3WGKA

Staphylococcus aureus ftsz t7 mutant substituted for gag, deltat7gag-gdp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGAGLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 97
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgkA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgkA01
4TUYA 3JALB 4O4HA 3RYIA 4YJ3B 4ZHQA 1TVKB 5JCOC 3RB8A 5LOVB 5M7EA 4HNAA 4EB6A 4WBNB 4ZI7B 4I4TB 4I50B 3VOBA 3WGLA 3N2KA 2XKAA 5GONB 4O2AB 5MN5A 2BTQB 5LYJB 4YJ2A 1OFUA 3VPAA 4TV9A 5EYPB 5JQGA 5LP6B 4TV8A 5C8YB 5CA0B 2Q1YA 4I55B 4O2BA 5ITZA 2XKBA 1JFFA 3HKEB 4O4HB 5CA1A 3C8LA 5IJ9B 3UT5A 5EZYA 4EB6B 4O4LB 5MN6A 3RYFA 5J2UB 3VO8A 5LXTB 4O4JA 5LA6A 3N2GA 4F6RB 5JVDA 5KX5B 4B46A 3ZBQA 4TV9B 5FNVB 1TUBA 5J2TA 3HKDA 4X1YB 4X1KB 2RHLA 4TV8B 2VAMA 3JASA 4IHJB 4U3JA 3RYHA 5CB4A 5IYZA 4X20B 4O2BB 3JAWA 1W581 4O4IB 3WGNA 5IJ0A 4ZOLA 5BMVB 3JATB 4EI7A 1FFXB 1SA0A 2Q1XA 3HKBA 3HKCA 5LP6C 2RHOA 1Z5WA 3JAKA 3RYCB 3E22A 4DRXA 4LNUA 1W59A 4TUYB 5KMGA 3RYIB 4M8IA 4X1IA 5LA6B 4ZHQB 4FFBA 2RHJA 1W5AA 4HNAB 5CB4B 5EIBD 4DXDA 4U3JB 5JCOA 3N2KB 3JAWB 3M8KA 1FSZA 4YJ2B 5IJ0B 5LOVA 3VO9A 5JQGB 3ZIDA 4U39A 1RQ2A 3HKBB 4ZI7A 4I4TA 5ITZB 4I50A 5GONA 3JARA 1JFFB 4O2AA 5LYJA 5EYPA 5CA1B 3UT5B 1RLUA 5C8YA 3V3TA 5EZYB 2VAPA 1W5EA 4I55A 5EIBC 2GVIA 3RYFB 5JH7A 3HKEA 4O4JB 5JVDB 4IIJA 3N2GB 3VOAA 3WGKA 2RHHA 5IJ9A 1TUBB 5J2TB 3HKDB 4E6EA 4B45A 5IYZB 3JASB 3RYHB 3R4VA 4O4LA 5MN4A 3JALA 1RQ7A 5LXTA 4YJ3A 5J2UA 2VXYA 1W5BA 1TVKA 4F6RA 5KX5A 4ZOLB 3JARB 4EI9A 3M89A 1SA0B 5FNVA 4EI8A 3HKCB 4X1YA 4X1KA 4WBNA 4IHJA 2R6R1 2R751 3JAKB 3E22B 4X20A 4DRXB 4LNUB 4KWEA 4O4IA 1W5FA 1Z5VA 2BTQA 3WGMA 5KMGB 5JH7B 5BMVA 3CB2A 4X1IB 3JATA 4IIJB 3WGJA 5LP6A 1FFXA 4FFBB 2VAWA 5CA0A 3ZBPA 2BTOA 3RYCA 4XCQA
chains in the Genus database with same CATH superfamily
2UV8A 4G97A 2H2AA 2WU4A 4I6GA 3L9WA 3RUPA 1KNKA 1IY9A 2QV0A 1VQNF 5C5CA 2FFRA 2CHEA 3WK5A 1PBTA 2PL9A 2DY0A 3B3AA 1E6MA 1JT2A 1NP3A 4QJBA 5TQ0A 3U60B 4OGWA 4OAQA 3KZOA 1MA0A 1QO0D 1H7MA 4ML3A 3SZ3A 5JNTA 2O8EA 1KOLA 4MR8A 3PGJA 1QOZA 3ASZA 5D5QA 2XVMA 3WGUA 1VJ1A 1VPTA 1PD0A 4R1PA 4F21A 1P60A 1PSWA 2NXEA 2I87A 1SGWA 1P1HA 1QNFA 1WAMA 2OR3A 3EC7A 2DPYA 3FPCA 2BBTA 4P3XA 4BZWA 4GECA 3HFJA 2YBEA 1MBZA 2FPUA 4HJRA 4AN1A 1KEKA 2G4CA 1X2EA 4OP2A 1VQPF 2O8VA 4OGGA 4HQ0A 3ROGA 3WMWA 4URVR 5KTTA 3GFOA 2GM4A 3L7NA 4IO0A 5B2EA 3IKTA 3P2IA 3BEDA 3DKVA 2QRGA 3C7AA 2PWPA 4J9VA 3K9BA 1T10A 2D62A 3VTAA 4NRDA 1DJNA 4TV9B 2XT0A 3EJWA 4XPIA 3NNSA 4MI6A 3LGXA 2YYZA 1I1OA 5DX0A 2HXYA 3FPKA 1U7PA 3DYIA 1RPNA 2QROA 4S2UA 3WR5A 1TT5A 2AE1A 2H18A 4KWCA 1C7JA 1OT5A 4C5CA 4R2JA 1FFXB 2QI2A 1HE1C 2HLPA 3CY6A 4E5UA 1EFKA 1G3UA 1XRQA 4BATA 1NQXA 4RS4A 2XTNA 1C9JA 2DZDA 1E2BA 1OILA 2P5TB 4JBNA 1GO0A 1E3SA 2BOVA 2OHJA 3B1WA 4A6DA 4D3YA 4EATA 4WOPA 1BROA 1Y4DE 2A0YA 3WMXA 4PYLA 2CW4A 3W5VA 3VPCA 1QPBA 1U0OC 3GBSA 4PLWA 5CBPA 5INTA 1EFHA 1INLA 4RKEA 3GK3A 3LKDA 2IBMA 2JG3A 3NDBB 3AVQA 2AG5A 2QL7A 2B9EA 1J8YF 2NSJA 2R1TB 4Z4HA 1JZTA 3KNZA 1HLGA 4DV4B 5LSAA 4KPUA 4K9KA 1GIAA 5BQ3A 1KKUA 4NOLA 4AKIA 1E2NA 5AVOA 4MS1B 3JAMM 4C0SA 2DU8A 4ZO4A 1OLUA 5TGTA 5IC4A 2ZRBA 1KZ9A 5KQPA 2P9CA 3EAFA 2JBWA 3WGIA 1J0BA 1TW2A 5TS2A 3BJIC 3PFNA 5DWQA 1CUSA 3W04A 2XZPA 5EQFA 2VCHA 2VSYA 4QYIA 3U3XA 2V6GA 3IEUA 2A7QA 1R4ZA 1X52A 1UOEA 5TNXA 1ZXXA 1I51A 2O8DB 1XQ6A 3DF7A 1QYCA 1JXMA 1C30B 2J9FA 1B23P 3UUFA 3QMMA 1MX3A 1P3DA 3JAKB 3OQ1A 4WLOA 2P4SA 4I1UA 1FC0A 3QXGA 4OLFA 3AR7A 4QUHA 3R8XA 4DR5B 2DC1A 3F8WA 5KNBD 5TPWA 4BS9A 4YAOA 1QRUA 3VUFA 1T1RA 4MWBA 2BGLA 5IN4A 2E3JA 3MB8A 3KQTA 1HF3A 1KC1A 1XTSA 1XZDA 4OHYA 1RNLA 2Q6TA 4K0RA 1L5VA 3QF4B 2D2EA 4D4HA 2YDYA 3LDUA 1T3ZA 5CLQA 4DN6A 5CPFA 2C03A 2WKSA 4DMGA 1EFPB 4X8LA 3AZQA 4PLHA 1ZVQA 1JHUA 3P4UA 5ARDA 4B3DA 1H3FA 1J7KA 4K46A 2FKAA 4GP6A 4OL9A 3GAAA 3IUPA 5JMTA 2W98A 2E5LB 1OSNA 2I0FA 3EIEA 2W9XA 2I34A 4F3YA 5IT9A 3WYEA 4HZUA 4RHYA 2B33A 5K09A 4FFPA 4NESA 4QGGA 3MTDA 3TQQA 1QH0A 1PR0A 5A03A 2FSVC 5ES3A 5HKAA 4B6SA 1G1MA 2PUJA 3DMTA 3D43A 4ESOA 2X9QA 5B6IA 4OYHA 5REQA 5B3KA 2I03A 1V6AA 4YAFA 3SQWA 1ZESA 3HUEA 2B1IA 4TS9A 3U17A 2CXRA 5B6PA 4L4XA 2WHQA 3DTNA 4YO7A 1AG9A 1LI4A 1T5SA 3IMEA 4ETMA 3KB1A 2QIOA 4PZ9A 4ER0A 1NVXQ 2J0SA 2PGIA 3IYLW 5K3CA 2SKCA 2Z4TA 1QZ3A 3RUDA 2FCAA 3VSEA 3WAKA 4BE9A 4DJFC 5A1JA 1QQAA 1Z07A 5EXXA 2UYCA 3CNLA 3D2AA 4HUTA 5JXJA 4LY6A 2EQAA 1AY0A 1OC2A 1O5IA 3O47A 3P9PA 1MAAA 1AKEA 3H1PA 4RK4A 3ZBUA 1TCVA 3TLJA 2XBMA 1TIKA 4YCDA 1SR8A 1OU0A 1XYGA 1Z17A 2HUNA 4J0KA 4M49A 3VU9B 5ILQA 3E61A 4DRXA 2OYSA 2VGMA 3BORA 4LECA 1L5ZA 1O3YA 3S81A 4A15A 2FC3A 5BNWA 3ZWKA 4ZYTA 2JFPA 4W82A 3TIFA 4NXNB 1CUFA 1ML4A 1E5LA 4MWEA 2A9QA 4KODA 3SJUA 2NNWB 4GP7A 1JG1A 4PC1A 5FA5A 3TK1A 5JSHA 1E4VA 1V39A 4HNRA 1G8YA 1Q7TA 3K1ZA 3D6HA 3RHSA 4D41A 5JPIA 1MOQA 5B1HA 5IJ0B 4IM7A 1JFVA 1DOAA 4C0QC 2OM2A 1MVLA 3L6UA 2CFTA 3ANLA 4CQNA 1T5HX 4JFRA 1W4RA 4WIAA 5ALGA 2O7VA 3EA0A 1N0VC 4C7BA 5GGYA 1W42A 3CD6F 2PHZA 1F0KA 4GRIA 4HAXA 5H82A 4BLPA 3G2IA 1FUEA 3FXAA 4OQDA 4K1LA 3U4MA 2SKEA 2HSEA 4CM9A 1JYSA 5C8VA 1J2UA 3GF4A 3HZOA 3EXG1 3PPXA 5LQMA 4AUNA 1IL0A 1UPXA 3KOMA 3P52A 2FX3A 2ZIFA 3ZU6A 2QN1A 4E6EA 2NACA 4L8VA 3VM6A 3DT6A 3E4DA 4AKGA 5I8ZA 2KI5A 4F92B 2VPZA 3SMVA 2HUPA 5I7WA 5B3JC 2JPDA 1VH8A 3R2JA 1FJXA 2R6R1 3EWSA 3FVTA 1QCDA 4FGKA 2R84A 5KMGB 1I4EB 1JR2A 1W48A 1X7WB 2C3YA 3AUKA 1E20A 3EXEA 4M9QA 2WWVD 3T5TA 3ER9A 4CEJB 3PQEA 3NV9A 4KQEA 1TYAE 4UVIA 1MR3F 1NJ1A 1A9RA 1EK5A 1S02A 1R4MA 1U2DA 2ZFUA 4HWPA 4ICIA 3ZWAA 5EMNA 2AOWA 1ZAKA 2D2IA 3TNLA 1GU7A 3RU3A 4QVKA 1NPYA 1TD9A 4JYBA 3T3PB 4AN4A 5BRJA 1YR7A 2BUCA 2FR8C 2NN3C 3EISA 3DNFA 1X8JA 3ABZA 3M33A 3MYYA 2HCBA 3C85A 4FDMA 2IHYA 4MCAA 3GLFA 1L7AA 1OX4B 3AW8A 2QU8A 4CQMA 5L45A 5C8XA 1E3DA 2O8DA 1X87A 4R2LA 4DLWA 2G28A 2W58A 4MV4A 1DGQA 2ZB7A 5DBOA 3A4MA 5IC5A 3K15A 3ZIAD 2BM1A 4MWTA 4MWZA 1X1QA 2DM6A 2PPLA 3QKSB 3PC6A 4IIUA 4PC2A 4CM8B 3TNFA 4Y1EA 4BNZA 1PG2A 3WL5A 4GLLA 1DAKA 3C8LA 2VHQA 4FNGA 4OKIA 4CM5A 3OPVA 1VHLA 4MYTA 1LLFA 1YJBA 3EG5A 3U1BA 4LFBB 1NDUA 2ABWA 3HACA 3W7BA 4JVOA 3ADCA 2NO5A 3JQ8A 5BW8A 1V47A 2JAQA 2R2AA 2G07A 1XB2A 4MKGA 3A9RA 2JFNA 1MIOB 3JRWA 4QGHA 1B3RA 2IUYA 3EVEA 1KMMA 3ROXA 1GGVA 2IXFA 1B6SA 3DDCA 2JRCA 1G7SA 4JX9A 4UKDA 4BU0A 1MRZA 1P7WA 4KO8A 3D3NA 1Y6ZA 4D1YA 1N77A 3HKCA 1DMSA 3H1FA 4RVNA 2UXCB 3I8OA 2HLHA 1HORA 1I2ZA 3AF5A 4NYJQ 4CG1A 3U7HB 1NURA 4A7PA 2P7HA 1RC0A 2R8OA 1R10A 2C2YA 3ELWA 4BV2A 4E5YA 3MMPA 4PIMA 4WT7A 4C3VA 1G55A 4DCJA 5FYDA 4LV5B 4AC9A 1SBQA 4LN1A 3PEEA 4JOQA 3TLCA 4CKYA 4BWFB 3HXLA 1S2OA 2QGNA 2PTHA 3DZIA 3P0HA 5PNTA 1YK1A 4JI6B 2XTMA 1JMYA 1XT6A 1YZTA 1NNI1 2GT1A 2CEKA 2W37A 3PNPA 5B7PA 3SAJA 2G17A 4NBWA 1CCWA 1YNOA 2NVUA 3DP7A 2KM1A 1PEYA 4DMFA 4I8IA 5AJXA 2RHBA 1IOWA 1KYZA 2RBEA 1P1BA 1Z3CA 2ZSDA 4I3GA 2Z30A 4UTOA 1GYQA 1HFKA 1WMFA 2DFKB 1IZ0A 1U7HA 2W2MA 3KSUA 1BHJA 1N6NA 2QPTA 3HB0A 4M3NA 3QV1A 2PZAA 3BQMB 1NBEA 1DQZA 2CJFA 5HY2A 3K5IA 3OVMA 4WKPA 3RFVA 4M7OA 3GHYA 3WNZA 2FQ1A 2XOEA 4TYPA 3HMKA 4ZVQA 4KQCA 3KKOA 1A50B 1VIDA 1KZ4A 2P5UA 4YBZA 4B47A 4D44A 4YJ3A 4ZOLB 2TRSB 4LCEA 4RPCA 1Q15A 3BTOA 1EGVB 2GJ9A 3ITKA 2O2GA 4ZOLF 3T3HA 1S2LA 2V74B 4NR0A 1WD7A 1AS2A 1QQTA 4OCZA 5H3LA 1ZD8A 5DBIA 2F8MA 1CN7A 3TZBA 3TLEA 1BS2A 3PC4A 3VJRA 4CIDA 3PIIA 4HGQA 4QVGA 4UUPA 3WGMA 3IDOA 2BR3A 3UK7A 3W6OA 1VKJA 1FX1A 4HLNA 4OHWA 2O4CA 2QTMA 2Y9PB 3OA0A 3L0YA 4IJ5A 5H9VA 1JFSA 1T3HA 4PBTA 2CLCX 2IU4A 4Z3KA 3PEFA 2NP6A 3M49A 1XN1A 1ZD3A 3J81k 4YT8A 3V7WA 1I30A 4YN3A 2FZEA 1OF1A 1PL7A 2KW5A 2RHDA 1J07A 2XVAA 4AYWA 4DCNA 1ZZGA 1PQWA 2JIDA 1N9GA 5LU9A 1I4DD 2B8EA 2P3SA 1BXRB 4RY2A 4UDYX 1T4MA 3WIEA 5K4HA 1QRAA 1E1CB 3A3PA 2VWPA 3MWDA 3MCVA 2Z5GA 1SC6A 4LJ8A 5I7VA 2FW6A 4KDEA 5EJ5A 3AP3A 1QH1A 1ZM7A 2PX8A 3IQDB 2LVBA 1JWLA 5JY6A 1L2TA 1R8JA 4QSHA 5AVRA 4HB4A 1XCJA 2H5JA 1JFFA 3OZSA 1KY5A 4GU5A 4MARA 3U4CA 1FTYA 4F4DA 1CJVC 3CGGA 1XUOA 2C4VA 1AF7A 3MT0A 4NBTA 4LMAA 5MN6A 3I9NA 5B6JA 5JVDA 1CLEA 3HR8A 2AJLI 2FZGA 4FB5A 2R6HA 4BW0B 1CZKA 2J3IA 3AKZA 5EXDA 1CW2B 2Q07A 4IWXA 4L6AA 2AZDA 3R3WA 3FTCA 4XGIA 5EJEA 2P1ZA 1J5PA 1BA3A 1G3MA 3LK7A 5HFJA 4HD8A 1KJZA 5SICE 3K9HA 3B3FA 4BVHA 1XVLA 4QZVA 1HKHA 1MGPA 1V5GA 2Q0QA 4QA9A 4EO9A 1WVGA 1LLQA 2H7XA 3K3PA 1UBHS 4NWOB 1JPJA 3P4XA 4CF4A 4FDLA 4BFZA 5CB6A 1U2DC 5IT5A 3WMFA 1Y8AA 1FFSA 1P19A 2H85A 4UBJA 3GJ7A 4BO6A 2ZREA 3NTQA 1MW8X 4LY3A 4KE6A 4KITB 4RK1A 1KD1H 4RD1A 1AS3A 1PJBA 3P0FA 2HSWA 2X77A 4QHTA 1J8DA 1N6KA 4LW8A 4DBVO 4AWXA 1I6LA 4IDGA 3DQPA 1WWKA 3PHJA 2ROQA 1QIFA 5LQKA 1OBHA 3TQSA 4A9AA 4HXFB 1X92A 4ITUA 1Q7EA 5CT5A 3V8PA 3N2YA 5CLFA 2P77A 1GZ7A 4P84A 4BMZA 4RIEA 4C6TA 5TX7A 1NULA 3KKPA 5FH9A 3AEKB 2BT4A 1KAOA 2YV1A 2J3MA 5DEIA 3ONDA 3E9RA 5HQ3A 2IHNA 1E3IA 2DLDA 3A1SA 5ALHA 2WVHA 4JBWA 5ISMA 2GCGA 4QEKA 5D8DA 3VR0A 5EJAA 1TNDA 1K97A 3H5RA 4UTXA 4DSUA 5B7NA 7YASA 4OOFA 5EVCA 2W0SA 1W75A 1KK2A 1GZHB 4EG8A 2QI9F 2XOKD 4RENA 1P1RA 1V1RB 2BMFA 3LK6A 4BLTA 2C2BA 3RBAA 1X70A 2JFVA 3EUEA 3LHFA 1XEXB 4PSAA 3VTIC 3PFBA 3B38A 3ZYCA 2MJLA 3BE8A 4OP3A 3T7EA 3MC1A 4KVFA 1VHDA 2NSDA 3C6MA 1CJBA 4M46A 4Q05A 1RXWA 1FS4A 4MRVA 3DS8A 5CLGA 1NUPA 3ZGZA 3MAJA 1LK7A 2X1VA 3GN2A 4LHWA 1NIJA 3C1AA 1A9TA 4H7IA 1AV6A 3L6RA 1PGJA 2YJ3A 1YB6A 2G72A 3DEJA 3ELBA 5MDHA 1BVUA 1F4PA 2JI7A 2W42A 1MUUA 2YNMC 3Q3HA 1EBBA 1EDEA 1EX6A 4AQDA 3I12A 4KTTE 1ZRSA 3IP1A 1P62B 4E5SA 1QTRA 2JNWA 2B61A 1QH8A 2CLHB 3FUXA 4TTJA 2OG1A 4ZWNA 1O87A 3CZCA 4D9HA 1PNOA 3TIGA 2XMBA 3SS7X 2XKAA 1NI3A 2FAXA 2ACVA 2X3UA 3RS9A 5KOHB 5GV7A 3O4FA 3B8EA 1QF9A 1SVWA 2FZWA 3C7TA 3H2YA 2OO3A 1VLVA 4E13A 4UEOA 2UAGA 3CPQA 4ZCQA 2PR2A 4KVZA 2IZZA 2AQIA 3SLRA 1RTTA 1YRQA 3LTNC 1FRFS 4TZZA 2B4QA 5E6UB 2C9OA 4R81A 1XA3A 3SBDA 4R40B 1YZUA 2Q4OA 3JQ7B 1JJ2F 4TTSA 1X7XB 4HEA1 1EWTA 1WKBA 3KPYA 1O77A 3T61A 4L4ZA 2F9FA 1RHQA 4HGOA 2HAEA 3FDJA 2H9YA 3M5PA 3GBPA 3PRKE 3R44A 3OKAA 2RB4A 3I6YA 3M83A 4RAOA 3P9SA 4NF2A 4PQRA 4DLBA 2L26A 2C2OA 3PQ7A 1KO1A 2VH1A 2XVYA 2RSLA 3U4AA 3FZYA 2QRKA 3IEPA 2QZJA 3E1YA 1E6KA 5DN9A 2GN8A 5CXQA 2Z1MA 1PKXA 2WAMA 3ZZ0A 1J0XO 1GGKA 4DJTA 1Y1QA 1AVTA 1YQXA 4U9IS 3OHPA 4LF9B 1KVQA 4MAAA 1M83A 1PXWA 1Q57A 2IFTA 3RTBA 1XF1A 4HFMA 2P6NA 4TUYB 1UQUA 2Q5LA 2BFBB 3RYIB 3ONEA 4JUDX 3KB6A 3SZUA 4NXMB 4TUYF 5F78A 4QRIA 5CJJA 3VNAA 1SPXA 2BELA 4OK5A 2B20A 2VJCA 3OQJA 3LC7O 3WK8A 3DWGA 1XVIA 3H5OA 1Z6GA 4O59O 4UC0A 4W5HA 3RIHA 1DAIA 1PV4A 5G0SA 4Q9AA 3FVQA 2OGSA 2HZBA 3RD5A 4RACA 3ROMA 3TD2A 3WHPA 3IMCA 2Y4OA 1YMVA 3OU2A 3KE1A 1CULC 3O90A 4XD7A 1D9XA 1KYQA 3MBOA 2G5GX 2Y0BA 3R9XA 1JBQA 2JH9A 4AD8A 1YE8A 4M9RA 1OU4A 1YOVB 2ZP1A 5GONA 1JKMA 1N2CE 1WG8A 4JYZA 1M72A 4G24A 2KX7A 1CQXA 3EIHA 2QG6A 2HWWA 2NTEA 3I4LA 3X2SA 2YCLA 2V58A 3IQZA 1MH9A 3HWWA 3NAGA 1CHNA 3H2BA 3IP9A 3C3JA 3WJQA 3ZY4A 1DX4A 13PKA 2QPAA 4ZHWA 4Y6LA 4PZYA 2LZ0A 4TXLA 5DM2A 3K0SA 1G6OA 1CUBA 1IC6A 2E49A 2OQVA 2AFHE 3DZKA 1EA7A 1ZIDA 2A3NA 4WKOA 1Q14A 1P5RA 1C7EA 5DZSA 2E48A 1PS0A 4JCOA 1UP7A 2HJHA 1YB2A 4WZAA 2Y1LA 3FPIA 4R3UC 3VJMA 4F5YA 5AI8A 3K70B 4Z53A 3BWVA 3VYRB 1D1PA 1NASA 1DTWB 4PNZA 3U44A 2GSDA 1AJEA 2NO0A 2ZE7A 2JIZA 2NO1A 4D43A 1N9KA 3LUFA 4EO4A 2AWNA 3ZD8A 3GUYA 2X0NA 4YXWD 5B4TA 1ZR2A 1YQNA 2XMQA 3LX6A 3RF7A 2E85A 1PFKA 4R5HA 1DKOA 2CMDA 4DLYA 1IN1A 4QU8A 1KH3A 2ZT6A 4PPGA 1VRCA 4KPYA 3Q7SA 3K8OE 3M3PA 4U1RA 1UOPA 3WHKA 2H5EA 3INYA 3NHMA 5K6TA 4OQLA 1BMDA 1TCAA 3AILA 2J85A 5K20A 5JJLA 1V5EA 5FPTA 4MW0A 1VQ7F 4RH1A 4REOA 5IFLA 2EW8A 2A9VA 5KYNA 2O2DA 1FLDA 3KTOA 1BE6A 4OIMA 3H4TA 3K0HA 3MHTA 1AUVA 1PRYA 1GG8A 4IDEA 4N6OA 3TZCA 1BE0A 5KTOA 1BE1A 1CUYA 1QHYA 5CCBA 1YE5A 1AHNA 1CEQA 3W8NA 4UUNA 1PBNA 3ADOA 3DV9A 2H06A 3K30A 4M8SA 3E3AA 2QMHA 4WKBA 1M76A 2FR0A 3LH5A 5A4FS 3IDZA 4Z4QA 3QY0A 1LWNA 2I3DA 1RWBA 3I04M 2C83A 4MW5A 1BJRE 1AUOA 4R69A 2UVPB 1NDHA 4BJ6A 2D8MA 4YT2A 2C0CA 4OD0A 2VDWB 4KXYA 4YRSA 3U7FB 1RI4A 4E5NA 1VJTA 3V97A 3ZHVA 2IYZA 4M1OA 3F49S 2PGNA 4TQ9A 4FGLA 3VDMA 3C48A 2CFIA 5GV8A 1AKRA 1MNQA 2RHLA 4G0NA 4CT5A 2I6FA 3FOWA 1KJYA 3LFUA 1Y1KE 3JYNA 1V9CA 3A3OA 1SC9A 4WKNA 3L7JA 2D2VA 1Y3IA 3DKKA 3JPYA 4HDRA 5CB0A 4G5FA 2V9YA 1PR3A 4A8TA 3EFOB 4JH0A 4WZBE 2Q5FA 5HW0A 3L43A 2CF6A 1DE0A 4I9HA 3TB6A 1KSHA 2WKWA 3X44A 3H5LA 1A8IA 2B83A 2VPYA 3KPWA 2BPOA 4JEHA 3DFFA 3HY3A 1SU7A 3IDSA 4OFBA 3JW8A 1E89A 2C8LA 3DKRA 2BKEA 4Z9FA 1JIQA 4OHCA 3VR5A 2XNHA 2XGGA 2J6HA 4CV2A 1N6OA 4BQRA 1QRDA 3DPIA 1LSOA 3H11B 4PAQA 1VQLF 3ZGOA 1DUIA 1F9AA 1Y7LA 1ISSA 1DQNA 2PD6A 1N8TA 3EA4A 1HRKA 3I8XA 4FZVA 4OHZA 4DBZA 2R1ZA 3C3CA 4JL5A 5H02A 5JQGB 1LBTA 4AWBA 4IMPA 1J21A 5BRAA 4H60A 4ZVLA 3ZE9A 4LTDA 4QBIA 2RAFA 3S44A 4QHYA 3VV2A 1UPAA 4XUEA 2ZW9A 1BOFA 1XZCA 5IU6A 1T9CA 1ZSNA 3RV4A 2GHQA 4KACA 5B57C 1P81A 5DPMA 2UU9B 4MVJA 4W1SA 5FI0B 3USES 1QKJA 1SQ0A 1C0KA 1CIJA 1TZKA 1FNCA 2CXPA 1ODCA 2HU5A 2IYUA 3GCDA 1L1QA 4AG6A 5BN3B 2WJIA 2Z04A 1M0SA 4UUMA 5LKAA 3FF4A 1GVHA 3W9SA 3PJFA 3HXKA 5E9QA 1D0IA 2NO7A 3EZ2A 4B84A 3N86A 1G5HA 4OQMA 1Q1NA 2IPXA 5AKGA 1SO8A 5MN4A 1ACJA 5CB4F 2CV2A 2X6QA 2Y6VA 4FT4A 3ONFA 3B7PA 3QFCA 5DTQA 2NP7A 3MLAA 4J1TA 1TA0A 4RMGA 3GLHE 3I0ZA 4KCGA 3HADA 1EYZA 1AGNA 3BSWA 5TT0A 2YL2A 4RLFA 1CT9A 1U0JA 2ORIA 3F2VA 4FWIB 4Y6RA 1DXHA 3ORYA 3MGBA 4OXKA 4C1NA 4ZMBA 1SN7A 1FFXA 2B3TA 4I14A 3U26A 4KREA 1IN8A 4FHZA 2QS9A 1G8GA 3L0CA 3CFYA 3U40A 4E4RA 4KN8A 4NZYA 3WWEA 1JIVA 3M3DA 4HH1A 2NZWA 3ZHZA 3ZEAA 2UYNB 2XGMA 4B6JA 2O20A 5AKKA 2BI4A 4M55A 5D3ZA 4FDTA 3CVJA 2GM3A 5EQDA 3ZXIA 3A2LA 1Z0SA 4TWZA 1VYTA 1V0JA 2BBSA 1A76A 5EEGA 3P32A 4I50B 1Y42X 2FN7A 1AA6A 2K87A 3BIWA 4NZZA 4I50F 5EIXA 3TRFA 3TLAA 3T3MB 1U9CA 3USZA 4HDCA 1F4LA 1K9VF 4GHWA 2R1TA 2PRJA 2C2GA 2D54A 5F33A 4BAUA 1QCZA 1H48A 1QIEA 1M34B 4AZ0B 1J8FA 2FN4A 1SD1A 1P61B 3HJCA 4J43A 1EFRD 4F4CA 1SXQA 3ZTYA 2YXDA 3PQ3A 2GM9A 3BRWD 3CINA 5HZGA 3PJEA 1WBBA 4MPJA 4FB4A 3GD5A 3KZMA 2QTZA 3I3SR 4MS1A 4GE3A 5LC1A 4B2LA 4GGPA 4DEXA 3SHTA 4L78A 3AK4A 5K4GA 1QGUB 5I45A 5DISB 4Q9HA 4UNIA 4NEQA 5D7NA 5BV1A 1A8HA 4Y0NA 4KLCA 3GFRA 1XEWX 2QDKA 2OTMA 3O4RA 3W7AA 4C4YA 2PEYA 2WM8A 5HIKA 1S5PA 1OLSB 1JQKA 3IMKA 3M4SA 1F4VA 1FPQA 1S96A 4IDCA 4FKZA 4LRWA 3U3KA 8ADHA 1O6CA 2QMUA 4LX8A 3KKMA 3NWJA 1C30A 3L7BA 2OKGA 4IUYA 1USIA 1D4ZA 3JAKA 2YV5A 2OZVA 3E5RA 1RI1A 2VTEA 3OFND 1MC1A 1B14A 1CJSA 3JR7A 3EULA 3IAUA 3A6GA 1KHHA 3DBLB 3GVHA 3IELA 3JQEA 5EMJA 2ORVA 2P5SA 4RM3A 3U19A 1SQGA 4LC9A 3TIVA 4Z0TA 2B8WA 3QF4A 3UWMA 3BGDA 4W5JA 1RCTE 3CRVA 5EUMA 3CNNA 3K6KA 3NYQA 5CFOA 4HBZA 3S5UA 5A4IS 1EFPA 2BMVA 3ZHSA 1H2FA 4FFSA 2YC4C 1NLFA 4PR0A 1UAAA 3K2XA 3T52A 2PA0A 2P9GA 4MP8A 1YBVA 2JD0A 1MTZA 3LCMA 1Z4QA 1HEUA 2C2MA 2Y0CA 3F6CA 4OXNA 5ALUA 3Q7RA 5EN4A 4BEWA 4H7HA 2C04A 2XMDA 3D6VA 4DCUA 3ZHXA 3IS3A 2XR1A 1UQRA 3FG9A 5EZYB 3AY0A 1E3MA 5F7ZA 2QUAA 5EZYF 1PTKA 3MINB 5IDWA 2EW2A 3REGA 1EXDA 2BFEB 1A9ZA 4NH0A 3M2PA 2HF8A 2O3JA 4PTZA 1YE3A 5LA6F 1HDOA 1PD1A 5HM8A 3HKDB 4JD5A 3GLSA 2IIQA 3JD2A 1SUEA 1JXOA 4KP7A 3U9LA 3BERA 3RFFA 4JJZA 5A05A 2IAFA 3CLHA 3DCIA 3AI3A 1VE6A 1Y1RA 3A7DA 4G89A 4K05A 2VDKB 2XE6A 3QE9Y 1Q1GA 4QELA 3BK7A 1EPUA 3KR1A 3MMSA 3ESXA 4ZVNA 3AHCA 1N6PA 1PS8A 3P0EA 4XI9A 1BVRA 4MYRA 1Z35A 4LOKA 5ALTA 3BE5A 1YJ5A 2FFJA 4II3A 5D3MB 3WGJA 1YR1A 3ICCA 1H2HA 5BP7A 1WABA 2OGZA 3VU9A 3ILXA 2O3UA 3UGJA 2B36A 5CW1A 1A9QA 1AMOA 4EB3A 3C6QA 2PVCA 1R15A 2ZAYA 4HN2A 1MN6A 4XRGA 4NCBA 1DSSG 3CE6A 4KI7A 3CCJF 1CQZA 1YA4A 4G8CA 1V7CA 4I36A 3UFXB 2GPJA 2GEUA 1JKJA 3KR2A 4JI0B 1NPTO 4Q4DA 4UMFA 1CF9A 3C6XA 3K4HA 1KXZA 4KH0A 4CHTA 1LPOA 5HFAA 4QGFA 1KO7A 1P17A 1SRRA 1XJQA 1ZGZA 2FU5C 3EHEA 3ODGA 4Y7DA 2UUPA 2F9MA 5IKPA 3ZCRA 3MT9A 5IP5A 5J4HA 4W5QA 3WRYC 3JQGB 5TMBA 5KNDD 2C2KA 4I46A 1ZRMA 1TK9A 3SSOA 4ZVSA 1EA5A 1BG6A 3U3JA 1C4OA 3OE7D 5A62A 5KVVA 4YR9A 3EVCA 1M90H 3AW9A 2ANBA 4NPCA 5J2UB 2TMKA 4B43A 4IIXA 2I78A 4IQ8A 3EVFA 4F8YA 5J2UF 1PR5A 3KR9A 5AHXA 2E0IA 5E4YA 4YPVA 4NCKA 2PTGA 4J1TC 4YV2A 3VC7A 4ZCMA 1OPRA 1GYRA 3ZE2B 4ZOQI 2WICA 1LNSA 4FHGA 4I0WB 3T7SA 4E30A 5BQOA 1IHDA 1UT5A 6REQB 2BL4A 1K0UA 4O33A 2JI8A 3VHLB 1QQ6A 1UOQA 2GXUA 1MO3A 3CONA 2EBFX 5CVCA 2WB2A 3EZ7A 1F2TB 4M1SA 1M1UA 2BFPA 4ATNA 5DK6A 3DMHA 5KMGA 1X7WA 2J31A 5I4IA 3D4IA 3NOOA 2OT3B 3OPQA 4CEJA 1CY7A 4F71A 3WADA 3SYMA 5D1NA 3G2HA 1JG4A 1NQTA 2ZG6A 4IZHA 2CFCA 4FYWA 2PMCA 4AUMA 1XX6A 2H08A 3AYZB 2IQQA 1Z4KA 4NJMA 2AJ8A 4RTMA 3P10A 1JU4A 2YOFA 3KALA 4HPWA 1Y3BE 4P4TA 2BONA 3T1VA 2KYRA 2P9EA 2VHWA 3IQFA 2RD2A 1QRSA 5DYYA 1UK9A 2CHFA 4B9EA 2ZM6B 2HMYB 2YYAA 3PNMA 1XU7A 3TJRA 2FF5A 4QPNA 4G01B 4RFSB 1NF3A 4Z3DA 3EK2A 3VNQA 2HMSA 5B2FA 3ZK9A 3EWIA 1VGRA 4GZ6A 1W5EA 1GARA 4GOOD 2NQ8A 1A5AB 2Q0XA 2JI6A 1FE8A 3UMGA 1T3SA 3QKSA 3JVUA 2GNOA 4WHMA 4CM8A 1N7JA 3EZGA 3WK9A 4ZZ3A 2FPIB 3CGWA 4HC4A 1ICEA 1AF4A 4IF6A 2DMRA 4YCSA 1ZEMA 3FX2A 4V24A 3RIEA 3OX3A 1M8KA 1QO0A 3DGFC 2CLDX 1T5BA 1ABBA 2VPPA 2RKWA 1T8UA 4XVRA 3HYCA 4CN8A 3ADBA 2QK4A 2OHGA 1WSDA 3SQXA 1B2LA 2FPPB 1MV8A 4EHAA 2K7FA 2PWAA 1MIOA 4EX6A 1PF7E 4BX2A 4HS4A 3AEXA 3CLRC 1CP3A 2PS9A 3W5SA 4AZWA 2VP2A 4GRAA 4KKVA 3BWCA 1ECCA 1H9CA 4GX0A 4JJEA 1QGED 2ZBQA 3DVQX 2J1LA 1J49A 1HYBA 3MB5A 4BJ3A 4D4JA 1LA2A 3BWXA 4DLXA 1H2XA 1SBIA 5JDCA 1FP4B 5F3DA 1IXRC 2PS3A 1EK2A 5EIEA 3K9LA 3C9RA 1DIGA 4GLBA 3M6XA 4DSNA 4FBGA 2WJPA 2QZSA 4J3JA 4XQGA 2RHGB 5FL3A 5CDFE 4TYNA 4YMVA 3EDQA 4AY2A 4XQ9A 1YXMA 4LF4B 3IAM1 2VA9A 2B99A 4Q16A 2GA8A 4LV8B 2W5UA 3FWPA 1Q1EA 3WDSA 4NH4A 5G4VC 2FG7C 4DCTA 4D25A 3UWSA 3AI7A 3V1LA 4KBGA 3NW9A 1VL1A 2WWFA 1PTJA 2QN6A 4X44A 4J94A 4G0MA 4WESB 3W8RA 4ZK2A 1G3RA 3OZIA 1L8OA 4C4AA 2QTLA 1UAGA 4A0HA 3R3VA 5ADVA 1MO5A 3TSCA 3GLVA 3KQSA 3L7KA 4RJKA 4X5OA 3GFPA 2I2CA 5J47A 4U3JA 4OLBA 5DXJA 2H1RA 4O2BB 3QUQA 4WBNF 4BY9D 2G1AA 3ZBTA 5K8IA 4ZOLA 3AQ4A 2KTVA 1H5UA 2Q21A 1MP0A 4F8JA 1XTIA 1E2LA 1H0KA 1QMGA 2C58A 2DBQA 2BAGA 4MP6A 1EUDA 4XYBA 3L8FA 4ZPXA 3WGOA 3MCQA 2H3HA 2WWIA 3COYA 3FCEA 2ZIUB 3A6EA 4TM8A 3H8VA 4D9CA 1E0DA 1XV5A 4HDOB 1UI9A 1K5DA 2TSYB 3ZXSA 4D80A 2H2FA 1I6WA 3PD7A 4WN9B 3NHAA 9ABPA 1LBIA 5LLSA 3F78A 3F98A 1O94D 1GL3A 4RJLA 4KNWA 3HSKA 3KHTA 2IIVA 2ZE5A 3PR1A 5LB4A 4ZP1A 3V55A 1Y3HA 1CZHA 1ZM2A 2IXEA 2Y77A 3GWGA 4DHWA 1Q1BA 3TQTA 1VB3A 3E9YA 3PXGA 4C0LA 1TEVA 4F4IA 2BP7B 2IUTA 4RFLA 2F1KA 1YMQA 2G5TA 5F3WB 5KNBA 2A9FA 1F3OA 2IS2A 3NBAA 1YKGA 2UZ1B 3PNKA 1E1CA 1FRQA 1M1NA 2GM5A 2KSQA 3Q7TA 1GUYA 3JWIA 4UMDA 4PCVA 4J1NA 2C9BA 1YSCA 3WG9A 4Q4LA 1AHPA 2VRBA 2LTAA 5KVSA 2BSAA 3V42A 3KLNA 5CYOA 3WI7A 2VDJA 1GPH1 3IVAA 4WADA 1NVUQ 2FSUA 2CNBA 2N9UA 2Z1EA 3VOAA 3BXOA 3Q98A 3BMQB 4PS0A 4RZ3A 4BVLA 4D42A 4YXFA 1Z0AA 2FTKE 2IYRA 5EHGA 3PLAE 3RREA 2VJYA 3KJQA 5K3SA 3JV7A 3BZBA 1J1IA 4DS3A 1XDUA 2BISA 3ANSA 5LIPA 3T0FA 2GESA 3HP1A 1Z0JA 2QQGA 4C4RA 4WGFA 1C1HA 4DCVA 1NM5C 3KHNA 3TECE 1Y8QA 1ZL0A 1WPRA 3HCFA 2JD2A 3VR3D 2QD5A 1IUNA 2GLUA 2OV4A 3JVHA 2OGUA 5EGNA 1AUPA 4J29A 2FJUA 3WKAA 1QFZA 3G8CA 4NDAA 3V4ZA 3VTFA 4BB9A 5LPNA 3G1UA 3TRIA 3VDRA 1FOEB 1YVUA 1TM1E 1Y6JA 1D1SA 2BGJA 2E5WA 2PZLA 1KI9A 4JX8A 2GYYA 3IHKA 4G5YA 4MEBA 3UYKA 1C9EA 4KIWA 4M8LA 4F97A 3GJRA 4B80A 3H0KA 1RLGA 1KI7A 5L6LB 4UE2A 1FF9A 4PCUA 4N39A 2R8EA 1PQPA 3NDPA 2HIGA 3KT6A 4FFRA 2XJ9A 4KWIA 5EESA 1XYVA 1Q5PA 2ANCA 2ZZNA 5SYNA 2I3AA 1T3TA 3OQ6A 2MQEA 2YFKA 3TXYA 3VKWA 2GDZA 1P6UA 4RJIA 5DWDA 2WTEA 3F8TA 5IYZF 3FHOA 4QNRA 1B00A 3HZHA 2P4QA 3AP2A 3ZHOA 3TN7A 1G8SA 3TQRA 5B30A 4GM1A 5FF9A 1J22A 4TRRA 3UY4A 1AC5A 2HGZA 3Q11A 1EVJA 2Q1YA 2QLJA 2XCOA 1R3DA 1F48A 4I5EA 1BX0A 2AOTA 1H6BA 1QP0A 1ACLA 4ZHYB 3DHYA 5E3IA 4YCLA 2QRLA 3TIIA 5HIMA 1DKUA 3HB5X 4B2YA 4OA8A 2F3RA 3AM3A 2DFPA 4RFVA 3AEKA 2XX3A 2IPNA 2XW6A 2FG5A 2YWRA 3GT3A 4EW2A 1WB9A 1LV7A 3QE2A 1EEXB 4R1NA 1NYRA 3ISVA 5E6RB 4MHSA 4YAEA 2W4MA 5BSKA 4QT0A 4WL0A 1CIVA 1R50A 1NQAO 2I4IA 3N58A 3UCFA 3P0IA 1VE5A 3Q0TA 4C2AA 2W4QA 2JFOA 1XXLA 4DJ5X 3V2UA 1HQYE 4KZKA 4XB2A 1V1RA 5EJ6A 1D0VA 1U3VA 3EW9A 3OCWA 1K2WA 3C2QA 5FUBA 2C4HA 2NQ2C 4KE8A 1L1EA 1ZK0A 2YUIA 4UBKA 5E9JA 4ESVA 3VZBA 1ZBDA 3SD7A 2V7QA 1SFRA 1T9AA 2OWEA 4PSKA 3A3NA 3V4RA 1GTMA 3PQCA 2Z5VA 5HY4A 3MS4A 4C5AA 2PSJA 3G9QA 4PZEA 1WY5A 4M6WB 3ZOZA 1XTUA 2ALJA 4Q1VA 2OXIA 1J1UA 1X77A 4IGKA 3ZYZA 3C5VA 2G71A 5JSKA 2ZM5A 4Y0AA 5BVGB 2CFSA 5JDCC 3RSLA 5HGJA 4MW7A 4ZC8A 1UKCA 3ZGYA 4P1ZA 5LQRA 2H9IA 3EQ7A 3OUTA 3D7KA 1RWOA 3RO7A 1B42A 3L2OB 4Y2GA 2HA0A 1FXUA 5ENZA 1DG3A 5CUQA 3PJRA 1NRIA 5CFPA 5B12A 2VPXA 3N4ZA 2FFAA 4PPQA 4RX1A 3C7KA 5IH3A 3X1XA 3S8EA 3S2SA 5FBVB 2PBRA 1Z8NA 5GADl 1TAQA 4GMGA 4GVLA 5KOHA 5JISA 3KU4A 1YACA 4ZQIA 3UHJA 3G5MA 3NVKI 3GMIA 4F60A 1PCXA 1U3DA 3VYTB 2ZODA 3BTUA 3HBNA 3K92A 1PTJC 1W7AA 4LYGA 5I51A 5E6UA 4UNNA 4CGZA 3OZAA 2DPMA 5LCXA 2HN9A 3JQ7A 3HCDA 4AY5A 1X7XA 4C89A 1TUBB 3EG9B 3IEKA 4LJ5A 3CEHA 3ACDA 4BY9E 4N65A 1P9OA 2M2IA 4IIFA 5FPYA 4RF5A 2RK6A 2VPQA 1RKQA 3IOBA 5H59A 1CR4A 2OESA 2VHEA 2FMKA 3IR5A 4OO3A 4TXJA 4UEKA 4UPDA 1JI3A 2PL3A 2QRVB 3WRVA 3ZIAA 4DC0A 1WF6A 3NANA 2EERA 4MYDA 5DHRA 2Q1SA 1JDNA 3VPXA 1JA9A 4R1LA 3A37A 4F5DA 4NOMA 2X4GA 3L6EA 2CYBA 2CYAA 4ISCA 1LJUA 4AN0A 3ZE8A 2GRUA 1SUAA 2WUFA 4ZAVA 2Z8YM 1ZRHA 2O0LA 5FOSA 4QL3A 5BPHA 4TUYA 2I4TA 3CKMA 3EORA 3RYIA 1B7GO 4WEOA 4KOEC 4LJYA 1UPTA 3HL0A 4QFCA 3V4PB 1OXXK 1QGYA 4OU4A 5F64A 1M1KH 1RSZA 3B6KA 1QF7A 1C4KA 3DMFA 2CUTA 2WD9A 4OXRA 4B7ZA 2FI1A 4H1HA 1H0RA 4XIJA 5LP6B 1LF0A 1R8QA 2O0MA 2WTXA 2GGSA 1JIJA 2V7TA 3HL4A 4NUTA 3QNUA 4P3YA 4TTAA 4UFNA 3X2EA 2G1UA 1N0HA 4GOKA 2BFCB 2JHCA 2A30A 5KHLB 2ZUDA 1EK6A 1H4TA 2PJDA 4M7PA 4M0DA 1LTKA 3R4CA 3TEMA 1C1DB 4Q9NA 3BMCB 1GADO 4IVQA 4DMLA 1ENYA 3GG2A 1NE7A 4FBLA 3NT2A 4Y2QA 5ALYA 1BN7A 1SC1A 2FLKA 3T99A 2VDOB 1TM5E 3BM5A 3PDJA 1LJLA 4NCXA 1GQ2A 2AZTA 3PFGA 1GPUA 1BDJA 4AJJA 1EXVA 4E88A 2G36A 1D2HA 2YWJA 1T24A 4UZEA 1U98A 3NHBA 3PQ8A 4U6QA 3WB2A 1C81A 1B4DA 3T15A 3K0FB 1DJMA 1S2MA 1U02A 1XLUA 2D6FA 1DTWA 3WC4A 2FMHA 3R6TA 2PKYX 1OH7A 4KHPB 3AG6A 2DBVO 3IDQA 1GPAA 2EWVA 2VRCA 4KQ2A 2ZRIA 2QNRA 1LPAB 3PUWA 1EQUA 3R0QA 4JT8A 3JCMM 5FLEX 4ND3A 2ZBUA 4L5BA 1DV1A 1W4CA 3ZI4A 2C7PA 3KAJA 1PN3A 1D1QA 3OT1B 1R1MA 2R11A 721PA 3Q40A 1L7PA 3KT0A 5SZKB 3E7DA 1OFTA 3AB8A 3UYLA 1F6DA 3DDWA 1VSBA 3CBQA 1ZITA 2BHSA 1GSOA 3ANTA 1XCMA 3N74A 2M6KA 5LNK1 3FD8A 2DHQA 1SZPA 2YS7A 4I1IA 1U8CB 2VXBA 1CXZA 3UWDA 2J41A 3PVZA 1R0KA 2W70A 4WGGA 4Y6SA 3RCBA 1SQSA 2PWBA 2QUIA 4J75A 3UICA 3ZQUA 1PW7A 4ZO9A 1OKKA 1E2IA 4L76A 1K6EA 1WQ1R 4J90A 5EQTA 4EL0A 1DG1G 4TT3D 4CGYA 5FO1A 3DSRA 2QMZA 3GUVA 1JR3D 4XCVA 1FQWA 1U4NA 2B92A 5LD2B 3R5FA 2VDWA 2IDJA 4UHBA 3ETLA 4ZJPA 4F5ZA 1TRHA 2QI9C 2XT6A 4B17A 1XXHE 3OBWA 1ULAA 2BKXA 2WAAA 3GEMA 3OQPA 1AQ6A 2ZJ8A 1WCWA 4QDZA 2AN9A 2Z2KA 4U2FA 4V0QA 4EG6A 4DV1B 3EWNA 1Y9ZA 1ISHA 2W2VA 3UBMA 5AW1A 1J0CA 2VWGA 5EEHA 4JDPA 1MAVA 1A0OA 1FUKA 1W5FA 3GLRA 3C24A 4YP7A 5GP1A 3IJEB 2CE2X 4EA8A 1YIJF 1ICIA 1U2TA 2HHLA 4GOXA 3EFOA 4F4JA 2VDPB 4NCNA 1YAHA 4KXVA 3OLCX 5EIFA 1JUDA 3LDHA 1PR1A 2YN2A 4RLSA 4UBMA 2JLZA 2JBAB 3RK0A 3TQCA 1CRPA 2QG9A 1WCV1 4BQEA 4TL6A 1XO1A 2AFHA 1Q7YH 2FW9A 2ZJYA 3L41A 2OHVA 5K8VA 3R77A 3WL8A 1SXJB 1XP5A 2HCJB 3JAMA 3FNEA 5BSUA 2ACEA 3BXPA 1QBGA 4AYTA 4TVBA 3HN2A 2UUBB 2OAEA 4BT3A 4HAUA 5JQGA 3IDFA 3PFCA 4GXTA 1OWNA 2ZANA 2CZCA 3UXEA 1SUWA 3CZAA 1I2MA 4QWWA 1TK2A 1HDZA 2ZJ3A 3D6JA 3QEBZ 3O3CA 4O4HB 3RVKA 4ZHVA 2IF0A 4J0JA 3HVKA 1QFYA 3F1LA 1KRWA 1JHQA 5HOEA 4G1UC 4MLCA 5A04A 2YIMA 3UGQA 1YCGA 2YZGA 4DE5A 5FTWA 3U80A 1NMXA 1RFLA 1MZVA 4MVXA 1I2AA 5B36A 1IHPA 5A9RA 3BWBA 5CB4A 2GD6A 3QE4A 3SSAA 1ECFA 1VQVA 3CG6A 1EVEA 4IDDA 4JLJA 4ND4A 5ED0A 2WW8A 3ZCQA 1SXPA 5EAIA 1KKMA 3W5UA 3WPWA 3PC8A 5AI0A 3RC9A 4B5KA 1YFLA 4QTYA 2DT5A 3H6HA 2PBFA 5KYWA 3T1TA 4CPDA 1ZD9A 1I2BA 2GFIA 3C70A 3DGEC 2DECA 2LPMA 3KSZO 4FQ7A 4MI1A 4Q7JB 4ERXA 5DM60 5KREA 4Q3BA 2ZDQA 4ARBA 5KWSA 1K9MH 4WY5A 1E1QA 1E8DA 1U1IA 2XOKA 2YHAA 1RPTA 3DF9A 4H3SA 1XCGB 1F7UA 3AETB 5H83A 4IVNA 5KJFA 4RY8A 4L72A 2Y05A 2UYNA 3UHOA 3QPUA 1Y3AA 2FMFA 3PJDA 1WP4A 4YRCA 5U4XA 1IV1A 3JWEA 4I19A 2PU7A 1I9CA 1R6AA 5F1PA 1M7HA 1ZMRA 2XWJI 3ETEA 1RWVA 2HLDA 3O84A 4BT5A 5CGQB 4BB6A 4I50A 2Z9BA 3OCVA 4WCFB 1ZM3A 1GFWA 2BGKA 3OI7A 4MUEA 1HDEA 2X4DA 3WFZA 2R87A 3FSGD 4FK8A 3UKDA 3L5OA 1W2BF 1KZGB 4P4NA 1G0NA 1H9AA 1MFPA 4L7VA 4ENRA 3S1SA 4N9QA 3G8DA 1FYXA 3AEZA 3QPCA 4AZ0A 1M34A 2X0JA 3E8XA 1VG1A 1Z7GA 4KH1A 4MKFA 2RC5A 1E9RA 1L7DA 1T5TA 5C32A 4LCBA 5IT0A 1HK7A 3KOZA 1VKNA 4LDZA 1O97D 4LYYA 3VISA 3LCCA 4QQFA 3SY8A 3QFFA 3JASB 4EUEA 1QGUA 3FGZA 3L8HA 4NFYA 4BWVA 4UU7A 2PX6A 1HE4A 4LDPA 3TAXA 5EXPA 3G0OA 2CXXA 3BCHA 2ETXA 3UKJA 2P7IA 1XTZA 1E2EA 2QTNA 1OLSA 3SC2B 1S89A 1QIIA 2VN8A 1VBKA 2NPFA 3T1HB 2BUAA 4DA9A 3CB2A 4L2IB 5FOWA 4MTCA 5AXAA 2ERCA 3WKEA 4AP9A 3GI1A 4FFBB 2VDUE 4MW4A 3KOWA 3M4ZA 5KBYA 4G4YA 4XM1A 5M3BA 2Q2WA 2RBKA 1HC7A 2UYOA 4UNQA 5U9CA 2HF9A 2P6OA 4R6XA 3UOAB 4ND5A 3DBLA 1YZGA 1Z2PX 2DPXA 2X9GA 2GCIA 5LNK6 2K1SA 1E7MA 1L5SA 4M86A 4AXXA 1AO0A 1X7YB 2OORA 5JU6A 1CLIA 2XZOA 1TKAA 1QVWA 2PGLA 4TMWA 4LF5B 2JW5A 3UENA 4K6MA 4MDYA 1FY2A 4NMWA 4KPFC 4OI2A 3A6DA 3QWBA 4CR6A 4YX9A 1ZRNA 2QVCA 4JJIA 2ISSD 1M67A 3GQBA 4PHGA 1HQDA 2JKYA 3RJMA 1JR3E 2X15A 2IEIA 3G13A 4YCMA 2J45A 1MOPA 5FFFA 2Z57A 4HYEA 2J4FA 3S2YA 4G4WA 2H59A 5JRJA 4ZZIA 2A0KA 4WZZA 3PYMA 1A04A 5EZYA 1IXZA 2J3JA 4JUCA 3SKXA 1CBUA 1BQEA 4OQQA 5AW4A 3SZGA 3MINA 4LJ7A 2EHDA 5LA6A 3OQHA 2BFEA 2ZIVB 1XDGA 4GC5A 1JAXA 1P7CA 3HU3A 5HBGA 2YN0A 4E2YA 3GPDG 1P6XA 4PFKA 1TCUA 3HKDA 4BNTA 5CFQA 7GPBA 4TM7A 3EPHA 2ATVA 4JBIA 5FFNA 1OVGA 1SZDA 1PKEA 1QIJA 2A94A 1G63A 3OU6A 5DYIA 5F51A 5H5JA 1O08A 1TFUA 3MLBA 3VYSB 4D99A 4BPBA 1JZSA 5BMVB 4LZOA 3JATB 4WK6A 1TQDA 3TD5A 5IG2A 1M2EA 3KKZA 4IYJA 1IPHA 2DKNA 3RSHA 5BMVF 3I56F 1E6WA 1G64A 2Q7XA 1TPZA 3U56A 1MEJA 1TB4A 1ONOA 3QKWA 4NJEB 4Y6OA 4REMA 5IVIA 5CAEB 3H87A 3IBTA 4LXXA 2HDHA 4W4TA 2LIVA 2M6LA 1FU7A 3DVAB 1EINA 3KXDA 5D3MA 5BNIA 1A88A 3D1VA 4QNNA 4HCJA 3CO0S 4TZ0A 4HLDA 3P2YA 3WYCA 4LVUA 1Y8ZA 4J0GA 1TYCA 5AXBA 5IBCA 4ZEMA 3DZFA 5LMNB 3AIMA 5D7BA 2XMCA 3VPFA 4JVMA 2P35A 3C98A 5L4NA 4R9RA 1UUFA 2QZPA 3F7MA 1PUXA 3N2LA 2BM0A 3N75A 5G3ZA 3T4EA 2DETA 4HP8A 4PNPA 1FSGA 3Q12A 2ATIA 4EFDA 5LLTA 3UFXA 2FSSA 1ESEA 4UPEA 4CCYB 1C2YA 3O21A 1JB1A 1ZK4A 1FL9A 2Y93A 2XXAA 1WTCA 1QOPB 4WZ6A 2BV3A 3DFIA 2VJOA 1BEZA 3IQEA 3KZCA 1NLYA 1SD2A 3C87A 3DE6X 2XGOA 4C0BA 1QDEA 4DR2B 4CTMA 1KFEB 2C7VA 2OO5A 4JT4A 4OGFA 3ZDRA 3PRHA 1I3LA 4LXIA 1GQYA 3RNOA 4PN3A 1Y6FA 3CX6A 1RE0A 2H5LA 3NIWA 3ZU4A 3W78A 2VZ0A 2C8JA 4E14A 3S8YA 1SKBA 1T8TA 1XMJA 2QTRA 3DL0A 2E82A 4J03A 3MJHA 4KO4S 5J2UA 2ZI7A 4L0DA 1FMTA 4ND6A 3ZJYA 1ONBA 2OCAA 3JARB 1VKOA 5AM2A 5DHAA 2WP8J 2EWWA 2CB9A 2IL1A 3DV2A 1Z4PX 1U9IA 2ZYHA 3C1UA 4HF7A 4UATA 2H92A 2HC9A 3L4BA 3BF7A 4MHTA 1CY0A 3HYRA 4DY4A 3AJAA 3C39A 3IP7A 3OF5A 5CYFA 1GNVA 1BS9A 2Z43A 4NAHA 3FRIA 4PLCA 6REQA 5J43A 4TTPA 1H4QA 4QQNA 5EVJA 1K63A 3RTCA 2ZXFA 1S9HA 2Q49A 2JGMA 2KWIA 5KSYA 2J9XB 1C50A 2B8TA 1KAHA 1UXOA 4BHTA 1SCDA 3M1YA 3K6SB 1GGEA 1X1SA 3PK0A 3IQIX 3QJ5A 1TX4B 4EOGA 2CL7X 2M98A 4IICA 2Z2YA 3R7WA 4JI1B 4ITVA 4RZIA 3TYXA 3V8VA 4EENA 3OAAD 3O2NA 5IDXA 4HK4A 1S3SA 1K68A 2UUOA 4HDMB 4Y2TA 4YUZA 3CCRF 1SBZA 5L4SA 1IVNA 1K0FA 4QECA 1O9BA 2AG0A 4FUQA 4FILA 4LGVA 1BWPA 3N6XA 2A9KA 4ENWA 2HXSA 1XNRB 4V0NA 3LOQA 3QFHA 5FBWB 4H7EA 3OIDA 2Y66A 3IKLA 3Q7QA 1SCQA 4JNKA 3UJBA 1I7PA 5FL7A 1DU4A 5P21A 4QJIA 2JLYA 1N4DA 2ZB2A 4PYMA 3TB4A 1JI0A 5ALKA 2PO5A 3PHLA 1J25A 4YQEA 3DLBA 3LYHA 2VTKA 2I2BA 4RMIA 3SIUA 2IQ5A 1EHIA 2WJGA 1BFKA 1CETA 1P73A 2FPIA 3G5AA 5EWMB 3RODA 3RVLA 4RYLA 3ZQJA 3GL9A 2ZRHA 3O8BA 4KXWA 5DNVA 2G82A 3QVTA 3CLSC 3UANA 4X7PA 4D6PA 4N0DA 4EFLA 1F60A 5K0JA 3JAWA 3C41J 4AY4A 2GH1A 2CWWA 2ADMA 3BGVA 1ODTC 2I7VA 4TWIA 3VR5H 2F64A 4K28A 3PEUA 3EH1A 2XVZA 2FPPA 3G68A 3IE2A 4EUKA 3KB2A 5KDLA 2PH1A 3O8CA 1D2MA 2X42A 2MYPA 2I99A 3G49A 3UMSA 2W8BC 5LZ5A 3TL2A 3W5JA 4AJNA 1LDMA 1TOAA 2Z95A 1Y9DA 1IQRA 2Z4SA 5AOBA 5JY1A 3D7NA 3B5IA 4YDHB 5LQDA 4KTVE 1V95A 4UARA 2HRZA 5KKCA 3GVXA 3GDWA 3PNVA 3AVOA 3EXAA 2OORC 4HZGA 1V26A 1JQ5A 1XD2B 4IHKA 1M0TA 2OD7A 4XDYA 1GQQA 1TJ3A 1FP4A 3NWEA 4MVJH 1QC5B 5HOQA 3Q7IA 3KVOA 4LE0A 1BGXT 1UKBA 4XVHA 4AL4A 2H07A 3IE0A 1SUSA 3AGKA 2FX5A 2WNIA 1ORDA 1IBCA 4RHTA 3V32A 2YQ4A 3BQ9A 2HK6A 1T9ZA 3D01A 2PT7A 3WBFA 1JEYA 1C0LA 3NTXA 3AL0C 3H75A 4XASA 2VYQA 4G1EB 1OBOA 4YRTA 3SYNA 4EQZA 4L9RA 2C54A 2E6UX 2WC1A 2PPVA 4YJHB 4D9JA 1CQWA 4TMTA 4ZZ2A 4QGSA 3NGLA 2YINC 2E55A 5CW2A 2VHZA 3A31A 2RHHA 1T1JA 2C1XA 2WYWA 3CE9A 4GUAA 3K0EA 4D82A 4CETA 5I7FA 1ZH0A 5J2TB 1Y4ZA 2IHZA 5L7YA 3E4CA 3WBBA 4WESA 4QJ4A 5LBIA 3HXOA 2Y1FA 4HB0A 4MGHA 4I81A 3G23A 2ORYA 2AX3A 3GRUA 5JNUA 1VCMA 1FU8A 3OY7A 2VJQA 1H47A 4IW3B 2I3GA 3WNVA 1DVRA 3QP9A 1XI2A 3SDZA 3GJXC 1HE5A 1MAWA 4WBNA 5BQ5A 4IH9A 5A6SB 1MG5A 5E4FA 1EFRA 4Q3OA 3IR9A 3ECCA 3F73A 1QIDA 2CLMB 3I39X 1JLSA 1CK4A 3BRWA 3GHHA 3WPXA 3AMVA 4XRRA 3FMOB 2J0VA 4GG1A 3UC5A 1ND6A 4Q4AA 5M34A 3UH0A 4BOYA 3II6X 1D09A 2BUBA 3K09C 4IGFA 4W99A 4EGFA 4PM4A 5HXAA 1D4OA 2JLVA 1PV1A 1Y4UA 3OCYA 4YLGA 4KAXA 3FBGA 1NQ5A 2IHJA 5DHSA 4WN9A 2OFOA 3REFA 1OXVA 2XHEA 3BBLA 4GWGA 1RQPA 1Y4AE 3ICPA 4EB6A 1ZQ1A 4UM5A 1JFTA 2EP7A 3ZHBA 4DLPA 3TZ6A 3THXB 1OBCA 3IP5A 2GBGA 3CZMA 3IUNA 4JLAA 4P2GA 5DKFA 4BVQA 2FCRA 2GBLA 2OVBA 2ZJZA 4UUBA 5ETJA 2E6KA 3F5FA 4GPEA 3ZWPA 4WN3A 2NQTA 4Z7QB 5IAAA 2EAUA 2CCJA 4DIKA 2IYWA 3PIRA 2Z98A 3QPDA 2UZ1A 3FETA 5COBA 3W5CA 2VYND 5JT1A 3NETA 2OO5C 1NQWA 5E2BA 1JDJA 4CKCB 1KSGA 2FHPA 5EG5A 5EUBA 3IVCA 3JVVA 4A0SA 4PBRA 4BKPA 2PMPA 2CUNA 3R3ZA 3I52A 1O0SA 3RANA 3AESA 4BKUA 4QDUA 3U09A 3WZLA 4Q1AA 3VI6A 1CZLA 5CNKA 4AK9A 3ZWBA 4WVLA 3U7EB 4WVFA 4QODA 3EXHB 1E79D 4A5OA 3CF0A 1TIBA 2OZLB 3M1XA 1W25A 2Y1CA 3OF2A 1U9IC 1GT91 3HCCA 3TDKA 4AM8A 3ZNNA 5KWVA 3L4BC 2A5JA 4C01A 1R0ZA 2CHVA 3GLUA 3HR7A 2VNIA 5DSXA 3MWFA 3I32A 5CDFA 2WYVA 1DJPA 2RHOA 1H2EA 2D4HA 4XKJA 1R5JA 4YCAA 1BZYA 1RHUA 1NJFA 1XTTA 2DHDA 3FBWA 4GPZA 4OHKA 4U4AA 4YHBA 2AMFA 3DQQA 2G77B 2H29A 2OCLA 4IIBA 1JAYA 5K0NA 4RDHA 1EMDA 1L4KA 2XEXA 3TCKA 1SVLA 4ZQHA 1O6FA 3L1VA 4NABA 4MV9A 4UUQA 5J5VA 3QVKA 3ZDYB 4MHOA 3GXOA 3V9AA 3PGKA 1GTVA 4EFKA 3GFVA 1SOAA 3MT8A 2G0NA 4CMJA 1KOJA 2VNSA 2PGOA 1D6JA 3HCAA 3LX8A 3BJZA 4IMIB 2O2IA 4BX8A 2DFDA 2BKUA 2WWRA 4A10A 1Q83A 3TZHA 2FOXA 3G82C 1Z4NA 1HURA 4DNXA 1BGWA 2P8SA 1K7EB 2Y1GA 3H5AA 3WTBA 3AIOA 3ONNA 4GD3Q 3P9RA 1K5GA 3P2MA 4OBEA 3PYXA 1U9JA 4QWMA 3WXBA 1CVRA 2QRZA 4V03A 3R8CA 1J6UA 1T3LA 5ITWA 1LSUA 3S70A 5JWRA 3X1DA 3U7RA 1NN5A 1R2QA 1QVRA 4GYKA 3LYAA 4BX9A 2CBZA 2VHTA 1F06A 1KYWA 2VKQA 3VJKA 3ZV4A 5HYVA 2GLXA 4F2HA 2BCGY 3IHLA 1RM0A 2XDYA 4NMMA 4QT4A 3WTCA 2DR0A 2Z8ZA 3FKSD 3FD6A 1KMNA 1WXWA 3QPWA 4HFNA 4PX9A 4XCXA 3UPTA 2IPOA 3ZO8A 3CX3A 1WETA 4WNCA 4D9KA 3KJHA 4EI2A 2VXCA 3EC2A 4B40A 1DAEA 4KO3S 3PKZA 3L6DA 1S8OA 3EGDB 4GZ5A 3DJYA 1PL8A 5DP1A 2BW0A 1N2JA 3EQ9A 2WWHA 1P33A 3JYOA 2DLCX 1T9HA 4AFNA 2QAJA 4M6WA 2ZK7A 4Z4CA 3B7WA 2ODEA 2QUKA 1ISRA 2JAXA 4RHFA 1H94A 2NXNA 4A8JC 1C3JA 4AY3A 2W2KA 5BVGA 5GOZA 1QYIA 1T29A 2K7ZA 3IODA 4BFXA 4PXAA 1RXUA 5B58T 3Q0EA 4D9NA 1GR1A 2PUFA 4U2BA 3TKLA 5AVYA 2FZCA 4E70A 1DKRA 2IEZA 2HA3A 3L6OO 4WDQA 2H63A 5F1KA 3ICOA 4BTEA 2Q6OA 3H5TA 1Y7IA 1QGAA 2CV0A 4BMCA 1E1NA 2FWBA 1J9GA 2AN4A 3EIQA 1X3LA 4O2LA 4DILA 4EK9A 1KI8A 1KRXA 2Q4BA 5DSTA 1YFJA 4IIJF 3G0GA 4QUKA 2XD4A 5KSPA 5CU7A 3N87A 1PJRA 4MVWA 5KJ1A 4IBOA 4MGKR 1NUUA 4REQB 1JVBA 3LQYA 3T5DA 4F3CA 1DT5A 1N2EA 5JOQA 4DR4B 2IHVA 4I9GA 1TUBA 1XQYA 3EG9A 1ZHFA 3MOIA 3T4XA 5LOVF 5K2OA 2HHJA 1W76A 3QBTA 3H5VA 4HAYA 3ZWVA 3TFOA 4WQMA 1BHO1 1Q22A 4DLLA 4DCGA 4DRYA 4G0OA 4EBBA 4CU2A 2FEMA 3H05A 3MELA 1V35A 6GPBA 3ZY2A 4EGCB 2QRVA 4B4UA 2O5RA 5F76A 5HTOA 2I33A 1M5RA 2GETA 3R0PA 1FEZA 4GVXA 1NSTA 3MJDA 3LGSA 3CMMA 4CCSA 4Q9LA 3VR4D 4EPRA 1QV7A 3LLVA 5LMZA 2VNJA 1CC1S 1SIUA 3AWDA 5J40A 4RESA 3TINA 1Q0PA 3HEAA 4LE2A 1M2FA 3U5TA 2BFDB 1JHVA 2ZYGA 3G17A 3S27A 1LB1B 4V1CB 5J3JA 5F2NA 3M8KA 3I04A 3GX1A 1W93A 3ORRA 4XGRA 2XB4A 1J8VA 1PFVA 3IT0A 3I6IA 2GBLC 4PSVA 1ZD5A 4KU4A 4MP3A 2YICA 4PQEA 3IUEA 3ZU5A 2R9VA 4DLNA 1YTLA 4BVEA 4PFSA 5IXJA 4C2TA 3O4JA 3EUWA 2QN2A 3TRJA 2WLSA 4CV1A 4D92A 4EKIA 2HI0A 4G88A 2V5VA 4LYAA 5DH9A 2QG4A 4YPOA 1X7PA 1EVYA 3CF4G 4TWJA 2QENA 1KYXA 3FSEA 5AD1A 2XUFA 2H4WA 4WKGA 4J0HA 3CTPA 4BT4A 3C6ZA 2ZRQA 2HA7A 2ZBVA 5C3MA 5BSMA 3VI3B 2C8VA 5B3AA 1H8HD 3A36A 3DZDA 1UJNA 1C1DA 4FI3C 1AS0A 1ZHHA 3BMCA 3BICA 1G5QA 4IINA 5LZ7A 2X2FA 2X0EA 3D59A 4R2IA 1YTUA 1EZ4A 1J1ZA 3D8BA 2FRDA 3FWKA 4X91A 2H54A 1CYDA 4DR3B 1T25A 2GVDC 2BCJQ 3UB3A 2WHXA 1U2ZA 4RL4A 3KWLA 3HZRA 2VNAA 1J7HA 2I29A 2J5QA 4E51A 1P74A 2QEXF 1UXKA 2W43A 1WB6A 5EWLB 2Z1UA 4UMEA 4UOQA 5F2KA 4Q3KA 2G1JA 2ZYRA 4ECAA 3K0FA 4H0NA 1SCNE 3EYWA 1IK6A 3LT5A 3ETCA 1N1EA 4Y9UA 1IEWA 2DQ4A 3A1EA 1NYLA 4Q4HA 1AA9A 3GA7A 1ELOA 1MH1A 3NIBA 3WWCA 2WI8A 3LI2A 3NBQA 5JXIA 3I9LA 5C52B 3R20A 3RVOA 3OT1A 4B6FA 3ASYA 4OATA 1ADGA 5TPZA 2QTFA 3EF1A 4IGEA 1Z0FA 1VOTA 2Z1TA 1AOXA 1NLMA 3X43A 1KIFA 1VPDA 4O2AB 3SYKA 3W2HA 2OTCA 3KPUA 4IRXA 4RK0A 1SXGA 2TYSB 4OXXA 3X1MA 3LC0A 3ZD9A 2H65A 4IG9A 2JGLA 2VOEA 2C5HA 2QZ4A 4FYJA 1DC5A 4GMKA 3PPWA 3RDPA 1P4SA 4JELA 1JD1A 1HFWA 5I7HA 3JVEA 4H9GA 1M1YB 1NSYA 2DPHA 3JYPA 3MFYA 4B3HA 3JQPA 3NORA 3A25A 2KGWA 3MM4A 2FJ0A 2C29D 1XTVA 2GF0A 3KE9A 3ZQ4A 1U0LA 3RUIA 2BO1A 4AS1A 4A03A 3EDCA 2LDBA 3I34X 4EJ2A 1JHYA 2QVLA 3FAZA 1G21B 3H1BA 4Y9SA 4INJA 4KLAA 3B1YA 5FD8A 2OQIA 1XZIA 1ECGA 1GAQA 1OYOA 2GSWA 4HO1X 4KOAA 5E1BA 3LCRA 5BUSA 1CQIB 3RABA 3IAEA 3OICA 4TYMA 4TL7A 3B7GA 3D6MA 2WKRA 5ICSA 1MG0A 3G0HA 4UHDA 4C82A 4M9UA 3HJWC 2C9MA 5B55A 1GGNA 1UKZA 1JQEA 4LIPD 3RSSA 1DTEA 4C88A 4RSMA 4R2KA 2ID9A 2V8BA 1EZZA 3AVTA 4MJ7A 5F9MA 3R5TA 1ZA1A 4UDOA 1O9GA 1KGSA 1KI3A 1POWA 4C7JA 1BDIA 4K8OA 3TXXA 2PMBA 3V33A 3PLAC 3NZEA 1PS9A 2JBAA 4GKBA 2PL5A 3VR3A 3COPA 4R51A 5LMCA 1E9VA 1FBNA 1SEPA 1GG2A 1KS9A 1KP9A 1M5UA 2P6MA 1IUOA 1E58A 1KSFX 2BM8A 2VJAA 3GFGA 1KDPA 1H1LB 4MUMA 4P8RA 4ESEA 1AKYA 1YDGA 3WIOA 3WWDA 1WLYA 1YVPA 1NU8A 3L1JA 3TXAA 3NAZA 4ID9A 2BGGA 1MVOA 3U3MA 3FBAA 4TWBA 2FRXA 4DG9A 4EY3A 3TLXA 2H00A 3QMPA 4N1AA 4HNSA 2VH5R 2X5JO 2DJ5A 4QE3A 2YJ4A 1PJ4A 4BCDA 4P58A 3CPJB 5K0ZA 3LCVB 1MPTA 2INGX 3C8HA 3R7NA 4CL8A 4KFRA 3AR2A 1SHJA 3GYBA 1LKZA 3C4VA 1L7MA 4YGXB 1Z0KA 4R2WA 2X0KA 3QE3A 3B1FA 4UW9A 1IH8A 4X0EA 5BSWA 1BWSA 4ZEXA 3BOSA 4HSGA 3F2IA 3ILYA 3OZFA 1LZLA 2Q0HA 4WY8A 4OXQA 3AR8A 1NXWA 3AKEA 4V0OA 3PZRA 1P2TA 2VP4A 3DUWA 2XWSA 4B48A 4RTKA 3UAOA 1AQLA 3J7AC 2Z6UA 2OD2A 4E1VA 1ZAYA 2L0XA 4Z9AA 1A7AA 4XM0A 1V8DA 4ZJZA 1DJOA 4IJ6A 1KJNA 1KO8A 4XH9B 3RTAA 3D8UA 3MTQA 5KNLA 1CTQA 1JLMA 3VJLA 1CRZA 5ER6A 1ETUA 3RRYA 4QQ8A 3HVJA 3YASA 3I30X 4DMMA 4Q4CA 4F93B 1AN9A 3AFHA 3CRW1 3VR6H 1NWHA 1TM4E 2V7EA 2OP0A 3BK1A 5DM1A 3P1JA 4RCVA 4URXR 1TA9A 4DR1B 3LRPA 4BNHA 1V4VA 3JD3A 5LDHA 1U90A 4LYHA 4RVSA 4DMRA 4Q9DA 3ITDA 1Z5ZA 3LOUA 3OSUA 4PINA 3M4YA 3Q0IA 3EEQA 5BNZA 1ZH4A 1YI2F 2JDIA 2GCNA 2WJAA 4FVTA 2HXGA 1SK9A 2H4JA 5G0TA 5KHAA 4DVGA 4ENSA 1UAYA 5CRIA 2Z4RA 3BXZA 4PO3X 2HCFA 3HCWA 1NVWQ 2VAVA 1QONA 2HZ7A 4WCFA 5L3RA 3KJJA 1W0KA 3Q8KA 1FUUA 1EM6A 4LS3A 3TH5A 2CC2A 1KPIA 1NXTA 1LGYA 1YZNA 3U13A 1V11A 4E5DA 3FWYA 3QFTA 5IF9A 3IP8A 5BV0A 4BT6A 3L8GA 2EBWA 2QTHA 3INGA 4RL6A 4B46A 2OV6A 2FRDC 2VUIB 3BAZA 4U6SA 5CM9C 4KQKA 2W0MA 1C1XA 1O57A 4E2WA 1VP9A 5CYGA 1DDGA 4GPTA 3JASA 3EDOA 2ZB8A 1IM5A 3LHSA 4Z4EA 3WLTA 1XNQB 2H51A 1BYUA 1UBNA 1FNJA 5F2EA 4RD2A 2HA6A 5HWSA 4OYRA 3MTBA 2HO5A 2JZNA 3FTPA 1RVV1 3L92A 3FRJA 4IOLA 3ZNOA 3G9XA 4PX2A 3RKSA 5C18A 1MC4A 2O07A 2ASEA 3MGKA 3IBGA 3HXTA 1P7VA 4GNKA 2FWIA 4IXMA 4WLVA 5K6RA 3I1FA 1AKVA 3SC2A 1X1BA 4ZEWA 1A9YA 1QE0A 4FNMA 1IJKA 4L2IA 3A6KA 2GJ4A 2JATA 1VE9A 4AMZA 4L8WB 5JZVA 4FFBA 4YIHA 3Q3EA 1UXHA 1QHSA 3RTGA 3BB4A 3LM8A 2ID7A 2GPNA 1Q92A 2R6AA 1TMKA 4V39A 3ZV5A 4D26A 4GX1A 4NU0A 3DLTA 1DPGA 2CVQA 3HJRA 2R6FA 3TR0A 1DC3A 3DHEA 3DNPA 5ELXA 5I9MA 3GRFA 1OX6A 3JQBA 2I8LA 4Y7CA 2F8LA 4DDHA 3TMKA 2YYEA 1PW5A 1SOWA 2VF7A 1OHHD 1DIOB 5DMXA 1T4BA 3B2NA 1N6RA 3S0JA 1ABFA 4AUKA 3S06A 4ZT6A 1RBMA 1Y5LA 1JG2A 2H2DA 2W6OA 4O0LA 2X8JB 5DW3A 2OWDA 5A5GA 3LWZA 3M6WA 2I66A 3SR0A 3ESYA 1R00A 4L9SA 3UT0A 5ALWA 3U7IA 4TROA 4B6QA 2WPDA 1NTRA 1OZAA 2LNDA 3FCXA 4DIOA 1JG3A 1HEYA 2GO7A 2H5IA 3HJUA 1T0KB 2KS6A 4HLUA 4NL4H 5DBFA 3SX0A 3M6VA 1G4HA 3KD3A 1C41A 3O8DA 2HS0A 2GEFA 2QSZA 3ETDA 3JZIA 3PGXA 4KR2A 3INNA 1FFGA 3BD7A 5LD2C 1NW5A 1XDWA 2XEDA 3S7ZA 3ITEA 4B3FX 1JBKA 4JC4A 2WIKA 2WYOA 5BO5A 3CXCF 1JJAA 3OF3A 2H8EA 5HDBB 5SV2A 4CKZA 1FMFA 1TM2A 1M8GA 1R37A 1ZJYA 2WWTA 2Y0PA 3A9WA 3ESQA 3IQXA 2VQDA 3QUCA 4RANA 3QNWA 4HV4A 4JC8A 1Z0DA 4DJAA 2YBDA 3E23A 1YDWA 2HJ9A 2AXEA 1DIBA 5BMVA 3JATA 2OCDA 3BE4A 4BFUA 2XB2A 3HN6A 4IKPA 4MJXA 4AO6A 3A26A 5JJ5A 1FVHA 3ZBPA 4GRDA 3FVVA 1GZDA 5TMEA 3A6JA 3WX0A 4JXXA 2HP0B 1M6WA 5CAEA 1U0BB 2GJKA 1US8A 3CIOA 3DVAA 2WB4A 1DBPA 2W2OA 4JP2A 4EJMA 5JE8A 1R0LA 2QT9A 3GJQA 3SOZA 3RWBA 4CMHA 1NVAA 4GM0A 3HPRA 2F1HA 1XTQA 2RCNA 1Q86H 1YVRA 2BEKA 2ZLBA 4EHFA 1P1KA 4EL5A 3BEOA 3PVCA 2WD8A 4ZTZB 3U61B 2OCGA 3FOAA 4AJ4A 1GA4A 3QY9A 4DMKA 4MO2A 5FA8A 2EG9A 3F0GA 5EE0A 4YRKA 3TL3A 1IY8A 4UHHA 3D9QX 3JWGA 4BKRA 3EARA 4KN6A 4EKNB 4X85A 4HOYA 4MB2A 4IG4A 4AJEA 4EPYA 3Q8WA 1QAOA 4IILA 1HWYA 2FW8A 4LC1A 1TYZA 4IIVA 4IOJA 4LNHA 2FXIA 5HKKD 1T91A 3M6UA 4Q6WA 4UXHA 5JW6A 4M9CA 2D3TA 4FX5A 1XLTC 3LDFA 4IIEA 4RXMA 1Q0HA 1PF5A 3IMPA 3O2QB 4DYDA 1AIPA 2HIMA 3CCCA 4BFCA 4Y1FA 4N7JA 5BUZA 1UANA 1J70A 4X6UA 4X94A 3CUYA 4DQLA 2FXVA 3ENVA 3GT4A 4MICA 1W9MA 3C3BA 4LI0A 4TT3A 3CLVA 3K71B 4S2EA 1A8QA 5FWXB 1E0JA 5LR6A 1JR3A 4TL9A 1NXVA 5E2IA 1LH0A 4EJ0A 4TSKA 2BSQA 3NUGA 4WECA 2OC4A 5AKJA 1AXRA 2Z56A 4QRHA 4W1RA 3T9EA 4H27A 2RHJA 1Q44A 2TMDA 1HH4A 4YT5A 5AI6A 2O4UX 2B0CA 5JSQA 3HB1A 1DMRA 1FSFA 4JC0A 3WL6A 2JIOA 3G89A 2X3FA 4GOND 8OHMA 1TPYA 4A8HA 3K6SA 3RSGA 5T67A 3VGPA 1DV2A 2YHUA 3AM5A 3WGVA 5KCMA 6AT1A 1L5HB 2NZ8A 2YHBA 1A97A 4D4KA 1DLIA 5DI9A 1VHJA 2IZ1A 2CK3D 2QX8A 3N39C 3OJ0A 1TTHA 1W88B 4B6PA 4B79A 4UCQA 3ZLUA 5CA1B 4HDMA 3OTOB 1ST3A 1PR4A 3EVNA 2JA2A 3QTLA 4YY3B 2KG4A 3G71F 3EHDA 4JYMA 5HS6A 1YI0A 3M9XA 1JALA 2ZAMA 3KLPX 2YYYA 5K5EA 3OWOA 4ZKEA 4C6RA 5ICFA 1XMVA 3FMIA 1HLPA 4PY2A 4ZHQF 3ND8A 2I6XA 2DBRA 5ALFA 4J8PA 3G2OA 1PR2A 1V3TA 4GMHA 3DL2A 3RF6A 4ID3A 5CVDA 1NF8A 3WQHA 3HP4A 1H3EA 2G8LA 1EQAA 5L3QB 4NYIQ 3I9JA 4WBXC 5EWMA 4GL2A 3RVBA 2VI5A 3JSAA 4MK4A 1RDFA 5HG0A 5A02A 3PPVA 1Z3IX 2F48A 3AF4A 4CLDA 1VMAA 2PAFA 2VQSA 3I01M 3L84A 4QKQA 3TVYA 1RHJA 3Q7EA 3LIIA 4X60A 1A98A 3PV0A 1GKYA 1ENOA 3ELYA 4HDSB 4L1KA 4BNYA 5KQMA 1TZJA 3L0ZA 1S8FA 5K8CA 3L0BA 3TKAA 3R7SA 3GRRA 3L1IA 5FDFA 1ZH6A 4RKWA 3KOYA 2PKWA 4XWGA 1FSPA 4K88A 3JD0A 5ADUS 4U9HS 1P4AA 1Y7HA 1ZBQA 2OTLF 3HNOA 4ARAA 3JQBC 4AX4A 1OV4A 3D0RA 3GRAA 1C2TA 3KFXA 2AG8A 1T0UA 2ONYA 1FFBA 1XMXA 4AIRA 5JS8A 1XD2A 3C9UA 3BWYA 2YXEA 1IPEA 1Z83A 3HO6A 5JSFA 2PUBA 1QC5A 2P9QA 4EUFA 2VBFA 3A6HA 3ZV6A 3W5BA 4DQXA 1C9MA 2BF7A 1SBHA 2WA1A 8ABPA 1F0PA 3PEWA 1LF5A 4NFSA 5JFGA 1M2KA 2VPIA 5DV9A 3FJOA 3L4KA 3ZDBA 5I3CA 2QIPA 3FYSA 3LCUA 4KSYA 4CV3A 1KO4A 2XVXA 5EMHA 1Y7PA 2X23A 2JLSA 3E2IA 3OZCA 4EECA 1OBVA 1T8RA 3JZAA 4XJTA 2C94A 3KIZA 1BYIA 4HLUC 4US0R 4YJHA 1F8UA 1MPXA 1O0BA 4L9WA 3Q5GA 3Q2IA 3TD3A 1DZIA 3HDQA 2QW0X 3KOXA 4M0FA 3ZE6A 1WP9A 1TDJA 1L7OA 2ZULA 2VJDA 4LYDA 4TN5A 5J2TA 4MDHA 3MRXA 2AC7A 4P22A 5IJWA 3JVDA 4WNAB 2VWQA 3RE1A 4AW9A 1NT2A 3AHIA 2QV7A 3FSGA 3BL6A 1NVKA 4II7A 3SXUA 5DF1A 1MQSA 5GVSA 1GA6A 3VYSC 3I55F 1J9ZA 4Y0VA 1G20B 4ENUA 1XSEA 5A6SA 3ONVA 3QQPA 2RKOA 4OFWA 3TNYA 3ZXXA 4TN1A 3DLAA 1HT0A 2DWQA 1MHPA 4KGZA 3FNHA 2F1JA 3LUBA 1D8AA 2IC5A 2IZ0A 4FZ5A 2RMKA 3B1JA 4NCJA 3ZIUA 4F56A 1W5AA 1S9DA 3ND6A 3UKOA 4N3BA 5FOQA 4YCBA 1IEQA 1FTWA 4MMXB 4DLVA 3D1JA 2D5CA 4X84A 3MD0A 3TSOA 3V6LA 4BX3A 2GPTA 4GXRA 4OBXA 1MAHA 5EXTA 2I6SA 1P75A 1P7YA 2HCRA 5KCZA 3ZDDA 2NV0A 3UAWA 3W1WA 3THXA 2B7LA 5CFRA 4HL6A 4JJKA 2NZJA 2ZPTX 2ODQA 3E3LA 4KMMA 4CLEA 3MVEA 2QBYB 2Z9CA 3K4QA 3QF7A 3OOSA 4EBFA 3LBHA 1LDYA 1Z7WA 1E63A 2ZRMA 3K1YA 5JC1A 1NBIA 1TU0A 4IMJB 4RW0A 2AKYA 1QV9A 2XB9A 5EA2A 1RLMA 3CPWF 2QZZA 2AW5A 5FUWA 1LLUA 3RYFB 4JMLA 5AM1A 4HS9A 4JVLA 1N92A 3LHIA 3FD5A 4WJZA 1K4MA 3D7RA 5I9IA 2ECFA 3O9MA 4GLJA 4KK4A 3PF9A 4NK4A 3JQ6A 2VJBA 3N0VA 4B6GA 2BEWB 4D46A 2CXSA 5ICGA 4FD3A 1DIAA 3UQZA 4DWVA 4TS4A 1WKVA 5DNAA 3RAPR 1UBRS 4B76A 4FT2A 5KJCA 4CXMA 5CDSA 1AQYA 3D4PA 3JQQA 4I4LA 1UBCA 2LRHA 2OFXA 3EXHA 4ZAFA 3IJPA 3KQVA 2OZLA 1ENZA 5JD5A 4HDNB 2KJQA 2FUCA 5F1YA 4P5DA 5G0UA 1W9HA 4CUJA 3C8MA 4AMGA 3HA7A 1GDDA 4O6VA 2FH5B 2BBWA 3O4VA 3N0RA 4OUDA 4M37A 3GLGB 6NULA 3RHFA 1R0YA 4NENB 3EPLA 3CCVF 3J7TA 1KOGA 4INZA 1QU9A 4BYGA 1VI2A 2NYAA 3N07A 1EIZA 5GPBA 2AYYA 3O8QB 4FCTA 3EBLA 3O6VA 1EJ2A 1VIMA 5BYBA 3PIDA 4ALJA 5IZCA 3GGSA 3DDNA 2OCBA 4QLAA 4E94A 3GO4A 2SBTA 4FE4A