3WGGA

Crystal structure of rsp in complex with alpha-nad+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Binding mode of the oxidized alpha-anomer of NAD(+) to RSP, a Rex-family repressor
pubmed doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 71
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wggA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wggA02
4L9TA 3OJEA 3BJ6A 4R01A 5B4VA 2UYYA 2QRKA 2PD3A 3L09A 1B1BA 1LLDA 4KP7A 2LDBA 2GA2A 4YJGA 1BM9A 4P55A 1ONNA 4PVDA 3E9MA 3DBRB 5ERIA 3AM5A 4NG5A 5DN9A 4B4WA 2FU4A 3FXUA 4I7HA 2P4QA 1XWFA 4Q3EA 4XB1A 3IKTA 5JS6A 2Q1SA 5BPIA 1LDDA 4H7PA 2AEFA 3JQDA 3CLOA 3KSDO 1STZA 4B4OA 2WTBA 3PQEA 1NFQA 3JQ9C 2Y1DA 3VDQA 4CMJA 1P92A 1G6KA 5I7VA 5KVRA 2CDAA 2A68F 4KDFA 1QYDA 5HDGA 3ZV4A 3GA0A 3ZWCA 1R0LA 5JCJD 4GKBA 4BNUA 1FP2A 3V7SA 3HRUA 1ZREA 3ENKA 5AXBA 5LDGA 5COAA 2MD5A 1BC7C 3LC2O 1XMAA 1F17A 4GWGA 5B4TA 1DHTA 5MGBA 1QBJA 1T2AA 1ZK1A 1R6DA 3WGIA 4ZGWA 2OZ6A 3CZMA 3JQ7A 4BNKA 2R6JA 2EFWA 2VHVA 2NU8A 5H83A 3GFMA 4PLTA 3I23A 4RDIA 1ADBA 2EV5A 2PNFA 4B4UA 1DBVO 4BO4A 4DPLA 1BGVA 3D7LA 5DCYA 1EVZA 1GFSA 2YY7A 4OXKA 1M6WA 1HDOA 5A03A 3K0LA 3F8BA 1XGKA 3GEMA 3LC7O 4N5NA 1ENYA 3WU0A 5IT3A 5IT9K 3ANLA 3PJGA 2RHCA 4M72A 1V3FA 3STHA 5L95A 4CQMA 5E8GA 4AIHA 3KOUA 1HSZA 2FN7A 3NRCA 2VWQA 3ZU2A 3GG9A 3OM9A 3PFWO 5ER9A 2W2KB 4IJAA 1H9AA 4M8SA 4E0BA 3JTGA 4DIBA 2YUTA 5CG1A 1PUEE 1UP7A 1IF1A 4FW8A 1A72A 5HS4A 2V9VA 1NP3A 4J3FA 5ICEA 1LRJA 3IP3A 4I9NA 3J81K 2J3KA 4R5HA 4RLHA 2PQ8A 1JWAB 3UXYA 5CJ9A 1PL6A 2IW5A 3PJDA 3TJRA 3OIDA 4PGHA 1YL7A 1BVUA 2DI3A 3BJOA 5DCMA 4FX4A 3PWSA 4OYRA 3F47A 4X54A 3V8JA 5F1RA 2J5RA 4RVDA 3U9LA 1GXPA 3GQVA 2ZJ1A 1B8UA 3FF4A 4U0JA 1BSVA 2Y66A 1U2WA 1RM5A 4FFPA 1OBFO 4I1IA 4RORA 1HXDA 4DMMA 4ZYGA 4RPGA 3LF1A 4KIGA 2FRDA 2WM3A 1PGNA 1FBSA 3ADPA 4MVJE 3I83A 2IRWA 5TRDA 2YHIA 4BKRA 4D45A 2EKLA 4DIOA 1PJBA 4NNJA 1F06A 4ZQFA 1HF3A 4KA4A 2BMAA 3PDUA 1KVRA 4O63O 1HKQA 1LRKA 1FDTA 1IZ1A 1C3VA 2Q8KA 1KYWA 1SD6A 2GLXA 5DBFA 4IRGA 3ZMTA 1AGNA 1G1AA 3GFGA 5JCJA 1NTOA 3O8QB 1TQMA 2XAAA 1HLPA 3C7CB 1HZZA 4KICA 2QBYA 4G94A 4L9NA 2J6IA 2HYGD 5TJJA 1WLYA 1DAPA 4CO8A 5G4KA 1HSOA 5T8KA 4II2A 3DTTA 4RCVA 1ZO8A 2E1CA 5L7WA 1KU7A 4HOBA 3QWBA 1XELA 2D5AA 3H9GA 1DIHA 3X2FA 2AXLA 1WDLA 4YPOA 4DC0A 4AJOA 4YXFA 3CUOA 3D0OA 1E7RA 3DL2A 3PJEA 1HLDA 3ZV5A 1IUYA 3UW3A 1K6IA 5LHHA 1HBXG 2HTSA 1UDAA 3GNSA 1HW1A 2JHFA 4ZYDA 4RVSA 1JWBB 1Q1HA 2ESHA 1MV8A 4QWQA 2ZNZA 2DTXA 3OICA 2FMLA 2PMUA 3RQSA 4DIFA 2ZMEA 3FR8A 3R6DA 2RGVA 2UVDA 3KVOA 1I27A 1RM0A 1P4AA 5DEQA 4OXYA 1PIWA 1DB3A 3AOGA 1B3RA 2WD7B 4ONEA 4BNMA 5L7YA 1JKIA 3Q11A 1C1DB 4BQPA 4LFUA 3T5XA 5L7TA 1HYGA 1KETA 3R61A 2DBBA 1BXGA 1LXCA 1N1GA 1UXGA 2GASA 1CYDA 2HMVA 5AOVA 3RU7A 2GXBA 2GNAA 1VJ0A 2P6SA 3GVHA 4QQRA 1XDSA 1EE9A 2KKOA 4IXTA 3KLNA 2TMDA 1EFLA 1Z6TA 1ULUA 2V6FA 3GZ5A 4XYMA 3AFNA 1ZH8A 1MJBA 3MWMA 2ZYGA 4KMUX 1B9MA 1SMTA 4WWCA 1E3WA 5E18F 1R37A 2JJYA 4O5VA 2JCXA 5AXCA 2M30A 2QVOA 3F6YA 3INGA 3LQFA 3OECA 1FF9A 4FPXA 4NFHA 3CDHA 3VZPA 4BO6A 4TQGA 2MC3A 3H5RA 4Y6SA 4QTZA 4AFNA 3M1EA 4RAYA 2AEMA 3SC4A 4EJUA 1S6LA 3JSPA 3M7GA 4HYEA 2GDZA 3PLRA 5F1PA 3ZP5A 1BN5A 1IOLA 4XCVA 3W1VA 1LQTA 3CINA 3SX2A 2B69A 4KQWA 3VH1A 1YG2A 4EYEA 2Q2WA 4DNCA 3HZZA 3OJFA 5JAZA 5JYDA 1UP4A 5LC1A 3JQFA 2WWRA 4MO2A 4YQZA 4IDFA 3CMCO 1NQ5A 2Y0MA 1M2WA 4PRLA 4E5PA 5G0SA 3PDJA 1YLFA 5DCFA 3JD3A 3TOBA 3LK7A 1NXQA 1Z7BA 3JQ8A 3ZWMA 4I9HA 4JJIA 3B02A 1H0KA 3V2GA 4HQEA 2IA0A 1WW8A 1KYQA 4RGXA 3Q9VA 2WYWA 3WLFA 1PR9A 3FNEA 1UHMA 3K1MA 1REPC 1J49A 1XU9A 2Y0CA 1R0SA 2GN4A 2K4BA 2IP2A 1UR5A 1YOVA 4GKVA 2G9WA 4IDAA 3R0JA 3RSHA 5IFLA 4Y9DA 1I30A 4A2UA 4UUMA 3F72A 1NAHA 2A9FA 2AE1A 3I5MA 1H5QA 4OOIA 1FK8A 3F4BA 4J9UE 1N9GB 2NWQA 2QRLA 2ZKLA 5A9SB 4PG8A 1TT7A 3BMCB 1NHWA 4IQGA 3NJ4A 5HS6A 3ZNNA 1ZLKA 3GWZA 5DV5A 3BOQA 2VC1A 1TB4A 2HJRA 5TRTA 1HDGO 1QO0D 1PS0A 3P7NA 3TZHA 4F7ZA 4HBLA 4M87A 4RF5A 4YVFA 1IN8A 1BW9B 2PKRA 2JPCA 3IOYA 3GEZA 2PN6A 1LB2A 4RF4A 3W8DA 1E3LA 4BNJA 5CVUA 4XYLA 1YW7A 3FM3A 3FXQA 3GPDG 3EZYA 4R54A 4BOYA 1DRWA 3L0DA 4DLBA 4M74A 1U6GA 1YB5A 1NQOA 2EV6A 2JAHA 3CZRA 3JQBC 3ONEA 1AWCA 3OQBA 1LDBA 2PZKA 3I3OA 4P4LA 3HHPA 3ZNQA 5HM8A 1UB9A 1TVEA 5I8ZA 4R1SA 1I2BA 2KRFA 5JFRA 3AY7A 3ZU5A 5C7LO 3TFOA 4ZYHA 5HLHA 2VN8A 4W7HA 3G3EA 1O7LA 1S7AA 5B12A 1PJQA 1DAOA 3HOTA 2RVCA 4RGRA 3CUQA 1ADCA 3O03A 5HA5A 3OIGA 3V8BA 2Z5LA 4B3JA 2BD0A 5AXDA 3D3EA 1CQJA 2E1NA 5H6QA 3ULKA 3HTUA 1T2KA 3ZN2A 3MTJA 1ZUD1 2RAFA 3PHGA 4XZ3A 3RWBA 1WMBA 1VL6A 3DBHB 3RFTA 3H3JA 3PQFA 3I9MA 1V9LA 2A61A 1G6NA 3AOEA 2HKXA 1IRGA 3SLGA 3MCVA 2IVMA 2XKOA 1Z6ZA 4GGPA 4QX6A 2RDPA 4KT5C 3MZHA 3KSZO 1I3NA 1MZBA 5ADHA 5COQA 4QSMA 5ENVA 1PL8A 2VXZA 2X0NA 1HEUA 3VTFA 3RBXA 4AJPA 3Q2KA 1O3TA 1OC2A 3GVCA 4OKIA 2JD0A 2OL4A 1B14A 3GUYA 3TN7A 4R8HA 2W24A 3MOGA 4BQRA 5L3FA 4TMFA 3VH3A 1OYWA 1PP8F 4CUJA 3UCFA 1BHSA 1HKSA 3AI1A 1KY4A 3EYWA 5AYVA 5A5EA 2UV8A 5JYEA 2YFQA 3JYNA 1SB8A 1LBEA 1GPDG 5BSHA 3LAJA 1M67A 1L3LA 3GZ6A 3Q3CA 3RROA 1M76A 2FSVA 4D46A 1XSVA 1DJNA 1KVQA 1MJ9A 2CFXA 3ONFA 4EJMA 4B3HA 2A6HF 1P1IA 1YDWA 4AVYA 2OZPA 1GYRA 4TSKA 1ZNQO 2F5EA 3IRRA 1WSUA 2BF7A 1IPFA 2D3TA 4WLNA 2XAJA 4FB5A 3BTSA 1OKRA 2Q1TA 1HW2A 3W6ZA 1D3YA 3KRTA 3C18A 3QP5A 4YFXF 1O9BA 1W4MA 4PCVA 1XB4A 2PD4A 2BEOA 1JAYA 4B4VA 2O3JA 1QZYA 1LC3A 4U6QA 1G3YA 3BROA 1YL5A 5I7FA 4HDVA 1IULA 1ISMA 3WTXC 3E3VA 5FLXK 2PZLA 2VHZA 1T26A 3KYCA 5FI3A 5CDTA 4IUYA 1PGOA 4HFNA 3WWZA 1ZK4A 4DYDA 3LZ6A 4JBHA 3L07A 4NHEA 5EPOA 1GUZA 3M8EA 2ILTA 2YX7A 3U2RA 2H27A 3DO5A 4YJFB 2MLKA 1FDWA 3CTAA 5JDIC 3FMQA 2BV6A 5ILVA 2ZB4A 5HOOA 1AHIA 3PFIA 1I1SA 5C37A 3F8MA 1R12A 3D5LA 1C1XA 3I9NA 3T7CA 1KS9A 3WWYA 1USSA 3E8XA 3BTOA 4FCCA 4GVLA 4UVDA 1WKMA 2QENA 2RNJA 4IXAA 2QQ9A 5JR3A 3NEUA 1FOKA 1IZ9A 5BNIA 1CGPA 2AS5F 1SOVA 2O7SA 3AI3A 1R4NB 1UDBA 3D4NA 2HGCA 1S3JA 5KCZA 5CFZA 4UUOA 1UFMA 2NNLD 4D42A 2IDZA 2FXAA 1T1RA 2HAEA 4D3DA 2ZK7A 4UUNA 2O3SA 3AK4A 1T2FA 3O26A 3QVTA 2X4HA 1LLUA 2VUTA 4UEOA 3V1YA 1Q0QA 4WCFA 4EM2A 3WMXA 4IDDA 4CODB 2ZTVA 2O48X 1LSSA 1SEVA 1PL7A 4FN4A 4QECA 1UZNA 1ISIA 4PLCA 5IXYA 2A35A 1G4DA 4ALIA 4DUPA 2R7FA 4G6QA 3WGZA 4FQ8A 4ALKA 2HDCA 1FXSA 1L7DA 1YJQA 5C7OO 1YDEA 3DONA 4J43A 1JHHA 5E1WA 1U3EM 3FTNA 5BNTA 2WE7A 2P4HX 3CH6A 1G3WA 1PZHA 4EJ6A 2K4JA 4BO8A 2HOEA 1ISHA 5KVCA 2BGKA 3DQPA 3U3XA 3E9QA 5DF1A 2PK3A 3DV8A 2EA2A 4PZCA 1PGPA 2P5VA 2LNBA 4R68A 1VJ1A 3ANMA 1SC6A 3ZN0A 1NM5A 5L3CA 4KN7X 4FJ1A 1FWZA 1EDOA 3CEAA 4I08A 3TZ6A 1U3UA 4GAEA 4J0FA 2ISYA 2A07F 5ICFA 1HDXA 1JXSA 1F14A 2BGLA 1ZW1A 3I52A 3H2ZA 3NKLA 3ONDA 4XYEA 5LDHA 2IXBA 2YFHA 4EGYA 3HN2A 3NDIA 5CEJA 1CJCA 2ZB3A 4OSOA 2QUFA 2X4GA 4K9DA 3DF8A 4URFA 1W4ZA 3I58A 1IPEA 3CKYA 2HDHA 4D44A 5A9TA 1FMCA 1I2ZA 1GL3A 3P7MA 5K6AA 2EFPA 1NWHA 1LDYA 4A0XA 4QO8A 5D6EA 4XGKA 1ZK2A 5TX7A 4E2WA 5JMWA 3QU6A 5EJ2A 4A6DA 3NT2A 4TKMA 1AOYA 2PGLA 2KIMA 3I1JA 1K78B 1F8GA 1ZXBA 4E5YA 4Z2YA 1FLIA 4BO7A 2Y0EA 3I9LA 4YJHA 1BI0A 1XHLA 3K30A 1ULSA 2NVWA 4G65A 1ID1A 4KMSA 1DIGA 2VYVA 3K69A 5F3RA 4CDGA 2M45A 4QXMA 3RFXA 2NLOA 1QKIA 3ETEA 5JAQA 5KWEA 1TA4A 2HMWA 3R3JA 2I9PA 2PG4A 3EGOA 2Q2VA 3WJ7A 3C8MA 1ZBQA 3QSGA 4EW6A 1JAXA 2JRTA 3I59A 3LA7A 1P74A 3FWZA 3H9JA 4DLAA 5CAEA 3VPHA 2QLZA 2H6EA 3HSFA 3DPTA 1VM6A 3DTYA 1IZ0A 3L4BA 3LLSA 3NX4A 4XQ9A 1XSDA 3OEYA 4LK0F 4TZTA 1T2CA 2VBZA 1Y0UA 4D3FA 1PZFA 5LHGA 3C3WA 1VI2A 2ZB7A 4AJ4A 2I66A 2HMUA 4EJVA 3T8RA 5A5FA 2W90A 1R00A 2FBHA 1E3EA 1KC3A 4IIVA 1H9GA 5C5IA 3D5TA 5D5XB 4GYIA 3ITDA 3K9QO 4JROA 2OOSA 3FSRA 4DMLA 3E6AA 3ZWXA 3ADOA 2TDXA 2FBIA 2LF8A 1V35A 2Z95A 2C5AA 1R5GA 3L7WA 2J5OA 2AG8A 2HLPA 4MINA 4W7IA 4CLOB 4WPGA 4CV2A 2AEJA 5DOZA 2HK7A 2YU3A 3OQ1A 4FS3A 2DAPA 1KVUA 7ADHA 1N1EA 2GO1A 3M6IA 4CMIB 3X2EA 4GSLA 5TGDA 4A0ZA 5I9LA 2Y48A 3WGQA 2X8LA 4LD5A 2XGXA 3E5QA 3EDPA 1E6UA 3TFQA 3K2ZA 2IPQX 4XRFA 2ZQYA 4CMHA 3UICA 4IGFA 4U7WA 2MLGA 3RTRA 1IN5A 1NNUA 5FD5A 1F8FA 4WEOA 3U49A 3VPFA 4YFNF 3I4FA 4GX2A 4J7XA 3RJ9A 1HKTA 4A7PA 4CLEA 4Q3NA 2F00A 2OP0A 4OH1A 4PLHA 1XGSA 3MJTA 1IN7A 2ISZA 4HV6A 1T25A 1NVMB 4BVAA 3Q6IA 1W5TA 5ICSA 2ZBKA 2EFOA 2A92A 1CEQA 1P1JA 3SLKA 2Y1OA 4BO1A 3DAPA 4L9RA 1ISJA 2X0RA 4HNGA 1PZGA 2EWNA 3D3WA 3H9EO 1Y5RA 3NT4A 4LK3A 3WGTA 4HX4A 1HWYA 4DRYA 4UVAA 1YO5C 1UAGA 3GZ4A 1Q7CA 1BIBA 2JCYA 3GN1A 1F9NA 5FFFA 4KYWA 2FSSA 4PLGA 3RC9A 3TPCA 1GXQA 3WJAA 3OP4A 2X5OA 3HRSA 2DTDA 3S1LA 1YS4A 3ZWWA 1MX3A 1PU2A 1UUFA 2CDCA 2RCYA 3M2TA 4FBGA 3ABUA 3E03A 5ENDA 2JFGA 2KIFA 3MEXA 4FC6A 5T57A 5K0ZA 3WGYA 1GU7A 4R51A 1ZLJA 3ZDFA 1JVBA 3IMFA 4F46A 3W4JA 2W2LA 3M9AA 2C7GA 1L7EA 2OZUA 2W25A 1CETA 1LC0A 3JD2A 2A5YB 4EITA 5B1YA 2O2YA 1GV0A 1ZH5A 2AE2A 4C4OA 1HZJA 4IGEA 2E4AA 3HTSB 2C29D 4WJZA 5FD6A 2BFPA 2X5KO 3PZBA 1K89A 2EV9A 1LDKB 2JD1A 4HLXA 1B59A 3OV8A 1K79A 4UNOA 2G5CA 2EHDA 1H6BA 1GPJA 1JW9B 1EQUA 2VE8A 4PG4A 4XGIA 1ZXLA 1ZRDA 2FY8A 3K6JA 3UUWA 3KEQA 1PR3A 4BS9A 3GF2A 3WE3A 1SEPA 1PJCA 4B8ZA 5TC4A 1QYCA 5C3MA 4KMFA 3VFZA 1LTHR 5I7EA 2IEDA 3NEPX 1OOEA 3VPSA 3GFLA 4PG6A 4YJGB 4Q47A 3S8MA 1XD7A 2VT3A 4XBFA 4UUVA 1Q0HA 5LCXA 4U0VA 3KXDA 1ZGAA 3T8TA 4RDHA 4TVBA 3HNPA 1K7AA 1E5QA 1ORRA 3ICCA 1ML3A 1R1TA 2EK5A 3KTDA 4RPJA 3PGJA 2EA4A 4R4JA 4YAIA 5FO5A 4MQVA 5EEGA 5ICMA 1Q2XA 1NQAO 4KWHA 4O0LA 3E5MA 4W99A 2H6CA 4Z6KA 4RO0A 3RI4A 1LEBA 3LQQA 5JDCA 2UDPA 5HDKA 1MC5A 5ILOA 2M8EA 1EUZA 1XQ1A 1SFEA 4R9SA 2D2IA 2PV7A 2DPGA 4BNVA 5EMHA 2C0CA 4L9VA 1EUCA 3DMYA 5JNLA 1CIVA 2NNYA 2EW2A 4RQUA 4RPHA 5LGTA 3JQ7B 4GX5A 3BA1A 3GXOA 1ONOA 1WXDA 1VC2A 1Y9EA 2DPHA 5A05A 3VEPA 4FFOA 3WSWA 4YT4A 4FIZA 4BNFA 4E5NA 3GMSA 3NAQA 3QIVA 4KTVE 4Z3DA 1BC8C 2VWGA 2L4MA 3ULQB 1QORA 3CTMA 2XUBA 3TDKA 3N7UA 4IQ0A 2ADUA 1FBQA 2ESNA 1YQAA 3I71A 4BHBA 3C7DB 4FOOA 4BB5A 3QRWA 3L6EA 4ILKA 4CQMB 4DTIA 3QP6A 2BLLA 5THQA 5CDGA 1MJAA 5JC1A 2G7UA 1X14A 3U4HA 4AJLA 4BGEA 6LDHA 2NS0A 3HE3A 4BV9A 4NJMB 1LNWA 5ICCA 1A9ZA 3N58A 4LMPA 2I5PO 3AY3A 4CLHA 1LJ8A 1MKMA 3GUDA 4J4TA 4CR7A 3KP3A 1P1RA 2Q4BA 3GF4A 1U4OA 1O5IA 3N74A 1IAWA 2W57A 1Y9AA 4CQLA 4MVJG 5L3GA 1EH7A 1DPGA 3BMNB 5HLIA 2B36A 3MWDB 4LN1A 4MQ9F 5U4QA 1DP7P 1SD4A 3RKYA 4MEYF 4OINF 1EQ2A 1YS7A 4OMZA 3DMTC 3WNQA 4KDEA 4HV4A 1BTOA 4EUFA 3HADA 5KJ1A 2V65A 2DBQA 4G81A 3R1IA 5CDSA 2P7VB 1B4AA 4BO9A 3QE3A 1DPRA 3GVAA 3NV9A 3Q2IA 3WIEA 2PZMA 3I54A 3RU9A 3JQGA 3K2EA 3F8FA 1WDKA 2DK5A 3BJAA 2DU8A 3ETGA 3AI2A 1R16A 3K8ZA 3L6DA 1RPNA 4JJGA 3LC1O 3H8VA 4NPCA 4OQZA 4BL5A 4A5NA 1N5DA 3G1TA 3QVWA 2CUKA 2NNNA 5LGNA 3NRVA 2QZZA 3VHRA 4ENNA 5L3EA 2FOKA 1U7TA 2DTEA 3GZNA 4IJKA 2GQQA 3TO7A 1AN9A 1U2DA 3KP2A 4FFNA 1DXYA 3PI7A 1OFGA 1P0FA 2E7XA 4UEKA 1TQPA 2NU9A 4EM0B 2QBYB 4YAEA 3OA0A 3MJ4A 4XIJA 4L0YB 1GD1O 4MP8A 1W7PA 2COMA 1GUFA 2ETHA 5G4KB 1U9JA 2AQ8A 2Y99A 3C24A 4MVJD 3JD0A 4DPKA 4XGNA 1DRUA 1KERA 4AD9A 2EF1A 3GYHX 1D1TA 4ESJA 4AJHA 4BNCA 1DOHA 4G7HF 3F8CA 3ZH2A 3QWAA 2BFMA 1LLCA 4AWXB 1LVAA 2OXIA 4E2YA 4RVGA 4ZQHA 3GRKA 3HDQA 1S6YA 1SNYA 1UHWA 1T2EA 3HIFA 4EEXA 4Q39A 1XYGA 4KIFA 3GFJA 2L02A 4L4RA 4OOFA 2PMHA 2VODA 3WYCA 5BR7A 3SVTA 2E82A 3F1KA 2UZKA 2CD9A 2J3HA 4CMGA 2BELA 5L40A 3NTOA 5AIQA 4I0AA 1JKFA 2XIGA 1ZG1A 2RC4A 1OMIA 2L01A 2ZMEB 3W6KB 2EG9A 3KE2A 3GY0A 4R1TA 5EN4A 1X7DA 2MA3A 4I01A 5L3ZA 2XASA 2X0JA 4M6XA 3LT1A 1O3SA 5T67A 1MDMA 2GWRA 4EJTA 2FP4A 4A0YA 3BP8A 2Z99A 2P9EA 3PTZA 4J49A 2YPRA 2B4RO 3R60A 2BE5F 3QU3A 1SFUA 1Y8QA 1E3SA 4E2XA 1RI7A 3JSOA 4I5FA 1U8XX 4NBTA 1UZMA 1D7OA 4K6CA 1E7YA 1E1MA 2GYYA 2PA3A 4DL9A 1NR7A 1UDCA 2PGDA 1P2FA 5CYVA 1BXGB 4O1MA 1SB9A 4MHGA 3M1AA 1Z91A 5JPIA 4BYYA 4A5OA 3AM4A 4BHCA 1EVJA 3JQ9A 1YIOA 2X6TA 3F6VA 2FPGA 1ZRFA 4K28A 3WSVA 1ZGJA 4OMYA 1NHGA 1ISGA 1BMDA 1E2XA 1E7SA 1R4MB 4Y98A 4EUEA 2GN6A 2Y0DA 4XDYA 3Q1LA 3DDNA 4Z0TA 5T8KC 4IJUA 3C7AA 2ZYAA 3GK3A 3S2EA 1WAMA 1E3WB 3DOCA 3VPXA 3OBBA 4A26A 1E6WA 4XQGA 4CM3A 3CO7C 5IT9Z 4K6FA 4E2ZA 1IN4A 4FX0A 1XQ6A 5EIOA 4EI2A 1W6UA 1PQUA 2QZ9A 3EMKA 4UEJA 2PGJA 4M55A 5D8KB 3EC7A 1K6JA 1T98A 5IZCC 3SZTA 4M9ZA 1H6DA 4WK8F 1YO6A 4LVCA 2VBXA 3ENNA 3IUPA 3WQSB 5ES3A 2QW8A 4L75A 4C7KA 4LB6B 1F5TA 3HG7A 1U5AA 4DLLA 1PP7U 3BDDA 5D8LB 4MVJA 3WGOA 3WXBA 4S1VA 4ND2A 3E48A 2W4QA 1KA8A 3KYDB 3KZVA 3S2FA 3ZNOA 1UZLA 3F22A 3H65A 3J81Z 1CF7A 1I33A 3NT5A 2PKQO 2JPBA 2RBEA 3OEWA 2VONA 1YBVA 2VYNA 1X3UA 1TQIA 3BHJA 3NTQA 5AVOA 2D1VA 1GADO 4I02A 4ESBA 2C2YA 4ESOA 4EEZA 3DBRA 2ET6A 3OIFA 2GZ3A 1U5TA 1YOVB 2ZCUA 3LSYA 2OU2A 2D8AA 2JSCA 4P38A 4XB2A 4RAZA 1R1VA 5D6FA 3P19A 3A28A 5G0UA 4U5QA 3ZI0A 5JE8A 3EUHA 4B7XA 3LT2A 5L4LA 3O38A 4E31A 4UV9A 1HDCA 3NGXA 3EYIA 3EYYA 4ID9A 4Q9NA 5D5VB 2P5LC 4ENKA 4NJOA 3IP1A 1MC4A 1IHXA 3JW4A 1YONA 3N97A 2Y68A 3FWNA 1FDUA 3T1BA 4DWVA 3IQDB 2IZ0A 3KBOA 3RUIA 3GT0A 3OQ6A 1QQIA 3LWFA 4XQEA 5A4DA 4L4SA 3BIOA 5JCXA 2O0YA 1X7HA 4UVIA 1HL3A 1WVGA 4OQYA 3DXFA 4L18B 1WI9A 2RH4A 4NK4A 4XIYA 2I6TA 1U1IA 3RYRA 3AU9A 4LISA 4JBAA 3V8KA 2NVUA 3JQFC 4WASA 3EHEA 4Z0PA 3I4PA 2CF6A 1DFIA 1QP8A 2CW0F 4DBVO 4AJEA 3SQNA 2Z1NA 3PHHA 1PZEA 3ICPA 4Y15A 1IXCA 3E6CC 4FFLA 4A0SA 4J1NA 4HV5A 1DC6A 2CF5A 2D5CA 4IHSA 3QV1A 3GLQA 4TRNA 2O03A 3CUQB 2YDXA 5I9NA 1VTNC 3PIIA 4P8RA 3ZHYA 2FR1A 3RD5A 2O6GE 1E1KA 4XDZA 2ZJ0A 2CGPA 3AWDA 4BNGA 3I9KA 3GHYA 3UFXA 1O8CA 3PHJA 3WGHA 3GFIA 2QG4A 1V6AA 4QFDA 4D79A 3KB6A 3RC2A 4RJTA 4W6ZA 2YJZA 3ROPA 1XU7A 5E17F 1I2CA 2XOXA 3E6DA 5DUKA 2HMSA 2B4QA 4MKRA 2IYOA 3WICA 1ONPA 1YQGA 1YS6A 2FPIA 5F5NA 3JAMK 3AAFA 2LSOA 2QX7A 1J5YA 2VNAA 4ZZDA 2P2SA 4D0SA 1QYWA 5A3VA 4I5EA 4ASNA 4IIUA 3ROUA 4Q3BA 1KEUA 1YQXA 2V6BA 4XLPF 3JV7A 3NDJA 3BXXA 3BMQA 4J7CA 1U4SA 4JP3A 4K1LA 4ZQBA 3ROQA 3AUAA 1XGMA 3FWEA 2VOJA 3VDRA 1ENPA 3LDHA 4XRGA 2H6BA 1MD0A 4J9VA 3QOPA 4YG2F 3HN7A 1UXJA 2EGHA 3NYWA 4EGFA 4J1SA 4KDPA 3B1FA 5EESA 4RVFA 3JTMA 1EVIA 1T1SA 3V2HA 4WNIA 4FSHA 4XQCA 2EWMA 3A4VA 3PPIA 1LSUA 5IDYA 5JY6A 1VSUA 1V3UA 2BGMA 1X15A 3WTBA 2O23A 2GUGA 2FHSA 1LQ1A 3FCOA 2Y93A 4E5MA 1BDBA 1VKNA 4XKJA 1O6ZA 4RGSA 3Q0EA 3SJ7A 1OR7A 5TIIA 4M9SA 1GY8A 1YFHA 2PBIA 1QPMA 1UP6A 3PIDA 5CPBA 1NVGA 4CM6A 5HBRA 1ZZEA 4RGBA 1GVJA 2Q0OA 3TKYA 1K6XA 1PTJA 2Y1CA 1S7CA 2XF8A 2OQGA 3JAMZ 1B15A 4RVUA 4UREA 3K9TA 1ODDA 2E7WA 4Q48A 3TO9A 3KLPX 3QY9A 4RB0A 1MFZA 1YBMA 2P5KA 4YT5A 2IT0A 3MJEA 4MKXA 2K86A 1GEEA 2F5CA 2FR8A 4Y6RA 2Y1EA 3I9JA 1XEAA 1A7AA 3AOEC 4J4HA 5MDHA 2CQKA 4GLOA 1FT9A 2DW4A 3KETA 3FNFA 2IJLA 3I0TA 4TVOA 2PZJA 4U7DA 1LX6A 5DP2A 4M54A 1P1HA 3ZGYA 3M1LA 7MDHA 2O3TA 3GX4X 1HSTA 1K5HA 2J5QA 3D0SA 3OMLA 4XD2A 4JBGA 4ZA2A 3UF0A 5CDYA 4CLRB 1B16A 1SD7A 4ALLA 4EZBA 2Z9OA 2HEOA 5KNLA 2XXBA 5A2QK 1ZARA 5CDUA 2Z5UA 3ABIA 4UV8A 3ERED 4PFJA 5L9AA 4HFJA 2X5JO 4BMNA 3TQNA 2I99A 3E6MA 1NWCA 1PSDA 3MJVA 4HP8A 2K02A 4WEQA 5GMOA 4GI2A 3WOHA 4CR6A 4GO1A 3WFIA 4E30A 2AQIA 4CM8B 5ILSA 1V8BA 3E97A 3EZLA 4PLPA 3A14A 1EUDA 4JK3A 2GN9A 2DU9A 4MVJM 9LDTA 4DGSA 4CLDA 2OBPA 5JLAA 4CMKA 5A3JA 3E82A 4NFYA 1B3BA 2RQPA 4GWKA 1PGJA 3FF5A 2Q50A 2FA5A 1QLHA 1VLLA 2CVOA 3E9NA 1P77A 2OBYA 1U3VA 1EBUA 4OJNA 1TXGA 3T4EA 1XSXA 3HDYA 4C7JA 2ZO4A 4YFKF 4LK1F 1TLHB 4MVJF 2MH2A 4MVJP 1TLTA 2DUUA 4CV0A 3K1PA 1UH5A 4ND5A 4R1UA 3ZCXA 4J2OA 1PWZA 1I01A 4BV8A 4WECA 4G6DA 2ELHA 1VSVA 4EGZA 3EAGA 5G0WA 3GH3A 4MVJI 2GERA 1ZJYA 4HF1A 5FI5A 3TZCA 1TTYA 1R58A 4LMYA 3K5PA 2B0LA 4L4XA 3TOAA 3WTCA 2PFBA 1Y81A 2GXGA 3PFFA 5DBIA 1GR0A 4XA8A 3AUTA 3RJ5A 2NYXA 4BUCA 2P9CA 5TF4A 3HOSA 5I9MA 1TNTA 4A10A 3KEOA 4CL8A 1XDUA 2VZ8A 2VQ3A 1PJLA 3L9FA 2YQ4A 4NU6A 1BXZA 5CVVA 2A3SA 1T39A 1DIAA 2HJSA 5HVQC 1R15A 5LEKA 2A4KA 5FFXA 1CERA 4IF4A 3ZNPA 2JZYA 2X22A 2EJVA 1T24A 3AUUA 3WBBA 2NQTA 4CHUA 1C0IA 4ZYEA 4OIOF 4Y13A 2J8ZA 5TS3A 1GCUA 1V3TA 3GR6A 1NBOA 4GPD1 3H92A 2JFHA 2ZATA 1KU9A 2P9GA 3GGOA 3KYBA 3H9UA 5L51A 2X7HA 2EKPA 4D3SA 4B09A 3GDFA 3HSRA 5FYDA 1WP4A 5A1TA 1QSGA 1P4XA 3DFGA 4Y67A 4IZHA 2VHWA 4ZVVA 3JSAA 3PLNA 2P5YA 4BNWA 1KEPA 4BNZA 4QLCU 1H0MA 3DR3A 4IPTA 4YJHB 3WB9A 2FSWA 2H09A 1HE5A 2HQRA 2J5KA 3E5XA 1V0JA 4WGGA 1RM3A 1I5ZA 3HHGA 3ABTA 2CVZA 1T2DA 2C07A 1PJ4A 1FJHA 3HUDA 4F6LA 1HDZA 1VJTA 3AUSA 3ZWOA 1YW8A 4AJIA 2UUOA 3F8NA 3ZMUA 5HDNA 4CV1A 5A9RA 2VYVD 2P6TA 4II3A 2O3FA 1E3JA 2C5EA 4BQAA 2X0IA 4M86A 4ENJA 3BPXA 4NK5A 5DCUA 3JQEA 2NU6A 1LSJA 3BWGA 1YTYA 4JQCA 2PLAA 4BGUA 3H3UA 3FRJA 4ALMA 1TEHA 2GZ1A 3QVXA 4YWJA 3JTHA 1ZSNA 5FLXZ 4XRRA 2B5WA 3LT4A 3EETA 1AUPA 4G8XA 4W4TA 4XJSA 1MG0A 2A94A 5T64A 1MP0A 1B2LA 3IKVA 5TT0A 1N92A 2FZWA 2W98A 4MJLA 1GZ4A 1D4FA 3W6UA 3RUFA 3WLEA 3MZ0A 4D43A 5DCWA 4RS8A 4DQUA 4DYVA 4IY1A 4OIMA 5F1KA 3LYLA 1Y8RA 3GEGA 2VT2A 1H6CA 2IYPA 3W8FA 2OP1A 1KQ0A 5DZSA 2DTRA 5ILUA 1NPYA 2G17A 5K6AC 4WLEA 5KKCA 5DNAA 4WXCA 3S2IA 1O57A 4AIKA 2H9IA 4RZIA 5JDIA 1G0NA 1IHYA 2G7HA 4YQYA 5H20A 3T0YA 4PZDA 4XLNF 3B1JA 1FYLA 1FP1D 2F5DA 3JQAA 4E32A 2HWVA 1GYQA 1RKXA 3GOHA 1UJMA 4R16A 4RV9A 2OUIA 1HXHA 1K3TA 3KHUA 4MPDA 4LLLA 1BJAA 5TNXA 3F21A 4MDHA 3NTRA 4WE3A 1KU2A 5J23A 4MKZA 2HKIA 3QA9A 1TT5A 5G0VA 1QV6A 4Q3AA 1VKOA 5IDWA 4H0EA 4CM9A 4NZ9A 2PI0A 4HZFA 2IODA 2EV0A 2M5WA 1ZEMA 2X1HA 3F5QA 2NU7A 1UCRA 4PIVA 4ZQGA 3SXPA 4ALNA 2DBZA 1SZJG 1TW3A 2H1SA 2B0JA 5TJ9A 4O3MA 4O6VA 3UH1A 3BZ6A 4KFCA 3GNQA 1Z9CA 4LSWA 4NIMA 4XX0A 3WQRA 3RJPA 4BAYA 2IA1A 2R00C 1PJTA 5A04A 4A2CA 4M49A 1H2HA 2O3UA 3FHLA 1RUOA 1MUUA 3A1NA 2IZ1A 4BKOA 5EL0A 2FRHA 3H2SA 1BDMA 4S05A 4BGVA 4BNNA 2W2LD 5HS7A 1IE3A 3G1UA 3INTA 4XYBA 1XR3A 4JQFA 2RH8A 1SPXA 3C3XA 4Z9YA 5FFZA 3DOOA 1QRRA 3R3SA 3ZWBA 2PD6A 5KKAA 4L0QA 1FYMA 4OIPF 4MNUA 3RUHA 1GQQA 3L9XA 4YJFA 1N7HA 4GX0A 1CF2O 1X0XA 4MEXF 1SAXA 4WOJA 5U1PA 3SFZA 1ULYA 2C6YA 1HYEA 4UHTA 3L00A 1EMDA 1HDRA 1LQUA 1RYDA 2HO5A 3AM3A 3DXJF 3K2BA 3EQLF 1VE9A 3DBLA 4A12A 3FHZA 4YIFA 1A27A 5GY7A 3U1DA 3RI3A 2FNPA 5D4RA 3C85A 1KY5A 4CMEC 3W8EA 2X9VA 1EDZA 2HKOA 4HX5A 3I9OA 2OGUA 3EVNA 4OXNA 3RKWA 2DQLA 2WDZA 2PKQP 1RIOH 4NMHA 5THKA 3GGPA 1Y7TA 4MVJH 4NH4A 1FNNA 2QRJA 4WF2A 3UN1A 3JYLA 2PH5A 3HFGA 5HTOA 6ADHA 2E49A 4ND4A 1MFPA 4I5GA 2POQX 4OGWA 5CG2A 3KCCA 4Y6PA 3MCZA 3QHAA 3M2PA 2XAFA 3TZQA 2LKPA 1BXKA 1VL8A 2VN2A 3F4LA 3IC7A 3QWHA 4PZEA 2Q46A 5TSDA 4ETSA 1LUAA 2OORA 2FR0A 2WYVA 2ZQZA 3H7AA 3A9WA 4ALJA 4DREA 5TLSA 3FMRA 2G0TA 1FC3A 1U3TA 4XJTA 1DDNA 1BI3A 1N2SA 4IS3A 4IVNA 1ZEJA 2WE8A 4J90A 4ZRMA 3FPLA 3GRPA 3H5NA 4CUKA 2MH9A 5CVJA 4B8XA 1C14A 2CG4A 1XA0A 3ZN1A 2VTEA 3FPCA 3QW2A 2WMDA 4RL6A 4XWYA 5A02A 4F45A 2EP7A 2HUNA 3DOJA 3KZZA 3BY6A 2NTNA 2OFPA 4ESFA 4U6SA 1A7KA 3UVEA 1OAAA 1RNLA 4PG7A 2R3SA 5F21A 1D8JA 2O4CA 5DD8A 5DDIP 4BKQA 4BKPA 1X13A 1A9YA 3PWKA 5HRUA 3WTZA 3V5NA 4YA6A 4P96A 1TBXA 1E7MA 4CQLB 3WX0A 2ZKZA 1DLIA 1WWKA 2B83A 2CZCA 2UAGA 1QYVA 3DZHA 3JQ6A 3LT0A 3NDRA 4U0YA 1B8VA 4UVHA 3UKOA 1HYHA 5ITWA 3WMWA 4I09A 3ZMZA 1E7QA 5F5LA 3G79A 3WGGA 2YDYA 1IYZA 4GVXA 3RUCA 2FNAA 1GEGA 2BHLA 4TKLA 2D2WA 2GZWA 2VHYA 4LMRA 4HADA 5GZ6A 3P9KA 1UXHA 2RIRA 4ITUA 3RKXA 5HWSA 3HUGA 4J6FA 4QO7A 3KP4A 4UVBA 3I4CA 2W84A 4A5MA 1G0OA 2W85A 1M75A 2YV2A 3DWFA 4CMEA 4Q4ZF 4F3YA 4JIGA 4L8VA 1K78A 1SD5A 4LGWA 2O50A 4IDGA 3ZPLA 4KNYA 2EGGA 4ZQEA 4FGSA 4Q3DA 4WUVA 2FF4A 5J8FA 4M71A 3PQJA 5BQTA 3PQKA 3GZNB 3O6BB 3W4IA 2GAUA 1DLJA 2OA4A 2R7DA 2JFFA 5J6XA 1YYVA 2EKQA 4YR9A 4Z9FA 2JKVA 3DFUA 5JMPA 4D0RA 2FBKA 3PGXA 2J5PA 3QJ5A 4KZPA 2CSOA 3ZU4A 4RB2C 2EJRA 4OAQA 3B70A 1W7PB 3GEDA 4CM1A 1IL0A 2RHRA 2WD8A 3HHHA 5ER6A 1XCBA 4CMBA 1MGTA 3ASVA 1BOAA 2Q99A 4PVCA 4WLVA 1AXGA 1W7PD 4ZZLA 4HF0A 3D4PA 3NQOA 1LU9A 3ZMVA 2P68A 3BZUA 2NAZA 1CWUA 3A06A 2DBRA 2X0LA 1J59A 1YKFA 4G5HA 4GSKA 4KN4X 1WWXA 4JCOA 3U09A 3FMSA 4CLOA 3K73O 1P3DA 3DHNA 3WIDA 3DP7A 1FDVA 4IMPA 4IZIA 2HK8A 4LW8A 4WXDA 1FZPB 2FOIA 2WSBA 2KIUA 2DK8A 1YJ8A 2I3AA 4UVEA 1HE3A 3Q9UA 3RASA 3J80K 3W6JB 4N5LA 4CGZA 3R4KA 4GGOA 4XR9A 5DOVA 5JBIA 3DQVC 1T6SA 5L53A 2JTVA 2NM0A 4W82A 4EUHA 3I6QA 1MA0A 4F6CA 3R0IA 3PP8A 4OU0A 3DEYX 1MDMB 4YJDA 2JCVA 2PH3A 2VWPA 4YCAA 4OMUA 2CVQA 4FJ2A 1O94A 5F6FA 3KO8A 2VBWA 2VOOA 1C0LA 1NHAA 1KQ8A 3LVFO 3V1TC 5C7IO 5IXSA 2GPTA 4CMAA 2CNBA 2I67A 3PWZA 4P9FA 1DEHA 3IWFA 1J9IA 1A5ZA 4JK1X 2CFCA 4D41A 1CRWG 2IZZA 5JI6A 4LGVA 1V4RA 3VH4A 4A27A 1X7GA 5DUIA 1KC1A 3GVXA 5DCMB 1P44A 4E6PA 3K1NA 3PHIA 4RZHA 2C7VA 3TL2A 3DKWA 5ED4A 1XSEA 3VODA 3QLJA 4WK6A 3RUEA 1BBYA 3QAHA 4BHPA 4DA9A 3IAHA 2Q1UA 2QQAA 1HRDA 2E6UX 1RJWA 3CO6C 1B6AA 1RUNA 3WYEA 5I8WA 4LCEA 4JXKA 3I6IA 3QPHA 1EFKA 3K92A 3J80Z 2DPUA 1KVTA 3D64A 2YHIB 3U9GA 4WLOA 5ICGA 3D5QA 4CM5A 1FPQA 1JN0A 4EJWA 4DXHA 3R0AA 3ECHA 4WNCA 2VWHA 2O7QA 1B7GO 3PYXA 4H16A 4JJFA 5AXAA 2QZ8A 4E5KA 2ZJ2A 4A03A 1J2XA 2JAPA 4E4YA 1ZVMA 1LJ9A 3V7CA 4AJKA 2NSDA 1F0YA 4OSPA 2EIHA 2HFHA 3KZYA 4AJNA 4R5MA 3DFZA 3WODF 1AHHA 1CQIA 2ZNYA 2EW8A 3CXRA 1RM4A 1Q1NA 3DC2A 3ZWNA 1F4KA 1ZHFA 1CF7B 2XAQA 1I6XA 3BHIA 3OJ0A 2R2GA 4IINA 1KVSA 2VRCA 2F2EA 3EVTA 4M89A 5E1XA 1HT0A 1LNQA 2YSRA 3FX3A 3TL3A 2XAGA 4FD3A 5JAIA 1IXRC 3ROKA 1USTA 4HFMA 5K5QA 2H94A 2K7LA 1U5TB 2VYND 3IJPA 8LDHA 1BI1A 2SCUA 2ZTMA 1OYIA 2OBNA 1GZ3A 1Z73A 3H3FA 3LA3A 3EDMA 3VZRA 4HFRA 4AJ2A 5KJCA 3GLXA 2B35A 1IRFA 2FMUA 2A69F 3DMTA 4N5MA 3BPVA 2Z33A 4B8WA 1JA9A 3U0BA 3TNLA 1P33A 3NGLA 4J7UA 1NFRA 2TMGA 3R6SA 3VOEA 2WEKA 1I8TA 1B0AA 1WZEA 1XMKA 3JD1A 2DFDA 1R23A 3Q5FA 4OOEA 4CUZA 4W9NA 1DIRA 4J91A 4K26A 1IW7F 1YBAA 3GVPA 3JD4A 3ZHBA 1SAYA 3CJNA 2AMFA 1R22A 4LLGF 3T7EA 5KOIA 4BNXA 4PRKA 5U9CA 4E12A 3F5SA 3C1TA 2L54A 4G9YA 3RVDA 4BIIA 2Q2EA 4QUKA 1ON1A 3OETA 2WTEA 2VC0A 2MBFA 5L4SA 3G17A 4IXWA 2NUAA 2I3GA 4GMFA 1OMOA 5K5OA 3S2GA 4E3ZA 3AY6A 1SBYA 2GIVA 1FSEA 2NQ8A 4S3MA 1XKQA 3ZMSA 5KVVA 4PGGA 4LG0A 4M73A 1QYXA 1GTMA 5EERA 2NVUB 4DPMA 2BYVE 3VH2A 3ROMA 1PJ2A 4ND3A 3FZVA 1HE2A 4WCGA 4GCVA 1O3QA 3SC6A 1YRLA 1ZSVA 4HA8A 1A4UA 2GA1A 2ZIZA 1E3IA 1LRLA 3GFBA 4I8XA 3IDSA 4NJMA 2NTVA 4BKUA 1HW5A 1P4WA 2EP5A 4LVUA 1L1FA 4BO0A 4ON0A 1DPUA 4YBZA 3P9IA 4YAGA 3DEUA 4YAJA 2WJPA 2HQ1A 4ZH4F 1U5TC 2EJWA 2ZCVA 3BMNA 3SXYA 2QYTA 3MFKA 1DJQA 3PRJA 3O4RA 3MAJA 3I64A 3C7JA 3QQPA 3KLMX 2VNSA 4HNHA 5JC8A 2EEZA 3DZGA 2G82A 1BI2A 1U8FO 2B37A 2CSUA 4JLWA 3E18A 3MEQA 2BKAA 3JYPA 3ZW8A 5KJFA 4NBVA 3H6KA 1OPCA 2X23A 2IE0A 1C0PA 3BMQB 4IMRA 2UXXA 1DRVA 5HLGA 2NTJA 2YQ5A 3F3SA 3B6ZA 3GUCA 3JQ8B 1BIAA 2DO7A 3QVOA 1NAIA 3BMOA 1SO8A 2E37A 3H9QA 2ZXJA 4CM4A 5JY1A 1OI7A 5KJEA 2ZTUA 4NBRA 4L5IA 4TZKA 3WTYC 1SMYF 2AXQA 4RPLA 4YEDA 5JSFA 4EVIA 1IB6A 5LBQA 1ZRCA 2VE9A 2F5FA 5DDGA 4HQMA 2V6MA 3PYLA 5TJHA 1IN6A 3PEFA 4G7ZF 4XSZF 1ISFA 2D4AA 3HSEA 3CMMA 2IRFG 1KEWA 4TROA 3IRQA 4RLSA 3ECOA 4BO5A 5LRRA 5FEUA 4WX9A 1SCUA 1VRWA 4R3WA 1J4AA 4CXFA 3WFJA 3CSDA 2QIOA 4HW0A 2M1BA 3RIHA 1CDOA 1FX7A 4YTEA 2BBYA 3IIEA 1EV7A 1GHCA 1D8AA 5E1ZB 4E13A 1TNSA 1I1GA 4WCDA 3V2UA 4EJOA 5A06A 3ZQ7A 4ZRNA 1SOWA 2D1YA 2L3DA 2KJCA 1NVTA 3DZFA 1H2BA 5IZCA 3O3KA 2HU2A 4E21A 2EXXA 2D1HA 5K5RA 4BNIA 2GR9A 1B9NA 4BH9A 1H93A 4LB5A 4PGFA 3FM5A 1J75A 2W8ZA 2XRNA 5D5UB 1KU3A 2FMYA 3CPSA 4NQZA 2Y75A 4IRHA 3D1LA 4EMSA 5T5QA 3ST7A 5H82A 1D5VA 1ZKMA 4LRSB 4AL4A 3RIRA 1IUKA 1I32A 1D8KA 1H9TA 1J0XO 3QPTA 4IDEA 3REOA 4IRIA 4HXYA 4P9UA 2W2KA 3WR5A 2VTDA 3EK2A 2XXJA 2VBYA 4CPDA 2DAOA 3GC6A 3LA2A 2OD5A 3ZW9A 1Z82A 3C1DA 1UXIA 3E1KA 1PEDA 3QVSA 1DUXC 3ZV3A 3QWIA 3F1LA 3Q9SA 5LHIA 4KIBA 1T4BA 3RKRA 2PJPA 3TDUC 1AXEA 3PXXA 3P2YA 4UVCA 3P5SA 4HY3A 1O95A 1QZZA 1XGOA 4RGUA 1Y5MA 3VZSA 5EEHA 5L3DA 1A71A 1R4MA 4HKTA 3RFVA 1EH6A 5LRSA 3MQ0A 1W8DA 1T0FA 4QEDA 4EDFA 1X1EA 4RVHA 2F1KA 4B79A 3WYBA 6PAXA 3EW7A 4BNYA 4LJZF 4NFSA 1DDOA 2DC1A 1KOLA 3WTVC 2C20A 4UXNA 1R36A 2HYFA 2EFNA 4A6EA 5AONA 2PFGA 2VUUA 1WDMA 1XCVA 3LAPA 1JTVA 2X9NA 1WRJA 3KV3O 1J7KA 1ZG5A 1ZMOA 4YRBA 3GG2A 3MJCA 2EFQA 3P9CA 2DT5A 3HYIA 5BT9A 3WQQA 4DVJA 4RB3C 4OIRF 3CUKA 3O2PE 4GQAA 2QQBA 5F64A 2VOEA 2J3JA 4JX8A 2CMDA 3DZBA 1LDNA 3O8QA 4NBUA 4XEHA 3TOXA 5AIPA 4HDUA 4G7OF 1KBZA 1Y6JA 1ZJZA 2GCGA 3KYDA 3ZWYA 1S29A 2KJBA 2PTGA 1TI7A 4BNLA 4BXUA 3PYMA 2P4WA 1E17A 1ZAOA 2E48A 1R1UA 5BMZA 5E8IA 2D0IA 1MXHA 3CUQC 2YZ7A 5JO9A 1OYYA 3RPUA 4R1HA 4CICA 4ZHSA 2IA2A 4FT8A 3KYCB 3G3ZA 3FI9A 4HX8A 4FHTA 1XN7A 5FB2A 3WU1B 4H3VA 5TT1A 4GGGA 2CY0A 2GGSA 2K27A 3E6BA 2X58A 3HWRA 3LF2A 2DPDA 2Y1GA 3PVZA 2BI8A 2YYYA 4KUMA 3TZKA 4CJXA 3KP5A 3GMDA 4FDAA 3WE2A 1UAYA 1BRMA 4U88A 1Z75A 1PJ3A 3H3ZA 3LQRA 1W73A 3MTGA 5IG2A 1WPQA 4FGWA 1C1XB 1GZ6A 2O61A 1LSOA 4PN3A 4IM7A 1E6EA 3OHSX 4YT8A 3VAZA 5JVTA 2RKHA 4Q5SF 1KYZA 2XV4S 5LEJA 1Z6RA 1R0KA 5B4UA 5DD4A 5KVSA 1J6UA 1PJSA 1MG5A 2WD7A 3GGGA 1ARZA 1Q7GA 3IC5A 3G73A 3FXRA 1Z7UA 1E1NA 2JHGA 5I7SA 4L73A 2UXNA 3I5UA 1C1DA 2YV3A 4XR4A 1ADGA 3HDHA 9LDBA 2AHRA 2PY6A 1HQCA 1KQ9A 3VKUA 1XG5A 3F6OA 1J5PA 3OFSA 4Z3KA 1EK6A 1NR1A 5JO0A 5FF9A 4WCFB 3U4CA 4PZJA 2H5LA 2HS5A 3GW2A 2YR2A 1KIFA 4QFCA 4N9IA 2DFIA 1Z7EA 3ZWPA 5KK1A 2VCYA 1P45A 4MIEA 4GLLA 5CHEA 3BTVA 5E20A 4PLVA 3O9ZA 1YXMA 4WOKA 1I3KA 1SFXA 3JYQA 3ETDA 1GDHA 5KIAA 3PK0A 3ANNA 1Y8RB 1GQYA 3TGNA 4KTTE 4XYGA 1Z45A 1LA2A 3RBVA 4B7UA 3LSTA 3RYPA 3DZIA 3KFWX 1P9LA 3OSUA 3VZQA 3FTPA 1NYTA 5CPFA 4GBJA 3ORFA 5A2QZ 2JD2A 5CLSA 1G3SA 3JQBA 3NUGA 3DB2A 1QV7A 1Z1DA 5BSEA 1X1TA 3JQAB 3WBFA 2BRUA 1A4IA 2X86A 2O2SA 2XVCA 4N54A 1QGPA 4N9HA 2OAZA 4PLWA 1RZ4A 4ENMA 4E70A 1LDEA 1E92A 2HTJA 2PR2A 3JQAD 4ROSA 2WV0A 1IY8A 1K2WA 5CVIA 1E5LA 1TT5B 2Q3EA 4OIQF 4N18A 3GO5A 4UULA 4B7CA 2Z1MA 5IZ4A 3TF5A 3PZRA 4MIOA 4HX7A 2WWYA 3SHFA 3IS3A 3OJOA 1BG6A 5EINA 2YX4A 2CWEA 2DKNA 4IQ8A 4N0BA 3FNHA 3VC7A 1ZN2A 1YL6A 2ZFWA 1M66A 3UAGA 1DSSG 4FFRA 4CM9D 5K9ZA 5BS6A 5B37A 4WCFC 1N9GA 2FWMX 5A9SA 3RDIA 2AA3A 3AW9A 3BAZA 3BMCA 4I5DA 3TO6A 4YACA 2Q2QA 2BFAA 4LRTB 2RV8A 3GN2A 1E7WA 2LDXA 1F12A 1JU9A 1P1FA 4IHTA 1Z74A 3GAZA 4TRJA 5CVRA 1GQ2A 1U78A 3HB4X 2JT1A 1J0RA 1LLQA 3SJUA 3INRA 3BTUA 4GL4A 4DC1A 1BW9A 3QWFA 1NPDA 3GAFA 2L4AA 3I59B 1R5HA 4P5OA 4HLYA 1YE3A 3TSCA 1YB1A 1YVEI 4GMGA 4J2HA 5FWNA 1GAEO 3E5UA 1JKJA 1QLJA 1I24A 4R69A 1ZSYA 1EK5A 1PX0A 3P2OA 2M87A 4NHJA 2XKPA 4YYZA 5KVQA 3L4SO 5EQDA 3ZWAA 3GVIA 1Z05A 2PLYA 1ZCJA 1ENZA 4PCQA 1DC4A 8ADHA 2DM6A 3ZU3A 2CO5A 3Q9NA 4WLFA 1K0UA 3DBLB 3SZPA 4EM1A 2D45A 1B26A 1I3LA 4L74A 4PLZA 4D0PA 3KSUA 5BPDA 1MB4A 4FFMA 4P22A 1ENOA 4CLRA 5L4NA 3WTTC 3FD8A 3RAJA 3ZHXA 1ZG3A 5IJZA 3V8LA 3RCBA 3DAGA 3JCZA 2XPCA 2DVMA 3DBVO 1M6HA 2O3RA 3C1OA 4HBGA 2Q45A 5G4LA 4Q3CA 4CL3A 4MP6A 4CM8A 2DLDA 1O89A 2Q1WA 3FNGA 4RF3A 4OM8A 4YRAA 2IEBA 4KUHA 1IXSB 3DBHA 2Y67A 1JE8A 2DQRA 2Y1FA 1XGNA 4MGRA 1HTBA 5CEFA 4CZZA 4PDKA 3HJAA 3PQDA 3L6OO 3F23A 1D3AA 4PG5A 4Z9XA 2BI7A 3RUAA 1MGOA 3WS7A 2I76A 3T4XA 4AG3A 2G76A 1LEAA 4IJWA 1DIBA 3GPIA 4I98B 3ISPA 5FGMA 1K6OA 4L0ZB 3OH8A 2A6EF 4NDNE 4DQVA 1Q7BA 4ZJUA 4LLNA 1QMGA 4I0BA 4RF2A 2V1DA 3IHUA 2NADA 3MZYA 3ELKA 2QWWA 4DQ2A 4OL9A 5BQFA 2ZTLA 3B1KA 1HETA 3D3WB 1FY7A 1T4DA 4EJ0A 1A04A 1MXFA 3HQ4O 2XHKA 4UVGA 4L76A 1U5CA 3S2WA 5BSFA 1GV1A 4CYDA 2O8XA 2G1UA 2QQ5A 4FJ0A 1YW9A 3UOGA 1E1LA 1YB4A 1YH3A 3H4VA 3L4BC 5L45A 4NB5A 1JHFA 3BYZA 4OHUA 4FR5A 2FEZA 3HRTA 3OJLA 5JHUA 4TRRA 4YAKA 3BHMA 1FYKA 1T38A 1VL0A 1ZMTA 4MP3A 4ZICA 1ZFNA 2PEXA 1NASA 2HSDA 3K96A 1DO8A 2V7PA 3GNTA 3KUXA 4KUGA 4OO3A 3ZZNA 2GZ2A 5BOXA 2AG5A 3HFSA 1N7GA 2JL1A 3HSKA 1LDJA 1DC5A 3S55A 1XIVA 3D4OA 1EVYA 2EERA 3ON5A 3RKUA 2DBVO 5ITVA 3DZKA 2YV1A 4YRDA 1YGYA 1H94A 2CDBA 2C59A 2X9GA 5GZ3A 2P91A 2XROA 3HB5X 1PWXA 4GXOA 1PDNC 1U2GA 2VRBA 5HS8A 5BSGA 3WDSA 3TQHA 1X0VA 1OC4A 3OOPA 1NFFA 3GDGA 3RC7A 4KQXA 4M6YA 4PLYA 2QHXA 3IWZA 4H15A 4R41A 3ZMDA 2Q49A 2IXAA 4HWKA 4R9RA 1H6AA 3EUWA 2DUWA 4BGIA 2HZTA 4EBFA 2QM3A 1GCOA 3KP7A 1KEVA 2C2XA 4YDRA 3OF2A 4BMSA 4UAGA 1WNTA 4EV0A 1EE2A 1RYEA 1ADFA 2CYYA 2FZEA 5DBGA 2QYSA 1V3VA 3U62A 5LGUA 2V6GA 2NACA 1R4NA 1ZYRF 5DT9A 4OKNA 2AQHA 3LLVA 4P4NA 3KM0A 4MIYA 2FPPA 1JQBA 4RB1A 4TWRA 3U5TA 1W5SA 3IL2A 2DFVA 3NJ8A 2RN7A 4U0KA 2V1UA 3HDJA 2V79A 5L3BA 1DHRA 1EBFA 2AW5A 4ZD6A 3TDZC 1I0ZA 1DC3A 4AJJA 4MOWA 1F1ZA 1B8PA 2R00A 4KUEA 3JQCA 3FBGA 1W0CA 2DLLA 1DFGA 1LDMA 1Q0LA 1WMAA 1E0DA 3WNVA 3WG9A 3IJRA 4WLUA 4CMCA 3B73A 4E33A 2BGCA 4O59O 2Y05A 4J1QA 1S7OA 2YHUA 3MOIA 1BWSA 1XLTA 3ML6A 3V7RA 3LFKA 1C0WA 4ND1A 2ZCWA 4Y8VA 3RC1A 1DFHA 2ZYDA 1FBUA 1D1SA 3J7AO 4HF2A 4M9XA 1JVSA 2PWZA 3B20A 3ZV6A 4AVPA 2J3IA 3K31A 4J16A 1LDGA 5G0TA 3VB2A 4L9JA 4XSXF 4NR0A 2P8TA 5LLQA 2VUSA 3N4MA 3SBOA 2LDUA 5IDXA 1FDSA 3I53A 1O0SA 3AFMA 5DYMA 3HRMA 4D7AA 2NVBA 1JLLA 4ZU3A 3U4DA 3VKVA 4U7BA 3FR7A 1O7FA 1ZK0A 2HCTA 2FQ3A 3MWEB 3VVBA 4JNKA 2UUPA 2HR3A 2H63A 3V1UA 1U3WA 3VPGA 3DHYA 4O5OA 5G2OA 2NV6A 3L2CA 1SMKA 5COBA 4Z0HO 1AE1A 1E77A 2OMEA 4WXHA 2P5UA 4J0EA 5IAAA 3W4KA 3CIFA 1P1KA 1BVRA 1G3TA 4KOAA 4BB6A 4HUJA 5IDQA 4JGBA 5K1YA 2BFOA 3QRFF 2OO5A 3MJSA 1NPTO 3U4IA 5JDCC 3ZWVA 2HRBA 3QP9A 4CLXA 5CP8A 2VZ0A 3JQGB 4IPAA 2GN8A 5D5WB 1ON2A 1P0CA 3TWOA 3UCXA 5JW6A 2P7CB 3C1AA 5GZ1A 3RPQA 1ZK3A 3F3XA 4O6JA 1LI4A 3TOZA 3EY4A 1UXKA 2QYOA 1HDYA 3F46A 4U8GA 4YIIA 5TQVA 3L77A 4JP2A 4BHTA 3VVCA 1PS9A 1QR6A 3G49A 2O3QA 4LCJA 4NQWA 4I2OA 4LSMA 1GYPA 4R1NA 1I5RA 2XAHA 3DAFA 1JGSA 3M8FA 3IUSA 4L5JA 1MLDA 1WZIA 3PHLA 3VTZA 2VOPA 2UWMA 4INAA 3RUDA 2WYUA 4GYGA 2V1XA 3V4GA 1C0KA 2GF2A 4EQQA 1KGSA 1O3RA 2EB7A 1YWGO 5KJ6A 4UUPA 4CV3A 2VRCD 4Y17A 2YW9A 3JYOA 1R66A 2C82A 1U28A 4AICA 4K2EA 3G0OA 4AJ1A 2NRAC 1WQ2A 1EEHA 1PQWA 2OHXA 1HKUA 2GD1O 1U7HA 1R7JA 4U0WA 3FN4A 5CEEA 4BNHA 2GSDA 4I9UA 2Q4EA 3COSA 4BNTA 4DBZA 4TRMA 2BH9A 5ILGA 4CMIA 2D59A 2HMTA 3WTUC 4AIJA 2ZB8A 4IS2A 2HRZA 4A73A 3WTSC 5IF3A 3WTWC 3DPLC 1P31A 1YQDA 1LEHA 2OQRA 4J4BA 5JXWA 3COAC 1RWBA 3UCEA 2C54A 1L0OC 3KLOA 1PS8A 2AQKA 4DQXA 4R79A 1Y8QB 3OA2A 5T6BA 1TW2A 4YT2A 2HQNA 1QG6A 1PGQA 3UGKA 2V6CA 2STTA 2B5VA 4KWIA 3ITKA 3LU1A 2GRAA 5IN5A 2FE3A 1GUYA 1OZAA 4IJVA 4ZN6A 4LG0B 4QT0A 4CR8A 3TRIA 2WC2A 4R3NA 5HS9A 3DZJA 3F9IA 4M1QA 4FC7A 1I36A 4PLFA 5DULA 1QNTA 3ZHZA 4GX1A 4CM7A 4B3IA 5D4SA 2STWA 4JBIA 4GH5A 3E5RA 2Z3YA 3PJFA 4NBWA 1P6RA 4CQMD 3GDOA 4RPKA 3FBTA 2I65A 4WKGA 3AU8A 2VZ9A 5IN4A 4P4GA 2LF7A 4IDBA 4J1TA 4N7RA 4NI5A 4TV7A 4S04A 1EZ4A 3SEFA 4BO3A 1EH8A 3KP6A 5EQFA 1I3MA 2HK9A 4MTDA 5J8CA 2VHXA 5BNFA 4IBOA 4HAMA 3H5AA 1ONVA 1VPDA 3ASUA 3DHEA 1S8NA 3GHHA 4BO2A 1H9BA 4FOSA 3AJRA 4RQTA 5F1OA 1NX6A 4YB8A 4MTEA 5H6RA 4IDCA 1U8RA 4G2NA 1XDWA 3CE6A 4JN6B 2O4UX 1N8KA 5DP1A 1FSHA 3VOSA 3RBZA 1PQPA 2DQ4A 1HE4A 4BMVA 5JFOA 1HSJA 2ACJA 1ZIDA 4W9NC 5JAMA 1JDJA 5KTKA 4NU5A 1QXSA 2B4TO 1Y1PA 5H81A 5AQ1A 3L9WA 1I10A 4CM4B 3BMOB 3UHAA 1NQTA
chains in the Genus database with same CATH superfamily
4EGQA 5EJ6A 2PD3A 5DX1A 5DN9A 2VP9A 1N2XA 3OT1B 1CY1A 4XORA 1YHZA 1QCCA 2P4EA 3BWEA 3TTXA 1GU0A 3QELB 3MVPA 2GM3A 3LC2O 4GWGA 1DHTA 2YVKA 3PSHA 4E51A 3EW9A 1BGVA 1M6WA 4N5NA 3ANLA 5BV1A 3FRIA 1P0PA 1JKOC 3T1VA 2X8WA 2VWQA 3FUTA 5E7QA 3GCMA 1EH5A 2J9YB 3GJTA 5CG1A 1NP3A 2HY7A 2ME0A 4W8GA 3AEQA 4PGHA 1XD9A 2WZBA 5F1RA 2JGDA 2REBA 2PZFA 1SG6A 5DM0A 1LGYA 1C7EA 2XWSA 2FRDA 3B7PA 3ADPA 1L5GB 2EKLA 3OCZA 1F06A 1JG2A 2YS6A 1LRKA 4DZTA 3G1OA 1BGWA 3HS3A 4MPTA 3N0VA 4UM8B 2Z9BA 4TMYA 5G4KA 5JALA 2E1CA 1KU7A 2FV8A 3X2FA 4D3YA 4Y52J 2FUEA 3UB4A 1HBXG 3D6FA 5F78A 2BP7A 1QVAA 3EGEA 1MV8A 4DXAA 3A1YA 1KFCB 3ISTA 4DLKA 1I27A 3QKIA 1BS1A 1UBSB 1J33A 1VL1A 3R61A 3PNTA 3JALB 3VU9A 3BGIA 1ZH8A 2XTJA 3ZGXA 1BQ4A 1WBDA 1J9GA 3GBVA 4KYVA 1R37A 1V71A 3HO8A 3PUFA 4D1YA 3UK6A 1VQ6I 2Q5FA 4X8LA 3S5UA 5K3FB 3KVVA 4O2AB 4IL6C 4MQFB 4Y2UA 4MRMB 1L8QA 4BX9A 3LK7A 3P2IA 5FTJA 3B02A 3W2FA 5JD5A 3Q9VA 4A3GJ 2WWFA 4GEGA 1LBTA 3U3JA 3EG5A 4LXQA 1ZAKA 3W06A 2YC4C 1N9GB 1R8SA 1R5JA 5TMBA 4RA9A 3W8NA 3WAKA 1G7TA 1BKSB 4NU8X 1LB2A 2L19A 2JIPA 5JSUA 2ISSD 2QP3A 3DKXA 4R54A 4BZQA 4ZOLF 3ND5A 3RF7A 4BZZA 3V8BA 4D80A 5DT2A 2WD9A 3HDDA 5H6QA 2DT7B 5D2CA 3HWWA 5LPNA 1WMBA 4ZVOA 2OLKA 3BH6A 3AOEA 2FEAA 5ADHA 2ZSKA 3F0TA 3KKZA 1OC2A 4L8YA 4N0PA 2UUCB 4TL8A 3F6RA 5EGNA 2PLNA 3RT1A 3WLOA 3QX3A 2CYAA 1LBEA 1FTNA 2GF9A 3G6WA 4D46A 2ACKA 2Z6QA 1MOZA 4EJMA 3LAWA 3MCWA 2P67A 4ENQA 4Q6WA 3GBGA 1OKRA 3PNLA 4F1KA 2PD4A 3I04A 2L7KA 1XCJA 4FVTA 1PGOA 2PQ6A 1XJ0A 4K9OA 4TSRA 1UFQA 3W5IA 3E9YA 4IIGA 3GGJA 1R12A 4WK4B 4CF4A 5A7FA 3NEUA 4KI0A 4WSOA 5C3UA 1SOVA 3FDXA 1N6IA 3QE4A 1IXZA 1JFRA 4UUOA 2X3UA 2R2AA 1RKTA 1L8AA 4O5AA 4N03A 3EEOA 2X4HA 4UEOA 2WFAA 3HVJA 3N53A 1M1NB 3OPNA 2F4NA 4CODB 1A5AB 1UZNA 3EVEA 1G4DA 3ANTA 1LNZA 4R84A 4FFBB 1DWOA 4TN5A 1V5FA 2Q5IA 5EHQA 5E1WA 1K7SN 4IH9A 4BO8A 1KEKA 3DV8A 3OYAA 1O87A 1YVDA 2DWOA 3U6KA 4R68A 2P5TB 1HA8A 2PKEA 3ZN0A 3LHIA 3CX4A 3X1DA 3GJ4A 3WA7A 5DHFA 2JCBA 1HDXA 3I52A 3NKLA 3NWOA 5DV9A 1URPA 1P9RA 1OAOC 2EWWA 2O9JA 2W6QA 3I01A 4NARA 1LDYA 4DM7A 5TDHA 5JVDB 2H1KA 2GI4A 4I55B 4BL0B 3FIWA 4LXGA 2ADMA 4J0KA 2PBFA 4AZ3B 3LHSA 4NC6A 1K3UB 2V9KA 5K8VA 4DLAA 1IZ0A 5JXHA 3B8EA 2JPDA 4MV5A 2CH0A 3C3WA 3WE7A 4DA0A 2RHDA 1CIPA 3GFSA 2J5OA 1UZCA 1R9TJ 4DAEA 4O2AF 1AKNA 5JH7A 2RAUA 3OQ1A 1ZA2A 3ZCPA 3HC7A 2X8LA 5K99A 2DA2A 4PZ0A 5FBKA 5KHAA 4A7PA 1GKLA 3MJTA 1IN7A 2E2JJ 4BVAA 5F7OA 5IY5H 1JG7A 3AV0B 4BO1A 5K09A 1JEYA 3ZQFA 1DL5A 4HAZA 1A8HA 1P7PA 3IBSA 1KZ1A 5FOSA 3E03A 5EIWA 4PK4A 1THGA 3ZHUA 1RHUA 1KR2A 3W4JA 5DM1A 3VVLA 4ZMBA 2G7MC 1FIPA 3D6HA 3U7EB 4PR0A 2JD1A 2IHYA 2EEPA 2WIBA 1E2MA 4WUTA 1FYVA 1X3SA 2WM9B 4GFBA 1DCKA 3VFZA 3D8NA 1QP7A 3HOZJ 3ICCA 2EK5A 2B8TA 4U8HA 1VGRA 4TMVA 4NDAA 3BLYA 1G17A 2UZAA 1JMKC 2Q9AA 1Y3IA 1G4HA 1EP2B 4XKWA 2DPHA 3KAQA 3L1VA 4KTVE 4Z3DA 2O1XA 2XUBA 1Z7YA 4IDQA 4YIHA 2ADUA 1WQ4A 2XVMA 4UE6A 1UMCA 1G2QA 3EZ9A 5FWDA 3AY3A 4TYQA 5HYVA 4FKMA 3KP3A 4TKVB 3NEAA 3M1YA 2B36A 2FFAA 3DXZA 5KO2A 5SYMA 1QPZA 3BF8A 2KS6A 4X63A 2A5JA 3I54A 3ZGNA 2DK5A 4GC5A 4BL5A 3LC1O 1SC1A 5H3CA 3WAGA 3HY4A 1XRLA 3A8TA 5EOVA 3A1DA 1W7PA 4C0BA 3A25A 4JASB 1T1EA 2GNPA 4QWMA 4BNCA 2MSLA 1CUUA 5CFOA 4RVGA 4I46A 3EZ6A 1UHWA 4LJ7A 1EB8A 1FQWA 4R6WA 2HCJB 3B3FA 5TPWB 4X1YB 2GZHA 4MKFA 4QVGA 2ZIAA 2QGNA 3O1LA 4BYYA 4UXJA 4WACA 5AK6A 2IDJA 2P65A 2WA0A 3OYNA 3EUEA 1CY8A 3G85A 3QLUA 1BIFA 2FH5B 4US0R 1MJ5A 3D6TB 3IUQA 4FN5A 1H6DA 1BKYA 2IYYA 3WQSB 2QW8A 2X77A 1HM5A 2DFHA 1CE8A 3WXBA 3ZNOA 6ABPA 4XN3A 3F22A 1QYIA 3GFTA 2JPBA 3URMA 3N6RA 4AZVA 1NN0A 2X7JA 1L5LA 2K2WA 1R1VA 4BQEA 3P19A 1T9AA 4U5QA 5DWVA 4HNUA 1VZ3A 1N5IA 4E31A 4B74A 3NGXA 4OH7A 4ID9A 1NKTA 2MSCB 1T4CB 3T1BA 2ID8A 3BR6A 3KBOA 1G6HA 3LWFA 2FB9A 5K6RA 4NEHB 3HYSA 4R05A 3GFFA 1A4RA 1U8BA 5HQ3A 1XC5A 4AJEA 4HG2A 1MCZA 2QSHX 4OHPA 2CF5A 3RVOA 1E1KA 1NXSA 3AWDA 3K8OE 3D8BA 5E1OA 2IIPA 3ROPA 2UYHA 2N3ZA 1FQJA 1T08B 3IURA 1QZTA 1FFXA 4AY6A 2V6BA 1U4SA 2VOJA 4X97A 2QW1A 4J9VA 1FIUA 1M6YA 2N1BA 4F2PA 4XQCA 2A6PA 2ZSIA 4X1IA 3RSOA 4XKJA 3Q0EA 2D2XA 4RGYA 1NVGA 4I0WB 4YPVA 5BV2P 1P75A 1VYHA 3OZFA 1DMSA 5AW6A 3EVDA 2WHPB 1BVYF 4L5AA 4UMFA 3ZGYA 4JBGA 1B16A 2HDWA 3O8HA 1IATA 3PCRB 4P36A 1NJ8A 4GIBA 2EBFX 3MJVA 4C3OB 4E30A 4GO1A 1K2VN 2SKDA 4JK3A 1ORDA 3RVBA 1CR2A 3LSGA 3E82A 3AB3A 1GKYA 4OHBA 1CQZA 1P77A 1Y98A 4A23A 3V6LA 4BYMA 4LK1F 1HTTA 4MVJP 4ZVLA 4ANFA 3SZOA 3C7TA 1GZVA 3WTCA 4AXBA 4MRNA 1A76A 5K51A 2XI4A 1JMYA 4QGBA 2A3SA 2A4KA 4GU5A 2X22A 3CE9A 2ZUCA 4ZYEA 2CE7A 4XW2A 4YJ2A 1TWHJ 4FYIA 5A1TA 1P4XA 3KXPA 1ZN8A 2VHWA 3PLNA 1IHDA 4PC6A 1AS2A 3V8QA 3H99A 4WGGA 2GPJA 5EXDA 4ID3A 2C07A 1MQ9A 3TYXA 3HV0A 1X70A 1MENA 4AJIA 2BWJA 2G28A 4ENWA 1R6TA 5KWJA 2R7LA 3T1QA 2VKDA 5M3FJ 1QP0A 1C7IA 1V4NA 1IJKA 2B1IA 1IAQA 5FADA 3WHPA 3KUCA 2FDXA 5KKCA 3PV0A 4A3FJ 2AO9A 1KI8A 1J8FA 1I80A 1O97C 4RV9A 1BJAA 3U3MA 3CUTA 3D1VA 3A6KA 5YASA 4HS9A 2OO3A 2PWPA 3W2TA 1NQWA 2HBQA 1N2OA 1KQGA 1IUFA 3VR6H 4KW7A 4NIMA 3WQRA 3L1UA 3PDHA 4XYBA 4HMQA 4UTZA 3QX7A 4L0QA 2JEOA 3VPRA 3EZGA 2ZZMA 1CF2O 1JR3A 3EWSA 1RYDA 3K2BA 3E84A 4E88A 1VE9A 3KQVA 2H9AA 1BW6A 1SOUA 2FNPA 5D4RA 4F2WA 3EMBA 3DD1A 3GGPA 3T3MB 3E3NA 1EFVB 6ADHA 3AIMA 3CA8A 5AVXA 5KX5B 3F3MA 4Q02A 3H11A 1EUCB 1M7HA 1O4VA 4BE0A 3UHFA 2MGQA 5BWMA 2G0TA 2XIJA 2OSBA 5ISMA 1EX1A 4XWYA 5A02A 5F3DA 1ORKA 2ZULA 3X1JA 2DPXA 1VFNA 3FPJA 3QXSA 3TVDA 1QYVA 3DZHA 3OZGA 4GL2A 2FF5A 4E14A 3UAXA 3HZHA 3EZXA 5C53B 3VR3D 4FGSA 4GWLA 4M71A 4HYQA 2OA4A 3MK31 1QP4A 1Q57A 2XZDA 4FGLA 3KT8A 1ENHA 4G37A 5L3SB 1D5YA 4MS4A 1C7JA 2DBRA 1V11B 3GXBA 2QM0A 5IVPA 3D3JA 3FXKA 3WIBA 3RASA 3J80K 1VG0B 4E07A 2YWEA 1T6SA 2NM0A 4K88A 3I61A 3R0IA 1MDMB 3IH4A 2FP4B 3QSYA 4Q4HA 3ZUGA 4F8JA 4H1VA 3G1WA 1NHAA 4D8VA 4ABZA 2GOYA 4UCQA 2QI9C 5KYGA 4BV2A 5EMMA 2E6UX 4JXKA 3QPHA 2FSIA 2B7LA 2B1RA 3PFYA 1GLNA 1T2NA 4OSPA 3MTAA 4U2BA 2HFHA 2QT9A 3IP7A 3M9LA 3LSRA 1M3SA 2ZWVA 3GTGJ 1HT0A 2IHZA 3WADA 2VYND 3TCNA 5HNKA 3H3FA 2JVIA 2L2OA 4GPAA 1JKMA 5FRNA 1R9MA 1YKSA 3Q5FA 1FU7A 1IW7F 3QHQA 1J0EA 5KOIA 2FRDC 1DQPA 4BIIA 5EF6A 5E4JA 4E3ZA 1SBYA 4XRSG 4KQGA 1O3QA 1A4UA 1E3IA 2EKZA 4MHSA 5HBGA 2CRGA 4LNUA 4CNBA 4LVUA 3O74A 4ZPJA 3UFXB 3DEIA 3A1UA 3PRJA 1AA7A 5ALTA 3QQPA 4OYHA 3S3MA 3ZCVA 5KSOA 4XB6B 1MMNA 4RD2A 2X23A 3BMQB 3QVOA 4CM4A 3MFQA 3PA8A 4OSEA 3S3TA 3QF7A 1VLJA 5DDGA 3AILA 5LU9A 4GFDA 2JI9A 5TJHA 5JXJA 2H4YA 2RKOA 5KTOA 3FPHA 4DR4B 1N3IA 2OXTA 2IRFG 3V6MA 2C04A 5LRRA 1JPUA 3DLLF 5JNRA 1Y0BA 3DZ8A 4CCJA 4UTVA 3TQCA 1NVTA 5HUQA 4QIWN 5K3EA 5AM3A 4UU8A 3SXUB 5C4MA 4Q4AA 1JB9A 4ZAYA 1CUXA 5CGQB 3PM1A 2Q5QA 3NH9A 1T0IA 5BWLA 2D5LA 1L3CA 2ZZNA 4TYWA 2DAOA 2SBTA 3C1DA 3CH7A 1JIVA 4BDZA 2WHYA 3FNIA 2X0DA 1HQYE 5CVEA 1RI1A 3H5VA 4NFSA 3BGVA 3MKZA 1IDYA 1KL7A 1WDMA 1Q74A 3LAPA 1XN1A 1N33B 3MJCA 4EF6A 3G2KA 4DVJA 4UKDA 5F64A 2J3JA 4CF3A 1N5KA 1JKRC 1TKAA 1HQKA 3K1ZA 1WZCA 2FCAA 1JFTA 4LWQA 1IM5A 2DWQA 3KFLA 2A9RA 1V7ZA 3K0HA 1XN7A 3HJEA 4XLTA 4UE3S 2PL1A 2JK0A 1UKYA 4CJXA 1NRXA 2XV4S 5LR6A 1R0KA 3MT8A 5KVSA 1J6UA 4Y6LA 3T54A 2J0VA 2QY9A 4RLQA 4YH1A 1NMSA 1C1DA 2J7KA 2PO5A 2F2TA 5HIKA 1PFVA 1PVEA 4PZJA 1JEAA 2WNHA 4F2DA 3GW2A 4CQJA 2WKSA 4A0GA 2C9BA 4KTTE 3HP7A 1P9LA 3OSUA 5CPFA 3KL4A 2JD2A 3JQBA 3MHPA 1T8YA 4UU0A 1IBLB 4X6YA 1VP9A 4DSTA 2X86A 2K3FA 4FMDF 1V1MB 2IOYA 2ZRIA 4H0FA 3B7GA 4BY7J 3H5LA 4LTNA 4PYQA 2R9VA 2J3QA 2RV8A 4IFIA 4LXIA 1KZ6A 1T0PA 2V03A 1L8LA 1XMSA 2GTIA 1XTPA 5BW5A 3P2OA 4NHJA 1ENZA 1MBJA 4DLZA 5B1YA 1MB4A 1NUSA 3JCZA 2XPCA 2XUKA 3SC2B 1RC8A 3O82A 3FNGA 3WGNA 1XZCA 4CCKA 3WJ1A 2JC3A 3PQDA 4FYHA 1ZHOA 2G76A 4IJWA 3LP8A 3GPIA 1LF0A 1ULZA 4NONA 5DEOA 3FYHA 3SDSA 1OZHA 3B1KA 1HETA 1T4DA 4MKGA 4P5DA 3LT5A 4CYDA 2LY2A 3O3OB 1YH3A 4YNBA 4OP2A 3BJEA 1FDOA 2C8KA 2WJAA 4YAKA 4EENA 3ZZNA 3GZTB 4XOUA 2L9NA 3SI7A 1XB2A 3P8ZA 5ITVA 2F7SA 3WMEA 2X9GA 2IT1A 3R0ZA 3A03A 1IZ8A 4GNRA 3II6X 4L2IB 3B8HA 3TQHA 4KISA 4FI3F 3OOPA 2SHKA 2OWEA 1SU7A 1H6AA 2QYHA 4BGIA 4GPBA 3KP7A 5K5EA 5KHLB 2CYBA 4MW4A 4A3CJ 4U2FA 2BI4A 2A1UB 1W5SA 4AM3A 2V79A 2B61A 4MOWA 1XVIA 1YI8A 2VC2B 4KACA 1OGJA 3TMOA 1T8TA 3AIIA 3M4XA 1NN3A 4IJ6A 1Z5VA 2W6PA 3WOVA 2GRJA 3ED1A 4M9XA 3PRHA 2C4VA 1W7AA 2H3EA 3NKFA 4UJ5A 1QH1A 3DEKA 1V4BA 4YRSA 5IDXA 1FDSA 5LQSA 1OQYA 1YQ9A 3P9NA 4TTTS 3KWMA 3K6KA 5IBQA 5COBA 3AERB 2QMYA 3BWYA 5J4KA 5I51A 2XWPA 4I4TA 1B74A 3MJSA 1QQ6A 1ONBA 4HWPA 4IPAA 4ROTA 1CHDA 2XMSA 5FBQB 3TX6A 5FIUA 1JZSA 4YIIA 2Z58A 3G49A 4I2OA 1N78A 1L4HA 4E3WA 2POCA 3VSAA 4WBNB 2VBCA 5AHKA 2QX8A 4YUYA 3PPVA 3WKCA 2ZEJA 4XOIA 2EB7A 4XUDA 1ZL0A 2KHZA 3BJMA 1U28A 3CCQI 4M3BA 1Y1SA 3MQ2A 1HKUA 4I9UA 4CMIA 1R0CA 3WTUC 2OTLI 2HRZA 4XASA 3IUNA 4RTJA 4IOMA 5JXWA 1RFGE 3KZNA 4D9CA 1Y8QB 3R9KA 4X64B 3BXOA 4EHHA 3I1IA 3LU1A 1DIOB 4PNZA 2VAPA 1U7XA 3ZJ4A 1HUQA 4FR0A 3VV3A 3PJFA 2JGAA 4ZFNA 1A7JA 4LBYA 4C1BA 1QOPB 3TMAA 4ZZ2A 1AY0A 3K05A 1KJ9A 1SQFA 1N8KA 2WJ4A 1ZIDA 4KR0A 5KTKA 2JA7J 3C45A 3IOCA 3CCLI 4UNQA 3OJEA 2UYYA 1FTGA 1QIHA 2HRDA 2BEKA 4Q3EA 4F5WA 2AIRA 1EUYA 7ABPA 1VJGA 4J0IA 5KVRA 2F48A 4ZP1A 2A68F 5JCJD 1SCUB 3DLCA 3QLUC 5LDGA 5GIOE 5D01A 5B4TA 4C4AA 1JDNA 1VXOA 5JIBA 5HNFA 2C7RA 1TJYA 1L5HB 3CKKA 3PJGA 3BFKA 1PKEA 1Z8NA 5SZIA 3SJCA 4AIHA 1EWTA 3HMQA 4L07A 1OKKA 3N7AA 5C81A 3GG9A 2W2KB 4DIBA 1AQJA 3HBJA 2Q9UA 5ICEA 3J81K 2IOQA 2NNWB 1E9EA 4QGHA 4X54A 3ZK8A 3V8JA 1T9KA 1Z4LA 4QGGA 1RM5A 2CLDX 1Y4DE 2WM3A 2IRWA 1CDEA 3U26A 3BTCA 2N9UA 5DBFA 3C8ZA 2QWXA 4KICA 4G94A 4QDZA 5TJJA 3UXEA 1M0WA 3G8BA 3EDRA 3KYIB 2QU8A 2I8CA 5EUQB 3VJKA 3ZV5A 1GTG1 1VYTA 2HTSA 5I4KA 1V37A 2EWVA 2EIJH 4V0QA 4FDLA 1SU4A 2G5PA 4LRUA 3OQNA 5E3IA 2I3ZA 4UHJA 4ECEA 5EZSA 4HUTA 4BBJA 4R7ZA 2FDRA 3E05A 2OV6A 3QMVA 3C41J 3E7PA 4DLPA 3OYCA 3UV3A 4F84A 1SXJC 5CU7A 1E3WA 5B2EA 5H9VA 4JYAB 3CMAI 4NQRA 2ESRA 4F96A 4RCYA 2CDNA 2VEDA 3GRZA 5EXEA 2XA9A 4URHA 1YLFA 1FRQA 5ULLA 2PPVA 4C43A 4I50B 4ZZ0A 1G21B 2VT6A 4E5SA 4PC1A 4CL2A 5AHWA 1SULA 3AFOA 4LXYA 4UUMA 1X8XA 1GITA 3CUSA 1TB4A 1RIFA 4Q0MA 4TV9F 5TRTA 3PNQA 5EE0A 2AWNA 1XWIA 2YXBA 4RF4A 4DSZA 1C1YA 3DP9A 1YW7A 3FXQA 3EJWA 4W1PA 1PR1A 2BHZA 2QKLB 1J1UA 3CU5A 5HA5A 2Z5LA 4TS1A 3T5MA 3ZHCA 3D3EA 3U3OA 3RWBA 1LJUA 1PR0A 5E6SA 1ECJA 2E85A 2RHOA 4WTOA 1PL8A 4P7FA 2IPOA 3FVRA 3BDIA 4PF1A 1X1QA 5B64A 1CY6A 1HKSA 3EYWA 2YFQA 3TCXB 1KNQA 3RROA 1SBTA 2Y31A 1RAAA 1MJ9A 3ONFA 5CX1A 1EE1A 3Q5EA 3IRRA 2ZS9A 4XX0B 4F3RA 4B4VA 4PCVA 2BEOA 4B84A 4RHEA 221PA 5BVHA 3BRCA 1L3BA 2D2EA 4NHEA 5F98A 1KKUA 1GUZA 3SN6A 3DO5A 1A9SA 1SUAA 2Y77A 4JYZA 3W0LB 2QLLA 3CGGA