHHA 5G0SA 2WM3A 3DFGA 3S2IA 1XN7A 1BW9A 4EJVA 1KETA 3FNEA 4R3NA 5A05A 4CV1A 5G2OA 5EIOA 2W4QA 1W73A 3OP4A 3T4EA 1QXSA 1LDKB 3WGIA 2FSSA 1W4ZA 4J7CA 1BIBA 4KUEA 4MP3A 1B8UA 4XYGA 1N8KA 4IXAA 1GYRA 4UUPA 3JQEA 2CGPA 3VAZA 4CMEA 4OOEA 2D1HA 5LEJA 2YV3A 4LRTB 2JJYA 4XYMA 3D5LA 1O7FA 1RZ4A 1ADBA 2CDAA 3ZV6A 5HS6A 2ZCUA 6ADHA 1E1MA 3F1LA 4ZYDA 2I3GA 4Z9YA 3ECHA 1PIWA 3FMRA 5K5RA 2UV8A 2FBKA 5TJ9A 2R3SA 4R79A 2FWMX 5HWSA 3L9XA 5ER6A 4R68A 2VWGA 3LLVA 5E8GA 3PWKA 2A69F 1KQ9A 5I9LA 1NAIA 1OMOA 1ZK4A 5L3DA 2P7VB 5C3MA 3E3VA 1LQTA 1M2WA 1T2EA 5DCFA 1QYWA 3F23A 4YVFA 1P4XA 4AJHA 1P74A 4RZIA 4OL9A 1D8KA 2E7XA 4O1MA 4GBJA 4M6XA 2ZNZA 4HFJA 2J3IA 1NPYA 4CXFA 2BE5F 2ISZA 1JDJA 3HDJA 1ZRDA 5FWNA 1LNQA 3LSTA 4DC1A 2NTJA 3TO7A 1JWBB 1T39A 1ENOA 2FRHA 2P9CA 4YFXF 5CDYA 4LB6B 3MZHA 1Y8RB 3TDKA 5E18F 3ZWPA 2ZCWA 4EGZA 1LLQA 4WLEA 1V4RA 2M87A 1WQ2A 3VZPA 4Y13A 2OORA 1R1TA 4PLPA 4XQ9A 2F2EA 2M30A 4L5JA 4CM6A 1E92A 3N74A 4MVJD 1CYDA 1PJTA 4CR7A 3DHNA 1LSJA 4O3MA 4E70A 4EEZA 2K27A 3NQOA 4EW6A 5C37A 4U0WA 4A6DA 3M2PA 4IUYA 2IA2A 5I7SA 4DGSA 4CMEC 1IZ0A 1ZZEA 5EERA 4WOKA 2XIGA 3OFSA 3WQRA 3PWSA 1WZEA 3GNSA 4XQEA 3I4CA 3QWAA 4YDRA 4BO0A 1TXGA 2Q2EA 1HDRA 3GY0A 1ZXBA 4UVAA 5E1WA 1OAAA 3SLKA 2C0CA 4IDDA 3V8JA 3ZHYA 5FD5A 4P9FA 5HLIA 3S2WA 4E2YA 4LK1F 4XR9A 4RVDA 2X9VA 3WQQA 3KSZO 4FX0A 4RAZA 1FF9A 4L9VA 1IRGA 4EV0A 1HYHA 1PSDA 1PZFA 3A06A 3IP3A 4FJ0A 3JD1A 1G6KA 1PEDA 4ESBA 2HMSA 2J5OA 3W8FA 3FD8A 4R1TA 3QOPA 1QBJA 1AXEA 1HW2A 1U3TA 4FQ8A 5B4TA 3KCCA 4RL6A 2JRTA 4XZ3A 3MZYA 4ZQFA 3TKYA 3INRA 4U0KA 1QKIA 4R1NA 5EEHA 1H2HA 3CMCO 1MFPA 3DR3A 3J80Z 4U7BA 2J5KA 2OA4A 1LSSA 5C7LO 3BIOA 1JXSA 4IQGA 3BWGA 1FYLA 4RF3A 2PQ8A 4G6QA 3NDIA 4ONEA 1WXDA 4B7XA 1I3MA 2EERA 4FJ2A 4AD9A 1U2GA 2ZK7A 2C07A 1HQCA 1USTA 3V4GA 2J5PA 2Y48A 3JD0A 4BKPA 5KCZA 5ILUA 5L7WA 4J0FA 2EV9A 3WGZA 4YJFB 4AJJA 4BO5A 3HSRA 2WWRA 4IMPA 2PA3A 5F6FA 5F1KA 4RO0A 1BI1A 2Q46A 4LMRA 5HM8A 4WLFA 3CUQB 4CHUA 3MOGA 1HZZA 1OYIA 5C5IA 4L4SA 4R16A 2TDXA 2P6TA 1TBXA 3FXRA 4YR9A 2WE8A 4J0EA 4QXMA 1LDYA 3RKYA 1T2DA 2I65A 4HX5A 4XRFA 2G17A 4UEOA 5L9AA 4HLXA 3IRQA 3IUPA 2DTXA 4RPHA 3E9QA 1ZVMA 2FR0A 2HUNA 1QGPA 4KQWA 4CLRB 1JE8A 1OYYA 3K30A 3PHHA 2CSOA 5JBIA 1KEWA 1BXZA 4CQMD 3Q9VA 3O8QB 2EJRA 2VBYA 3EC7A 3C7AA 4KTVE 2P91A 4OXKA 3ONFA 4EJOA 4R54A 5G0TA 1P9LA 3C7JA 3LQRA 2VHZA 4UAGA 3TO9A 1HDGO 3RUCA 3WFJA 4P38A 4Q3AA 4GVXA 1E2XA 3DXJF 2EKPA 2OAZA 1BG6A 1XU9A 1LSOA 3D4OA 4XYEA 4BV9A 4L4RA 2R7FA 1LDEA 4JBGA 4HDUA 1DDNA 2BFMA 3RI4A 4YJFA 2O3FA 4OMYA 2AEJA 2ZYDA 5EL0A 2L01A 3DAFA 2XAHA 3JQ9A 2HQNA 4EJWA 1AN9A 4ESJA 2FZWA 2H09A 3DOJA 5LDGA 1FMCA 3ZWXA 3CLOA 3FX3A 3UCXA 1ML3A 3ROMA 3H5NA 4Q3EA 4ZYEA 3JQ7A 5AXDA 2JTVA 4E0BA 2VRCA 2DO7A 1GCUA 4XYBA 5D5UB 3ETEA 1F9NA 3RROA 4ALLA 1TQMA 2PKQO 3N7UA 3RIRA 3M8FA 3PFIA 2BD0A 1HW5A 4ENKA 2V65A 1I2BA 1OBFO 2NACA 1N2SA 2YDXA 3HFSA 4NBTA 3CDHA 1CWUA 1R4NB 3SC4A 4BO9A 3OV8A 4DA9A 1BRMA 3O8QA 1XU7A 1PX0A 3BA1A 3AUTA 3KP2A 3RKXA 4BHBA 2W2LD 4MVJM 3SXYA 5IT3A 1E0DA 1YDEA 1GQYA 1PTJA 4L0YB 3C7DB 3VFZA 3OEYA 5DOZA 4J4TA 4J7XA 4BB5A 4IJUA 1PQUA 1E3SA 3L07A 1J2XA 3PLRA 3LA3A 4M49A 4E5KA 1H94A 3SJUA 4DPMA 3IWZA 3OBBA 2FOKA 4M9XA 1F8GA 4GGOA 4OINF 1GYQA 1T6SA 1A27A 2DK5A 1D5VA 3RC9A 4IM7A 3MTGA 2KJCA 2HSDA 4K6CA 4LFUA 3I59A 2Q2WA 3KP5A 4ZQEA 1R22A 1BWSA 3R0IA 2V6MA 3VPSA 3LVFO 5K5QA 2A6HF 2IRFG 3S2EA 4YRBA 5JFRA 1DUXC 3W4IA 2P4HX 4CUKA 4AJLA 4DTIA 4OQYA 2Q99A 1B2LA 3OJEA 1GQ2A 2O23A 3D3WB 4D3DA 3ONEA 1IYZA 4LVUA 2Q49A 4PZCA 1FSEA 2D2IA 1ZG1A 2OP0A 4OOFA 1O57A 4P8RA 1IY8A 4LLGF 4I2OA 1PWXA 2Y66A 4QT0A 1ZJYA 1ONOA 4EUEA 3WTYC 4O59O 1P31A 1U4OA 3K2EA 3R0AA 1NWCA 1R4NA 5BNFA 1VKOA 2DQLA 3WIEA 4JCOA 4DQUA 2B4QA 3DO5A 5IJZA 3AOEA 1EFKA 4BKRA 4M89A 4U6SA 5L53A 4HYEA 4WUVA 3H5RA 2O50A 1G3YA 1GEGA 3C1DA 1ORRA 4ZQHA 3RCBA 2X4HA 3R1IA 2EV5A 2DC1A 3VPHA 3JD3A 3ROKA 3DXFA 4DL9A 5LHHA 1QV7A 3OHSX 3RYRA 2VCYA 1BI3A 2GQQA 2ET6A 2Y93A 5F5LA 4BKUA 5L4LA 2AMFA 1BVRA 5ITVA 1G6NA 3B73A 4UV8A 1JW9B 2UUOA 1IN6A 1PR3A 4G5HA 4GL4A 3DONA 1N9GA 2QUFA 4BHPA 2H6EA 2ZTVA 1EDOA 2LDXA 4EUHA 4YAKA 3Q9SA 1HETA 2OUIA 3NKLA 4LGVA 5HOOA 2XVCA 1IUYA 4Y67A 1V3VA 2E4AA 3BMOB 4FD3A 4MHGA 1RIOH 4M87A 7MDHA 1D3YA 3D3WA 3DOOA 3NRCA 1YTYA 4OYRA 2GWRA 1BDBA 1IXSB 3GRKA 1OFGA 3DB2A 3KOUA 3V1TC 3DMYA 3ZMUA 2CQKA 4DNCA 1HWYA 4MINA 4DPKA 5I7EA 5JCXA 5JAZA 1ISMA 4XIJA 3VODA 3QWHA 1Q0HA 4E31A 2X58A 5TRTA 3EGOA 2G5CA 3RUFA 2D5CA 3KLNA 1FDTA 4WLNA 2IEDA 1K89A 4LK3A 3LYLA 3KLOA 5A9SA 5IXYA 2HTJA 2ADUA 4L9NA 1T1SA 3AM4A 2BRUA 3EUWA 4BMSA 4URFA 2VTDA 2YDYA 3R60A 4C7KA 4GXOA 3RDIA 1L1FA 4A5MA 4K28A 1KEUA 3OJFA 3T7EA 3F8FA 2VWQA 1ODDA 1HEUA 1O9BA 2VHXA 4OSPA 4OAQA 2J8ZA 4UVEA 5BSEA 1C1DB 3ASVA 1CJCA 3DZIA 5ICFA 1CEQA 1ZREA 3F8CA 4OO3A 4EM2A 2XAQA 4LLNA 1AXGA 2O3RA 4XRGA 1JKIA 1IN4A 2YV2A 5KJ6A 1TT5B 4TRRA 3GVAA 3D4NA 3SXPA 1R58A 2L02A 2YR2A 1QORA 1UDCA 4MKRA 3FF4A 4AJKA 2CF5A 2NNNA 1ENZA 4EJ0A 4ZRMA 1M67A 4RS8A 4PGGA 3ZNQA 5JMPA 3BMQA 4RQTA 5TS3A 3C7CB 4OXYA 4BMNA 2VXZA 1T1RA 2AG5A 2ZNYA 3C18A 1QP8A 1HF3A 2NSDA 4TKMA 1TW2A 1F1ZA 1KA8A 1XSXA 2HK8A 4DQXA 1LEHA 5BMZA 1XDWA 3IJRA 3L6OO 1G3TA 3C1AA 3WYCA 2VTEA 4RF5A 5D8LB 2Y1FA 3ADPA 3F6YA 4GAEA 5E8IA 4IMRA 4CMCA 4DVJA 5KK1A 1ZO8A 2HU2A 1SOVA 2O48X 1GTMA 3JTHA 2DAOA 5BS6A 2DM6A 1X7GA 4R51A 4Z0TA 3G3ZA 1BJAA 3IOYA 3P9IA 2QBYA 3I83A 3GHHA 1HXHA 1VC2A 5FO5A 2BV6A 1VM6A 2G7UA 4G8XA 4R9SA 3LA2A 3UUWA 4JNKA 4RGRA 4UUOA 3GOHA 4D3FA 1H6CA 1TT5A 5D5XB 4EM1A 3OEWA 1P1JA 5B37A 1PUEE 4P4LA 3RYPA 4IZIA 3SHFA 4BGVA 2PLAA 1HT0A 1SB8A 2DW4A 4ZRNA 3K31A 3QW2A 5I9NA 5I8WA 3F1KA 1SEPA 2ISYA 4FFPA 4PN3A 1ZHFA 4KT5C 3ZMVA 4RVUA 3IQDB 2FBHA 2D2WA
chains in the Genus database with same CATH superfamily
3I1YA 1L7DA 1T4CB 1XJ0A 5KEIA 4HMOA 3NATA 1CC1S 4LE1A 2RJOA 4CFYA 1A9RA 1RZRD 4IV8A 4MGRA 2E3JA 3MQ0A 2DFEA 4TWRA 1NBEA 4JLPA 2DXIA 3FJOA 4XUGB 3PDJA 4BQAA 1U4NA 1WXWA 3WLTA 3UGKA 1Y89A 3R6SA 1AQJA 3D0OA 2I6TA 1NOIA 1U9CA 4CHGA 2AQIA 4DDKA 1TMYA 2QAIA 4HSGA 2YZ7A 1KJYA 1BM9A 2DLDA 4RGXA 4JI7B 3CZMA 3DBHB 2GBLA 4Z4CA 4HDRA 3P2EA 4CM4B 3SJZA 4E94A 4G5FA 3LPCA 3E5NA 3VV2A 4EUNA 4XLEA 3PDIB 4HS9A 1YTUA 1G19A 4WINA 4EL0A 5H80A 2AMYA 1YMUA 1UEJA 1OTYA 1MH4A 4PAMA 5K2OA 2IIQA 5KQLA 5HFJA 3IIJA 3RVBA 4WLVA 4BVEA 2IL1A 1FP2A 2CU7A 1QJ4A 1W59A 1KOGA 4UTXA 3MFYA 1GKKA 1WTAA 3T1VA 5D5PA 2Z3YA 2FPGB 4RPIA 3PGA1 4F3QA 4BRZA 2BFBA 1H66A 1C50A 2VO1A 2XRLA 3DL4A 1E2LA 1MH1A 2LD4A 1CF7B 2RGWA 3OT4A 1RRCA 3MJFA 3WGGA 4B3AA 1HSJA 5J5VA 3R3SA 3GP5A 4GKBA 3RB8A 2WICA 2PMUA 1L5KA 2DJIA 2BY3A 2ZMEC 4KN4X 2VJDA 5DNVA 4NWIA 3HHHA 1FRQA 3M6XA 3MWGA 5FEUA 2YBEA 2QVYX 4CG3A 3VU0A 3N05A 1Q15A 1WDTA 3L6RA 1OASA 3AR6A 3ENNA 1MB0A 1C81A 3DF8A 3TZLA 5CYOA 3CJQA 1H8ED 5BSFA 1YJBA 5BSWA 3SEZA 3ZU2A 1ZCFA 3F3XA 2BFDB 2MDTA 2EW1A 5ULLA 2W6ID 2C5BA 1KBZA 2YYYA 3S1AB 4RPJA 1F4KA 4XIGS 3DZKA 2EBWA 2I33A 4HQEA 2W57A 4CM9D 2FA5A 3LWDA 2XAFA 4QWMA 1A71A 2WFLB 2WC1A 1YFLA 1F20A 2E4ZA 4HYQA 1U7OA 4U7DA 1JXMA 3H7AA 1G66A 1JLRA 3IPYA 1P1IA 2ST1A 1JP7A 4L9TA 4EI7A 4HRYA 2FRDA 3KSMA 4YRFA 1MO3A 3ELUA 2PJUA 2MYTA 1Q0RA 3ZXIA 4QQ8A 5IEBA 2R5YA 2C3MA 1UXOA 2Q5OA 1ZM3A 5JS1A 1UG2A 4AKTA 1L7EA 4OFZA 4G86A 3ZWOA 3L0ZA 3PNQA 1MP0A 3QYEA 1RQ2A 1MIOB 3KHSA 3ZK8A 4L0ZB 3GPBA 2PGDA 4PVDA 3BORA 1J5XA 3IBFA 2OAP1 1AGYA 5F0FA 1K06A 3WIBA 4F2GA 4Q3LA 2Q4OA 5ALMA 3EQ8A 1J25A 2HZTA 4M60A 5KYWB 1X3UA 5FOSA 2JGDA 4HX9A 2PK3A 4PFJA 3BTCA 3IEMA 4CR6A 1I50J 3HRTA 4TX1A 2RGYA 1HCRA 5TPWB 4N76A 1IIBA 2VDLB 4H4EA 1RAAA 5D3KA 2MC3A 4ZK6A 1XYVA 3T3MB 3KR9A 2OOSA 3H17A 1FOKA 1VE5A 4G94A 1K3UB 4Y33A 3LBNA 3N8HA 3C3CA 5F98A 3HY6A 4LRUA 1QP0A 5AKZA 4PSXA 3DMHA 2II6A 2PLWA 4AQYB 2WU8A 2PMWB 5HMMA 4OQLA 3KXIA 1MMDA 5C3EJ 4MDHA 5DM1A 1NZJA 1Q16A 1XZMA 2HDHA 3HJNA 2R1TA 4Z4EA 4WN9B 2I8DA 3P9PA 3P7MA 1PI3A 3H42B 2OM6A 1L7VC 2VE9A 4ZVNA 3U7GA 4ZFNA 1V4VA 4DIOA 3FMSA 3VC7A 5LBTA 1H0MA 1JPNA 3PV0A 3V32A 3QMPA 2OMEA 4YAGA 1DKMA 1SC1A 3LWNA 4YDSA 3I56I 1NU6A 3NHWA 3CO6C 3OFVA 3Q7RA 5EJAA 4XARA 2G1JA 1WMAA 4M9CA 3GGPA 4PGAA 2BEUA 2ZT7A 2P5KA 5IDXA 1DL5A 1Q3TA 2IP2A 1UT5A 3FUWA 4D8WA 1R0SA 4HVCA 4OLJA 2JVKA 3EVDA 2B4KA 1Q0TA 2W6JA 4JKOA 1CRLA 4HB2A 2H92A 1X1CA 1C3XA 1XB2A 4MKHA 1Q0ZA 3PA8A 4CCAA 5GAEJ 5I9LA 1RI3A 3GCXA 3T0FA 4X61A 1EM8B 2Q6LA 1UM8A 1XXHB 5JPDA 5H82A 1T8RA 4TKVA 4IX1A 3LG2A 1Z77A 2ALJA 2ZBFA 3I04M 1WJAA 1PR2A 3KP1A 5A4IS 5CW1A 3DGFC 1AZLA 3BTOA 1ICIA 2A6EF 4RZHA 3HOXJ 1TZCA 4EZBA 2MCFA 2BAGA 2H06A 3H0CA 1DARA 1K3TA 4QTUB 3I52A 5LP6C 1FUIA 2GSWA 4FDLA 3WSWA 4KRFA 4LHWA 1ONPA 4Q4ZF 1FTQA 2CVHA 4CYMA 3BYZA 3R5XA 1PP8F 2BFPA 1HT3A 4JLVA 2H1SA 1QFSA 1U1IA 3EZXA 5B3KA 1NUHA 5E2AA 4FX5A 2VI6A 2IXFA 4YPFA 3TIIA 2GDJA 1XMIA 4UOZA 4LWQA 3PM1A 1UADA 4GCVA 1K27A 1BA2A 3HEBA 4QU9A 2YWBA 3MMNA 2P79A 3U7QA 3BDIA 2OEPA 1NI3A 3NTUA 1N6OA 4RD1A 4WOBA 1JECA 1I6XA 2BMFA 4A1FA 4J9UE 2ZQYA 1SELA 4DIFA 3G2BA 2OQRA 3DVAB 4XX0A 1CP3A 2WWIA 2QROA 5ADVA 4R2KA 2OO5C 4X8LA 2EHJA 3KTOA 4TS1A 3OFKA 1Z5VA 4R1SA 3F6CA 2X0LA 3RYFA 1J59A 2VXCA 1JIQA 1XTSA 2XVXA 3T5BA 1EFAA 4OI4A 4HMPA 1ZGBA 4UTVA 1W96A 4JI1B 1KTIA 4ZVQA 5KDOA 2Q2VA 3AGQA 4OSOA 4L0QA 4FFMA 2JJMA 5JMTA 1KY5A 4QASA 1FBUA 2VAMA 4X0EA 3SIPA 3SQNA 2R8OA 2Q1UA 3HM2A 4M22A 2W7NA 5DM0A 4Q47A 4Z9XA 3TL4X 2QB5A 4F5WA 2X8WA 3RJ5A 3SR4A 1M7BA 2PLYA 4NH4A 1PZXA 4WK8F 3C4JA 4N39A 5B53A 1D8TA 2A6PA 3FBTA 5JSQA 3TOXA 2BN4A 1IXCA 1J4AA 1G5QA 3SF8A 4OP1A 2KIFA 1E5XA 4WLOA 5FGMA 4D4JA 3HWRA 2Q8QA 3TB6A 4QUJA 5D7BA 1MD0A 2JA1A 3MZ0A 2D1FA 3TYXA 1P39A 1I4DD 4CMIB 2P9EA 4A3IJ 2FPPA 4N12A 3ZCSA 1EGAA 3VO8A 1LPPA 3RUDA 3TCXB 1WS6A 1GUAA 4NZMA 3N2LA 4OJTA 5EINA 1W5CC 5G3YA 5LQUA 4RIHA 1FUUA 2Y75A 1PRYA 2R7UA 4TSRA 3HXOA 4I3FA 1AT1A 2PVSA 4BN5A 4YUYA 2XB0X 2M8EA 3M07A 4XSGA 4Q18A 3VTZA 4N82A 4D3ZA 4NVRA 4LHSA 5AJHA 4E2WA 2GO1A 5ELLA 4UEJA 2HU9A 1MBEA 4XAQA 2H51A 4A27A 3QOXA 2NOAA 1EIWA 4OKSA 1X3WB 3FWYA 2B9SA 1GEEA 5ALRA 3OQMA 2RGXA 4B33A 2ZFWA 4HDNA 1XSEA 3L0CA 5LWQA 2DPLA 2W1OA 3U19A 4RHUA 3QLUC 1R27A 1CFJA 1LDBA 1NA5A 5BWLA 2GXBA 5IUKC 2M6SA 3TRKA 2PKQP 2VDPB 4P08A 1A4IA 3ZQCA 4B48A 2GM4A 1B8PA 3CLHA 2VPWA 3HNOA 4QNNA 4OI0A 5EG0A 4L5YA 1SK9A 4JLBA 1A9TA 3CDLA 4JJ4A 1VBKA 4DNPA 5EXDA 1NC1A 1RI5A 3VNQA 1XAIA 3Q3IA 3WBJA 5BW8A 1PLJA 5E4JA 3JWJA 5JLAA 4X97A 5EHNA 1SD6A 1N8TA 5GAJA 4A10A 1R8JA 3WTTC 2BISA 4R1QA 3CW9A 2K7FA 4RSGA 3SLGA 5GZ6A 2O52A 1I3AA 3QF7A 2VQFB 1E0AA 2GILA 2UYHA 4LBYA 3EMVA 3ELYA 4QBKA 3GTOJ 4B0OA 5EESA 1MB4A 5B57C 3TX6A 1V8OA 2YWXA 4AJNA 1V35A 3L5KA 4ZVUA 1T5IA 2XOKA 3UOAB 3STTA 3IMEA 3VU9A 5DJ5A 1F7UA 5FTLA 3BFJA 2QWWA 3W4KA 2OV4A 2Y3IA 4JLOA 2QQFA 2QM3A 3WY9A 1KK3A 1CB0A 1ORDA 2MINA 1Y5RA 2C83A 2RDPA 1JYEA 1IUOA 4XM2A 3IILA 4X85A 1J0EA 1X86B 3TG2A 4BX2A 1VPTA 1K8YB 3O92A 1LRJA 4MQFA 4MWZA 5KYKA 4DLPA 4QGFA 1H23A 1EE1A 4GYJA 4DXAA 3KL2A 5GPCA 2Q0QA 1GARA 4Y6OA 1B23P 1PL8A 4TVOA 1R66A 1Y6RA 3BDAA 4BVLA 1EUDA 1GV5A 3T12A 4IDEA 3I01M 1FFWA 3VGPA 2WTXA 1N5MA 2VL7A 4LY6A 2CF6A 4LG3A 1J2YA 1XG1A 1GNVA 2HHAA 1G20E 3GJTA 3ZGKA 1W52X 2Q6OA 3K5IA 5CH5A 3OQIB 2OCBA 1EU1A 1XEFA 1EVJA 3W6OA 4XLZA 3D4PA 4AZVA 3CLVA 2ZVQX 5G1NA 3Q4GA 1JLLA 1SKMA 5D00A 1Y7PA 1MC8A 1G8AA 3PICA 3VQTA 4A5NA 2O7OA 3R7FA 4A0YA 1DUVG 1JU3A 3QNWA 4D42A 2G63A 5HJ7A 1J99A 3GLHA 3NHSA 4EI8A 2X6QA 1T56A 4B75A 4G1MB 3AHGA 1SQFA 1PUJA 3I9OA 4XX1A 4ON0A 3TM5A 3ZQFA 2JLRA 3KZMA 2Q3EA 5L40A 1Y1PA 2D1RA 3PXEA 1JHOA 4WFIA 1LPOA 4II7A 3U1TA 5CXQA 4TXNA 3ELDA 5KWEA 1RZVA 5FWYB 1GV1A 1OF1A 3T7SA 3NJ4A 3QYJA 1A2KC 1VRWA 5EQJB 2IEAA 4CMKA 5CU7A 3Q3VA 4OSEA 5FLXA 1YFZA 3GLSA 3LGSA 1XNRB 3FXMA 3HHPA 3R6TA 1M6WA 1FA9A 1YKFA 4OH7A 3EVEA 1IBSA 3OR1C 2ZUDA 4YCMA 2AF3C 4AY5A 4L85A 1P0FA 4NSNA 4ZPJA 3F98A 3S29A 4ARVA 2RAUA 3EISA 2P5SA 8LDHA 4A3FJ 3RV4A 5H6QA 4BFZA 4N9QA 3JQGB 4Q1BA 1MENA 2MW8A 3PGMA 3R3XA 4FJ1A 2FKAA 1E2PA 2FN8A 2IQIA 1YB4A 5E6SB 2LBFA 3L7BA 2OCKA 4GYGA 3S1MJ 3DAGA 4ESFA 5EE9A 5D3ZA 1KARA 3NGXA 4OHBA 1FX7A 2H3EA 2V8BA 4WBSA 4KWCA 1DMRA 2C8KA 1QIKA 1V6CA 2BXYA 3W5BA 2ADMA 1HOXA 1EXMA 1O3TA 1ZKDA 3ZS8A 5K8UA 4ZCPA 4BAZA 4BBSJ 3EXFA 5JAMA 3DYBA 4OHUA 3D8RA 4ZT2A 2QTVB 4MVJH 4J0GA 1H6BA 4CE6A 2LLKA 3RVPA 2HTFA 1NLZA 1R64A 2NAPA 4JEUA 3GJ8A 4UJ3A 4KKVA 1LE8B 1TEVA 5HHTA 4QO8A 3SICE 1V7QA 4MLPA 4FCWA 3S5UA 2Q5IA 3E4DA 2A5YB 4D7AA 2KPMA 2Q4EA 3O8CA 4GXNA 1TYBE 1CIJA 5ESXA 2ZXUA 3HHGA 3JD2A 2YJNA 3I04A 5ECDA 3J7AO 1CU1A 1VCHA 4A2CA 3HKBB 3EJWA 4NENA 3EPKA 4MK4A 3QVTA 4Y3OA 3NHYA 4EO7A 4NJEB 1FP6A 1XTRA 2YYSA 2OPTA 1U0TA 1RYBA 2J6IA 2XUIA 1O77A 1KY3A 5LQJA 3GQBA 2AOXA 1RKTA 3ED1A 3KSRA 3U9SA 5MFZA 5F1PA 3Q7SA 5IABA 1QB7A 3FRIA 1K78B 4RGBA 4CLOB 4Q9JA 2EFNA 1NVDA 2P9QA 1XCPA 2Y92A 4UXJA 2XAJA 4LUCA 2VQ6A 4BB6A 2GEUA 3WL5A 4LF4B 1YSCA 3VYRB 2JLBA 1PDOA 3OF3A 4X60A 1LDMA 1RWOA 1IQRA 4J9VA 5IKPA 3OM0A 4ENMA 2PD3A 3WHKA 1G2QA 1XA3A 4CQMA 1K7SN 2ZJ5A 3KYJB 5HNFA 1MD9A 4RIIA 3HE3A 1JAXA 4P9NA 3TW0A 1X7HA 1ZX1A 3DPIA 4B7ZA 3EAQA 2IELA 2YYAA 2B8EA 3SC2B 3LZDA 1BQEA 2PYDA 2XZPA 2C3PA 2W2LA 2W83A 4QG7A 2XGXA 4PGHA 3PD7A 4COOA 3PNTA 5C8VA 4E46A 3DAHA 2B5OA 3MGCA 4RTSA 5FLYA 4RS3A 2OZLB 3TM4A 4TTIA 2FW9A 4D99A 4N18A 2G9QA 5BSUA 4N7RA 4U7GA 5DDGA 4LGYA 4HN4B 2HDWA 3S93A 1B72A 2DWCA 4F9FA 1XU4A 3KZ1E 1VZ3A 2E19A 3E7FA 3P9QA 2Z9DA 3T0IA 1EFPB 2Q1TA 2G0AA 4PAQA 4BE7B 2L9RA 1M8JA 3IP8A 1UBKS 3O8RA 4ZOLF 3NAMA 2CXXA 4OOEA 1EB8A 3PEVA 3WLPA 2FWMX 2JIOA 5LL6P 3A6KA 2PH7A 4OFWA 5ALKA 5UKDA 3ZBUA 1S9HA 3HL2A 3NNNA 4K03A 1AHPA 3H0EA 4A3JJ 2F3TA 4RETA 1TGVA 2OORA 1I3OA 2ROQA 4JOSA 1KYTA 4O3MA 5C37A 1RWVA 2NNWB 4JB8A 4D5CA 5TARA 1Z7YA 4XQEA 2C0CA 4RFLA 3I1IA 4OUKX 3A06A 3A4TA 3SU8A 1G6KA 1PEDA 4ESBA 4O2BB 3VOTA 1OD6A 3BXZA 3RLIA 5DHPA 4RXTA 4FB4A 2TSYB 2VC2B 5E3IA 1WXIA 1IBCA 1X7WB 1Z35A 2GN0A 2PO7A 4IL5A 2ZRPA 5ILUA 2WWRA 1FMTA 3LMMA 1JDPA 5DWDA 5KYUB 1E0KA 4L4SA 1YNSA 2WE8A 4UE3S 2Q6TA 5BVHB 3ELBA 4HB0A 3IXLA 2C5FA 1BNCA 3E7WA 2MTBA 1UKAA 4P38A 2VLAA 5ALZA 1LSOA 1X2MA 2I10A 3VYUB 5CTAA 3DOJA 4ZYVA 3CLOA 2LWIA 4WGFA 1TQMA 2XMQA 4URVR 2EZUA 1JRLA 1YFJA 3WRVA 1FSGA 2OHHA 2WYHA 5LJLA 4BHBA 3NAUA 4GEGA 4BMPB 5C7YA 4A82A 5DM6F 1M34B 4BB5A 3LA3A 1FS5A 2FOKA 4G5OA 4PC3A 2XQGA 1D5VA 4K40A 1Z5OA 2Q2WA 4OB6A 2FK7A 2GBPA 3J7TA 1RQLA 3DE1X 3FSGA 3ITEA 4V2IA 1QZEA 2HA0A 4A3SA 4CEHB 1PWXA 2JMWA 1VKOA 2DQLA 3WIEA 2WHXA 2XCRB 1JF8A 3VO2A 4RGYA 3H5RA 3ROKA 4KCGA 4EVSA 1TF2A 3EX7C 3UJPA 3WLHA 1N9ZA 4YAKA 5IJ0B 2XVCA 3BMOB 3FUCA 3MRTA 2VZEA 3ZLJA 3ZJVA 4H59A 3DMYA 3KWMA 4XIJA 1BCSA 1Z4NA 3IAS2 1SVOA 4QM7A 4LVNA 3RS5A 4YK7A 2ADUA 1T33A 3LOCA 3FYDA 4JENA 3PKJA 5JXHA 4OQPA 1QPZA 3KHKA 3JWHA 3QVMA 4TRRA 3RYCB 3PPXA 2IHKA 3N8KA 1ZS9A 2JASA 2JBHA 4A8JB 1Y4DE 5TS3A 1G8KA 2ZNYA 1A36A 4MUBA 4AX8A 5EYPA 4D56A 4PFQA 4DCNA 4ZI5A 2VTBA 4JVMA 4AKHA 4QVIA 1AO0A 2DAOA 2R8ZA 1BJAA 5E7JA 5K0LA 4BFTA 2IPOA 4RGRA 1JQ5A 1NY5A 5DHUA 4D3FA 4E7LA 5H8WA 4RVNA 3ZQUA 1SB8A 2Q9CA 3K31A 3F1KA 4OBEA 3DLPX 4EG8A 3IVXA 3L01A 1RKQA 2UYCA 3WL4A 1F1BA 1P4HA 3WOVA 3UZUA 2RE8A 1MT3A 3ZHBA 1XQ9A 4G1BA 4CLHA 2I4IA 1CUCA 1UKYA 2YHUA 2Z8ZA 3R8XA 1VPVA 3I9V1 4RGUA 4EKIA 4P83A 2ZG6A 2ZITA 3OZBA 4S24A 4B83A 3QQPA 1NW9B 2IU0A 2M4GA 1TEHA 1AU7A 1H0RA 1TKAA 2PWAA 4HADA 1YI1A 2ISQA 4NOJA 4BNLA 2PZKA 5KX5F 3ZZ0A 4LK0F 4LJ6A 1OHHA 4TWJA 3IHTA 2QLTA 3TR5A 4FMDB 3IBGA 4KGZA 4EG4A 2R7DA 2X22A 1Z0JA 1T4DA 3N8DA 2CXOA 4Z6YA 3MBIA 2D1TA 4L8LA 3O95A 5D6FA 1G5HA 3GT4A 2JA2A 3EVFA 3VR5A 3ZNNA 5HTOA 5BYKA 1XA4A 2QW0X 2GBLC 2JI6A 1ZNQO 5CFLA 1RRKA 3PL1A 1WV1A 3CRQA 3UV3A 5KTKA 4FKBA 3UG7A 3QBDA 2C5EA 5FYQA 3JZAA 1L1RA 3A1NA 4E09A 2MMCA 3PCRB 4LG0A 1ZINA 1JHMA 4FX2A 2AZXA 5GVRA 1WVRA 3C5WP 3PRHA 1VQ8I 3OJWA 3EZ2A 1G17A 3QVWA 1JA1A 2VH1A 3IOCA 4OXQA 4P3XA 4OQZA 1P73A 5LA6F 1BKSB 3H86A 2HMUA 3E8MA 3E3OA 2P3QA 4I4CA 5ITSA 3P0JA 4ZA2A 5KYXB 3OM9A 4DBQA 1ZRNA 2ZGVA 5JBQA 5GMOA 2PNFA 1IBKB 4PC2A 3OPQA 2WB2A 5CPRB 3EEQA 3VJLA 1E7QA 2EKBA 1SIUA 1Q14A 2GZ1A 5EMHA 4JOMA 1N3IA 2JFZA 5JWRA 1R4MB 4P35A 1SKAA 4PG4A 1KPGA 3P2YA 1NURA 4Q7EA 2BUAA 4QAQA 4MR9A 3URKA 2GK3A 3DP7A 2MSNA 5IVKA 4MQMA 5BV0A 1HDYA 1MJNA 2WYIA 4AJIA 1K6JA 3IP9A 3GUZA 1Z6YA 3H05A 5D1HA 2Y1CA 2UZ4A 4DMKA 1XXLA 1NJ6A 4IRGA 3OLVA 3FNFA 5CK5A 2ZAOA 5BR1A 1JAIA 4KK3A 4TKUB 2C5GA 1M2HA 4C2TA 3HDQA 3ACCA 1PJ2A 1R0XA 4LCEA 3ZDQA 4LGMA 5CVVA 2UVPB 3L8MA 2C78A 4OA5A