3WGKA

Staphylococcus aureus ftsz t7 mutant substituted for gag, deltat7gag-gdp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGAGLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 97
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgkA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgkA01
4X1IB 3JAKA 4O2AA 5JCOC 5MN4A 3RYHB 3JALB 3JATB 2VAMA 4I50A 4YJ3A 4TV9A 4O4HA 2VAPA 4TV9B 4F6RA 4KWEA 1FFXB 5CA0A 4DXDA 5LOVB 3HKEA 5FNVA 3RYIB 4O4JB 4LNUB 3JAKB 4O2AB 2VXYA 4YJ2B 3WGMA 4I4TB 5J2TA 3ZIDA 3HKDB 5IJ0A 1FFXA 3HKEB 4I55B 5CA0B 5KX5A 2RHHA 3JALA 2Q1YA 5IJ9B 2R6R1 3CB2A 4O2BA 1RQ2A 3ZBPA 3N2GA 4ZI7A 5LA6A 5C8YB 4XCQA 5KX5B 2BTQA 1TVKA 5GONA 3M89A 3WGKA 5GONB 1JFFA 5JQGA 1JFFB 5CB4B 5MN5A 5IJ0B 4O4HB 3UT5B 3JASA 4F6RB 5LA6B 5C8YA 3VO9A 4YJ2A 4IIJB 2GVIA 3C8LA 5JQGB 5IJ9A 1Z5VA 3UT5A 3VOBA 5CA1B 4O4LA 5CB4A 4ZHQB 5KMGA 4TV8A 5LXTA 4ZHQA 1W59A 3HKCA 5IYZB 3R4VA 3HKCB 5IYZA 4HNAA 2XKBA 4TUYB 3RYHA 5JVDA 1FSZA 5JVDB 4O2BB 2RHJA 1TUBB 5LP6C 4U3JA 2R751 4M8IA 4X20A 4O4JA 3M8KA 4EI9A 4EB6A 3RYCB 5ITZB 3WGNA 5EZYB 4EB6B 3RYCA 1TVKB 1W5FA 5EIBD 5J2TB 1W5EA 3E22B 4EI8A 1SA0A 1SA0B 3RYIA 4WBNB 3JARB 3ZBQA 4DRXA 4LNUA 4TUYA 4FFBA 5EZYA 4B45A 4I50B 1W581 4X1KA 4YJ3B 4ZOLB 3JAWB 5CA1A 1RLUA 3JAWA 5EYPB 5JCOA 4TV8B 2BTOA 4I55A 4X20B 2XKAA 3VPAA 3JARA 4X1YA 5EIBC 3VO8A 3RB8A 3RYFB 3RYFA 4O4IA 5BMVA 2VAWA 4I4TA 4E6EA 3V3TA 3JASB 3E22A 4ZOLA 5EYPA 3N2KB 5LOVA 3N2KA 5LP6B 5JH7B 5LP6A 2BTQB 2RHOA 4DRXB 5ITZA 4IIJA 4FFBB 3VOAA 4B46A 3WGLA 3JATA 4O4IB 1RQ7A 5BMVB 5M7EA 1OFUA 3N2GB 4U39A 4ZI7B 1Z5WA 5JH7A 5FNVB 4HNAB 4IHJA 3HKBB 3HKBA 4IHJB 5J2UA 2RHLA 5J2UB 4X1KB 4EI7A 1TUBA 4O4LB 5KMGB 3HKDA 3WGJA 5LXTB 5MN6A 4U3JB 1W5BA 5LYJA 1W5AA 5LYJB 4X1IA 2Q1XA 4X1YB 4WBNA
chains in the Genus database with same CATH superfamily
1GKLA 3PXEA 2BP7A 1QC5B 3ELUA 3OFND 4B33A 4RADA 5GZ1A 1XNRB 1L8OA 4TZTA 1TYAE 1O9HA 2UVPB 1I6WA 1R9MA 2BMWA 3RRFA 4M6WA 4EMTA 3FR7A 1GNTA 1RWXA 3A4VA 2EDAA 3VJLA 3X2EA 1B4DA 2BM9A 2OV2A 2PD6A 4FZJA 3DAHA 3R40A 4WESB 5HE9A 4DLLA 1W88A 1W1UA 1XLUA 3R6TA 3WGVA 5KYGA 2QJRA 2HKIA 2I3DA 2XODA 1YBAA 4II2A 2D7DA 3BM5A 1SVKA 4IDOA 1BWPA 1M6NA 3WRYC 4CR6A 2R6R1 3IE1A 3IQZA 1U2DC 4BVSA 1X9GA 3MGBA 3FD8A 4A0HA 1M34A 2NPIA 2IXDA 5EIXA 3IMGA 2O6HA 1ZQ9A 3FNBA 2Z2KA 4ES6A 2HV9A 1NQXA 2QRUA 1IYZA 3QWFA 2PWZA 4ENWA 3K0AB 1U63A 2JW5A 4OKIA 4K9OA 1ZUIA 3WWEA 1QAHA 2BOVA 3MZ0A 1TM2A 3IKMB 2X3UA 3N76A 1FMTA 4IIJB 1R8XA 2OHXA 4C4SA 3ORSA 4Q18A 4KBYA 1BSVA 4BVJA 4DDKA 2ZJBA 1W1WA 3AU8A 1KS9A 1S4MA 3BB3A 2P67A 3KOWA 4KR2A 1TJ4A 2ZTUA 3NWBA 4GBMA 2BFAA 3HTXA 1VMIA 4UMFA 1RAIA 1DC4A 5EHZA 2R9VA 3HY4A 3UT0A 4AM8A 4AQDA 2XYVA 2ZWAA 4US2R 4MQ5A 3R23A 2X4GA 3AKYA 1U2DA 2CZCA 2GFIA 5G02A 3SKVA 4CGYA 2IBTA 4GMFA 2ZBPA 3E1GA 2RK6A 3GDGA 1P8JA 1DLJA 3OA0A 4I4NA 4BW0B 5ICCA 1NPDA 5JANA 1U7ZA 1OLOA 4CFSA 3TDNA 4YUAA 4EB8A 3DMTA 4ALKA 3KQNA 4X97A 2UUBB 1M1NA 2QRLA 3CONA 2ZB3A 1V41E 4JR1A 2FWIA 1EQAA 3I9JA 2ZE7A 3OURA 4RFLA 3V1KA 1E3JA 5TR9A 1TJPB 3GWZA 1LS6A 3NHYA 3IIIA 3OZDA 1H8ED 1ZH4A 3BICA 3BL5A 1WF6A 4EQ6A 4E6EA 2C8VA 2YHAA 3GLHA 4MJ3A 1Z6YA 1Y5MA 2QG4A 4RENA 3QEMA 4REQB 2FLWA 4MTCA 4ER0A 1KY5A 3EGCA 4PIVA 4R41A 4KAFA 4NE7A 2ZTSA 1VPLA 4ZXPA 4JJZA 4L28A 1XP5A 4Q1CA 4PLGA 3LHKA 1HKHA 4MS4B 1PG0A 3C24A 1LB1B 4MW9A 1OI2A 1T3SA 3VR1A 1EB9A 1ZM2A 2FEPA 3AKZA 3CLKA 3H1PA 4IYJA 5LNK6 2GKOA 2RB4A 4O5OA 2HA5A 1MOPA 1HURA 2XV1A 1WMSA 5EIFA 3PG5A 2LZ0A 3Q72A 4M0CA 4W8HA 3TLXA 4A5OA 4KRGA 1NJIH 5KQPA 3AEQB 1II8A 2EF0A 1MB3A 2Q0XA 4G56A 4FIZA 5IHPA 4YN3A 3FZGA 5JDIC 3MEQA 3R41A 4FTWA 1KNKA 1VSUA 2VP3A 2G1UA 4KWEA 1TAQA 4HD8A 5EJAA 2JS7A 3DV0A 3DW3X 3Q7SA 2H1IA 4FDTA 2HA7A 4KWTA 5IAEA 3WO0A 3NR2A 4LZJA 5E1BA 1OGIA 3BJZA 4O2AB 2VF8A 2JHPA 3GDWA 3MT7A 4L6AA 4X41A 3IEXA 1QZXA 4GWLA 3UG6A 3H3XA 3EQ9A 4LOAA 4MYSA 3OFKA 4ZVUA 5K6AC 1S2MA 3OKCA 4MO2A 4EX7A 1GUDA 1VM6A 1HA3A 4L8GA 5CA1F 1S8AA 2EU8A 4KXLA 1JV2B 4CLOA 3LT4A 3CEJA 4G9EA 4X6XA 1R18A 2HGSA 4PZZA 4M0MA 2IGBA 3CGGA 4TTRA 1DPFA 5AP9A 2ZUDA 4QYWA 1ZGBA 4Q6WA 3KVOA 3B1FA 4CM4B 3GIDA 4QU5A 4J0QA 1GFZA 3DCNA 4PRZA 2OORC 3LF2A 1YHZA 4YYEA 1VYVA 1TK2A 1E3IA 1H66A 1WSWA 1D03A 2A33A 2H07A 1BC5A 2I4MA 2I7CA 3A2NA 2XNCA 3EA4A 4FFSA 4XVHA 5EZ6B 5F3DA 5K8LA 5KYXB 2DU8A 1OJLA 1PW7A 3E5MA 3I58A 1LPAB 1BXGA 4TS3A 3DEZA 4IDHA 1RIIA 4YRDA 5ECYA 1LK0A 1D2CA 1LTKA 1H47A 4KODA 1GQFA 4HUQB 3QVMA 4FHEA 3UHAA 4FU0A 1ZK0A 2G6TA 1ID8A 2F3TA 3IS3A 4Q9JA 2R6ZA 3G49A 3VNUA 2X4DA 3QXCA 3WKDA 4F3RA 1BS2A 2GN9A 4M9RA 2EIHA 1ZIDA 4IMIB 4IMJB 4B7ZA 5K4HA 4J94A 1NXVA 2VSXA 3DEHA 4P8RA 1SVOA 3FVVA 2B7LA 2KS6A 3UWOA 4A5SA 1AS2A 3IV6A 3QJ5A 1OILA 3HBJA 4CIAA 5ABPA 4BVFA 3KTOA 2AFHA 2G09A 4DT1A 2ZBEA 1RI5A 3D2AA 3K53A 2D8MA 3A3YA 1KERA 1NTRA 3DGEC 5H3LA 1EGVB 3IV9A 4G1FA 4R8RA 4G81A 4C0QC 2JGMA 5A06A 2H9YA 1R00A 2IVZA 4HNQA 4M21A 4B45A 2GK6A 4UBLA 3KVVA 5DLQC 5IAKA 4W5NA 1ADJA 5FORA 3MIIA 4XX0A 3W2EA 4F4IA 3HJNA 2JGFA 1L7QA 3BGOS 3V2GA 1E66A 1G63A 1SVNA 1DKUA 4GYWA 1UOPA 4W5OA 4JT4A 3KKPA 2AF3C 4H6XA 4IGEA 4RH1A 3KDPA 3ZE2B 2YCLA 2Y0PA 2OHHA 4XAQA 5FO0A 4DW8A 4MUGA 3KB2A 4QFCA 2Z09A 3E5NA 3UJ6A 1GWNA 3HCFA 1XVIA 3PHGA 4DMHA 1GO0A 4FT4A 4YEDA 4FFBB 3OT1A 1Y80A 3A1TA 3L4KA 3IJRA 3PIRA 1W4RA 3H8SA 4HUTA 5DOVA 1KHTA 2XDYA 3ICCA 1EDOA 3L0SA 2A5YB 4FOPA 3TZCA 3W9BA 3COSA 4W6ZA 1X7XB 2GN2A 3OOEA 4IDQA 4P08A 1Q92A 2LE0A 2PMKA 9ATCA 4P5PA 5LJIA 3DBHB 5CLFA 1P31A 4L6CA 2B4AA 2QAJA 4B3SB 1DAIA 3GFOA 1G8SA 1SOWA 5DBOA 1KZ9A 2C5HA 3LBNA 2KW5A 4HTFA 5JJIA 1E63A 2ALJA 1Z56C 1GAWA 3KLBA 4CEIB 4C3UA 1KPGA 3TM5A 5FHRA 3OLQA 2GZAA 4G8DA 4WAUA 4NE2A 2GRAA 3QITA 1KNQA 1XD8A 2O5RA 3IPXA 1DAKA 2I6RA 1EWKA 1PKXA 3PSAA 4WY2A 1YVPA 1TAUA 3NEJA 3V4RA 2Q49A 3KJNA 2B30A 5AVKA 2Q3BA 3UK6A 4UTOA 3UW1A 5FWYA 1UEIA 5J1TB 1USUA 1FC0A 4LJ6A 1T26A 4BNJA 4GNRA 4U4AA 5TQ2B 3CR8A 4ENQA 5IC5A 1UKYA 2YH2A 3Q10A 4KR0A 2FQYA 2Y8EA 1GT91 1X92A 4YRAA 1YHQF 5BR1A 3U19A 1SCBA 3VVMA 3B6MA 1PK9A 4CKWA 1QQ6A 4EX6A 2PUCA 2WNSA 2NACA 3PD7A 2REOA 3C4VA 3SBEA 3FH0A 1RRVA 4FT2A 3TLZA 5FLKA 1ZVMA 4CIWA 5CEFA 5K20A 2KM1A 4KVFA 4ZOBA 4RCVA 1AQLA 1GJRA 1HYQA 2PJZA 4TKLA 4XGNA 1G59A 4ZTBA 4W9RA 3TD6A 1FU7A 4UM9B 4RELA 1X25A 1MN6A 4Y2TA 1Y9ZA 3RF7A 1C8LA 1TF5A 1M90H 4MLDA 3CZRA 4UNQA 3TX2A 3W2HA 1MJ5A 5I5EA 5ALYA 2ADFA 1YGPA 4BQSA 4KGZA 2GBCA 4I46A 3DSRA 5FWDA 4Q7JB 2B4RO 2L0XA 1MUUA 3WJ7A 3LCUA 1P5FA 3T7RA 3PEWA 1O97D 2BGLA 3L6UA 4PY2A 1GIAA 2JARA 1YS7A 1XX6A 3JQBC 2XCUA 1UKBA 3PHBE 2N47A 1KQNA 1H0HA 4BIMA 1YBFA 5CXQA 5LQNA 2HHAA 4FPXA 2WMOB 3CCUF 4LE0A 1AZSC 4ZALA 1N1MA 3NIWA 5K0LA 2H0QA 4R8KA 5ALPA 5F3RA 2I2WA 3WK5A 1T4CA 5I8ZA 4IW3B 4PONA 3ZG6A 4EP1A 4EG4A 3DO6A 4ZI3A 2O4UX 3D7NA 2D54A 1R8YA 2AIFA 2HRDA 2NU9A 4LEIA 1WR8A 2BGRA 4BASA 4D4JA 4L4RA 2O5CA 2R1VB 1PK7A 3GOHA 1N7IA 1CDDA 4C4ZA 5C3MA 3K20A 3PQ6A 2IODA 3MOGA 4I4LA 2YIMA 3FPLA 4ZU3A 2AG5A 1WU8A 5EJEA 5I3ZA 1T2AA 1EUCB 1J9EA 1HDYA 3R5SA 5D3MA 1DJMA 1VPWA 2AC2A 2V9CA 3C98A 3W0LB 4MDEA 4R83A 2WICA 5DHRA 2YN0A 3U7FB 2RD2A 1WWKA 5A0TA 4FINA 4ESEA 4LDRA 4R51A 4GR5A 5IKXA 1TRHA 2BEWA 3BDIA 2BY4A 1ZCZA 4L15A 3UXYA 5ENVA 4FDUA 4LNAA 5BMVB 1QYCA 3QOWA 4EGSA 4FE3A 3VPGA 1JLKA 1W3EX 2YFQA 3CEPB 3O3CA 1Y8AA 1RKUA 4D2IA 3GF4A 2A0FA 2OO3A 1Z5WA 4AS3A 1DLIA 2NXCA 4HQKA 2FZWA 4L76A 4E7OA 2EOAA 3I6ZA 4DJAA 3OX2A 4QTUB 1B1AA 2XGSA 1RABA 1IC6A 3CW2A 4YIKA 5HY1A 4RTSA 1Q1GA 1SVSA 2C2KA 2VF7A 1IV3A 1EZ1A 1E9DA 3PQEA 2QTVA 1XBTA 3SYRA 5CG1A 1T91A 4LTMA 3DE6X 1GPJA 1M2KA 2XYRA 4H7PA 2DPLA 1M66A 1SWWA 4JLSA 3WLKX 4HWPA 5BVGA 1E64A 1EXVA 2P69A 1FNDA 4HWTA 4DDWA 4MRVA 2F7SA 2OPHA 4OREX 1WV1A 3RROA 1N9KA 2L19A 1MFPA 3HJUA 2OECA 2P9YA 4IIEA 4OBEA 3DOOA 4NC9A 4ENUA 4KN6A 1BWSA 2J9ZB 4HLQB 1NMXA 3UV6A 2EFEB 2Z08A 3JZDA 4NYMQ 5A4JA 2OG2A 5G0TA 1ODIA 3AIOA 5FUXA 3UAWA 4YCCA 3OEEA 2GM4A 4N5IX 1IY8A 1XK6A 2BGUA 2YRFA 3GUUA 3D8SA 2XMCA 3OJLA 3NBAA 3R3XA 2GXAA 1XVAA 2G5PA 3TLEA 2ZW9A 4BNUA 4ERHA 1KFKB 1RCTE 4NMWA 3I53A 5BR8B 4BIIA 1DBIA 2HUNA 5KSPA 4M7OA 3SIWA 4BKPA 4EG1A 3H5NA 3LUDA 1VDMA 5F73A 1MF7A 3C8ZA 3SJUA 1PRYA 3RVPA 4QLOA 2BM8A 2RHRA 3NOOA 4IM7A 5IDQA 2VQSA 4IDDA 1VPEA 1JR2A 4YJDA 5EXPA 4Z4GA 3IULA 3O1LA 2XEXA 4P38A 5SV2A 2GTHA 5JUWA 1RYNA 1E6UA 4QDOA 3G1UA 3H5TA 4F2PA 2GBLC 1YV9A 3AUXA 2X0FA 4J2TA 3TZQA 2QQFA 1BX0A 2A0KA 4HPJB 3VOSA 2Q3HA 4R8MA 4LDAA 1LC0A 2XGMA 4RHYA 2GS9A 3G5MA 4R9NA 4WFIA 1R0LA 4XB6B 1I1NA 2V7BA 2J5BA 3FY4A 4YS6A 4C08A 1EKXA 4O1MA 1DAFA 1GYPA 4PZ9A 4D44A 2OXRA 3DVSX 3RJMA 4YWHA 3VPSA 1GDTA 4F72A 4DSUA 1A27A 1HG1A 2XHEA 5KVAA 1TXGA 1GA4A 2CXUA 1XD2B 5C7LO 2DBVO 2C94A 3HN2A 1NQOA 4MNTA 3A58B 3GJ6A 1U2QA 4M83A 4B6FA 2GEKA 4L57A 3CISA 4BT5A 4LXIA 5TF4A 1KFBB 4UUOA 3RREA 4XX0B 4MI1A 2P9GA 2AOTA 4HADA 5F1KA 1SC1A 5F1OA 4ER7A 3QX3A 1CR1A 1U6KA 3DE5X 3P0FA 3AEQA 3AEXA 2EKLA 4HMQA 1AGRA 2BFEB 3OE4A 4OOEA 2VDPB 4QT0A 4TGLA 3V8BA 4AUKA 5CCXA 3KIZA 4QUBA 1Z39A 2PKRA 1W4BA 2FE1A 4JI0B 2YIJA 4C87A 1FYWA 3KEOA 2JFFA 3QEKA 4AQ7A 2EGUA 2W2PA 2WUGA 4LZNA 4UAGA 1L5MA 2N1BA 1RTTA 4PVDA 2QA5A 1RRFA 1KEPA 2FPPB 3M4YA 4EPWA 1T13A 2H2FA 221PA 2Q4RA 5ADUS 3IP8A 2QVGA 1ZI8A 2IY8A 3ORFA 3P2EA 4MIYA 1J8FA 1P7YA 4IR7A 4N3AA 3FMFA 1VC2A 1NC1A 1SUSA 3HGTA 2ZS9A 2ZOSA 3L8EA 2DHCA 2DB3A 4KN9S 3MVEA 4Z3KA 3AUFA 1WKBA 4AKTA 3SJZA 4IHKA 5K3BA 1UK9A 1KQ3A 1V96A 2IW1A 2IXAA 1C4OA 3BUSA 3TTUA 5CLIA 4XA8A 3D2LA 3AV3A 2H18A 3H84A 1HTTA 1QMGA 1UKCA 4ZVTA 3M9XA 3TEFA 3G1TA 3T06B 4I2NA 3WZMA 2RH4A 1KVQA 4V2UA 5HIMA 2GNPA 5IKOA 4QFBA 5FR1A 2V6FA 1EX9A 1C8BA 4EZBA 2PVSA 1FLNA 2HC9A 3O1HB 3K73O 1LBEA 1LNSA 4MSUA 5LBUA 3R7WA 2BGMA 2JBWA 2YIVX 1GZHB 1AY0A 1PYOA 1K8YB 1JLHA 1X0VA 3ROQA 1ZW6A 2F9MA 3CT4A 2H4XA 2I54A 3BK7A 3BXXA 1Z6GA 4ZEWA 4BEVA 4UDNA 2ZT8A 3W6NA 2FSPA 3M5DA 3MHTA 5HFJA 3G1WA 5LMNB 1CJSA 2NUTB 1Y34E 2PLAA 3O83A 1RJEA 1DZ3A 1QGUA 3I2YX 3IUJA 4FNAA 4UVGA 3MINA 3M1YA 4YAEA 1G8JA 3WLNA 4P3KA 4DTIA 5JNTA 1LD3A 5CVVA 4M9SA 2X77A 3BCHA 3I04A 1AJEA 2XWQA 3V6LA 1DJLA 1LRKA 4GLBA 4DLWA 1E6MA 1EFVA 1C9YA 1Y4SA 4C30A 3LBYA 2FUG1 3SAJA 1DXQA 1P3Y1 4BMSA 3WLSA 4BX0A 4QTZA 1AQJA 1T29A 1GT6A 1Q20A 4HNHA 1U0FA 1T4DA 1KZGB 2JL1A 3HBMA 3UAZA 1S4QA 2QBYB 2V58A 4HQ6A 1O94C 1J07A 2WJAA 3M34A 4IKOA 5FNZA 4AJLA 3D00A 2X4LA 2WVJA 2HLNA 3M1IA 2XMGA 4UD2A 4ZO9A 3BZUA 3U56A 5IABA 2ZYWX 3BPSA 4LWPA 2H6LA 3FSGD 4UM5A 1WL8A 3RRXA 3DC7A 3VH2A 1I7DA 3I0ZA 4CN9A 3H87A 4FFMA 5DCVA 2EX1A 2FPOA 3IDAA 3I9V6 3RYCA 3QVGA 3BXOA 4TSKA 3QMPA 4MB6A 4PC2A 5B2EA 4Q7MB 5ECDA 2H16A 3OIYA 3HA5A 4PGHA 2RSLA 4QQ8A 1RFGE 5CTJA 4PCUA 4EI8A 2DSNA 3WMWA 2Y1OA 1DBQA 4QNRA 4IH1A 2Y0CA 3L04A 1T2NA 3ZBQA 1ONIA 1UXKA 3EVGA 4NMHA 3ZVMA 3BWXA 2OAQ1 1U40A 1L4MA 1D0IA 1PDVA 2BEUB 1SRQA 1Z2EA 2XA2A 4W5RA 1U2TA 1HT1E 2BKVA 2AK3A 5T41A 2BI8A 3N05A 1TC1A 2JCGA 4L85A 1Z45A 2XNDA 3G5UA 3VO8A 3JQAD 3O4GA 3QVOA 4DE5A 2RHGB 1COZA 1ZAKA 2VQ3A 3HDQA 2ZBRA 1G9SA 3N28A 3S7ZA 4XQ0A 2W90A 3KEFA 4EFDA 4EL0A 1STOA 1EM6A 1QG6A 2QT1A 2R5FA 2Z4RA 4V2IA 4R8VA 1Y8CA 5D3QA 2G8NA 1JAXA 1OFUX 2QLMA 2XUPA 3BD6A 3EMBA 1XZ8A 3IAHA 4MEJA 2PUWA 4NH0A 4YV1A 4E5KA 2QZPA 4TQGA 5JJLA 4OEHA 4PCLA 1ZL0A 4YHBA 1QHEA 1QHXA 4H0FA 2QOEA 2MQEA 3KVYA 3TRHA 3UAGA 1E20A 3DEAA 1WBDA 1N5IA 1XV2A 3OT5A 3KQLA 1ZH6A 1OFHA 1W41A 1DBRA 3QKRB 3K94A 3U7GA 1Y98A 4PG6A 4RPHA 2P4QA 4QEZA 2ZUTA 4GWKA 3QKSA 5JBIA 4GC9A 4DTCA 1WZUA 4X6LA 3WLRA 2VHVA 2ZSBA 3BMQA 2QWXA 5FV4A 3RKSA 1NG1A 1L5KA 3DE7X 2IP4A 1IY1A 2SHKA 4TM8A 4RETA 3LWDA 2JJYA 4AZ3A 4CTJA 3IR9A 2PUHA 1KKUA 4LV6A 1SKBA 2ZAIA 3I5AA 4CLRB 1JDSA 4OI0A 3FCCA 1E4EB 5KDLA 1U7PA 3ELWA 1C1XA 5C3UA 4L4XA 3ANNA 1UBOS 3URKA 1QIJA 1E9BA 1RWQA 1KAMA 3HB5X 5I4BA 1L5VA 4GOJA 4WK2B 5JY6A 1O4WA 4B6PA 5G4UC 3UK0A 5HY2A 3L82B 1Q12A 4GVPA 3JYHA 4P54A 4DUGA 4EECA 1HNNA 3NVAA 2CW4A 4KWHA 5DX1A 2YC4C 1ADBA 4GVLA 3CNQS 5F1PA 3H0KA 4C81A 4LKOA 2PX4A 1VJRA 2NADA 1YBHA 3CCQF 3G82C 2OL4A 2JJ8A 4EO7A 4X3OA 5DZSA 1SHUX 1DB3A 4KQ9A 4HDNB 5F9MA 1UBEA 2GXUA 3LHSA 3JZAA 3KBBA 1BFKA 3AX6A 4BT7A 3V7UA 1SK9A 2HXYA 3VTZA 2C9BA 4OQNA 1OBFO 3K0CA 4ZYVA 3EH1A 5EJIA 3C3YA 2QZ9A 1JKFA 2HQ1A 4ZDWA 4O1HA 1NGSA 2IF0A 3I61A 3M6VA 4PBTA 1R0CA 3SFTA 3R7AA 3K16A 1CJBA 4N3CA 1MHPA 2V45A 1U9IA 6LDHA 4P4GA 4MKIA 2K87A 3FKSA 3HEAA 3UW3A 1XQ6A 2FPIB 2JZCA 1V2HE 3C7TA 1FFDA 4U9IS 1E9SA 2FPGB 2AB0A 1TVCA 1M0SA 1DX9A 1OBCA 2OXFA 4FCTA 5JVDF 1USIA 3FLMA 2J1LA 2XLBA 1ZKDA 1FS6A 1EP1B 1JIKA 4OK6A 2XCSB 3S7TA 3BTUA 1Y7HA 5BV8A 1FNNA 2JEOA 1P1BA 2XUKA 1VI6A 4MKRA 1YFLA 5HPYB 2WAXA 1P1HA 3MIZA 1P45A 1B8PA 1ZNQO 1M9NA 2BDEA 2VKTA 3G2MA 3VZQA 4A2WA 1UWCA 2FZLA 4NHEA 3GPCA 1VQ9F 3J80A 1KDVA 1BVYF 2HCFA 1I2ZA 2OZPA 1HKUA 1N92A 4ZODA 2NPFA 5EA2A 2P4EA 5AW3A 2GT1A 2QYSA 1BXRB 2WPDD 1JU9A 2WTMA 2B8NA 2ROQA 3AESA 4LNHA 4UREA 1EVLA 3QKWA 4Z3DA 1FS5A 2VWPA 3AGQA 3RC8A 1D5CA 1VKJA 5K8CA 1UIRA 4LIPD 2GHIA 4PPGA 5KTTA 4BY9E 3HJAA 4GM1A 1HSZA 3PNPA 1DXYA 2DETA 2Y0EA 2BMDA 2GHRA 4WT7A 4YROA 2JC3A 3ZDRA 1T5TA 3DHVA 2QMEA 3QMVA 5JMTA 1AK2A 3IOCA 3SF0A 5HFNA 1QYXA 5U9CA 3PGA1 2C7PA 4CTKA 4EPRA 4X44A 1T5OA 2FVYA 2G3YA 5M7EA 1IUOA 3RS2A 3UEOA 4IOLA 1RBYA 4HL6A 4BTLA 4ZIRB 1PJCA 2V8BA 3S8MA 1ORRA 3MPOA 2K2QB 4MUMA 1PN3A 3KYIB 4BGUA 3ZWKA 1YZ3A 2G63A 3QQPA 4BO4A 5CT8A 3K14A 3F49S 4P58A 3LUBA 2HQSC 1XBIA 1ZINA 1OWOA 3WICA 1UC8A 3WWZA 4EW1A 1CX9B 5A1TA 3QNWA 5AK3A 1PV2A 3BERA 3JTEA 5A6VA 5BNIA 3MRTA 3OJXA 2OESA 4PTLA 4DG9A 4GI5A 2I1WA 4GYJA 4BFXA 3IBGA 1NVAA 4A0SA 3DBLA 1NVBA 1RYHA 1K27A 2VBIA 1QGED 1B0AA 5P8WA 2ZRGA 1RJ9A 4NV3A 1W55A 1KMQA 5LQUA 4DV5B 2FEMA 3VU9B 1TTHA 3ZHSA 4A6PA 4EJ6A 4QLBA 1KI7A 1JI0A 2IHZA 3M9LA 4J6EA 5C8DA 4GMDA 1XDWA 2WHEA 4YRQA 1PFKA 1ATIA 2AUNA 2XMDA 4GE0A 1O5IA 3VRHA 4AT1A 3BWMA 1N33B 3IKTA 1ZD5A 3VUEA 3TOXA 4AWAA 821PA 1E3WA 1DJNA 1KMMA 2QIOA 5AM0A 3VZSA 2ZJ8A 5IK2A 4BWGA 3K5IA 1VTKA 4O2RA 4BNIA 1ND5A 1IM8A 3H0CA 4C7VA 2WTUA 3OH8A 4AMGA 3F6SA 2GJSA 1Z0AA 2ZTLA 1ZRMA 3LWRC 1ZEJA 5DDIP 1ZK1A 4AROA 3C5VA 3DE0X 4E13A 5IBCA 4D6PA 1YAHA 2H57A 1ZM3A 4QSMA 5IDYA 5TVKA 3ROFA 1SHZA 4V0NA 5DM2A 2ZE8A 1YJNF 3QXJA 4OH1A 4QC2A 3M82A 4BLWA 5F2EA 4PLWA 1Z5ZA 2ZPTX 2ZSIA 3UATA 1EXNA 1RWKA 4US1R 2J7PA 1AB5A 2ADMA 3T5MA 2BE7A 4LDPA 5CVDA 3T5PA 3H99A 3P9NA 2QTBA 1HFWA 2HSZA 2XQKA 4LV5B 2ZYVX 4FM9A 2N75A 4Y0VA 4BMCA 4IJUA 3ZHTA 1CTQA 5T6BA 2BFWA 2OBLA 3K2XA 2HT1A 1NUPA 1OGYA 1UK8A 3MRSA 3LWQC 3EOAI 4BFZA 3MT0A 2PZKA 4GGPA 2IUTA 4RXMA 5HKBA 2JF0A 3CZ5A 5KKCA 1OXMA 4BZZA 3CVJA 3IDQA 2EJCA 5EQJB 1SKYE 3MTBA 1L5GB 5AQ1A 1EX1A 1ZJ4A 5D3MB 4QZVA 1FUUA 2P65A 3TLBA 1J39A 3NTQA 1F4PA 4QJBA 3WFZA 4RGQA 5KNLA 2BTOA 2Y3IA 2H9IA 2KE5A 2D5BA 2FV8A 1EEXB 1JU3A 1TRKA 2BGIA 3JYOA 4Q19A 2VQ6A 3EIWA 4PNEA 5KU1A 3KV1A 1CETA 2BMFA 2PSHA 3QX7A 5CDHA 1H8HA 1DBFA 1F8FA 3EMVA 3ZQKA 5LDHA 2BBSA 4HN4B 5LP6B 2J9XB 3FCYA 2GUWA 1NMUB 2B1IA 4J1QA 4QPJC 1MU0A 5EL0A 4W99A 2Q4EA 3WGLA 4R40A 1V1RB 1NZJA 2FK8A 1AOXA 3M4SA 1FSFA 2DULA 3RRNA 3LKVA 2XTAA 4DRZA 1T2CA 4N76A 4OB7A 2E4AA 4YP1A 3TECE 1IL0A 1PEDA 2JRLA 4J0CA 1P3DA 4MVCA 4Y1GA 2W98A 1BN7A 4NQ3A 4EI7A 3VSAA 3HPQA 1NBOA 5CJ2A 2AJCA 1DL5A 2G76A 2QTVB 3MD0A 1ANKA 4G0NA 1AU9A 4ROTA 1PT7A 2Q9BA 1EWTA 1NUUA 2HU8A 2JD0A 3D1LA 3HUTA 2JLQA 3N8GA 4KIWA 5DX8A 1OVGA 4J2HA 1M2HA 3MC1A 3K70C 4FGWA 2NYUA 4MIEA 1E8NA 2AK2A 1KJJA 1NXQA 2J7KA 3GRAA 2COKA 5AKKA 3ZHUA 1O87A 3KJJA 3M6LA 3SMQA 1UT6A 2RKWA 3NVDA 4Y0AA 4F5WA 4CKCB 4ETMA 3PJFA 2V4MA 4DAOA 2ZIZA 1RRGA 4WWHA 4BO8A 5JECA 4U6QA 5DTJA 3SK0A 2IIBA 4P84A 3U1VA 5DV9A 2X13A 3WGYA 1U0NA 3LVQE 3VHXB 4DVGA 1T0BA 2O9JA 1Z37A 3VDRA 1KU6A 4BOYA 2PUGA 4EHLA 3TOCA 4GI1A 3UCFA 5A9SA 4Q15A 2RI1A 1TMGE 2COUA 3G89A 3RJ5A 2HQRA 2YJ4A 1YR9A 3M6AA 1X1CA 1UMDB 4N03A 1JG2A 5AICA 3PNSA 1RPZA 5AVXA 4IX9A 5EKUA 2RHDA 4ZEOA 5ALKA 5BYBA 2JGDA 2Q3CA 1NVKA 5KSYA 2Z2IA 3WIEA 4RA9B 3DDSA 4CPDA 3EWAA 3WGZA 5H1YA 2GVIA 3K15A 3KHUA 2FEAA 3MERA 2V8OA 4TS1A 1K8RA 1ECLA 5TXGA 3TSAA 3WNCA 3CPWF 2AVDA 3BK2A 3PZBA 4WJKB 5E7IA 1JEDA 3UMVA 2WQ6A 4H9GA 3EZFA 1IB0A 5ECGC 4KLCA 2J5QA 3ZE7A 5L53A 5EP2A 2HF9A 2A9PA 2C1XA 2FW7A 3LUFA 2AEFA 3P8ZA 4LC0A 4LXYA 4X20A 3LYBA 2JCYA 4JB3A 2VJAA 4RHAA 1WCIA 4YUVA 3PQDA 4ARIA 3BORA 2QV7A 3DL4A 4W63A 3QVWA 4FP9A 5AOVA 5DLYA 4Z2AA 2GZRA 4ZEXA 2XCRB 1UBRS 5FI1B 1GG2A 2Q1TA 1T1RA 1PU2A 4Y2SA 2Q7OE 4DCVA 3WI7A 3VV2A 3O74A 5G3YA 2VDVE 5GOZA 1H23A 1XCGB 1YK0A 4EY8A 3Q2KA 3RYTC 3E3MA 3AZOA 1T0PA 3LK7A 2A9FA 4OKNA 5BUQA 1EHCA 3AG6A 1XE3A 4TKVA 1IHYA 2H0RA 1H2ZA 2FJUA 3HNPA 4FC6A 1K5PA 4K46A 3G79A 2HEGA 5BORA 1CUWA 5J1SB 2H51A 2VEOA 4BLRA 3I4CA 4UTNA 2GLUA 5JAOA 3KTAA 1U0JA 2O7RA 3AM3A 2C20A 3C3JA 4JC4A 4F2DA 3OPVA 4S1NA 3DZDA 1ACJA 3LGAA 5IF3A 1X7HA 2QNBA 4MS3A 1RE1A 3TLGA 1IZ9A 3H2GA 1JLLB 4MWTA 4KMMA 4Z51A 1S0UA 3B52X 4X90A 3B1ZA 2JFUA 4HG2A 3VR0A 4DQVA 5B2FA 1T9BA 3IT1A 4MMYB 3JVVA 5EZQA 3EFOB 3SS9X 3RTEA 4B5CA 2XSZD 3LPMA 4EY4A 5CJPA 3UFXA 1RKQA 1XA4A 4HXEB 1QVFF 3TZKA 2WQZA 4F1WA 3KQVA 3OEHD 4U6SA 3M5WA 1OOEA 1VGQA 1G7TA 2YFHA 1BDBA 2A6PA 2ANCA 3AIMA 3KFLA 5E1DA 5K3AA 3FVRA 3L8GA 3KT3A 1IB6A 3ODGA 3I2IA 3U26A 3ZS8A 2O8DA 2P5TB 4FE7A 3QPBA 3R7WB 4KMSA 1Z3CA 3W8NA 3GLGA 1GG8A 1NUQA 4DIKA 5IWAB 2QLFA 4PX5A 5IAGA 1WHTB 1JXAA 3TW0A 2AXQA 4TYNA 4G1VA 5BT8A 3N2EA 1PBNA 4QPDA 4B3CA 3OX1A 3DHYA 4JKOA 1AS0A 4PS1A 4BMXA 4CUKA 1N2CA 1R0WA 4HT3B 4J4BA 1QCZA 5AUPB 1JXOA 1Y7IA 4MQMA 1G9TA 1NNSA 4DB4A 3IV7A 4EUHA 3GEPA 2LV8A 1KBZA 4PE5B 4WJZA 3DLIA 3EEYA 2Q5CA 4NBSA 2QTRA 2CL0X 4LXUA 1GU0A 2CN1A 4TKUB 3FMGA 3QEBZ 3T94A 1M1YB 3U2QA 1ZZEA 2DUUA 3NJRA 4PFJA 5E4JA 1IG0A 2KBFA 3CRNA 1RM5A 3EGXB 3IPCA 2P2GA 5H68A 1E1KA 1YS9A 1MR3F 2HWYA 1PJZA 1XRMA 5LA6A 1FQOA 1W96A 2VP9A 2YZ2A 2ZVJA 3B3FA 1JPUA 1OIXA 3L1UA 4QULA 4AX4A 2WU1A 4ARAA 4NCAA 5JMOA 2CE2X 1U2GA 3VTFA 3PFGA 2RJOA 2A1TR 4FYVA 1H94A 4Q3CA 2YKGA 3MUEA 3UT5B 1Z16A 2QW0X 2VCYA 1EFPA 1XZDA 4GL4A 4AAYA 2FWAA 2XZLA 5KVVA 4ALNA 5GIOC 4G07A 4KWCA 1AD2A 1SEPA 5AI6A 3WA7A 5B2ZA 3ZXSA 4ZA2A 1Y1RA 4I1VA 2HDOA 2PV7A 5NLLA 2DHQA 3U6KA 3EXIB 3O8NA 3RD5A 3RVKA 3W8RA 5B4TA 4LGVA 5ITWA 1CVRA 5D6OA 3KSBC 3T3IA 3EE6A 5JRDS 5FA6A 4ERNA 2ZJ2A 1ESDA 1XZGA 2YJ3A 3QFRA 3A2LA 3IR6A 3GFTA 4X24A 2PGXA 6AT1A 1ULHA 1DO8A 4IUYA 4DMLA 3OIGA 4E2WA 3PNVA 1HFJA 4I14A 1G0OA 1UXIA 4Q01A 2VWGA 4DHWA 4WRRA 2YWRA 1PQYA 1N6IA 1RHUA 2DUWA 3IPRA 3IDFA 1XDBA 4K6CA 4RSRA 4WLEA 3L0DA 3NANA 3N07A 4XVQA 1OZ0A 3BH0A 4FYJA 1I80A 1CUCA 2GNAA 4HUJA 1G3MA 2EX4A 2R8EA 1GFWA 1UXJA 3PC4A 1VE6A 4WXEA 1N4AA 4G5RA 4REMA 3TD2A 3C9RA 3JAWA 5C34B 2HJRA 3VO1A 2AYXA 5EUBA 3EODA 2ZB4A 2C2BA 1LH0A 5EIOA 3G13A 1IJKA 2XF8A 4X8MA 3G2JA 2R1TB 2OD2A 3DE3X 4LAFA 3VHXA 4KHZA 1T4GA 1Z0SA 1I4OA 2NIPA 5EN4A 1YA6A 2Z2XA 3HE3A 3TE6A 1N0VC 4AZWA 1QLWA 1AF4A 2PZGA 5JPIA 2JLZA 1Y33E 1MJGM 1H42A 1FDOA 3MLAA 3GCGA 2Y68A 1RSZA 4UTXA 1Z7EA 3T1YB 4ZCIA 3REQA 3HYNA 1AUQA 2F67A 1C7ZA 2I80A 3DUWA 5JPCA 1AA6A 1VIYA 4O6VA 3LWVC 4UBJA 5TY0A 1YJBA 1C0IA 1CEXA 1RVDA 2EP8A 3X1JA 1ZDMA 4WLFA 4U2EA 4BNTA 5J4YA 3AFMA 1FP4A 2DBQA 1MZPA 2E18A 1YL7A 4A0QA 4K6GA 1D1TA 1S3GA 5D5PA 3WSWA 2P40A 3EGXA 1MT0A 3R6GA 2ISQA 1LQTA 5TGDA 2WA2A 1SUFA 3LGSA 1B8UA 4BQEA 1N6NA 1UPBA 3FNFA 3K0FA 1E3LA 3VC2A 3RWBA 2A5FA 4YACA 2QX4A 2M9MA 4UU8A 2VXYA 3CMCO 1VKNA 3IEUA 3BDAA 4D9BA 4E15A 4UOZA 4DV3B 1D5WA 3AOGA 3KSDO 2VPYA 1QYWA 1Z07A 3SX4A 2HMTA 2XE7A 3MWDB 4IMRA 5KTMA 1AXEA 3QKTA 3GRVA 3LVFO 5TGTA 1A8IA 1U2SA 1OFGA 3SOPA 3C39A 2ABWA 1LUAA 2W43A 3T61A 5FUBA 1F8XA 2YASA 2CLDX 5A3RA 1S2DA 3KXIA 3GLGE 1AB6A 1FLVA 2W7TA 1H6DA 1YVRA 4TYWA 3AO0B 3I2HA 1QF6A 4TTAA 1D9XA 3SM3A 3F3YA 2PZAA 1V11B 4OOFA 3ONDA 3WGIA 5EG5A 4RU1A 5GONA 4NV1A 3ER6A 3IMKA 1H3NA 5HDBB 1F2TB 2JLBA 4KXWA 3U17A 2VUHB 1LLUA 1B7GO 2VRWA 4QYXA 3K09A 2C78A 3WNBA 4DARA 4PHGA 4BXOA 2J3LA 3BG5A 2OTLF 1HMPA 3I8OA 4XYMA 3LOQA 3JYNA 2FSUA 5DE3A 4C4OA 1P60A 2JJ1D 1HG0A 4MP6A 3EC1A 4HGPA 5A4FS 3CRQA 4JC0A 3USES 4DA7A 1BIFA 1E62A 3U3DA 5LYJF 1M2GA 1PZMA 2E4XA 1OTXA 1Y4AE 2R0QC 4O2AF 4E09A 1RWPA 3H5LA 2VGMA 3ZVLA 4B75A 1I3LA 1KH2A 4QDUA 3AL2A 1II0A 1MOZA 1GZUA 1SIOA 1T15A 2OQ2A 4JJ8A 4N5HX 4EB6B 1WU7A 4R2MA 2QPTA 3OWXA 5CLLA 1QP7A 4LJ7A 3VZDA 3EG5A 3IT3A 2QBYA 1JQKA 3GXOA 5E7JA 1YGYA 5D8DA 3MINB 1G1MA 1NKSA 5DM0A 5EPUA 4DLUA 1ISRA 1CKEA 4ZRDA 4B3MB 5BT9A 4P6VF 1C7FA 1OLXA 2E5FA 4ZO6A 5JCPA 5BO5A 4GXTA 1NVDA 2HDWA 2IV3A 4IGKA 4AZ3B 4AX8A 4Z4FA 4KOEC 2NZUG 4LKRA 3IAFA 3IIEA 4ENTA 1M34B 2V98A 3ZI7A 5AW2A 3CUVA 3OOYA 2P11A 4DJFC 1QVRA 3WLQA 2WU3A 1ABEA 1YZNA 3JASB 1GQYA 4KR9A 3HVJA 2HSWA 3O91A 3WJ2A 1XDZA 4HSEA 4XD7D 1UZLA 2ZSUA 1Q8RA 1QH9A 3HWWA 4LZWA 1W5TA 4MLCA 3S2ZA 5CCBA 2CJWA 2AD5A 2ZBQA 2FOXA 1XU9A 3RASA 5IDXA 1AMOA 4K03A 1PIWA 4DMCA 5IZCC 2Y4OA 1I2AA 3DQPA 3I6IA 4KNVA 1RDFA 4ZVPA 4GKJB 1MP0A 3DG9A 4EI2A 4I9GA 4BECA 1RC8A 1WUHS 2AWNA 2HA4A 2IY7A 2C2GA 2WJJA 5FWYB 2C58A 3ROPA 5MN6A 3UK7A 2BJHA 3OX4A 3KYCA 5EIAA 3RYHB 4JVOA 2WJ4A 5ALTA 4B3DA 1J0CA 4JBNA 5D00A 1ESNA 4PQFA 4I6JA 1XF9A 3O4HA 3FYUA 3VPCA 5F4ZA 3M4NA 3NHWA 4ZDKA 4NIMA 1TIKA 1V1MB 2WG1A 7REQB 1IG3A 1PUJA 3AEUB 2WAAA 2JJ1A 3BA6A 2HV8A 4C0KA 1JQ3A 1VECA 2YVUA 3RM3A 4ETIA 3DXYA 1X38A 5JNSA 4ETNA 1BCRB 2ALEA 1PGPA 4PWYA 1GU1A 4KV7A 3B1YA 4NXNB 3QPCA 2EBWA 4GOXA 4HRYA 3DFMA 5JR3A 4G0WA 2JLVA 3IAS1 2XAUA 5HIKA 1VG9B 4BO3A 2L26A 2G06A 4PZPA 1JHOA 1NVUQ 1T9DA 3KSRA 3WDLA 2XH8A 5CXSA 1UAGA 3IKVA 2BEVA 4E3WA 4GBGA 2H48A 1VZ2A 2PZ8A 3GYBA 3QU4A 4D0RA 1SB9A 2F6RA 3ICWA 1M1YA 1K68A 2FB9A 2QL6A 4KQFA 4XD2A 3HJGA 2V7PA 3BGWA 3O4JA 2G9IA 2P1DA 1X1AA 2H2AA 3K4HA 4LRSB 4P4UA 5E2BA 3T0FA 4BKRA 5B58C 2OEPA 2VDUE 2X0DA 5LA6B 1H1TA 3KSZO 5EOVA 3DT8A 3H75A 3AF3A 3GJ4A 1QRTA 3E9NA 1M2OB 1X8KA 2VO1A 1MIOB 2J87A 3N2YA 2YDXA 3VNAA 4A10A 5CDYA 5J2UF 2WTAA 2WKWA 1FA9A 4LE1A 1BMDA 2SKEA 3FTDA 4FBLA 4KAAA 2EZ9A 4TUYB 2WU0A 1RVV1 4OSEA 1YC5A 2HCRA 4H1VA 1B3RA 1CUSA 4ILEA 3TI7A 3RAFC 2WIDA 1CJKC 1TMKA 3O8QB 3QHQA 4KDCA 4L8FA 4WCVA 4M0DA 2Y05A 4O4HF 1DT9A 1V9CA 1JP7A 3OD1A 4ZC1A 3WYNA 4EENA 2DT5A 1W5FA 2GWHA 1FS4A 3A9CA 3BSSA 4RO0A 1OLUA 4Q37A 3TMYA 3UFBA 5E38A 1JQDA 4DPKA 1NJ2A 1J20A 3MFYA 3SNHA 3THSA 4AYXA 3ZVNA 3NG1A 2ASVA 1MDBA 4NDNE 2R7LA 2OSBA 4WLVA 2ORVA 3C97A 5H02A 5KO2A 2WKSA 4I9HA 4I5DA 4HLNA 4R9UC 5AH0A 4B3FX 5GVSA 2YOFA 5KBYA 1YUNA 3VPAA 1DTWA 3FOWA 2FPKA 4YBZA 2ZJFA 4S1TA 3AJ8A 3ZNPA 4MAFA 3EWIA 5SZHB 1LDNA 5DNWA 2DVMA 2G1AA 2ZDQA 4FOSA 1Q0ZA 5JRZA 1J0BA 1MAVA 2OV6A 4K8OA 3C5HA 3LO5A 3HJCA 3A6KA 3UMYA 4IDPA 2EKBA 2QU8A 4A0GA 1BE8A 1XLTC 2JH3A 5BVGB 1ZG3A 4EM6A 3EZXA 3MCWA 3LXUX 3V7FA 4LDZA 2UZ1B 1XL1A 4DIMA 3QW2A 4YRJA 1SZQA 4I19A 1PG2A 2VSQA 3AB3A 1QHHA 1JKJB 3ZHRA 2ZT6A 4EHNA 1DCKA 3R7NA 1C9EA 1C8KA 2VDNB 4U00A 3O9MA 1LFAA 3L84A 1FTWA 5IVPA 3T9CA 3W5AA 3A0RB 1EBUA 2BV3A 2HB6A 5KOHA 3QHPA 4IXWA 4NYMR 4UBIA 1HQCA 3HB1A 4NG4A 3ZK8A 4TRMA 1RQPA 4CMEC 5IANA 3A4NA 2AOXA 2QR3A 2FZCA 3ZDDA 1KYYA 2G36A 1BE1A 1K7EB 2ZJ3A 4P31A 5HZMA 1RNLA 6REQB 3JATB 3LCRA 1EK5A 3PNOA 3HA7A 3TW8B 3KHKA 2BGJA 1N2JA 4F4HA 4HZUB 3UQYS 1YZTA 3OQHA 4L8LA 1SMKA 4YBRA 1P72A 1ZRSA 2HPAA 2ODEA 4IQ0A 3RS8A 4BCCA 3F73A 3PX7A 3WL8A 3GLQA 3F46A 4AY2A 1DUSA 2JFQA 2VHQA 3EEQA 1FFXA 3C9SA 5AKJA 3MWGA 2MU1A 1AKQA 3H2ZA 1Z8DA 4AS2A 1H93A 1I7QB 1YR1A 4JIGA 3P9KA 2Q5IA 1X39A 2EJBA 4JUDX 1YDMA 2EWCA 2B8WA 1PQUA 2HP0B 3WJRA 3QX9A 4OL9A 2BM1A 1NMEA 2WP0A 4OQMA 1ILWA 4PSCA 5EPOA 3P0HA 1GZDA 5BMVF 2QXUA 3CH4B 2CE7A 3VAYA 2CLOB 2HIHA 5HJ5A 1RPAA 3KYBA 4WZAB 1SAYA 3ZGZA 4HDOB 3A14A 3ZDZB 2WU4A 1ADYA 4KPFC 5EQFA 4R0MA 3LLSA 4O8CA 4BYGA 3FXAA 3S0WA 3L7KA 1OPRA 4Z9BA 2P2CA 4HATA 1KVTA 1O9BA 2RGUA 4LOJA 4RIGA 3L49A 1SK8A 2RCNA 1A5BB 4RKQA 1ZU4A 4UDXX 5T8KC 3VZCA 1SBHA 5ANRB 3HU3A 3L5KA 1VQ1A 4KPUA 1J42A 1GRVA 3GD7A 3VDXA 1GEGA 1K1EA 2VHXA 3NBZC 3OQVA 4FK8A 4LYJA 4RY2A 4ZRNA 2C7GA 5FDFA 2CHUA 2H7CA 1TUBB 1E1YA 2YZMA 4TQAA 1APBA 1GTMA 1RHQA 3CPEA 4JVMA 2CV0A 4C76A 3G3EA 4BJ5A 4RAQA 1F3OA 1WTAA 4YP6A 3VAAA 4R71A 3AUAA 1P7ZA 1D2RA 4MRPA 4WGFA 3UC9A 1JT9A 1F0KA 3K1TA 1OWPA 3C6QA 2P78A 2UDPA 4B81A 2IWHA 1I6MA 2H4HA 3W5SA 4DL9A 1GL6A 3R4CA 4D8XA 4DWJA 4RTPA 3LG2A 1KSFX 3C3AA 1ABBA 2FJ0A 2LBPA 5AT1A 3S2SA 4D8VA 3UBMA 4KDRA 4MO9A 2UYNA 5CA1A 2FWRA 3A1DA 2CUKA 1YITF 1S2LA 1MPXA 1R1MA 1ZSYA 2XQVA 3PWZA 4NDAA 4WDQA 3TQOA 2RH8A 1EM8A 2BW0A 1HLFA 3GNLA 4GPBA 1YZKA 4NK4A 3TLYA 4YUYA 4K6KA 4FNMA 4OB6A 2PT5A 1CRPA 2V7EA 2XVMA 3HZHA 4HAZA 4KI0A 2QZ4A 4N40A 5HDQA 2H3EA 3OU2A 2I22A 1T2EA 4PHHA 3OD5A 4FXPA 4PPYA 2EGHA 2VYFA 3JYLA 4GMKA 2IHJA 3FFAA 4D6YA 2YZKA 2Y2UA 1RI4A 2E5WA 1UJ4A 1NBMA 1XAJA 1XDUA 3JATA 2EWWA 2GCOA 2P75A 1DAPA 4JBGA 3GZ4A 1KI6B 3HO6A 5BN5B 1QQTA 3WV4A 1W9HA 1WO8A 2FKAA 3G8AA 2VN8A 3HYCA 3TH5A 4C20A 5CFZA 2CVHA 4IAOA 3IOBA 2QNRA 3OM0A 4BYMA 4HAVA 3OZRA 1SH7A 3EGDB 2R6FA 1QBGA 3EYWA 4UJ5A 4TMXA 3DB2A 4H1UA 1G6OA 1VLVA 4JR0A 1KC8H 3G7UA 4BT2A 1QYIA 5T57A 1KA9H 2FXIA 4C0LA 3FWYA 3LXRA 4FD2A 2JHAA 2G88A 4I6EA 4XJXA 2HXGA 1NURA 4KR6A 4KUGA 1P7WA 3N4ZA 1UT8A 2H7XA 1RZUA 3BMXA 5CAEB 4GXRA 4ZT3A 1ZA2A 4DYDA 1QTNA 1NYTA 3QTYA 4H16A 3F3MA 1PJAA 2CB0A 3UENA 4JXZA 2R6CA 2V6JA 1Q3TA 3WJAA 3D3KA 1NDHA 1FDRA 2PCLA 4KE9A 1QVWA 4DOMA 4B35A 2JBAA 4G5XA 1SIUA 1W44A 3SXUB 3ZK9A 1RWMA 4M98A 4XWKA 3JAMA 1BJKA 4INZA 1KR5A 4EEKA 2GESA 1PSWA 4B87A 1J1ZA 3K05A 3QSGA 3VA7A 1QM5A 4QXOA 1LC3A 1T4MA 5EQTA 5F76A 4AZ0B 4CV2A 1E9FA 4YB8A 1WNFA 2XMQA 3I9V1 4JS0A 2FCRA 2IPOA 4YRLA 4BFYA 5C1DA 4DSNA 5EPEA 3O8RA 1I1QB 4HN2A 3HACA 5EE0A 2ZRHA 3UUFA 3HUFA 4XQCA 1IOVA 3DZHA 3Q9LA 4XR4A 4ZOLF 4YJKA 3M89A 3JQAB 4L4ZA 3TN7A 3I73A 2X3YA 3DBRA 3NNDA 4CUJA 5EY5B 2CT8A 1RYDA 3HCRA 2F3QA 1XPRA 2PGDA 1KRHA 3BIJA 1G8HA 5E2AA 3ST7A 2JFPA 1CR6A 1K88A 4RVNA 3FFBA 4XYEA 2K5UA 1UZNA 1QZTA 2GF0A 2C4TA 1VA4A 1NUHA 5ALWA 3V80A 1MC4A 5KYKA 1KI3A 1OU4A 2E89A 4P0QB 4FHZA 3IB6A 4YUZA 3ROEA 3WB0A 3LKBA 4MICA 5FBRB 2FLVA 3W5JA 3IEQA 3WXMB 1HYBA 2ERCA 1DJPA 4HJXA 5AJZA 3TZHA 2G17A 4IILA 2BKEA 1NBAA 1HE2A 4J7CA 5EEGA 2ZBGA 4YMSA 3RU2A 3ECCA 3PUWA 4IJ5A 4XPIB 4JI6B 2BZ0A 3ZR4B 3ILXA 2J30A 1KK0A 3D4LA 3CYQA 5AO9A 3OHPA 5TDHA 3L41A 4EY7A 1U8XX 3TUZC 5HSGA 4Q3KA 3D5QA 1RLJA 4YLEA 5JSKA 1U0RA 1E2HA 1DRKA 5I9MA 1K63A 1RLUA 1XTJA 4HNUA 1C41A 1T35A 1P33A 3NHFA 3OIFA 1QWSA 2E7ZA 3WK9A 5J47A 4L9WA 3DLTA 2CVLA 3AHIA 1BWRA 1KMHB 1E1RA 1H2YA 3BA1A 2PUAA 3QA9A 4LJ5A 4R81A 3V00A 3WIOA 4BO0A 4BNMA 4EKNB 2J59A 4S0ZA 5IT4A 1SJ9A 5JTUA 2ZU0C 1Y8RB 1MKYA 1RKBA 4XFJA 3WHIA 4BNFA 4G37A 4K26A 1CK4A 3GPDG 1BOOA 3RRMA 4X7RA 3Q1KA 1MT3A 3A6DA 5FPPA 1FP4B 5BSKA 5ED0A 5BNZA 4INJA 1BX3A 2UUOA 3SPXA 3O31A 4DDUA 4RPLA 3EJWA 2Y66A 2BTEA 1NP3A 4IHJA 1S6YA 4W8GA 1T8YA 4V1CB 3U60B 4F5DA 3BGVA 1IAVA 2A5JA 3DEYX 3BK1A 1RJWA 3X1DA 1TVMA 2PZMA 3C1AA 2YHSA 4QWMA 1SQSA 2FSIA 5AQEA 3FHCB 3BZWA 1Z2AA 2BHTA 4UFPA 4RABA 3DDHA 4ARVA 4OGLA 3G5TA 1WKVA 4OO3A 5FOWA 4E14A 4E07A 2R1ZA 1CNMA 1Z8NA 2DZDA 1L4NA 5HEKA 4I50A 4MK4A 5JFOA 1OXBB 2ZWOA 3DCIA 4MVJA 4GMGA 3KDAA 3B5EA 2QTPA 3G2OA 3WYCA 4EB0A 3C7CB 4KN8A 3CWQA 4LGCA 1V3TA 3WJ1A 5M04A 2Z6UA 3CF6R 2JIQA 3C7DB 3UOAB 5F12A 4JJIA 1FRVA 1VL5A 1EA7A 3CVYA 1AO3A 1JA9A 3OIWA 1E1QD 2DWOA 2X9GA 4L7QA 4MWBA 1L6RA 1SU4A 4KCGA 4CM9D 3FTPA 4A6DA 3EZ9A 1L1QA 3NAZA 4KO4S 4KQ6A 3THOA 1X7GA 4BCDA 3ESXA 1XXLA 4AUNA 1I1HA 1E2GA 1V2GA 5CX1B 3L0YA 1OH8A 4X71A 4ZI7A 3LYHA 4CMIB 2OO5A 3KUDA 1CK2A 1PZFA 2NTEA 1W2HA 3OF3A 4I4CA 1N6OA 4J91A 5EXTA 4BS9A 4ZCMA 4R9VA 4N4AA 4R2XA 1B23P 2CHTA 1L7RA 3OZXA 2ZKIA 1M8FA 1FFSA 2CXRA 2IXEA 2EDCA 3WAGA 1D6JA 1IMJA 2J0VA 4PR0A 2VF4X 3UUWA 3FPBA 4YMWA 2BCJQ 1NDQA 5DM1A 4H7KA 3DTVB 1WLYA 5F5XA 1NI5A 3QTLA 2V0NA 1YC2A 4XUDA 1JG7A 4NH4A 5KYYA 2D2EA 4RV5A 3MTQA 3BWEA 3QMMA 2YW9A 2Q3LA 4LJLA 1NQ3A 2KJQA 3KYJB 3HSSA 3OLYA 1GU7A 1ZWLA 1R6AA 1J5XA 3OJOA 1NSTA 1SBYA 1IZ0A 3H5WA 3MRXA 2FHPA 4GX0A 4NFSA 1FFEA 1PL8A 3ANMA 3EDOA 1FYEA 4N6NA 4WDRA 1CR2A 3NH6A 1NXOA 1GUAA 1HETA 3A27A 4WOJA 3ZQUA 1LS1A 1MFZA 2LW7A 4URZR 5CLHA 1IVSA 3MJCA 2QRVB 5CUQA 3NOVA 1PQPA 2ISSD 3EMKA 1W29A 2E9SA 1FYDA 3JAMM 4C3VA 4YY3B 4TMKA 4OAPA 2OYSA 4KYVA 4AZSA 5ADHA 3MCZA 1J23A 3DJFA 4ZPJA 1EK2A 1K98A 2PKQO 4GQBA 3EZLA 2BFDA 1FDIA 2XGOA 2X22A 1NE2A 4KVZA 3RUDA 4EGAA 2LKDA 5B37A 1UKZA 3ZWVA 1Y8RA 4L0MA 3H2KA 3RIHA 3WQQA 2Y6UA 1UDXA 2L17A 2VCHA 3NHBA 1W581 1T0JB 1Z62A 2ZR9A 1T0UA 3LJKA 3QG5A 3LSYA 1J0EA 1NY5A 3PV0A 4CQLA 5FTLA 1JYFA 3RVQA 3VZPA 2Z1NA 2QEXF 3NTOA 2NYRA 4EIWA 5A9RA 5C0OE 5IAAA 3ZGLA 2ZUWA 3GQBA 1UQTA 3JQ9A 4XWGA 3W5IA 3FYDA 4KZPA 3VR3A 4YK7A 2O0MA 1NASA 2I6XA 3OUUA 4DMUB 2IZ7A 2XQFA 4HGZA 2EFGA 3D31A 1WUJS 4E51A 2H1FA 3OQNA 2F62A 3KD2A 1ODTC 4B6OA 1V37A 1IH8A 1QC5A 3MWYW 1IRIA 2P41A 3GLHB 3H2BA 2D1TA 1I3CA 3BAFA 1CJUC 4NCJA 1G9XA 4Q7EA 4YQEA 2X6TA 1OGJA 3R3SA 2V9YA 1Z3IX 2WKRA 4MZXA 4CDGA 1JZSA 4RAOA 1XTUA 3HZRA 1FQJA 3N2LA 4YLYA 3SSOA 2V4ZA 1AH2A 4Z4HA 5I7UA 1P9NA 2WPNA 2HTFA 1BG6A 1HRKA 2VJLA 3FPCA 1A4XA 1WHTA 2GKSA 3D1VA 3JS5A 3BKXA 5FPHA 4P36A 3WK7A 4DFDA 4F9GA 5LYJA 2PXHA 5D86A 3NHAA 1YRHA 4ZCLA 1MB2A 3JQCA 3AEUA 3F78A 4HO1X 5MN4A 4LZAA 3MS2A 3UWSA 3ND8A 4EG0A 2ESRA 1DVRA 1PZXA 5HRUA 2C0CA 3CVOA 4HC4A 3G2KA 3ZWYA 1VH8A 3ETCA 3JWIA 4PU0A 4QNMA 3E23A 4MDHA 2BUBA 2QTHA 3GJXC 1WMAA 1G38A 1C1XB 4CM3A 5M34A 2J48A 1KSJA 4LBZA 1V25A 2GPYA 1AZTA 2GUGA 2O2EA 2FOIA 4OHCA 4XPIA 4QVGA 3FDIA 4F6LA 3L0OA 2LWIA 4Z54A 2IX9A 2JAQA 4RTMA 1G8AA 3U40A 1PGJA 2AI2A 2EYUA 3O95A 5AKLA 5B58T 4GRIA 4ZZIA 2C83A 4BFTA 1PCXA 1RHRA 1U8FO 2H00A 5FQNA 2LBWA 1PLLA 2Q9CA 3FPIA 2IEZA 3BYZA 1PJLA 1QMPA 4TLMB 3T1HB 1W4CA 4L5CA 4PZ0A 4DV0B 4PN3A 1EA5A 1MB9A 1DQZA 1XCLA 2YMMA 3TVTA 5CB4B 2GKGA 4DSAA 2GZ1A 3KJFA 3R9WA 3Q3HA 3T4XA 4NULA 1V3UA 4ZDJA 1DTEA 5TMEA 2C77A 3BIWA 3F71A 1RWWA 1N8TA 3H05A 1BZYA 4EPXA 3DBVO 5B1EA 3AHEA 1XJWA 4MB2A 1MXHA 4OHWA 4XTRA 3PGXA 3EOZA 4D74A 3EIUA 2FPWA 1RXUA 1CS0B 4O3FA 1DRWA 3RNOA 5CFPA 4ZZ3A 1JKIA 3W1EA 4EA9A 2ENUA 1XSEA 3AUKA 4DLSA 3KLMX 2A30A 3F8SA 4KO3S 6YASA 7REQA 4K0KB 4IQ8A 4JXJA 4MVJF 1SG9A 2C4UA 3H9EO 3PWKA 3VH1A 4ZO7A 4EITA 3AGPA 3GGSA 2W70A 2UV8A 1W5EA 1I0LA 5K4AA 3AFGA 3I6QA 3SC2A 3IA2A 4COKA 3A1VA 3HJRA 1VK3A 3KYCB 2BZ1A 4HYYA 4O25A 4EHFA 4N47A 2IBMA 4QYTA 2ATIA 5EKDA 5LZ9A 4X1KA 1NL3A 5AWFC 3SE0A 5KSOA 2QB5A 3HBNA 1U3TA 2PH1A 1ESZA 3PFIA 2HBQA 2QR2A 2WHPB 3STXA 5ARBA 2NX2A 2XKAA 2XE4A 2QVLA 5C4GB 3O3MB 4PSAA 2OP0A 3BQNB 4JODA 3I3SR 2JGAA 3OJWA 4MW6A 4YAFA 2WP8J 2ZJOA 3QI2A 1G7SA 3LPDA 4KDEA 4HS4A 3KVNA 1OZAA 4F3NA 5FL7A 3GFQA 2X5KO 2DM6A 4HMPA 5IW8A 4HEJA 1RPJA 3QEAZ 4RLQA 4R7GA 1R6TA 2VG8A 3M5CA 5JEDA 5JS7A 3BXHA 2J6CA 4FMPA 4GC5A 2AZ4A 3CZAA 2H85A 1OZFA 3DV0B 3DE2X 2OTCA 3UH0A 3BTSA 1QR2A 1KP2A 1YB4A 5A4KA 2BISA 3HKBB 3PE6A 4G01B 4MUNA 4TV8F 3ZY3A 1H9AA 1I32A 1VLHA 1X77A 3R6DA 1JE0A 5BSHA 2OHFA 3BWDD 3WGJA 3PC7A 1QH8A 2IYVA 1JWLA 3UFXB 4NPHA 4BMNA 3EA0A 4A7PA 3IAAA 3TNLA 1PJ3A 3RF6A 4B71A 3M81A 3D3WB 2C42A 3A3KA 4JHXA 5JLJA 1LBIA 3UXEA 3LQ2A 4TV9B 2X2OA 3V7WA 4D79A 3IIJA 4UBNA 2I2CA 1L4GA 3UH1A 1IDOA 4F60A 1WZEA 5E3IA 5BUSA 4YAWA 4CIYA 1MQSA 2X8AA 4RMNA 1AKTA 5SZIA 3D3NA 4DAEA 1E3SA 2WZDA 3ADBA 1VQ7F 3SGLA 4QAQA 4PG5A 5ADVA 2WSLA 1FYVA 1PHRA 3I1FA 3T5CA 4AG5A 1DQYA 3HLTA 4ZKDA 1YQTA 4J90A 3PLAE 1E3TA 3HJTA 5I7VA 3WJQA 2AR7A 3P1JA 4QXPA 2IHBA 4KXYA 1GQSA 3JRXA 4EJSC 2XHZA 3RTGA 4JB2A 1DKRA 1MD9A 4E94A 3E4DA 3NHPA 3EAGA 2XUIA 1XCPA 3RIYA 4WY8A 2FMHA 2A0YA 2I1QA 1R0YA 2IHUA 1JSRA 4RJKA 5IPFA 3KX2A 5A5FA 5IVHA 2HS4A 1SY7A 3R8CA 2NU6B 5LYYA 5TVGA 1L3BA 2PKWA 3OT4A 2CLMB 3SS8A 2DXIA 3WL5A 1UMKA 2ZYTX 3TQHA 4DQ0A 6PFKA 2RIPA 4DV6B 1HDOA 1WBBA 1U9CA 2PLNA 2XOKA 4A23A 4BN5A 3MBMA 4N9QA 1SHKA 1LPBB 1TJ5A 4DC0A 2XNHA 3HKCA 1BU8A 2YXDA 3C6KA 4V0QA 5EHIA 3VR4D 5BN1A 1TYBE 3PDUA 3LMKA 5DFAA 4HNAA 1S8OA 1Z68A 4Q12A 1A7UA 4N01A 1QKJA 4FMDB 3VO2A 1L3IA 4WL0A 3CPSA 4MQFA 3GLKA 3WMFA 1AHPA 2R6DA 1KL7A 4I7EA 4KH0A 1OT3A 2HMAA 3CZMA 3HA3A 1L1FA 1PFWA 3EXIA 3JWJA 3EDCA 1U7TA 1XVVA 2XECA 3IJ5A 3K30A 4FMCF 1EU1A 1NVXQ 4M9CA 4XIGS 4H31A 3CVWA 1L5HA 1T2FA 3A2MA 1TA4A 3EQ2A 3NU1A 5CITA 1VLZA 2Z9CA 3GFVA 3WWYA 2J9FA 1GPLA 3QFTA 4TWAA 4LMAA 4X00A 5TQVA 1BQEA 1RRMA 4FC7A 1MG5A 3FUUA 3IO3A 2CLIB 3Q3GE 3WA6A 5LNK1 2HIMA 2NV2B 4A03A 3N8HA 4MR9A 2QVZX 2DCUA 3FUVA 3LY8A 4CCYB 1E3DA 5D3ZA 2M6RA 2HREA 4C01A 1TLTA 3UB2A 1YULA 1C7QA 3C9TA 4KUHA 3REOA 4Q3AA 4EK9A 1D0VA 2PX8A 1LWOA 1NR7A 4LBYA 4R1UA 3UJCA 4DA0A 4DGQA 3C5EA 4HXFB 3D4OA 3OTGA 1DU4A 3FZQA 2K1SA 1X7OA 1OHHD 2EF1A 2WJHA 4U7HA 4BAGA 4BB9A 5C5CA 3IP7A 1GO1A 3HYLA 1L4UA 1GRNA 1E2PA 3ANLA 4QRDA 4PC1A 4A8TA 4G4SP 4PO3X 1KJZA 2X1VA 3G4SF 2MINB 3DVRX 3VX4A 4B2PA 2VJYA 1W2GA 2WK1A 2Z6AA 1NVWQ 3I3OA 4KQKA 3AM4A 4UPVA 2CJFA 4U7GA 1I51A 1EE9A 4UASA 1T4CB 1ZUD1 4WOBA 3QWIA 2BIFA 2ZCUA 3ZKAA 1HDIA 1S01A 3EPRA 3O75A 5K51A 4M7RA 10MHA 3ZWNA 5GV8A 3R7DA 2UYHA 1Y7PA 2JLAA 3GXBA 3MMPA 4PYNA 5DTMA 5B3JA 4RTRA 2WD8A 4IRMA 4FJ0A 4QOGA 1JIXA 1UMCA 2G04A 1CS0A 2HSJA 5MFPA 5L3SB 3FJYA 3CYPB 2YWBA 5EO3A 1IONA 4R68A 3V7NA 4ZC8A 1VE9A 4GEGA 1X52A 3LPCA 2XDWA 2G71A 1EFCA 1N78A 4YTEA 1Z6PA 1Q84A 4B4UA 1SB8A 4ML3A 1XTIA 2DTXA 1Y6FA 2PRZA 3S0HA 1JG1A 1XEXA 1SUCA 2PO5A 3C70A 4KXXA 5DOZA 4YRGA 4Q9DA 3HKDB 3FNRA 1QRUA 5GWXA 5A2QM 5AOBA 3W04A 2GOYA 1YJWF 1Y9JA 3E7DA 3T4PA 3OOSA 4O59O 4JLUA 4PXYA 2CV1A 4JVNA 1A5ZA 3GRCA 1CRZA 3KKQA 2WNIA 5DT9A 1DIHA 5LMZA 6Q21A 4IFEA 4ZK7A 2ZR0A 2G83A 3E8MA 3PXCX 1JLMA 1YK1A 2ZBVA 2JFYA 4QAJA 3T1TA 3H83A 4DR4B 1TOAA 2B25A 1FX0B 1SUEA 2FP4B 4S24A 3KSAC 3LUGA 1GFSA 2AQHA 3E9QA 2G8LA 2WT9A 3T8YA 3VPHA 4L4YA 1QRRA 7YASA 2I78A 4BAZA 2GD6A 4JBXA 1RWNA 1KC1A 1U7WA 1Y3DE 4JUBA 2ZPUA 1QFMA 3G2IA 1XZKA 2IQIA 5IEBA 1OI3A 3I7TA 3OZVA 5K3DA 4B7AA 2V0GA 4H3KB 4MP3A 5CURA 4R84A 3BDVA 3TTTA 2JCBA 2WSSD 1VQ5F 2QEQA 4UU7A 4YI3A 3K1AB 5B6JA 1O2DA 2OHJA 3GHZA 4ZVLA 4C0XA 4HGOA 5DLEA 1E58A 1HDEA 5ESWA 5TMBA 3GJ7A 3HC7A 3M2TA 5JCJA 5E8RA 4DADA 5IS2A 2IH4A 2AWOA 1PKEA 2KBEA 3PE4A 4IY1A 2ZULA 3DFUA 3IR5A 4OYLA 4L02A 3ZWOA 4C21A 2IU6A 2XUOA 4CM8B 4YRZA 3DLHA 1JY8A 5AKYA 5KVCA 2HD4A 1OMOA 3DV9A 3WRXA 2P4HX 1N0HA 4L4UA 1ZXBA 4FI3C 2W4QA 4NQZA 4DMKA 1AMNA 4Q93A 1T10A 4FYMA 4E03A 5B8FA 1JR4A 2HEIA 1ODFA 4PAOA 4YRFA 2OZKA 3SXUA 1G7CA 1PW5A 1UPFA 3I2KA 5EQDA 3N5KA 2IZ0A 2PZJA 4FGZA 1DWQA 4HI0E 3PEVA 4QRIA 5FULA 3RVJA 5CIYA 4PVCA 1FDVA 1BQ3A 2WWIA 1XVTA 4G86A 4HDKB 4ACAA 1L7EA 2J3KA 5SYAA 4BFVA 1Z15A 2BM0A 2ZJ4A 2ZUVA 3DCJA 2HOQA 4IV5A 3IERA 1NQAO 5EJGA 2YWFA 4Q0MA 4ZHVA 5AKHA 4DS3A 3JVIA 3LH5A 4W5HA 3K2QA 4Q9IA 3V4PB 2Z5LA 3AVXA 4AMBA 2JATA 2ZR8A 4K86A 4AJ4A 1UJ2A 1K0FA 2ZRDA 1JSZA 3P97A 3EVCA 3GCDA 1KDOA 1U0LA 3L93A 3ZWQA 3TOZA 5IKEA 4Z0TA 1ZMXA 3BN3A 4JGBA 1R64A 2YXNA 4V0SA 3RR2A 4Y67A 1O0BA 4MUYA 2WILA 1QB8A 5C5EA 5WRFA 1F3LA 3D0RA 1L4EA 2JLRA 2JH8A 3A9WA 3BHJA 3P2JA 1YCFA 2AN1A 3PTZA 3TTWA 4CKEB 5C1OA 2HN9A 2OV8A 3U3KA 3CLRD 1CR0A 1PZEA 2B61A 2H4ZA 3EXG2 2ECFA 3R5TA 4YMUA 2LRHA 2W8BC 4A9AA 3ZCVA 2PTGA 4URXR 2M32A 1JX6A 2NZXA 2DLNA 3AY7A 3S1AB 2TRSB 1SULA 1U2EA 1XQ1A 3QFSA 4LFAB 2X14A 4IG4A 5HQ3A 5IKPA 1CUBA 1XYYA 1JFLA 3QUAA 2VNKA 4M37A 2CDAA 1SBCA 5KQRA 2OD7A 1ETHA 3MB8A 4XSGA 1CQWA 2HHLA 3QKRA 4TV9A 1P0CA 3QF4B 3CXCF 2FG6C 4S35A 1KARA 3QKUA 4HMOA 2QMOA 2POQX 2D74A 1FTNA 4BVKA 2JRCA 4MGIR 3ZXXA 1QBKC 5E4YA 1CIVA 4JWTA 4FB5A 4Z86A 1ZNXA 2AJBA 3C6YA 3NV7A 5A1JA 4NQRA 2PWPA 3PFCA 1Q0HA 5IULC 3LX4A 3QVVA 4G24A 4HUQA 4TXJA 1LFDB 1U5CA 3L4EA 2RGDA 3TQRA 4UTRA 3HFGA 4MWDA 4G4YA 4M8LA 4GXQA 5EAZA 4QSHA 4R5HA 1Z33A 4TOIA 5L3QA 1YOBA 1DV1A 1U4SA 2VHZA 4JUCA 3T9BA 2RGEA 5HVNA 4RPGA 2BMEA 1JR3E 2WWXA 4TN1A 1EJ6A 3WQSB 2Q1WA 3A1FA 4BV8A 2P6RA 1CJTC 2A2ZA 1QP4A 1VBFA 5CYOA 4OMFG 3I5UA 4XJTA 1VGRA 3QWAA 4PSKA 3PF9A 4HH4A 2PLWA 1XFDA 4IDGA 1FMCA 3LPNA 4DLYA 4G65A 2NVWA 4ZJUA 5EP3A 2CLEB 2Z5FA 4IOMA 3RHTA 5JC8A 1SCKA 1CRWG 1X0XA 4P98A 3PQ3A 1DAMA 1X1RA 2X9VA 2I3ZA 2AT1A 2XTMA 2C7RA 4YJHB 4LZZA 3UJDA 1NKTA 2B6HA 1J7HA 1QIHA 3GH1A 2IUFA 4X85A 5DEOA 2NO4A 5B1IA 5EAIA 4DM3A 5ICFA 4NRDA 4X8LA 2O2GA 3E1KA 3ZY6A 5AJTA 1Y3CE 1YVDA 4O2BB 2F1KA 3P96A 2GYUA 4HAYA 1IOWA 2FSFA 4JLBA 2NXEA 5GOTA 3VYUB 3RLIA 5KIAA 4XGQA 4S1PA 2IG8A 2DYYA 3C85A 4GF5A 3L40A 4XZ3A 3V7QA 1F4VA 4UUAA 3WGHA 3G02A 4ISCA 1MABB 3RSZA 1KWGA 3QJGA 2B33A 3LQRA 1P5ZB 1QHFA 1B15A 1ZH8A 4MDYA 5LQRA 4NJMB 4TT8A 3EDMA 2BAGA 4NZ9A 1MGPA 1NVVR 5L6LB 1RBQA 4JLWA 1BHQ1 2GAJA 3CA8A 2H8EA 5DGDA 4OPMA 1G64A 2IYRA 5BV0A 4R8SA 5ALHA 4ER6A 1LQUA 2WT4A 4F4DA 4YMVA 3MJDA 5B6PA 3DEKA 3MWJA 4GOKA 3JARA 3E2IA 3F90A 4KITB 2W48A 2OAGA 3GC6A 3FHLA 3IE0A 1PE0A 1OV4A 1S9HA 1X9IA 4M0PA 4ARBA 4CHGA 3ISTA 3VI3B 4JQSA 3ZWDA 2C3MA 2RBEA 1XRJA 4NAVA 1VG1A 3FHOA 3G6KA 5ALJA 3RHSA 3MJFA 3ZWXA 4E5VA 5JD5A 3ADCA 3U5TA 1BROA 4NI5A 2AG0A 3KOOA 4V0LA 3GJ8A 1MZVA 3TM4A 2YL2A 5T4BA 1G4UR 1T24A 5AW8A 1WBJB 3JQDA 1WHSA 2CDCA 3CZCA 2APJA 3KKMA 5KNDD 5BSTA 3ZY2A 5HP4A 1BGXT 5JCZA 1WPQA 1OH6A 2IWRA 3F6EX 4GP9A 2ORYA 1V5EA 2ZSFA 4DUZB 2D2IA 1EGQA 3QXSA 2NMVA 3NKLA 3A6JA 1XR3A 2QX7A 1U6JA 1P75A 3ESJA 1J2YA 4NF2A 3GLHE 4RS3A 1SBIA 5JAUA 4JX9A 4ZWNA 1M2EA 3L7OA 3ZV3A 2R86A 1PR5A 4HBZA 1P5RA 4XVCA 3VX3A 3WP1B 4PFQA 3G2PA 3CCBA 4HK4A 4UEWA 3RVRA 3NVKI 2GILA 4X6YA 5AMXA 2D1RA 3GCZA 2HCTA 2BF7A 1GTSA 4URWR 1XQXA 1UFRA 5CFQA 4C22A 5K5EA 3NDJA 1Z6XA 2AH5A 2FR8C 1RYFA 1VL8A 4N18A 2Y4NA 4N5LA 1YQ9A 5HUJA 3TFQA 3O84A 2WNHA 3PFHA 2FLKA 2OV3A 3F4LA 1EK0A 4BRSA 4L5IA 4RTQA 4IJQA 1XKXA 4NBTA 4J7AA 1YIDA 1LNZA 3VJMA 2Y99A 3GMIA 3KKZA 3BBPA 2GBLA 4UUPA 3L05A 2V5UA 4OQ4A 2F1RA 1HL3A 3RJTA 2PKXA 2ORED 1GGEA 3P0RA 1T8SA 2OM2A 2Q3EA 5DNAA 4B62A 4M3NA 4DC9A 3QFCA 1JHMA 5TJHA 1GV0A 4JZKA 1ZK4A 4YDRA 1Z6TA 2QRQA 3T7CA 1WPRA 4R2KA 1XYGA 3SDSA 2FN7A 1YR3A 4HYQA 1XMXA 4CEJB 3U16A 5IVIA 1GTG1 1YQWA 3E81A 4BE7B 2MMGA 1CZNA 1TCBA 1MB0A 2AGVA 2P0EA 3PHJA 3FI0A 4HQNA 1NBIA 4I5EA 2WIJA 4BX3A 5BW8A 4RLHA 3FOBA 4F8EA 1C0LA 1V6SA 1W0KA 3T3DA 1FJHA 4REQA 1I33A 3FKSD 3QPDA 4BNGA 1F0YA 2IIVA 4RV4A 3AI1A 5KJ1A 2GN6A 1T9AA 3CUSA 1J1UA 1PEYA 3SIUA 1UADA 5KJFA 1YQNA 4IH4A 2IHNA 1JEJA 1YKSA 3HMKA 1I5OA 3FMOB 1EI9A 2FXVA 3HY6A 1OA0A 3U4MA 1T3ZA 2BT4A 5A4AA 3KWJA 3NKVA 1T9KA 4TV9F 5PGMA 3SE7A 2ZAYA 4MDFA 3O3OB 1D0SA 2BGGA 4AMZA 1ENZA 1EBBA 4NNOA 5KQGA 4N48A 3H4VA 4TYPA 1HEIA 2OFWA 2ATCA 1KQOA 4MROA 2WJGA 4YRCA 5E3JA 5INTA 3MBIA 1BX1A 3DUFB 3A4IA 5B30A 4P4SB 2ZB2A 4XUCA 3ANXA 2QU7A 4XX1A 3W5CA 5DCYA 3VJRA 3E9EA 3K92A 2WTXA 4ZEMA 3MJSA 3A36A 5JHHB 2I6DA 3RA5A 3E4CA 4KTTE 5KX5F 4KIUA 3QUCA 3LM8A 1CY6A 5FBWB 3A3PA 4Q05A 5DYYA 3ZN2A 4UTVA 4ARCA 3HO1A 3IKLA 1KZ7B 3UMJA 2HU7A 4P9NA 1WXIA 4KV9A 1KEEA 1A04A 4XTCS 3EAQA 3TW8A 3ZDAA 2PZBA 2RGRA 4RVFA 1QO0A 1D8TA 1UM9A 1IQPA 1MO4A 1WW8A 2CFIA 2CL7X 2ZU6A 3PC8A 1A8QA 2CXNA 2PY6A 4C1BA 3PU6A 1FXSA 1TZMA 4AF8A 4GHWA 2P1RA 1KGSA 1XEFA 3NS7A 3TSCA 3VYSB 1N5OX 1WVIA 3INGA 3DB1A 3N4YA 1W4AA 2VF5X 3PDWA 3AETB 3BF7A 3CX3A 5M3BA 2I67A 5LXTF 3SSAA 1DIAA 3HKBA 4JYPA 3HB0A 5HXZA 4QOIA 3SZOA 1JWAB 3LV8A 5JMWA 1H5QA 1T8RA 3I1IA 1IV1A 3CJTA 4X7PA 7GPBA 4TSRA 2HJSA 2DY0A 4AJEA 4F86A 3NXSA 4N7BA 1KOFA 1XMJA 3I5MA 3UJBA 5EJ4A 2IJGX 3O5AA 3GV0A 2P3LA 3KLOA 3WY9A 4Z5XA 3P0JA 5CIWA 2WYOA 1DI0A 5AVQA 1CCWA 4D4MA 1QDEA 1H5UA 3D5TA 3ILYA 4KHPB 5TQ2A 3V3KA 4C8IA 1RQLA 2BFBB 2CL6X 2VSNA 4UE6A 4YVFA 5EZSA 3TIGA 2JGIA 2Q28A 3WZ2A 3OHSX 3IJPA 4YDHB 5FADA 3TEMA 1ZO8A 2B9EA 4NZMA 4UNIA 1BKYA 2BR3A 5K45A 5KYVA 4LRWA 4AJJA 5LVAA 2PUBA 1RKXA 1X15A 4K9RA 2JIPA 3ZCXA 2Z6QA 4RHEA 4TWJA 4CG1A 1FIUA 2GH1A 2P4UA 4C7OB 2QPLA 3LQKA 4LVUA 2QPAA 1Z34A 2AMJA 1WB6A 4NTZA 1KI9A 4P2GA 1Z0DA 3C3PA 4KXNA 4C4XA 4E5NA 3G6EF 5ALEA 2HMYB 3RADC 1KVSA 1YQXA 3G0DA 4C5AA 3ZHOA 4DNPA 2R8RA 3ZHYA 1OUMA 3O0TA 3FYHA 1U5BB 2V5VA 4LYHA 3RFUA 5JQWA 3A1EA 3R3JA 1JHRA 1T1SA 2I1LA 3BXGA 2IUYA 1AF7A 2JCVA 5DPMA 4YT4A 3F98A 1EQ2A 4R3WA 4JXKA 1PFQA 3I9OA 4MARA 4IDNA 1XP8A 3JQ8B 4PXSA 2E4WA 2BVNA 2ZI7A 2RHBA 2VTDA 5ELXA 1SR8A 1NU6A 4XRGA 3H9UA 4ZHQA 3FIJA 1BRMA 3HKCB 1WTCA 3VHRA 5A3JA 3QUQA 2VPTA 3U44A 1E0DA 2EGGA 2R48A 3BREA 3L7NA 5JVDA 3O4IA 4OX9Y 4YT2A 5CXUA 4H7IA 5JTTA 4ETWA 1BA3A 2VZLA 3HXMA 1K0UA 1T9ZA 2A9OA 4PZEA 2YY7A 2HSDA 3RYCB 2R8PA 3PHLA 2YVQA 3WGNA 1US8A 2L69A 2NUBA 3QVGB 3H9GA 4EMSA 4ZU6X 4DMFA 4ED9A 3FLAA 1HORA 2BI4A 5KYWA 2HK9A 3CKLA 3AYZB 4FBMA 4BVGA 2H1CA 2AF4C 4GECA 3SFZA 3O9VA 4RMHA 1U94A 5B5SA 1PSZA 1CVIA 4YQFA 3KQHA 5LQJA 3G85A 2DPHA 2I0FA 2OO7A 1G42A 2WY2D 4AJNA 1B76A 3M7IA 4TV8B 4CIDA 2NVUB 3QWBA 2W42A 2DH5A 4RXUA 3SZ3A 1GZ4A 4ZQEA 4DVJA 2PZLA 3IUQA 4LYGA 2H17A 4MUIA 5CH5A 5SYMA 1ZFNA 1KSGA 3DTNA 1RAFA 2PUFA 4C5CA 3S06A 3K2IA 4BVEA 4RKYA 2OA0A 1Q44A 1G17A 4JJGA 4IIFA 4NZOA 3UWMA 4YRMA 2G07A 3PPYA 2WVHA 4C7KA 5K4GA 2ZZMA 4LDNA 4B7XA 1RW4A 1EXWA 1YE5A 3LLUA 2P9BA 4IUDS 4DYHA 4EY5A 4EA6A 2A3NA 4MUBA 3I6YA 3INRA 1ESCA 4ZCQA 3JZIA 1KO8A 5JJCA 5FCDA 1CUUA 2WWFA 5JU6A 1FL9A 4MXDA 3T3NA 1AUOA 1XI2A 5LXTB 2HSGA 2PH3A 3U3XA 1FJXA 2VHYA 4INPA 2HHHB 1SDSA 3DOCA 2J85A 4XW2A 3NALA 1V8OA 3HGMA 3G8DA 4IKEA 2R11A 2CSLA 3AI3A 1WW3A 2JANA 2Q5LA 2QX8A 4EEXA 1M5RA 3I04M 2HQSA 3R09A 3GDOA