3WGGA

Crystal structure of rsp in complex with alpha-nad+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
b'KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Binding mode of the oxidized alpha-anomer of NAD(+) to RSP, a Rex-family repressor
pubmed doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 71
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wggA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wggA02
1HXHA 2OUIA 5DBIA 3B02A 3VTZA 1P33A 2VE9A 2BLLA 4BNYA 4XLPF 3RUHA 1X3UA 1VLLA 4PRLA 1WDKA 2WEKA 4XQ9A 1EH7A 3KUXA 2XV4S 5D6FA 4E5PA 5LLQA 4WCDA 4AJIA 4UNOA 3BMQB 5TRDA 3BHJA 3W6KB 2KJBA 1TT5B 1W5TA 4M74A 2BYVE 1C1XB 4XRFA 1QQIA 4NBWA 4PG7A 1L1FA 3FBGA 2ZK7A 1GTMA 3D5LA 4J9UE 4EJ6A 4IRIA 3RAJA 5KOIA 2CDAA 5ES3A 2FMYA 4CO8A 4IDEA 3FWEA 2PH5A 3H2SA 2LKPA 5CEJA 4BNTA 1ADFA 5A03A 1PQWA 3WSWA 3DZHA 3ECHA 2VN8A 4AJKA 1I5ZA 4MP8A 4EITA 4BXUA 2Y75A 1XDUA 3VB2A 3WTZA 1U9JA 2WYWA 4CM1A 2WDZA 3EDPA 4OGWA 3TFOA 4MKRA 2AE2A 1R0LA 4CV3A 2AS5F 1GQ2A 4W7IA 3VFZA 1LDYA 1I0ZA 1QYCA 1C14A 3IKVA 4QFDA 1DBVO 4DIBA 1W7PA 1DFIA 3DQVC 3O3KA 2ZXJA 4K2EA 1YB1A 2RQPA 1YONA 3JQ7B 2O3TA 3ML6A 5A1TA 1W5SA 3LK7A 4BNLA 3FXQA 1E0DA 3H5NA 1EVZA 2YJZA 4I9NA 1IN6A 5D8LB 1N9GB 1XHLA 3WIDA 4A03A 4PG8A 3CE6A 1QXSA 1T2KA 5DBGA 3UVEA 1UUFA 3HFSA 3VZQA 4ZGWA 1Z6RA 1UXJA 4UVEA 3JQFC 5EQFA 5T8KC 1UXGA 4CMJA 4J16A 1Z91A 3GZ5A 1SNYA 2NLOA 5E20A 3Q6IA 4YDRA 2M5WA 3E97A 3HUGA 1KC3A 1RYEA 3FR8A 5JCXA 1O95A 4IMPA 4Y9DA 4JK3A 4RQTA 4UVBA 4U0VA 2J3IA 1DHRA 3OETA 4M1QA 1ZRDA 1D1SA 1K0UA 4YR9A 1LSUA 5HTOA 3KV3O 3PK0A 4BGVA 3J80Z 5C7IO 1K6OA 3ZNNA 2FR8A 3DB2A 1B15A 2Z5UA 3DV8A 4HDUA 1D4FA 1NFFA 3U4CA 1W4MA 1LLCA 2RHRA 2ELHA 3T7CA 3RJPA 4GH5A 1PJCA 4EGZA 4MPDA 3Q5FA 2HQNA 3PLNA 5A3JA 3F47A 3UCEA 1MDMA 2TMDA 2B37A 4OMZA 1RJWA 4YACA 5EEHA 2O4CA 2XOXA 1P77A 2Y68A 4HNHA 4GAEA 2Y0CA 2V7PA 3GA0A 4LLLA 5ENDA 4MHGA 2IVMA 2E4AA 1UXIA 3OBBA 5KJ1A 2I9PA 2VT3A 4GL4A 2VYVD 1MKMA 4NDNE 4I9UA 1CWUA 3ZWAA 3RROA 1H0MA 4NNJA 3L9FA 1ZLKA 4YA6A 1Y5RA 2ESHA 4DYDA 4KN7X 1F9NA 1XQ1A 3CSDA 3ZWPA 3S2WA 2O3JA 4HFJA 3WICA 1IZ1A 4Q9NA 2WV0A 2XF8A 3LSTA 3CXRA 3E82A 1YS4A 5A5FA 3G1UA 2FHSA 4ALKA 4OINF 2A9FA 3K96A 5EPOA 5E18F 3WGYA 4KDFA 4HY3A 1VL0A 5L7YA 4J1TA 2GERA 4R9SA 4RGRA 5HLHA 5HM8A 2FBKA 1KETA 1LDKB 4OKNA 4XJSA 3I9NA 3L6OO 5IT3A 2FPIA 4Z0TA 1MP0A 4I01A 3R3JA 3VVCA 4CV2A 1SB9A 4GMGA 2FRHA 3DZGA 3WE2A 3R61A 1JN0A 1P45A 1Y8RA 3I4PA 2PD6A 2MH9A 2X6TA 3K69A 1N8KA 4DA9A 3GEZA 1ZCJA 3GX4X 1QSGA 1VL8A 2OORA 4NHJA 4KTVE 4W4TA 4G6DA 4CMIB 2Q4EA 2RBEA 1WPQA 4AVYA 4FD3A 2R00A 1VKOA 2VOEA 1P92A 2SCUA 4GBJA 4E33A 1P0CA 2HKIA 3TJRA 3UCXA 4AL4A 3L6DA 5JW6A 2BFAA 2PBIA 5CG2A 5C5IA 1VE9A 2H6EA 2VBXA 4BOYA 1KVRA 2JCXA 4E2WA 1ISMA 1DO8A 2CDBA 3UH1A 1JHHA 3LT1A 3PIDA 1U6GA 3IC7A 2ZQZA 1KU3A 1MG0A 3JQAB 5CDTA 4B4OA 3HRSA 4M71A 3T5XA 1HYGA 2AQ8A 3QHAA 4HWKA 3I9LA 5KKCA 1BN5A 4U0KA 1ONVA 1N7HA 3FWZA 3TKYA 1JHFA 1U7TA 3VTFA 2HDHA 2G76A 4IQ8A 2NTNA 3AJRA 3FPLA 1QLHA 3H2ZA 1BI0A 1XR3A 3TQHA 4Z3KA 4PLFA 3X2EA 4C7JA 4BV9A 3RFVA 4P55A 3AK4A 4UVCA 3RKUA 4LCEA 1KYZA 1B6AA 4XLNF 4DNCA 1S7CA 4J43A 3RBVA 4AG3A 1MJ9A 5G0UA 4FX0A 3Q9VA 1HKSA 3KYCA 2FWMX 1RKXA 1GCOA 1FXSA 4LGVA 3PVZA 2HJRA 4YFXF 5U1PA 1RI7A 3FI9A 1TW3A 1ULUA 2A35A 3TSCA 2XIGA 4E4YA 4G94A 1T6SA 2I76A 2W2LD 1I3MA 3E9MA 2XAJA 1T2EA 3BWGA 1HDGO 4RZIA 2I99A 4CLHA 4EUHA 1F4KA 4P5OA 4ESFA 1Q0HA 4DQVA 1FLIA 1N7GA 2H1SA 2O2YA 3BMNB 3BJ6A 3FBTA 1Y8QA 3GF4A 3L4BA 5TJ9A 2M45A 3VEPA 1KEUA 5KK1A 2PKQO 2VC1A 2OMEA 1IL0A 1FK8A 1PJSA 2QQ9A 4HLYA 1LI4A 3GVPA 3NAQA 1BDBA 3PJFA 1PL7A 4GX1A 1KIFA 1GDHA 3DHYA 2X1HA 2F2EA 3E48A 5LRSA 1HL3A 3B70A 4ZICA 1XLTA 4AICA 2YX4A 5CVIA 1VPDA 3OECA 2CSUA 2V6BA 2XXJA 4NMHA 4XQEA 3FN4A 2VXZA 2NRAC 5H83A 4E6PA 2D0IA 4CXFA 2NU6A 4ALLA 5JSFA 3ETEA 3H9QA 3DO5A 3JSAA 5LBQA 4EDFA 1EE2A 1F1ZA 2PN6A 4E70A 1A5ZA 1RNLA 1WWXA 2HQ1A 3M8FA 1JDJA 5TS3A 3F9IA 3WB9A 4IDGA 4AJLA 3W8FA 2TMGA 4B4VA 2YU3A 3PRJA 4CUJA 1GXQA 2DU9A 3ROQA 5AXDA 6LDHA 2E37A 3QLJA 3UXYA 1HSJA 1UDCA 2NU9A 1FZPB 2J5RA 3I1JA 4A0SA 2FU4A 2K4BA 4KP7A 1KBZA 5F21A 4U7DA 3ZV5A 5TRTA 3SLKA 4KTTE 3I6QA 4EQQA 2OZUA 3ZV4A 2RH8A 1EBFA 1GPJA 3AI3A 2WTEA 3ONEA 3REOA 3PWKA 2EFQA 1AXEA 5TJHA 2Q99A 3K1PA 1IZ9A 4ZQFA 2M1BA 3TOZA 5C3MA 1LSJA 2OGUA 3GZ4A 4CL3A 3WTWC 2VQ3A 1Z7EA 2ZJ1A 5AXCA 3E18A 3BMOA 2IEBA 1RM5A 3WG9A 5KVCA 5AONA 3QW2A 3VAZA 2P6SA 3GFMA 4YJDA 3I59B 4ZJUA 4Y98A 2GQQA 5CPFA 3WTYC 3OHSX 3PFFA 4NZ9A 5BNIA 4I7HA 1W7PD 1H6DA 2Z3YA 3LVFO 3M2PA 5D4RA 1EMDA 4KMSA 4DIFA 2FPPA 4PZJA 5DCMA 1O8CA 1I10A 2IZ0A 3LDHA 1X7HA 3PIIA 3GDOA 4ILKA 1E2XA 1J9IA 1DFGA 4RGUA 5K5QA 1FYLA 4OIMA 2ET6A 4W82A 3EHEA 4U88A 4MP3A 5ERIA 4UUVA 3AOEC 2YQ4A 1EQ2A 1YBAA 1VKNA 5K1YA 2WM3A 3HDQA 3WWZA 3DXJF 1XB4A 3CJNA 2EA2A 1PU2A 4E12A 5G4LA 5B4VA 2F00A 3WTBA 5HRUA 1EUCA 2EP7A 3P2OA 3TZ6A 3JSOA 3HSRA 4Z9XA 2XROA 3ZW8A 5L53A 4TWRA 2R6JA 1OKRA 2EJWA 3TWOA 4YQZA 2K4JA 5DV5A 2YDXA 2JFGA 1HTBA 3JQBA 1MLDA 2EGGA 5TF4A 4LMRA 3E5MA 2O03A 4IDFA 3OM9A 1M2WA 2NNLD 1HSOA 3ZV6A 2OAZA 3W1VA 4ZYEA 2JFHA 2CVOA 2Z1MA 4UULA 3EK2A 5ICSA 4J91A 4CL8A 4EVIA 2CWEA 5G4KB 4IQGA 3ZWVA 4E0BA 4YAIA 4C4OA 4AD9A 1BTOA 1U3VA 3DFZA 3V2GA 3NKLA 5IN4A 3EVTA 1F12A 3WBBA 4BO3A 2C29D 4J9VA 1D8AA 2RKHA 4CM4B 2PI0A 1S7OA 1W73A 3GN2A 3KEQA 4L73A 4N7RA 4WE3A 2B4RO 2P4QA 5LEKA 2ZTMA 3HDJA 1R4MB 3JQEA 1P6RA 3UCFA 2ISZA 3WLFA 3UGKA 5A2QZ 1QV6A 4DC1A 4BNKA 1PEDA 2P5LC 1T2AA 3LT0A 1ZK2A 4PCVA 1EBUA 2Y67A 4CLRA 2AEFA 3SXYA 4YJHB 3WNVA 4CZZA 4KYWA 1E1LA 1IY8A 1DRWA 3CIFA 4R8HA 1QZZA 3KP6A 4B4UA 3GQVA 4CQMB 4NHEA 4P38A 4U6QA 3DC2A 4Q47A 4NQWA 1ADCA 3RKRA 4RPJA 3P7NA 8LDHA 3K9QO 4WOJA 1E3JA 1E7YA 1G1AA 2ZTLA 1R36A 4PLTA 2E48A 3GZNB 4CM6A 2RVCA 4B7XA 4BO5A 1HETA 2D1VA 4UV9A 3U3XA 1ZH5A 3K30A 2C7GA 4GQAA 5ADHA 2W2KA 1GUYA 2D45A 4Q5SF 5JXWA 4CMEC 2FNAA 1FJHA 4GLLA 2V1DA 4XR9A 5DCWA 1BWSA 4JP2A 2FMLA 1LSOA 3S2FA 3MWDB 2RH4A 1YBVA 3W6UA 4IUYA 3I52A 4UXNA 4EJWA 3DBLA 4E2YA 4PLWA 3LYLA 3OJEA 4FS3A 4L9JA 4GYGA 3GF2A 3NT2A 2GPTA 4BHTA 5A4DA 1T98A 4F6LA 4CMEA 3LQRA 7MDHA 1R0SA 1GU7A 5IZCA 4ENMA 5JMPA 4D46A 4JX8A 4C7KA 1PGJA 5JI6A 4L4RA 3MTJA 3RC7A 4DPKA 3VPSA 4NH4A 3BAZA 3MZHA 2VTEA 2DQ4A 1JW9B 2V6CA 1T39A 1NHWA 3RVDA 2RGVA 4HXYA 1PJ3A 4M73A 4TMFA 1BVRA 1KOLA 4CQLA 5E8IA 5LGUA 3UOGA 4BNFA 4MEXF 5H82A 2LDUA 1U5CA 3H3UA 2VHYA 2ZNYA 3ZMSA 3EW7A 4I9HA 2ZQYA 5ICMA 4HBGA 2QZ8A 2IXBA 2MBFA 3J81Z 3Q11A 3C3WA 1NYTA 2A94A 2WJPA 4GO1A 1K6IA 4IF4A 1R37A 3PDUA 1UXKA 4NU6A 2L54A 3UW3A 3EYYA 3DZJA 1BXGA 4E2ZA 1BW9B 1IZ0A 1S6YA 4LLGF 1KVTA 2NVBA 3ROPA 3SJUA 5A9SB 4BKQA 4BO1A 4BNUA 3GFJA 4EM1A 4PZCA 3HRUA 5COBA 1LRJA 4B4WA 1YQGA 3GPIA 1P9LA 1XU9A 1QYXA 3C18A 1YL6A 1XD7A 2X0LA 1AUPA 1PL8A 2CVQA 1XSVA 3GMSA 3I6IA 3IRQA 1I01A 4LCJA 1A72A 1BG6A 1U4OA 2I67A 4QUKA 3UHAA 3EAGA 3F1KA 3KP7A 4CM7A 4ASNA 1QG6A 2CD9A 2FMUA 3SZPA 3JD1A 1ZLJA 3E6CC 4DQ2A 1HYHA 3FNHA 2EA4A 1LEBA 1OFGA 3TF5A 3HE3A 4GGOA 3J80K 3RBXA 3RD5A 2C5EA 5BSHA 2IT0A 1RUNA 1X15A 2ZCWA 2ZMEB 1PZEA 3MCVA 3QP9A 3SEFA 4D43A 4RJTA 5I8WA 2O23A 3H7AA 3WODF 2VNAA 3DZIA 5BQTA 5I9NA 2FR0A 1NXQA 5F1RA 9LDTA 1HQCA 5FGMA 1DRVA 3O9ZA 3TDZC 4B8ZA 1P74A 3MOGA 1ISHA 3K2ZA 4JLWA 4J7CA 3TRIA 2EW2A 1VI2A 1S7AA 4M54A 3O2PE 4MOWA 2PTGA 2G7UA 3RKYA 2NNNA 5GZ6A 4PCQA 2GASA 2X0IA 4O6JA 3ADOA 1PQUA 5KJ6A 2PLAA 2QYOA 3C7JA 1F8FA 1UZNA 3PEFA 1TNTA 1B8PA 1K3TA 4HFNA 4WASA 5G0TA 3U62A 5ITVA 1R00A 2A6EF 2AE1A 5L7TA 3PQFA 5CPBA 1WDLA 5KIAA 5JYDA 2OFPA 4FSHA 4E5KA 1BI2A 4BUCA 1EH6A 3PGJA 3VZSA 3V2HA 2P5YA 5IT9K 3OP4A 1HLPA 3GVCA 2O50A 5A02A 3PQJA 1FX7A 5I7VA 1HKUA 1LU9A 4FC7A 1E3LA 1ZAOA 4YFNF 4PGGA 5J8FA 4B3JA 3VH1A 1ZREA 2V1UA 4J7UA 3P9CA 1E3WB 1NQOA 2GN6A 4XEHA 5F1PA 2X9NA 3LQQA 2OXIA 1PGQA 1QV7A 2J5QA 2DQLA 1GCUA 2FR1A 4P4NA 4Q3NA 2PLYA 4R5HA 2AG5A 5CP8A 3WYEA 1UDBA 1FC3A 2Z33A 2P68A 2YHIB 4WNCA 5I8ZA 2EFNA 2OZ6A 1LLUA 4KUMA 1GUFA 3OIDA 1XSXA 5CJ9A 4BNJA 1TQMA 5CG1A 1OI7A 4J4BA 1H9AA 2PEXA 2PR2A 4JQFA 4J1NA 2BGCA 1NPTO 4OSPA 5JAZA 1S29A 3R4KA 1IXRC 5G0WA 3E6AA 3QP5A 2C07A 2EJVA 3KYBA 3PTZA 4RVFA 1WMAA 5DOZA 3S55A 2IDZA 1DIGA 4N5NA 1Z7UA 3BMCA 1DLJA 2W98A 4PN3A 1P3DA 4JGBA 3KZYA 1VJTA 3I9OA 1XGOA 3E6MA 1ZK3A 3KLNA 3CH6A 2JCYA 5BS6A 4XQCA 2OO5A 2NYXA 1UCRA 4ENJA 3JV7A 4MO2A 4L75A 4IHTA 3KBOA 4II3A 2PZMA 4HDVA 1H6BA 3RUAA 2W25A 5F64A 3PHHA 4D0SA 3FMRA 4HV5A 4N0BA 3KB6A 2DLDA 4ZD6A 4BMSA 2QRJA 2CFCA 3M6IA 2HK9A 2NUAA 5I9LA 4BNCA 2B0JA 3L7WA 1ZMOA 4BKPA 3WOHA 4OXKA 4OMUA 2HS5A 1OYWA 2A92A 4XX0A 1EFLA 1H6CA 4M49A 4OAQA 1ONNA 4IPTA 3COSA 3CDHA 1PP8F 1PJ2A 1MG5A 1Z6ZA 4PLCA 5JDIA 4RGXA 1W0CA 2NNYA 1IPEA 1K78B 1V0JA 5CDUA 2RCYA 1XQ6A 4XRGA 4BIIA 2NVUA 1O9BA 1FOKA 2ZKZA 2QRLA 1FBSA 1ZSYA 3JTHA 4LVCA 3WU1B 2UUPA 3AI2A 4HUJA 2JTVA 3WS7A 4F6CA 5BSGA 1MC5A 1PUEE 4RF3A 4E21A 2MD5A 3I58A 4JBAA 1U2WA 3EGOA 1RM4A 4DYVA 3E6DA 2MA3A 4I98B 5FO5A 3F8CA 1R4NA 3RI3A 3VH2A 3I83A 3QAHA 3IQDB 4OSOA 4J90A 1HDZA 3RC9A 1M67A 5FWNA 1E7QA 1NR7A 5L4NA 4GX2A 3KZVA 4R68A 1LDGA 1QYVA 2HMWA 4L4SA 2JT1A 5JDCC 3WDSA 1PIWA 1F17A 3U4DA 3DFGA 1YG2A 4M87A 3JQGA 3T0YA 4MVJM 1UZMA 2KIMA 3IOYA 4Y17A 4WCFC 4WCFB 3ZWMA 5BR7A 1XU7A 4MIYA 1WP4A 4L8VA 4R3NA 4A27A 3HUDA 4GCVA 2D5CA 1NHGA 3ZWXA 4OYRA 4RPKA 4YT8A 4BQAA 1S3JA 1HKTA 1M6WA 1XDWA 4OXNA 5ER6A 5GY7A 4K28A 3S2EA 1EH8A 3IP1A 1JAXA 1Y7TA 3OA0A 3H5RA 4K9DA 1MXFA 2DPUA 3L9XA 1IN5A 3NDRA 4EUFA 4LG0A 2L02A 1O3RA 3HIFA 2GUGA 1BSVA 3S8MA 4DREA 3JTGA 1MD0A 2YV3A 2ZNZA 3I64A 4A5NA 3PHLA 1EUZA 3RC2A 5DOVA 4RAYA 4EM0B 4D3FA 1LLQA 5ITWA 5DUKA 9LDBA 2RIRA 4G9YA 3H65A 4ZYHA 2BF7A 4ZHSA 1YQAA 1TW2A 3LZ6A 4MVJP 1GZ6A 1I27A 3K6JA 4JJFA 4OL9A 3H6KA 3WQRA 2QBYB 1V3FA 1YRLA 1OMIA 1NFRA 4HAMA 2FPGA 3QVTA 3ANLA 3TO7A 3KYDA 3ABUA 1HKQA 3FMSA 1XGSA 3LA2A 1BHSA 2PFBA 1AN9A 3OMLA 2GDZA 4CLEA 3V2UA 3ULKA 1HE2A 2I5PO 1BIAA 1DOHA 1SOWA 4KWHA 3EUWA 2ZJ2A 3Q2IA 3LLSA 4FB5A 2EB7A 3PJEA 3GAZA 2W85A 1RYDA 1XKQA 2VC0A 1UP4A 3GFBA 4W9NA 3U9GA 3GNQA 4XYMA 3S1LA 1Z75A 4CMHA 3JQ9A 3AI1A 1I2CA 3QY9A 3PYLA 2AMFA 1AGNA 2WYUA 4IS3A 3S2GA 2HMVA 2DQRA 4CR6A 3GW2A 4PGHA 3SX2A 3W8EA 4XYGA 3ZHBA 1MZBA 3MQ0A 3AWDA 4NIMA 1Y5MA 1X13A 2JAHA 3WGIA 1UP7A 4Q39A 4CMAA 4WKGA 3HRTA 1HT0A 2IZZA 3A4VA 2EK5A 2H09A 4XYBA 3IMFA 3KTDA 1U28A 2Q2VA 4J0FA 1WKMA 1H9GA 5L3ZA 1ISIA 1D3YA 1L7DA 3WYBA 5K6AC 4NQZA 2VT2A 2X8LA 3C1OA 1KQ8A 2CF5A 4GI2A 2YV2A 2QENA 3FZVA 4R1HA 3ABIA 1GEEA 3VOEA 2HYFA 3CZMA 2CQKA 1ZK4A 2Y1DA 5IXSA 2JPCA 5E1XA 5L3BA 3M1LA 3B1JA 3VVBA 2QZ9A 1FDUA 3G17A 3O6BB 2YV1A 5A3VA 2WC2A 1P4XA 3HHGA 1ISGA 2Z5LA 4FOOA 4ZQEA 3AU9A 1I3LA 3BMQA 1TT5A 4W6ZA 3WYCA 4U0WA 1C1XA 2GO1A 5A2QK 4FOSA 5DEQA 1U2GA 2X0JA 3DMTC 3JD0A 1T1RA 1DXYA 3JAMK 3K92A 1FP2A 3KM0A 5LRRA 5ICFA 2EKPA 1LC3A 1PSDA 1XELA 1ZUD1 4QTZA 3OJFA 3W4KA 6PAXA 2DTRA 3ZMTA 1B8UA 3PJDA 2UXNA 2O48X 4MKXA 2FSSA 2OP0A 4HP8A 3V1YA 2Y1FA 2YZ7A 4EGFA 3WGQA 1K6XA 3WFJA 4D79A 4S05A 1LJ9A 1UXHA 2DFVA 1WWKA 1BM9A 1KEPA 3KP4A 4WEQA 2IRWA 1HDYA 3LSYA 4PLPA 3DXFA 3VPGA 5E8GA 3WIEA 3JQ7A 1XG5A 1R16A 2YX7A 2P5VA 5CLSA 1O57A 1QNTA 1P1FA 2HQRA 1TI7A 3LWFA 2DFDA 2POQX 1HDXA 1MXHA 1BJAA 1N9GA 5IDWA 5FLXZ 1YXMA 3UN1A 2GNAA 2I3GA 3V8KA 2VUTA 4IIUA 4R4JA 1HDCA 4BNGA 2V6MA 3JQFA 1DIRA 3KSZO 5T8KA 3GH3A 4PVDA 3WTSC 4BVAA 1X0VA 1XSEA 2UYYA 1YIOA 2MLGA 3HADA 2B0LA 1P31A 3SBOA 2Z95A 4CM8B 2GZ1A 1HSZA 2RN7A 3ITDA 1GVJA 4GVXA 4CM3A 4GSKA 5DDGA 1F0YA 2XGXA 1SFXA 1EFKA 3L07A 1ULSA 1VTNC 4FBGA 5HDNA 4DXHA 2VRCA 3DONA 1YO6A 5BQFA 5JC1A 1SAXA 1PZFA 1JXSA 5BPIA 1PL6A 4Q3CA 5JVTA 4WLFA 3OH8A 3H5AA 4QSMA 5DF1A 3ROUA 3ST7A 3SHFA 3WJ7A 2AG8A 3HWRA 3JD2A 4XIJA 3SC6A 1IW7F 3IJRA 1TQIA 3BY6A 5ICCA 1KVUA 3RKXA 1NQAO 1U5TB 2QQ5A 3R6DA 1U5TC 1PZGA 5JR3A 3ICPA 5B1YA 4KIBA 2P8TA 2Y1OA 4J1QA 5MDHA 2HCTA 3CTAA 2Q3EA 2CUKA 2FBIA 1IRGA 1PJLA 2EV5A 2HMSA 3ZWWA 3J81K 3RBZA 5L4LA 3N4MA 5JS6A 1I36A 2FRDA 3QV1A 4MVJI 1DJNA 3H4VA 1GYRA 3Q1LA 5JBIA 3HJAA 1JVSA 4A10A 2VYNA 3CO6C 2BFOA 4MVJH 2I6TA 5TGDA 3T8RA 1WW8A 2B4TO 1NHAA 1SMKA 4R01A 1EK6A 4TZTA 3HDHA 4NU5A 3F22A 2JD2A 1ORRA 3NQOA 3GAFA 2X4HA 2C7VA 3P19A 2YPRA 1ZSNA 3D5TA 4OIQF 2EFWA 2PMUA 4RS8A 3WGGA 4GXOA 1SMTA 3VZRA 2O3SA 4TRJA 1I2BA 1L0OC 4BMNA 2Y1GA 5F5NA 1AHHA 5FFXA 3TO6A 3MJSA 1WVGA 2A4KA 2BV6A 3JW4A 1QLJA 4CLOB 1KY4A 2DT5A 1K6JA 1Z73A 3GXOA 3GG2A 3LF2A 3JYLA 5DP1A 2GA1A 3UFXA 1G3TA 1CYDA 1B9MA 3PHJA 4D45A 5J8CA 5L3EA 2VODA 1ZG3A 3CEAA 3GOHA 3LLVA 2XAQA 2C5AA 1ULYA 2JJYA 1HEUA 3L6EA 3PZBA 4BNIA 1VJ0A 1JKIA 3QU3A 3I9KA 1LNQA 4M6XA 1CQJA 3F8BA 3JYNA 2C0CA 4AJ4A 4ZH4F 1J59A 3QWBA 1I3NA 1PS9A 5U9CA 4OXYA 1OOEA 2HYGD 3WTUC 2X0NA 4AIHA 3DBRB 3DZKA 4UVIA 4TV7A 3Q9SA 3M1EA 4KOAA 3LC7O 1CF7B 2BKAA 3OEWA 2WWRA 3RUEA 4IJAA 2Q1SA 3ZWBA 2NQ8A 4CMIA 4HX5A 4L74A 5ILVA 3FF5A 1CGPA 3IKTA 2ZB7A 4FR5A 4P96A 4ZYGA 4PG6A 2EF1A 4YJGB 1DC3A 1LDMA 3CO7C 4L9NA 2P9CA 4CMKA 4CGZA 1B7GO 4ROSA 1IUYA 4IJWA 4XJTA 1P1KA 4CUKA 2OD5A 2QQBA 3ICCA 3D3EA 2JPBA 2R3SA 3GK3A 5T6BA 2UXXA 2F5FA 3PXXA 3N74A 3AUSA 3HSFA 4MTEA 1DDOA 2OBNA 1BC7C 1LLDA 3JQAA 2IA2A 3I5MA 4TRNA 3E5XA 2J5PA 1LQ1A 1HZJA 5JO0A 1EVIA 3EUHA 5AIPA 4N18A 1QYDA 1E1KA 2OP1A 4TKMA 3RU9A 1T38A 3C1AA 2VNSA 5A04A 1PWXA 2BHLA 1A27A 3EETA 3IUSA 2Q0OA 3FCOA 4BGIA 4EI2A 5K5RA 2MLKA 1YL7A 3HFGA 4CR8A 4DIOA 2O0YA 1DLIA 4WEOA 4E5YA 1GD1O 1O3QA 5CVVA 2EWMA 2CYYA 1IHYA 2PH3A 3QWIA 4B7CA 4GWKA 4CDGA 2J8ZA 5T67A 3JYPA 1DEHA 3D4NA 4GX5A 4R9RA 2QX7A 4NG5A 1EUDA 4MIEA 2HOEA 1YVEI 1Z74A 3AY3A 1C0KA 3PFIA 1JU9A 2EV0A 3PQKA 3BMNA 1TA4A 4FGSA 1YE3A 5E1ZB 1SB8A 4U5QA 2QRKA 4DGSA 3SZTA 2E1NA 4YCAA 1DC5A 3EZYA 5DUIA 1ZN2A 1ODDA 2GD1O 4LVUA 2D1HA 3ANNA 3DMYA 4ND2A 1ZK1A 2ILTA 3ASUA 3SC4A 5HBRA 1GV0A 1JGSA 3ZNPA 4U7BA 1WNTA 3I9JA 3OIGA 1Q7BA 1R22A 5F6FA 1R1UA 4WPGA 2HGCA 4LLNA 2WYVA 4H7PA 3ZMDA 3HYIA 1HRDA 4BNHA 4EJUA 3K73O 5B37A 2FA5A 3GNSA 4WXHA 3COAC 2WMDA 3E5QA 1R0KA 2GZ3A 3GEGA 4KUEA 1G0NA 4MQVA 4JJGA 1P2FA 1A9YA 4AWXB 3E9QA 4TZKA 1R6DA 1M76A 4D0PA 3R1IA 4NI5A 4WOKA 5IDQA 4E5NA 1H6AA 3WE3A 2EXXA 1NQTA 1YYVA 2H6BA 3ZMVA 1I6XA 2EP5A 4TVBA 5A9RA 2Y0DA 2DK5A 3D4OA 3NT5A 4MDHA 2CVZA 3GR6A 4RLSA 5LDGA 5LGNA 1OBFO 4YXFA 5CVJA 3P5SA 4J4TA 2O3QA 5DZSA 3ORFA 4NJOA 3DTTA 1OAAA 1C1DA 4ZQBA 5T57A 3W4JA 4BO4A 5G0VA 3NEUA 4M9ZA 3F4LA 1DPRA 4HF1A 5JAIA 3GEDA 1LBEA 5DULA 4D42A 4RPHA 1GL3A 2K27A 1KS9A 1XGNA 1YB5A 3GHHA 3E3VA 4H16A 2D1YA 1Y9AA 4GKBA 3I59A 4WLUA 1MC4A 4YAGA 2FP4A 1N1GA 1LEAA 1DAPA 3Q9NA 1YQXA 2Q50A 2E7XA 4AVPA 3QWFA 1V6AA 3R6SA 4CV0A 1HF3A 2QUFA 4INAA 5FEUA 4OOEA 5DD8A 3JD4A 4GLOA 1OC2A 5KCZA 3MAJA 5CVUA 3SFZA 3V4GA 3HB5X 2CMDA 3T1BA 3DTYA 2FN7A 4IDCA 4IZHA 4XQGA 4JXKA 4I0BA 3IIEA 1J2XA 5DCFA 3NX4A 3AOEA 4BQPA 3U09A 1UB9A 2GZWA 5HVQC 3DPTA 1J5YA 1SD7A 2NTJA 3KSDO 1N2SA 4H3VA 1GXPA 1JWBB 4MP6A 4R69A 4WECA 2MC3A 5F5LA 5L3DA 2Y05A 1QMGA 5JPIA 1CJCA 2ZJ0A 4CLXA 3GHYA 3HQ4O 4J4HA 1OR7A 2EGHA 5AVOA 3LAPA 3JQCA 5D5UB 1DIHA 3C7CB 1Q1HA 4XGKA 4ALJA 1WQ2A 5LEJA 2VRCD 3ZWOA 1USTA 1ZKMA 3ENKA 4MJLA 4I5EA 4EMSA 3HOSA 2HLPA 4BMVA 1SOVA 1IOLA 3TPCA 4LRSB 3WMXA 4NK4A 4EJTA 1GADO 1ZXBA 3U1DA 4Y13A 2VBWA 2P5UA 1B1BA 4FFOA 4IXTA 5AXAA 1U3WA 1C0WA 2EKQA 1ZG1A 5LGTA 1QO0D 1FWZA 4FFPA 5G4KA 4U6SA 4EEXA 2AEJA 4ALMA 1BRMA 3K9TA 1UP6A 4W99A 5JO9A 2STWA 1R66A 5TIIA 3D3WB 2VBZA 2DBRA 1NBOA 2DPHA 1YWGO 3RPUA 4R79A 1NVGA 2PGJA 3HG7A 3I23A 4FFNA 1KQ9A 4HF2A 4CM4A 3WU0A 4K26A 2HO5A 4IGFA 2IZ1A 2VYND 4B79A 2JFFA 2D4AA 1R1TA 5FB2A 3GVXA 5B12A 3IHUA 1R4MA 1DPUA 3KLMX 4FHTA 5TQVA 4XDZA 2KIUA 2CO5A 3KHUA 4EUEA 1XWFA 3NEPX 3CLOA 3F8MA 4IM7A 1U5AA 4XA8A 2XHKA 5ER9A 5IF3A 4XB1A 3ZP5A 1I24A 3NDIA 4Z9YA 4FFLA 4YJHA 3FM3A 2ZB4A 4ESOA 1HE5A 4Z9FA 3SVTA 2GZ2A 2FOKA 4WXCA 1Y6JA 3AUAA 2OHXA 5F3RA 2NACA 3PLRA 1PZHA 1I33A 4CQMA 1MJAA 1H94A 3DPLC 3FR7A 4YBZA 5TX7A 1NNUA 2B69A 5C37A 4IJUA 4M9XA 3F6OA 5A9SA 4FJ0A 3NRVA 1DC6A 4PZEA 1VJ1A 3K8ZA 4IY1A 3RIHA 3I53A 3GZNA 3FHZA 4UUNA 4GVLA 5BMZA 2EHDA 5FF9A 4JBGA 2O3FA 1C0IA 3DEYX 4HADA 3H8VA 1E3EA 3I4CA 5JY1A 4ZZLA 2K86A 5L3FA 4FT8A 1ENYA 4J3FA 3DBHB 4G2NA 1ONPA 1V4RA 4ESJA 3RUFA 2J5OA 5D4SA 3NTOA 4RDIA 2EV9A 4R54A 4RCVA 4Y67A 1KYWA 3ECOA 4EJVA 4YG2F 1HSTA 1IF1A 3B1FA 1I3KA 4B8WA 1SEPA 1ON1A 2CFXA 2PFGA 3IS3A 3VH3A 1DB3A 3ZQ7A 4EYEA 3C1DA 5CDSA 3RPQA 1PDNC 3FNGA 4XSXF 1SO8A 5HS7A 5C7LO 3OFSA 4CM9A 2DBVO 3JQAD 3U0BA 3H9GA 3NT4A 3QVXA 1SFUA 1E7RA 3RQSA 3JTMA 1WAMA 3A9WA 4YB8A 1O89A 3PZRA 1K7AA 2Q2WA 4DLAA 5EERA 2HTSA 2XAFA 1FBUA 1JA9A 3EZLA 5ILGA 1I5RA 3CUKA 4E32A 4WLOA 1E92A 5I7FA 3V7CA 2YFQA 2ZYAA 2Q1WA 3IC5A 4WLVA 4UVHA 3DF8A 5FLXK 3RCBA 3WGTA 1UHWA 5EIOA 3D4PA 1BW9A 4QQRA 2F5EA 2V6GA 2XPCA 4XZ3A 2DPDA 1ZMTA 2UVDA 3NRCA 3V8JA 3QWHA 1G4DA 2F5CA 3H92A 1A7AA 2NU8A 4WK8F 1VC2A 4ZQHA 1MFZA 4YYZA 2VE8A 2OBYA 3KLOA 1P44A 4F7ZA 4HFMA 2W84A 1PX0A 3STHA 3ZU5A 4DVJA 1PTJA 3NUGA 4BHPA 4AFNA 5TC4A 1EE9A 4O59O 3GFIA 2Q8KA 3ZNOA 2IP2A 3BXXA 4J0EA 3OICA 3A1NA 3IWFA 1B3RA 5LDHA 4QFCA 1M66A 3WNQA 4YT4A 1STZA 2NADA 4IXAA 2W4QA 1USSA 3MTGA 5ILOA 4I08A 1G3WA 4N9IA 1ONOA 4KMUX 4RVGA 3I5UA 3KP3A 4WGGA 3V1UA 3KE2A 3GLQA 3TL2A 2IPQX 1SC6A 2L4AA 3E6BA 1YJQA 2NS0A 1JAYA 4MVJA 2ZMEA 4O0LA 3SJ7A 3FSRA 1UAGA 3G73A 2VHXA 3KVOA 4FN4A 3WBFA 1LXCA 1ZARA 2QWWA 1H0KA 3JCZA 1X14A 2IA1A 2NV6A 1R58A 2R7DA 2IEDA 1T2FA 1Z05A 3H3ZA 2BI7A 5EMHA 2AW5A 2MH2A 4JN6B 3E1KA 3K5PA 3TZQA 4E3ZA 4MIOA 5JFOA 2A61A 1P0FA 4F3YA 3F46A 2M30A 1LA2A 4LMYA 1I32A 1R12A 1P4WA 1OZAA 4LSWA 1XGKA 4FC6A 5CDYA 2DK8A 4ZN6A 4Z6KA 1HW5A 2V65A 5BNTA 1VSVA 1D5VA 1B9NA 2IYOA 2YYYA 2JD0A 4KQXA 1EVYA 4KNYA 2X5JO 4EJMA 5L7WA 3JYQA 4BO8A 2X86A 3HTSB 4H0EA 2KRFA 1TEHA 2TDXA 4N5MA 1XCVA 3GRKA 4W7HA 5TSDA 4CMCA 3Q2KA 5DCUA 2AQKA 1JKJA 3DZBA 1UFMA 2YR2A 2JSCA 2L4MA 3GWZA 2Y66A 1H9TA 3PPIA 3RIRA 1FBQA 3V7SA 2CF6A 3G49A 3J7AO 4PIVA 3S2IA 4R16A 2UWMA 1HLDA 1GZ3A 2DUWA 1NP3A 4O6VA 4YJFB 4BB6A 2PKRA 4RZHA 3VC7A 2JAPA 2VWPA 3ISPA 1VM6A 2ZCUA 5JLAA 2EIHA 2HU2A 5FYDA 4LK3A 2NAZA 1B59A 2AHRA 4BNVA 1ZNQO 2D3TA 3D1LA 2PZLA 5LCXA 1ZHFA 3KZZA 1E3WA 3PYXA 4ETSA 4EEZA 3GLXA 2XAAA 1LRKA 1E7WA 2VUUA 4B8XA 1B3BA 2Y1EA 3O8QB 4CPDA 1KEWA 2HRBA 1BXKA 3GVIA 2YHIA 1ZH8A 3KCCA 4CODB 4YIFA 3DHNA 4H15A 4CV1A 4EBFA 4TKLA 4FPXA 1NM5A 1ISJA 1U7HA 3QSGA 4R3WA 3V5NA 4ENNA 2O6GE 1E7MA 3K1NA 3OEYA 4A2UA 2W8ZA 2FSVA 1SD5A 4JCOA 1KA8A 2AQIA 4F46A 4A0YA 1I8TA 4DPLA 4LB6B 4FX4A 3WTTC 2HAEA 1U8FO 5KNLA 4YRAA 5AYVA 3E03A 4OQZA 3AUUA 4N54A 2BH9A 4J2OA 1QPMA 2FZWA 3VDQA 1EEHA 5I7EA 5K0ZA 1TBXA 3WGHA 3CPSA 4Y6SA 3M1AA 5D6EA 4BL5A 2V6FA 1KY5A 1B4AA 3U9LA 3P9IA 4OOIA 1Y0UA 5DCYA 3RKWA 1IE3A 4BNNA 3OJOA 2XAHA 1PGNA 4WLNA 3T4XA 5TLSA 4CR7A 3QQPA 3BTOA 1NPYA 2BE5F 1DDNA 4GGPA 2XASA 2V9VA 2WSBA 4MVJE 4HF0A 3HSEA 4Y8VA 3DEUA 2P7CB 2BMAA 1ZRFA 1G6KA 3MWEB 4QT0A 3GRPA 1R15A 2P91A 4A6DA 2ZB3A 3GGPA 6ADHA 1O94A 1KEVA 2ZCVA 4XDYA 2YY7A 1BI3A 4HOBA 3OQ1A 4FJ1A 5KVQA 2COMA 3HRMA 1M75A 3FXRA 2FXAA 3INRA 4Q3BA 5COQA 3MCZA 2PGLA 4AJOA 2DW4A 4NJMB 4BNWA 1K78A 4ENKA 1UDAA 4RVUA 8ADHA 2EV6A 1H93A 3CZRA 4R1TA 3L09A 4AJEA 3TQNA 1I30A 4KUHA 3TZCA 2C20A 3N7UA 4YT5A 3KEOA 2EERA 5AIQA 2GRAA 1HW1A 3BIOA 3NTQA 4LK0F 5CFZA 4CQMD 3SXPA 1DSSG 2DAOA 3GFLA 1AOYA 3PHIA 1BBYA 1S8NA 2GF2A 3UUWA 5HS8A 1QR6A 5KVSA 5IAAA 2VZ9A 5BT9A 4BO9A 2WD7B 1BIBA 1HDOA 5L95A 1PR9A 5ILUA 2PGDA 1IXSB 2PJPA 5JHUA 3JQ8B 1LDJA 3EC7A 1HYEA 2LDBA 3BP8A 2JHGA 3F5QA 3VOSA 5JDCA 1NFQA 4HW0A 1ZGJA 1U8XX 4HYEA 3TGNA 4HQEA 4HNGA 2RDPA 3GEMA 4PVCA 4HBLA 1YOVB 2J5KA 2LDXA 4IQ0A 4KQWA 1B16A 2VOPA 5JYEA 4WCFA 2PK3A 1KERA 3U2RA 4HQMA 4K6CA 3FD8A 4DBZA 4AJ2A 4KWIA 3WQQA 4Z2YA 1ML3A 1PQPA 2GCGA 2P6TA 3GVAA 5FFZA 1F14A 1O5IA 2B4QA 2D8AA 2X4GA 1WSUA 5L3CA 1PGOA 2HMUA 3FNFA 3WFIA 3NYWA 2HK7A 2W24A 1XYGA 2ZTVA 3TNLA 2ISYA 2QHXA 4QXMA 1XCBA 1AXGA 3PWSA 3ROMA 5BSFA 2JD1A 4CM9D 4LN1A 4YWJA 2G0TA 2PY6A 1RM3A 4JJIA 2KIFA 3V7RA 3L2CA 5DN9A 4HX4A 2UZKA 2OZPA 5D5VB 3TFQA 3CINA 3HN7A 1L3LA 3ZNQA 4AJ1A 1C0LA 4Q48A 4IINA 1XDSA 5HS4A 2P9EA 3KFWX 2QBYA 4AJPA 3HHHA 3B6ZA 3F6YA 3TO9A 4RVHA 4DRYA 5JE8A 4YTEA 3D64A 3GNTA 3VZPA 3IAHA 1T24A 1LDNA 3AOGA 3R60A 2B83A 3KP5A 1QBJA 2BFPA 5D5XB 4J2HA 2DBZA 1G3SA 4ZU3A 1NVMB 4R5MA 3QU6A 1CF2O 1X7GA 1IB6A 3BZ6A 3FF4A 4AJNA 1X1TA 3OA2A 2VZ0A 4UHTA 4MVJG 4EM2A 1LEHA 1ZXLA 1HE3A 4DL9A 3VKUA 5E1WA 1E6UA 3KSUA 2PQ8A 5JNLA 4IVNA 1ENOA 1K89A 5E17F 1LVAA 4FFMA 1LSSA 4I5GA 3EYWA 1DC4A 1CETA 3CUQB 3MWMA 3CUQC 4JBIA 5DNAA 4G8XA 1WZIA 1MUUA 2F5DA 1NASA 3HSKA 2G17A 4PLHA 3E5RA 1H9BA 1GV1A 1N1EA 4ND1A 4XB2A 1A04A 1Y9EA 2X58A 4MVJD 4DLBA 2FNPA 3M8EA 1KU2A 5K6AA 4QEDA 4UREA 4MGRA 2Y99A 3DP7A 3F23A 1E77A 2BGLA 3OV8A 3LQFA 4YAEA 2R2GA 5LC1A 3ONFA 4NPCA 4IBOA 3GN1A 3GUCA 4GPD1 4IXWA 5G0SA 2D2WA 1RPNA 3P2YA 4QX6A 2DVMA 3GG9A 3ROKA 3PJGA 5CEFA 4HZFA 4NB5A 1DAOA 3AU8A 4RVSA 1O3SA 1UZLA 4CMGA 1NWHA 2HZTA 1BDMA 2DTEA 3WTXC 4MINA 4E2XA 3JQDA 4BKRA 4HV4A 2GN4A 3HHPA 2OQRA 3RDIA 3DMTA 2D5AA 3QJ5A 5DP2A 1E1MA 3MZYA 1AWCA 1B2LA 2BI8A 1GQQA 3WGZA 1H2HA 4B09A 2STTA 3F1LA 4L5IA 4IJKA 3ZWYA 1YH3A 5TJJA 4RLHA 4PLYA 1W7PB 3QPTA 2O4UX 3EVNA 2GN8A 2FEZA 1GFSA 4WXDA 1FT9A 4U0YA 3V1TC 1A71A 4A6EA 1U78A 3R0IA 2O3UA 3C7DB 3F4BA 4HV6A 2D59A 3WMWA 4NK5A 3RUDA 5F1OA 5EQDA 1I1SA 2CSOA 1XEAA 3BJAA 1QGPA 2GXGA 2EWNA 1MGTA 1P4AA 5J6XA 2BEOA 1VRWA 1J0XO 3GPDG 4I1IA 1J5PA 4PLGA 3RUIA 4D3DA 4YAKA 4A5MA 1ZJZA 2ACJA 2O3RA 2Q4BA 3QPHA 1D8KA 5HS9A 3KO8A 4L76A 4BQRA 3C7AA 3M9AA 1WMBA 5KKAA 1MGOA 1D1TA 1TVEA 2DM6A 2DKNA 2PA3A 4PZDA 4Z0HO 4IRHA 3ZN0A 4OIRF 4EJOA 2FY8A 3RUCA 3HB4X 3OQBA 3PI7A 1J7KA 2V1XA 4WNIA 2DI3A 4TSKA 3ULQB 2FSWA 2ZKLA 3OSUA 2LSOA 1D7OA 4CM8A 5L40A 1CIVA 4YVFA 4BB5A 1WI9A 2C59A 2NM0A 4EGYA 3O38A 3QP6A 4MKZA 4GYIA 3E9NA 2NWQA 3DOOA 2X0RA 2VCYA 1MFPA 1IRFA 3I54A 2CG4A 3F21A 1EDOA 1L7EA 4A26A 1NQ5A 1MDMB 4Q3AA 3TDUC 4BHBA 1B0AA 3V8BA 1X0XA 2XVCA 1ZEMA 4M6YA 3FWNA 3ONDA 3ITKA 1U5TA 4J1SA 4A5OA 5MGBA 3AFNA 3RJ5A 3HZZA 3RI4A 3MJEA 5CYVA 3G79A 2B36A 2XXBA 2ADUA 2Y93A 4II2A 1EVJA 3ZHYA 4D41A 2ZB8A 4YIIA 3O4RA 4ID9A 2G1UA 1J4AA 1UJMA 2OA4A 3GO5A 4QECA 2DFIA 1D3AA 4NBUA 4PG5A 4YFKF 2PWZA 3MEXA 4IDBA 5L51A 1HBXG 2H94A 1LTHR 3DOCA 4IS2A 1I1GA 5KVRA 4XKJA 1O6ZA 3ZH2A 3A14A 4UV8A 3RWBA 2HSDA 3H9UA 2M8EA 1X1EA 2WTBA 4WCGA 4UVAA 3H9EO 4J49A 1CQIA 4P9FA 1J75A 3H3JA 4UEKA 4WUVA 5L3GA 4NFSA 4UEOA 1G3YA 4CLOA 1ENPA 3KXDA 1C0PA 2GSDA 5IT9Z 1PJTA 1Y8RB 4R41A 3LC1O 5A9TA 4GSLA 3I3OA 2HDCA 1XA0A 4RGSA 5FD6A 2X7HA 2L3DA 1E7SA 3C85A 3BHIA 3NTRA 2NQTA 3WXBA 3WTVC 2G9WA 4LJZF 4MQ9F 3EYIA 5T5QA 2QLZA 4DBVO 4YT2A 1H2BA 3BZUA 5LHGA 2R00C 4Y6RA 3DBRA 2L01A 2GWRA 3RYPA 2ZO4A 3KETA 3ZCXA 1CF7A 3EDMA 1K2WA 4RVDA 2VOOA 1ON2A 4RB3C 2X22A 3ELKA 1UH5A 2IODA 2WE7A 4HA8A 2GN9A 2GA2A 4OH1A 4YEDA 5A5EA 1SD6A 3QRFF 2IXAA 1ENZA 4YJGA 4LFUA 5AOVA 3RFXA 2NU7A 2Q1UA 3W8DA 4JQCA 4RO0A 5D8KB 2VHVA 1IULA 2RAFA 4OQYA 4PDKA 4WF2A 4TVOA 1E3IA 2BGKA 1A7KA 3DOJA 4JIGA 1TLHB 5EINA 2P4WA 2A07F 4BO6A 4PRKA 2C54A 3AFMA 4NFHA 5AXBA 4ND5A 1FMCA 4X54A 2CZCA 1GYQA 3OF2A 3ZW9A 3KYCB 2DAPA 5KVVA 2IA0A 1T25A 2KKOA 1JTVA 3G1TA 4QO7A 1FYKA 1OPCA 2VHWA 3T4EA 4A0XA 4KDPA 4U8GA 3P9KA 1QRRA 3K1MA 2DC1A 3DAPA 3F5SA 2FE3A 1Q0LA 1NAIA 1HZZA 4LMPA 1PS8A 2EFOA 1U3TA 4BKOA 4I5FA 3L4BC 1Y8QB 2VWQA 2ZBKA 3ADPA 3VPXA 2WD8A 2GYYA 3INGA 3IL2A 3ZN2A 1YDWA 2YUTA 4OKIA 4XIYA 2HMTA 2QYTA 3RFTA 2GIVA 3FNEA 3TL3A 1RM0A 1FP1D 1WXDA 4UUOA 2IJLA 1WZEA 5JFRA 3MJ4A 3TZHA 1GEGA 5JAQA 5JY6A 4ZZDA 2C2XA 3U4IA 1RWBA 1EV7A 1IHXA 5FI5A 5EL0A 2P5KA 4I0AA 1U2DA 1ZJYA 2IE0A 4HFRA 2QW8A 5H20A 1QZYA 3H3FA 3FTNA 4O3MA 4KUGA 5HDKA 1CDOA 3F8FA 2VWGA 3F8NA 3BTUA 5DD4A 2V79A 2HEOA 3E8XA 4BYYA 1IYZA 4TRRA 3LF1A 5IN5A 3LAJA 1ZG5A 3L0DA 3DKWA 2ZYGA 2WWYA 4G5HA 2Q46A 4BNXA 4D3SA 4DWVA 1GHCA 2BGMA 2VOJA 2VTDA 4AJJA 4EJ0A 4A12A 4Q3EA 3ZU2A 1N5DA 1TQPA 2XKPA 3OJ0A 1DHTA 1CERA 3DAGA 1YW9A 1EDZA 1A4IA 4IZIA 4ZQGA 3QE3A 1JLLA 4YAJA 4B7UA 1YKFA 1KC1A 1O0SA 4CUZA 4ZYDA 3VH4A 4NBVA 1IAWA 1YS7A 3HNPA 3G0OA 3D0OA 2PZKA 2YQ5A 4K6FA 2C82A 2XUBA 2J3JA 3ON5A 1NPDA 2J3KA 1ARZA 1R5GA 2Z1NA 3OOPA 3BMOB 5I9MA 2P7VB 4AJHA 4CM5A 4DTIA 1U8RA 1E6EA 2HWVA 2E82A 4PFJA 1DUXC 1C1DB 1PJ4A 4KIGA 3CKYA 3GY0A 4L4XA 3IP3A 5J23A 3DDNA 4BS9A 1EQUA 3JQ6A 3KP2A 3NGLA 4Q3DA 5DCMB 4L0YB 1UAYA 1PWZA 4FW8A 5THQA 1Q1NA 3T8TA 2Z99A 1ZRCA 2VRBA 3C3XA 3ENNA 5BNFA 3EY4A 3B20A 1KU9A 2IRFG 3ZWNA 3BROA 4CMBA 3K2BA 4K1LA 1C3VA 1A9ZA 3BJOA 3LC2O 2JRTA 1Y1PA 2J3HA 3RC1A 2DU8A 5C7OO 2JKVA 4J7XA 3ABTA 5TNXA 1FY7A 2VUSA 1F8GA 3Q0EA 4DUPA 2HKOA 3ZMZA 4E13A 1WLYA 2G7HA 4FCCA 3JQBC 1YB4A 4JP3A 4RB0A 5BSEA 2DO7A 4KIFA 2YHUA 3U49A 5BPDA 1NAHA 2RHCA 3H9JA 1T1SA 2AA3A 2DBBA 2GAUA 4OHUA 4BNZA 3VODA 4IDDA 3BTVA 3M2TA 3ZHZA 2P4HX 5TT0A 3F3XA 1LQTA 4LD5A 4KA4A 3JSPA 1IPFA 1ZW1A 3QVSA 1TB4A 4RV9A 3VHRA 3AW9A 1SMYF 4G7HF 4URFA 4LB5A 1ZYRF 2B5WA 3B1KA 3DAFA 5JCJA 2B35A 3A28A 1PR3A 1BGVA 3P7MA 4Q4ZF 5B4UA 3BDDA 5LHHA 1KYQA 4ITUA 4A73A 3L00A 4RAZA 3DZFA 4NR0A 1RIOH 1N92A 2O8XA 2QVOA 1BVUA 4D7AA 3BYZA 5L4SA 4P4GA 5ENVA 3D3WA 3ZHXA 1HDRA 2A3SA 2A69F 4G7OF 4IHSA 4RORA 1QKIA 1V3VA 2BBYA 2RNJA 4L9VA 4CLRB 4BNMA 3NJ4A 2X5KO 3A06A 4O63O 5JC8A 2X9GA 3L4SO 4UAGA 1OMOA 3ZI0A 4BV8A 1ISFA 4M55A 3FX3A 2PD3A 1XMAA 1KU7A 4G81A 3ETGA 3FXUA 1ID1A 3PGXA 4GMFA 4E31A 1SD4A 1SFEA 4O1MA 4FDAA 3JAMZ 1LDEA 1PP7U 2HJSA 4LRTB 1JVBA 1S6LA 4IRGA 1MJBA 3DBVO 2G82A 3NDJA 3IJPA 5L45A 4WLEA 1YW7A 1J0RA 2Y48A 3I71A 4KMFA 1NTOA 2DBQA 3UF0A 5KJFA 1KVQA 3V8LA 1DP7P 1UHMA 3AAFA 3Q9UA 2WE8A 4RGBA 1Z9CA 2EW8A 3W4IA 2HR3A 5G2OA 1P1HA 2PG4A 1GYPA 2W2KB 1W4ZA 2Q49A 2G5CA 1R1VA 3L9WA 3RSHA 2QZZA 4BO2A 3IWZA 5ED4A 3KRTA 3PQEA 2GXBA 1PJQA 5HA5A 1Z7BA 5CVRA 3DBLB 2X9VA 2HTJA 1FNNA 4BHCA 3ANMA 3OQ6A 2A5YB 3BPVA 3B73A 3FHLA 1ZFNA 4GWGA 1LJ8A 4RF5A 3DBHA 3DR3A 4XWYA 5IZCC 3ETDA 3IUPA 4OU0A 3N97A 1E5QA 3G3ZA 4ON0A 1QYWA 1ZSVA 4M86A 4RL6A 3N58A 1B14A 2O7QA 5LHIA 3OJLA 4XSZF 2ZFWA 1TTYA 1EK5A 1MV8A 1AE1A 4FGWA 4FIZA 2BD0A 1YO5C 4CQLB 3O03A 2IW5A 1FDWA 3ZU4A 1G0OA 2O2SA 2QIOA 1U3EM 1D8JA 3GFGA 2UAGA 5FI3A 3MJTA 4L0ZB 3VDRA 4RQUA 2GGSA 2YW9A 5IZ4A 3LFKA 2Y0EA 1X7DA 3TN7A 4M9SA 1SAYA 3RYRA 4IDAA 2LF8A 1FF9A 1V8BA 3AY6A 4PGFA 1RZ4A 1FDSA 1GY8A 1LQUA 2E6UX 4HX7A 4L5JA 1HW2A 5BOXA 4A2CA 5I7SA 2P9GA 1BXGB 1T4DA 3GT0A 4CLDA 1YS6A 4YRBA 4XGNA 5HWSA 1V9LA 2P2SA 2Q1TA 2EFPA 4CJXA 5DYMA 3U4HA 4I8XA 3FMQA 5A05A 2PD4A 4CYDA 1Z45A 3OIFA 2B5VA 1P1RA 4ZA2A 1KGSA 3RU7A 2RC4A 3RTRA 1ADGA 1QP8A 1Y81A 4S3MA 2I65A 1YDEA 1O7FA 4AIKA 4ND4A 4KT5C 4LW8A 4XBFA 4DMLA 4I5DA 1ZEJA 2UUOA 4BO0A 3ASVA 1FSHA 3ZN1A 4WJZA 3GDGA 1U1IA 1YQDA 2NVWA 4WK6A 1JE8A 2LNBA 3TOXA 1IN8A 1U3UA 2RV8A 4KZPA 5TT1A 1K5HA 3AM4A 4NBTA 4PG4A 3HDYA 3R3SA 2H27A 4P22A 2Q2EA 4LISA 5IDYA 3SLGA 2A6HF 2OL4A 5IG2A 3K31A 3PYMA 4ALNA 4ALIA 2M87A 4EV0A 3I4FA 1FDVA 3MEQA 4RF2A 4TQGA 5KJEA 3X2FA 2K02A 3C8MA 3LA7A 4G65A 2ZYDA 4GKVA 3AM3A 1T0FA 5EN4A 1WRJA 1TT7A 5GMOA 1BI1A 4BH9A 3HN2A 4RB2C 1FSEA 5A06A 1XMKA 5T64A 1LX6A 4GGGA 2DLLA 4A0ZA 2J6IA 4FJ2A 4BAYA 2PKQP 3WQSB 1YL5A 2C2YA 3TOAA 2VONA 2CNBA 2F1KA 3QOPA 2YDYA 4OO3A 1KVSA 5U4QA 1K79A 2H6CA 2KJCA 1XN7A 3LU1A 1LDDA 2X5OA 2YFHA 2BRUA 3L77A 4NFYA 1FYMA 4Y15A 4UVDA 4ZRNA 3VPHA 4AIJA 3PQDA 3WX0A 2FQ3A 4KDEA 1P1JA 2CW0F 3UKOA 1RUOA 3PDJA 2HRZA 1DIAA 4I2OA 2GR9A 4ONEA 4P9UA 3DQPA 4RDHA 4PLZA 4EZBA 3W6JB 5KWEA 3MFKA 4BGUA 4R1UA 4QLCU 4HLXA 1JKFA 4IGEA 4RF4A 4UEJA 2QQAA 4Z3DA 3PFWO 4NBRA 4F45A 5CEEA 3IRRA 2E49A 3AY7A 3ERED 4UUPA 2OOSA 4FQ8A 1YGYA 2ZTUA 4N5LA 3VPFA 2BFMA 1GPDG 1H5QA 4YJFA 1HXDA 5ICGA 2E1CA 4XD2A 1ZO8A 3ZWCA 2AXLA 3VKVA 1T4BA 1R7JA 1OC4A 2CY0A 4B3HA 4IJVA 3WJAA 1SCUA 4G6QA 3HTUA 4MNUA 1Q7GA 4D44A 3TDKA 1I2ZA 1T26A 4BKUA 1KQ0A 4MTDA 4J6FA 2XAGA 4MEYF 2C6YA 2Q2QA 3R0JA 4DQXA 1HE4A 5JMWA 3O8QA 4KFCA 5CAEA 3GMDA 4M89A 2EKLA 3PHGA 1DRUA 2O61A 2ZIZA 1YLFA 2R7FA 1F5TA 1QORA 1XGMA 3C1TA 4Y6PA 2X23A 2K7LA 2VN2A 1NR1A 1YBMA 3BMCB 2PV7A 1TLTA 4P4LA 1DPGA 4ZVVA 2PMHA 1GR0A 4CHUA 5DBFA 3JYOA 1LNWA 3BPXA 3PWZA 1LDBA 1ZZEA 5CHEA 5FD5A 3DHEA 5HLGA 2ETHA 4A7PA 4YPOA 3INTA 3F72A 1B8VA 3D7LA 4M8SA 4PLVA 5HLIA 1YTYA 1R23A 3WR5A 3EQLF 3GDFA 4O5OA 5HDGA 3MJCA 5EEGA 5THKA 4RPLA 2VBYA 2JCVA 1BC8C 3LA3A 1E6WA 1NWCA 4OM8A 4DPMA 2AEMA 3PP8A 1IXCA 1PS0A 4OJNA 3WLEA 1MB4A 5IXYA 5JCJD 4KN4X 3NV9A 1LC0A 2OBPA 1ZK0A 3U5TA 4R51A 3LT4A 4L9RA 4XYLA 4TROA 4RPGA 5COAA 4U0JA 4XR4A 3KOUA 5F1KA 5K9ZA 1W8DA 5JDIC 4D0RA 3GUDA 2I3AA 1AHIA 2JHFA 2VYVA 5H6RA 3ZU3A 3ZZNA 5IJZA 1MA0A 1ZBQA 2AQHA 2HUNA 3BA1A 3FRJA 4IIVA 4DLLA 2VWHA 2HKXA 1XIVA 1GZ4A 2NVUB 4Z0PA 1TNSA 2OU2A 1WDMA 2ESNA 3ZMUA 4JK1X 1V3UA 3ZPLA 3R0AA 2EJRA 3LT2A 2FBHA 4E30A 5IDXA 5B4TA 4NJMA 2A68F 2HFHA 1MX3A 3QA9A 1DFHA 2UDPA 3EMKA 1OYYA 3RJ9A 3JD3A 5DDIP 4E5MA 5CDGA 3GVHA 1ADBA 5AQ1A 1U4SA 3AUTA 2DTDA 4UUMA 1R4NB 2H5LA 2GLXA 2Z9OA 5KTKA 3WWYA 1CRWG 1W6UA 4LK1F 4BO7A 2H9IA 1Q2XA 1YJ8A 3T7EA 2VHZA 2JZYA 1XSDA 4EW6A 3C24A 1OYIA 1LRLA 3BOQA 1Q7CA 1Q0QA 4S04A 4OMYA 3FPCA 4XRRA 3FM5A 3GC6A 3SQNA 5L9AA 3GZ6A 5EJ2A 1SBYA 2D2IA 1UR5A 5DT9A 3D0SA 5ICEA 2CDCA 2E7WA 3D5QA 4GX0A 3MZ0A 2XKOA 4I09A 1BXZA 2WD7A 3JQGB 4MVJF 4YRDA 4BGEA 2Y1CA 1F06A 3JQ8A 1ZVMA 3I9MA 1EZ4A 2EEZA 4HX8A 1O7LA 3IDSA 1SEVA 5D5WB 3AM5A 1E3SA 5HS6A 5FFFA 5ILSA 5K5OA 3O26A 3GYHX 3CTMA 3M7GA 5GZ3A 1BMDA 1FDTA 1VL6A 4YQYA 1ZIDA 3TZKA 3BTSA 7ADHA 1YOVA 3QVWA 2JL1A 4ND3A 2H63A 2XRNA 4OOFA 4R1NA 3ZDFA 2HK8A 3GUYA 1P1IA 1VSUA 1FPQA 4LGWA 4LG0B 3QWAA 1G6NA 5EESA 5H81A 4OIPF 2IYPA 1NX6A 1A4UA 4S1VA 4XYEA 1V35A 2QM3A 1HWYA 1JWAB 4JNKA 1J6UA 1PGPA 3ZV3A 4IMRA 3G3EA 5KJCA 4O5VA 1PJBA 2UV8A 2BELA 3KLPX 2W90A 3CMMA 1Z6TA 2PNFA 2EG9A 1NVTA 1ZGAA 3K0LA 1SZJG 3GGGA 4QO8A 3UICA 3CMCO 4IPAA 3I0TA 1T2DA 1R5HA 2NTVA 2QG4A 1JQBA 3QVOA 2Y0MA 4KICA 3DFUA 1E17A 3Q3CA 4UVGA 4M72A 4B3IA 3WGOA 3KYDB 1GQYA 1SPXA 3CUOA 4DMMA 2W2LA 4HKTA 4DQUA 2AXQA 1T2CA 3F6VA 3NJ8A 2Q45A 3ZGYA 1GAEO 2CGPA 3WTCA 4JROA 3NGXA 1J49A 4RB1A 2FF4A 1DJQA 1E5LA 1IN7A 5H6QA 4WWCA 4N9HA 3F3SA 1BOAA 2W57A 4QWQA 4W9NC 1TXGA 4U7WA 1B26A 1DIBA 3DWFA 2OQGA 4L18B 3JQ9C 4JBHA 1O3TA 4L0QA 3WSVA 4L9TA 3W6ZA 4P8RA 4G7ZF 1M6HA 4CICA 1Z1DA 4XGIA 2ZATA 3HOTA 2DUUA 3FTPA 3MOIA 3DL2A 4LSMA 4XCVA 4ZRMA 1YFHA 1REPC 4DC0A 1Z82A 2FOIA 2I66A 5IFLA 3UAGA 1LB2A 3TOBA 3MJVA 1CEQA 2NSDA 2VZ8A 3BHMA 4R1SA 2YSRA 3QRWA 3RASA 5JAMA 3QIVA 3CUQA 4I02A 1GUZA 3K2EA 4OIOF 1IUKA 1E1NA 2DTXA 2LF7A 2QYSA 2FZEA 4ESBA 1LUAA 1IN4A 5HOOA 1V3TA 2O7SA 2PZJA 4TRMA 5GZ1A 3E5UA 3GGOA 1YW8A 2DPGA 4FFRA 4WX9A
chains in the Genus database with same CATH superfamily
4UNIA 3QFRA 1X3UA 5LMZA 3LHFA 1SK8A 4E5PA 3LCRA 5B3KA 3GIWA 2BYVE 1WXEA 5HF8A 2OV1A 3CDLA 2FMYA 3HXKA 4PSCA 4D9IA 3SFTA 1S3FA 2PG3A 1X92A 3LCUA 1MOPA 1YBHA 1W7PA 3BWDD 2RQPA 3K4CA 3ML6A 1Z7GA 4JOMA 5D8LB 1N9GB 2VRWA 4ZO7A 2K9LA 1C9YA 4BCDA 1UXJA 1ZJJA 5KYWB 5E20A 4HNRA 5LM3A 4ON9A 3MMYB 3DEIA 1KKLA 5AICA 4Y2GA 3T9BA 4G85A 3QXCA 2O8KA 2E1RA 1WP9A 5IFKA 4MPDA 4DBQA 2YWGA 2GAAA 4OMZA 2O4CA 1SAUA 3ONWA 4V0LA 2YHSA 3K0AA 4KQIA 3VHXB 5BW4A 3DKVA 2VYVD 4C3UA 4YA6A 5KTNA 4DYDA 3ELYA 1RJGA 4RGRA 2JIRA 4Z0TA 2IXFA 1EJ0A 4YH1A 2OORA 5PNTA 3AHEA 4BU2A 3KKOA 3H18A 4Q7LA 3C3MA 3L8HA 4E33A 2JAUA 1Z0KA 5JW6A 4FHFA 3FUUA 3DGEC 3X1XA 4OGGA 4ZCIA 4XMYA 3JQAB 2GK6A 4TGLA 1HBJA 4MGYR 4ESEA 2IP4A 1T0IA 1L5SA 3TIFA 2MWMA 3EPPA 1HKSA 4LGVA 2QL6A 2AQFA 3E9MA 2XAJA 1PKEA 2XQKA 1U7OA 4CLHA 1Q0HA 1N6KA 1UPXA 3FYHA 4UFNA 1E8DA 1FK8A 3DEAA 1T6YA 4FXOA 4GX1A 1W19A 2VPWA 3AVYA 1WSAA 2R8EA 4J94A 3EF0A 1JDJA 3WB9A 1YD7A 2J5RA 1I6WA 2A78A 3JREA 2HCJB 5CXQA 5HUHA 3WG9A 3M0EA 1U31A 4Y98A 1JKOC 2PM8A 5H1YA 1SCDA 4RELA 5KU1A 1SIOA 1SURA 1JPJA 4OIMA 1QGOA 2WM3A 3KR9A 2OSVA 5DLQC 4Z9XA 1OR7C 2BKVA 1NATA 2I6FA 5L53A 1JALA 1MLDA 4BLVA 1RYNA 2JFHA 2RG7A 3EK2A 3B7PA 5I5GA 3ZWVA 2I29A 3NKLA 4BPBA 3ROZA 4BE1A 1BFKA 1CTQA 1XDBA 3A58B 1Z6AA 1Y4UA 4FFBA 4YGXB 2QLTA 4U6QA 2CE7A 3LT5A 1FSSA 3C7TA 3U4GA 5TVGA 1WCXA 3RYCA 1I50J 4R2MA 5K51A 4XR9A 2FMLA 2OYRA 2RH4A 4IUYA 2G04A 4EENA 3L2UA 2R8RA 2X4DA 4F5EA 4AKGA 4N7JA 5F73A 4MX8A 3RVOA 4LDPA 2RGVA 5B5EC 2LCIA 2AVDA 2E5NA 4EPVA 3KTFA 1DTEA 4E3WA 3DYIA 1J97A 1KE2A 1IZ0A 5I4KA 2FG5A 1ZTRA 2QN2A 1K4TA 1P9LA 1KQNA 3C18A 4D8UA 3LD9A 4DQ2A 2PZBA 4F7WA 5BSUA 5F1RA 3WL8A 3VPDA 2PSSA 5EZSA 5KNDD 4EUKA 1V1RB 3CCCA 1O4XA 1U0LA 4TYYA 2X0IA 3AZQA 4JZYA 3VVMA 3VOAA 2IYLD 5DB4A 4HRIA 1OX5A 2A6TA 2QYHA 3F6PA 4B3JA 2V1UA 5CUQA 3ROEA 3P9CA 4JL5A 2HSGA 2OXIA 2RAPA 1G8AA 1Z7LA 2I6SA 3FGPA 4MS4B 1URPA 3TECE 2VEOA 1IVSA 2ZROA 1MB2A 3OYCA 3WV5A 1WPGA 5BS6A 4HYTA 4MO2A 2K85A 1FEZA 2DY0A 3T5GA 2R7UA 4WESB 4BFCA 4P80A 3IDQA 4HV5A 4TSRA 3WWOA 2JARA 1DQSA 1XU4A 1JR3E 2V98A 3GDWA 3N2KA 4PAGA 2RCYA 1M6VA 3JTHA 1GG5A 3EC1A 2OUMA 3WS7A 4F6CA 4KXFB 3LGSA 1N7IA 3ISVA 4PY2A 3QAHA 2F1JA 3P5BA 3VI3B 5AVWA 2C4TA 1S7GA 3LSHA 5BNZA 1TFUA 4OYRA 4BQAA 2WNSA 3HZHA 3AF3A 4RZ3A 4WXYB 1GFZA 4OH7A 4O4LA 3W9BA 4OFXA 3S14J 2RIRA 2ZXFA 3GP3A 4Y6GB 3RSSA 4QHSA 5K6RA 1CUBA 2YYAA 2XB4A 4KXYA 3SR4A 5BMVA 2RB4A 2HU9A 1OR8A 1UKZA 2GA8A 1JL3A 3AI1A 4IIJB 4BDZA 1KJIA 5DRTA 4Z99A 3ZXYA 3AKZA 4UUSB 2PMBA 4H4EA 2DKFA 1LE8B 1KQ8A 2YV2A 3FZVA 1G2IA 3KQSA 4ARSA 3CZMA 1CJTC 5IXSA 3SHWA 2ZI6A 1VHQA 4HNAB 2C04A 2WP0A 5EJ9A 1U2GA 3G82C 1IY2A 1E3QA 3E5HA 2XUKA 4QTZA 2Z08A 4EGFA 4N40A 4XIFA 1RHKA 3EF1A 3EISA 3GROA 1OV4A 4WEQA 4CCLA 1AKEA 4GR5A 2XLCA 4BLSA 4RXMA 1A5SB 4E5VA 2WB4A 3BH7A 3P96A 5EGSA 5T8KA 4BVAA 2A9JA 3DDWA 1CY8A 3OYGA 4R3UC 1FLVA 1P6UA 3RRZA 4D56A 1N5KA 1YO6A 3B9RA 4MGKR 4MI9A 4EB3A 3AHCA 4NATA 4CI9A 1FU4A 3HCEA 1F0NA 1FTYA 4XOPA 2WSMA 2CHVA 3FXLA 3F78A 2Y1GA 3VR6D 5DSTA 4HRAA 3WNZA 1L7QA 4KSCA 2EARA 1TNDA 1CF7B 4IJAA 4KI0A 3VYSB 1KK2A 1L7OA 3QF4A 4L9NA 1OROA 2C58A 3H0EA 3PXXA 4L3WA 3EA5A 1YC2A 1XX5A 1U2ZA 3KQNA 1IPHA 3W2AA 3EUHA 2OCLA 1QYDA 3PNVA 3C8DA 3C1AA 2VNSA 1C7JA 2CXRA 3R24A 7GPBA 1KSGA 1EDEA 4S24A 5T67A 2QXTA 3S1NJ 1NVBA 1YVEI 1CR1A 2DT8A 4PZZA 2LUOA 4ZAWA 4DGSA 4CCAA 1ZN2A 2HY7A 3LP8A 4RGVA 5B3AA 4X6XA 2QTAA 1SN7A 1IWBB 1SWVA 4BNHA 3V3TA 1R0KA 3GEGA 1ANKA 1M76A 3DVLA 3QLUC 1NVWQ 3WE3A 1VE5A 1ZGBA 4MDHA 1PNOA 2LBPA 3QEJA 1M5TA 3AWIA 3E3VA 4H16A 2J07A 3VSKA 2L9RA 4NZPA 3N0RA 4ZAXA 1DTWA 1R8XA 2CMDA 2X7JA 2FDXA 3DM5A 1CQXA 2I6UA 5HVQC 4H3VA 3RTDA 3KSDO 3PDIA 1LPPA 1TPYA 3GHYA 1I51A 2CXOA 1GTRA 2AFHA 3SS9X 4JJAA 1M2NA 3WDLA 3BJMA 1ZIOA 4EJTA 4B3FX 4Q00A 1B1BA 3OWOA 1Z2CA 2AEJA 4XTRA 5K5EA 1NVGA 5J2TF 3IHUA 2JRLA 4FHTA 4XDZA 2H1VA 4LF6B 4S0HB 1I24A 1NRWA 5IYZB 4H9GA 1TM5E 3P27A 4G0WA 2OHXA 4HAUA 1AA6A 3B3FA 2ERYA 2NXEA 2QNBA 4IJUA 1N7JA 5FTLA 5KC9A 4Y2QA 3QODA 5EZQA 3K2AA 1FS6A 3CUWA 3MUEA 5KS2A 1D09A 3IUMA 2I54A 3TKLA 3ZHRA 3G0IA 4MICA 2I2WA 2H00A 2EJCA 3FNGA 4JC5A 3IPLA 1YZHA 1SWWA 3PT5A 5AKJA 5EERA 1BE0A 3WNDA 1H8HD 3CUKA 4E32A 4EA6A 3ZYZA 1TQHA 3CCMI 3RS5A 4B3RB 2CLHB 2UVDA 3TIIA 4FX2A 5K3AA 1EFPB 1NG6A 4HSRA 5FPSA 1R64A 2BKEA 4NJEA 3W9UA 4QGHA 3FMVA 2CNDA 1REQA 3I5UA 4PRZA 2IPQX 4AKHA 1O6GA 3WBFA 5LZ2A 2BMEA 1CS0A 3JVEA 2QWWA 1H0KA 3S44A 2BI7A 1MVNA 4LMYA 5AM0A 1HMYA 2X0KA 1T35A 2OV6A 4Q0MA 4Z6KA 2X5JO 5L7WA 4BO8A 4HNTA 3GP8A 2G1AA 3T94A 1NLZA 4BB6A 4HDSA 3MS2A 5BRJA 4U2EA 1VM6A 5KBYA 5FYDA 1B59A 4B3GA 4X90A 1E3WA 1X70A 3JRGA 2A84A 2VF5X 2GCOB 2OZLA 4X1YA 4C0AC 5EJFA 1BS1A 3G02A 1ISJA 3QSGA 1XD9A 2HK6A 3K1NA 3U3RA 1E9FA 3SHVA 1YQWA 1UJ6A 5JAUA 4BMOB 4CEHA 3NTXA 5I7EA 3OG9A 2Y9MB 1F7UA 2V6FA 4KVZA 4REQB 1DP3A 4M37A 1PGNA 3HABA 2NVYJ 1P6QA 1XTUA 4HATA 5AK0A 1DDGA 4RYDA 3WC4A 1GNVA 3MJHA 4HLDA 4MHOA 1T1GA 1GL6A 1S02A 3INRA 2VFAA 5BWNA 4WI1A 2E3JA 1TCUA 2C20A 3SDSA 3ROGA 3I2YX 1PYOA 2Q5IA 4HUQA 5DTIA 1QR6A 2IVFA 2VZ9A 5L95A 1YZGA 5ALIA 4HYEA 4DLRA 5DM2A 2JPDA 1YZFA 4YLYA 2PK3A 3EAFA 1KERA 1UJ4A 2WUDA 3WQQA 3HRIA 1F14A 5C2JB 3SAJA 3OLZA 3WRYA 4QXMA 5TQJA 4ZDKA 1H89C 5EGNA 5FRMA 4NYIR 4HX4A 4CI0B 2H2GA 3IJ5A 4BJHB 1L6RA 1OLTA 2XX3A 3TO9A 1FVHA 4M46A 2AUNA 2B0CA 3FF4A 1X1TA 1ZQ3P 1BN7A 2QTLA 1PD0A 1ZL0A 3VPCA 2RAUA 4G8XA 2PS9A 2F5DA 3MW8A 2C9DA 4RACA 1N1EA 2MR5A 4FOTA 2CLOB 3M8EA 4NPCA 2Y9YA 2D2WA 2CW8A 3GG9A 4DMRA 4ETWA 3PF9A 4I1RA 3RDIA 4EAQA 3HJTA 3ND6A 2XE7A 3HMKA 3QPTA 2OLKA 4A8JA 4XFKA 3QZUA 2BPOA 3DAHA 1XEAA 4INAA 4IDCA 1P4AA 3E5NA 4E09A 3QPHA 4CYCB 3ZHOA 5KNCH 3SZGA 3HB4X 1EH5A 2LSOA 4EGYA 3R3VA 7MHTA 1SKUA 5LZ4A 1GGEA 2IH4A 3PC3A 4EYKA 1EDOA 4GECA 3Q3JB 2DLNA 3DE2X 3EN0A 2WOJA 3M33A 4K8RB 5TEVA 2B36A 5DHTA 2FEMA 1NG1A 5IABA 5JPCA 4C78A 5FOXA 3Q1KA 2VUMJ 1B42A 3KK0A 4HJXA 4IDBA 2BFEB 2HSDA 4ZVRA 4C08A 4WUVA 1I80A 5B1SA 2BHYA 4Y7NJ 3IX7A 1R9MA 3JVVA 4BN0A 3I3OA 5BY2A 5FD6A 3RLIA 4PE5B 1Y48E 1QPBA 2H52A 1QZUA 3G9XA 2XUPA 4HDMA 5BR8B 3PBKA 1MH3A 2H8GA 3V8RA 4NZYA 4KZKA 3MJFA 4RH3A 2P4WA 5JSHA 2ZJQF 3ZW9A 4QO7A 2VHWA 1RKVA 3P9KA 2Q3BA 2OGZA 2WD8A 3INGA 1FTTA 3I0MA 4ME6A 1XEXB 3TL3A 3MJ4A 2QRZA 3DLAA 1EV7A 1H8EA 2YVAA 1YI2I 1VLZA 3H8JA 1L5ZA 1P72A 3F8FA 2EYUA 3BH0A 3F74A 1XMIA 2AJTA 1KR2A 3LOQA 3WFZA 1MO3A 4KYIB 3QNUA 2G6TA 4DV2B 4A36A 4AWXA 3B1VA 5EFOA 1RZ3A 4I50B 3TXXA 3GJ0A 2Q5LA 1DBQA 3C3EA 5KPJA 3RV4A 1PJ4A 3WGLA 2FFBA 5EXSA 3KP2A 3YASA 4X97A 4DZRA 3EY4A 3LFHA 3FPFA 4FTHA 1XJWA 1N5IA 1NMEA 3WE7A 3PC6A 3ABTA 3ZQCA 3MUOA 2ZPTX 2V9CA 2GAUA 1ORWA 4U6NA 3M6FA 1KO1A 4XDHA 4ZGGA 2PRYA 1RIOH 2O8XA 3C3BA 1Q15A 1ZMRA 4RIFA 1QG0A 5FTJA 3Q7QA 4V0QA 5KHDA 1VJRA 4JDUA 4G81A 4BQFA 1S8AA 2WZDA 3LDGA 2HJSA 1L3IA 3IJPA 3CNQS 4KMFA 2Y48A 2DBQA 3BWVA 2VQ6A 3EVDA 1QJCA 3RABA 3PQEA 5FWDA 5HA5A 1S72I 2QEXI 3NQ41 3RSOA 4HGZA 1F8UA 3TW0A 1MQSA 3TGLA 4CQLB 1D8JA 2Q0HA 5IHPA 3K4KA 2YW9A 5EHGA 1FF9A 5H3HA 1D2CA 2P2SA 4WA7A 2K87A 2CJPA 4AD8A 2DCMA 4M1KA 1VA5A 1PK9A 3AVPA 3LUFA 3AFIA 4FFDA 4UTVA 1Y81A 1P80A 2FUEA 4CETA 4QNRA 3GARA 2DA4A 4C6TB 2ZVQX 3B13B 3DMPA 5TT1A 1V95A 4HCJA 4NF2A 5IG2A 2J30A 3WK4A 1C7QA 4C3OB 2GNOA 3ZIAD 1T9HA 4JBLA 4DCGA 4A0ZA 3M4ZA 1NXSA 1XN7A 1FYMA 5BN1A 2Z04A 4IIBA 3N70A 1DJOA 1JNXX 3W0LB 3SYLA 1OCPA 4CKWB 3D8TA 3W6PA 4QOJA 3TDKA 1T26A 2J4CA 1UDXA 4DQXA 4LZLA 5CA0B 4WJLA 3ZDBA 1JKQC 1ZD1A 3CURA 2CMPA 1LNWA 1PT8A 2EFDB 4M8NE 3WGMA 4XM3A 3VO9A 3QPDA 3GDFA 3I30X 3Q40A 1XZHA 1KPIA 2NUAB 4F72A 4OHMA 3U5TA 4KN9S 5AM3A 2Q4TA 5FORA 5JDIC 1DS6A 3MS4A 1KJNA 1OA0A 3OOUA 2ZS8A 1GZ4A 5BN5A 3FJ1A 3CZQA 5KEIA 3CMEI 3F6BX 2ONCA 2X9DA 4FYPA 4JLPA 2H5LA 3EZ9A 1W6UA 5LD2B 1OYIA 3TLGB 1T29A 1NMSA 2JCSA 2CDCA 4GX0A 4I09A 1KK3A 4ASUA 3G0HA 1F06A 4NOMA 2NPFA 1E3SA 1TLLA 3R9XB 2UUZA 1QO7A 2DFTA 1EXWA 3QWAA 3E7XA 3OBIA 1HWYA 3HCBA 1X8LA 3AFOA 1CS4C 1E2PA 4M1TA 3FDJA 4P4SA 1ZGAA 5K8TA 1FLAA 1T2DA 1GJRA 4HKTA 5FO0A 3PEWA 1E5LA 2MSEB 1YQEA 4DSNA 1USVA 4L18B 4JBHA 1T0PA 4X3CA 3UAGA 5AW0A 1X3SA 3BHMA 3Q0TA 2VPYA 2HOSA 3KCNA 2LF7A 2QZ4A 4OM7A 1A7UA 5HRCA 1VLLA 5KQMA 3LQ1A 3ZQGA 2IE8A 4K6OA 4BP3A 1KO4A 5FB3A 2VPIA 4CO8A 4BNTA 5A03A 1Y1KE 2JWTA 4A1FA 4UE2A 5KINB 3TFOA 3OZ7A 4OGWA 4J6EA 2CHUA 3ILSA 4TV8B 3M5DA 3DO8A 1D6NA 4XVHA 4M38A 5CJPA 4K2EA 2O3TA 4J16C 2H17A 2V9PA 3TQIA 2XZLA 1VCHA 4LHYA 2ZRJA 5I4BA 1QXSA 1ZM4A 2CYAA 3LAWA 3FGOA 1EE1A 2OXFA 1X1SA 2AD5A 3HUGA 5FBHA 4IMPA 1YB2A 4U0VA 1AS0A 2HXOA 1ZRDA 1S01A 3E27A 1KMNA 3DV8A 3U4CA 1LLCA 4A0FA 5FKMA 3ILYA 5HFJA 2FZLA 1K8XB 6REQA 3NBQA 2OHFA 3IP7A 1O03A 4KACA 3NBUA 4GL4A 4BXOB 3R7DA 3MT8A 2A5WA 1B74A 1RE1A 2O3JA 5CR9A 3PQ6A 4UBLA 4B3XA 5JH7F 1MTZA 4FGLA 4ZZIA 5F9HA 2D13A 3NDBB 4WIAA 10MHA 1RXVA 1K88A 1XRNA 3VVCA 4IKFA 1JN0A 2PD6A 3IP8A 4JXZA 2OQ2A 5HQ3A 1CY2A 5FJ8J 4ZCTA 1WPQA 1WB6A 1NNSA 2VXOA 1SIUA 2XITA 3L6DA 4E2WA 2QVGA 1DO8A 4PYLA 2IUEA 1Y1LA 4RTJA 2HLHA 4GXTA 1LFDB 4UVCA 4P7JA 4AG3A 4F9EA 2JLVA 4YFXF 4G94A 1I3MA 4OI4A 2IA5A 3I61A 2MINB 4MRSA 1Y8QA 4K3VA 1GZUA 4XWAA 5GJBA 2I7DA 1PL7A 2F2EA 4C06A 3FCSB 2VBGA 2NZJA 1E3MA 1WWXA 4Z4GA 4JDPA 1GXQA 2EATA 2DWCA 2IT1A 1GSOA 4YRPA 2E89A 5GINE 3Q3GE 4D99A 3FJYA 1OKKD 3DCJA 4YJDA 2GQQA 2X41A 2E18A 2W4SA 2R7OA 4IWXA 3ETNA 5ADUS 2PMEA 1QIKA 3MWJA 3LDHA 1NI4A 2XKBA 2RHBA 2QD3A 1RBMA 1YBAA 3DXJF 1XDZA 3RUPA 1O95D 4CBVA 4G8JA 4TWRA 4E1BA 5DWQA 1SHTX 3THYA 1JXQA 2OAZA 2UXBB 4UULA 1GZ5A 4HNVA 2CWEA 4U2BA 2HCRA 3EBOA 3FPEA 4RA9B 4N6GA 2PX8A 5F98A 2VJIA 5JOQA 4WE3A 1DKLA 2ISZA 5FHRA 4BNKA 3QEBZ 2J6CA 4OHXA 4PCVA 1DRWA 2FSHA 1MNQA 3DOEA 4LV5B 4CKCB 3VSEA 2YNMA 4AXXA 2OV3A 4YIHA 3K9QO 4CM6A 3GZNB 3HKZA 4BO5A 1XJQA 1POWA 2GBGA 5DCWA 2UZ0A 2V1DA 1UEIA 1EGMB 1GPNA 3QYEA 3LQRA 1GU7A 2BFBA 1Q0SA 5DO9A 4XX1A 4UY8I 4JKIA 2R87A 1Z3IX 5B36A 3AM1A 1XAHA 2WWFA 3RT7A 1W0KD 2I1VB 4IHJF 2A94A 5SY9A 1BXGA 3ET4A 1U90A 4CIYA 3OQHA 1U0RA 4EM1A 4Q9KA 3I4LA 4UTNA 4QUKA 1U9CA 2HN9A 3KIPA 2ASEA 2ZJ3A 5J58A 1RUNA 3WODF 2VNAA 2A3RA 3DZIA 4FWIB 4QDTA 5J4LA 5FGMA 5HKLA 1HQDA 4X84A 3QTBA 2BZ0A 4MOWA 2NNNA 1WTCA 2GPSA 2XSZA 3UJPA 3I3LA 2ZTSA 3PQFA 5KIAA 1X1DA 2HX1A 4ZDJA 1BI2A 4BP9A 4DJJA 1UAAA 3OD1A 4QLAA 4QBKA 4KO8A 5HKAA 1D9XA 2VJDA 4QQFA 5F1PA 3KPVA 4D4HA 2E55A 5IWCA 2GI4A 4KUMA 1IWPB 4LA4A 3AVOA 3DHWC 2PXHA 2C07A 1DLJA 3M9WA 2BL4A 4HMPA 2G4CA 4D0SA 3I3SR 2IJGX 4BMSA 2C7BA 2B0JA 4JLJA 2I2CA 2GVZC 4J76A 4D4GA 1FE8A 2GK3A 1N3YA 3CP8A 1F2DA 1Z6QA 1SQ5A 2JI8A 1FFEA 4UNQA 4O5AA 4M1ZA 1IB0A 4HUJA 4RF3A 3TX6A 2CBXA 3Q6MA 1U99A 1LPNA 2ZE5A