3WGKA

Staphylococcus aureus ftsz t7 mutant substituted for gag, deltat7gag-gdp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
b'LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGAGLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 97
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgkA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgkA01
5FNVB 1W5AA 3JASB 4TUYA 3M89A 4O2AA 3HKCA 1W581 4ZI7A 3HKEB 5GONB 3WGKA 4YJ2A 5IJ9B 4ZHQA 2RHOA 4IIJB 1Z5VA 1W5EA 5IYZA 5MN4A 4DRXB 4O2BB 2VAMA 4U3JB 3RYIA 2R751 3C8LA 4O4JA 1TVKB 5LP6C 5LYJB 5ITZA 3RYCB 2VXYA 5FNVA 5KMGB 5M7EA 3JASA 5JH7B 3V3TA 3HKEA 5GONA 5IJ9A 4IHJB 4O4HB 4IIJA 5EYPB 3VO8A 4X20B 2R6R1 5JCOC 4LNUB 5C8YB 5JQGB 4DRXA 4O2BA 3WGLA 4U3JA 4EI9A 3RYHB 1TVKA 5LYJA 3RYCA 4U39A 5KMGA 5JH7A 1W59A 3HKBB 4TV9B 1FSZA 4IHJA 4O4HA 3JARB 5EYPA 5CA1B 3ZIDA 4X20A 3JALB 5J2UB 5EIBD 4LNUA 5C8YA 5JQGA 4B45A 3N2KB 3WGMA 5MN6A 3RYHA 4B46A 2GVIA 3ZBQA 4X1KB 5EIBC 4FFBB 2XKAA 4HNAB 1RQ2A 3RYFB 4WBNB 4EB6B 3HKBA 2RHJA 4TV9A 3VOAA 1JFFB 4EI7A 3N2GB 3JARA 3ZBPA 5JVDB 5CA1A 1RQ7A 5J2UA 3JALA 4X1YB 3HKDB 5LOVB 3M8KA 3N2KA 4ZOLB 3E22B 3VOBA 4YJ3B 4I4TB 4X1KA 4FFBA 3VO9A 4HNAA 4X1IB 4KWEA 5KX5B 4TV8B 3RYFA 4DXDA 4M8IA 4EB6A 4WBNA 5IJ0B 3R4VA 1JFFA 2Q1XA 4EI8A 4YJ2B 3N2GA 5JVDA 3JAKB 3UT5B 4X1YA 3HKDA 5LOVA 4XCQA 4ZOLA 3E22A 3JAWB 4YJ3A 4I4TA 4I55B 5LXTB 3WGNA 2Q1YA 4X1IA 5J2TB 2XKBA 1FFXB 5CB4B 2BTQB 5KX5A 4TV8A 5IJ0A 5BMVB 2VAPA 4F6RB 3JAKA 3UT5A 1OFUA 5CA0B 1SA0B 4O4LB 4I50B 2BTOA 3CB2A 1W5FA 5EZYB 3JATB 5JCOA 2RHHA 5LP6B 4O4IB 1TUBB 5LA6B 4ZI7B 3JAWA 4I55A 5LXTA 5MN5A 4TUYB 3VPAA 3WGJA 4O2AB 5J2TA 3HKCB 1FFXA 5CB4A 2BTQA 3RB8A 5BMVA 2VAWA 4ZHQB 1Z5WA 2RHLA 4F6RA 1W5BA 5IYZB 5CA0A 1SA0A 4O4LA 4I50A 1RLUA 5EZYA 3RYIB 4O4JB 3JATA 4E6EA 5LP6A 4O4IA 1TUBA 5LA6A 5ITZB
chains in the Genus database with same CATH superfamily
4KRGA 2N1MA 1MAHA 1OIXA 2KSQA 2EGGA 4FX5A 2YV4A 2P4EA 2J0UB 1FNCA 3RVBA 2P3LA 1P2FA 2YN4A 1Z5GA 1FTNA 2GK3A 5LZ7A 1Z6XA 1ECPA 3E35A 4US0R 2AFRA 2WQZA 2CLIB 2H7VA 1TB4A 2GPAA 4LMRA 1H9CA 4P5EA 2F3UA 4P1ZA 3TSWA 4GDMA 5GM2A 2KBEA 2V1XA 5KMGB 1UDCA 3E3OA 3IEPA 1RJGA 1S3SA 1HC7A 2B1IA 1KRHA 1TZKA 2CSUA 3Q3HA 3R3UA 1U43A 1YZHA 221PA 3RS8A 3WI7A 2A9FA 3LDFA 4UU8A 1WBBA 1VLMA 3FFWA 4NYIR 3M5PA 3H1AA 3SP1A 3OHMA 3AI1A 2R7AA 1VQ8F 2VSYA 5CXUA 2JIDA 5AXDA 2VRBA 1RWQA 1Q81H 1WPXA 2QF7A 1M34E 1ZZEA 4GPD1 2UZ3A 2RK3A 4Y2XA 4CTMA 1X3LA 1FRFS 3A37A 3ZGZA 3C3BA 3R75A 3GCDA 5ENZA 5C1DA 2XSZA 1YDHA 4NYJQ 1VOTA 4CNQA 5JDIC 1G8YA 2C9DA 4BVHA 4O4HA 3RU3A 1KO1A 3Q72A 4UKDA 3JALB 2VWHA 3DZCA 3HZZA 5JXWA 2KWIA 1VCHA 3BGSA 2VSNA 4RLSA 3W5IA 3E7PA 4ZOLF 1TM3E 4KP7A 4KIFA 4YUWA 3LT1A 5CCDA 1FQJA 3ADBA 1VBNA 4BV2A 3ZOKA 1ZJ6A 4CMAA 1D4OA 2XZDA 4E5YA 3I2GA 4ZAXA 1GQYA 2QSZA 3ZDDA 3CEHA 1G9XA 2GJ4A 3ZGYA 4GMHA 5JJIA 1M2KA 3UHPA 1E7WA 2HSEA 2CF6A 4M98A 1EA5A 2UYNA 2A1UA 3E5RA 4WIAA 1RT9A 5E4TA 1QBKC 1WMBA 2E5FA 3B1FA 5EPEA 1BTOA 1LU9A 2ZRKA 4FDVA 1YA8A 2XCUA 4FIZA 5IDVA 3WPWA 1GP2A 4AJOA 5E6SA 2B3DA 5GGYA 5EB0A 1SB9A 5K3FB 2QRLA 2MYPA 4ZK7A 4DG5A 1QQ6A 3R0VA 1EM6A 1Q0HA 2PKCA 3SEQA 5E2BA 1WV0A 1AA6A 1HQDA 3I9NA 2DPGA 3QFFA 3ADKA 3BHJA 2P0EA 1UR5A 2ECQA 1N1DA 3JCZA 4CEIB 2HPAA 4JFAA 2ZBPA 2QXUA 3CBGA 2I4OA 4H4EA 4R41A 5M34A 3TCXB 2NZ2A 4AO6A 4A03A 1V6CA 1FY2A 1S3IA 1XVAA 5DI3B 5K0NA 2MOKA 3ZWBA 3KD3A 2LBTA 5BQOA 1E5LA 4Y1EA 3VC7A 5YASA 2LVBA 3BICA 2DU8A 2PRYA 3R7BA 1FLVA 2AKAB 3EXAA 1J2TA 4JBYA 5L45A 1Z75A 2FE4A 2YZ7A 4E5KA 4POOA 3LF2A 1AK9A 4CN8A 4LXGA 4MEBA 2ERXA 1KKUA 3NJ8A 1E32A 1XZBA 4ZT2A 1N2JA 3TWOA 3LQ4A 1WB4A 4LGVA 4P9NA 2W7TA 3HYNA 2WV9A 1XXHE 2E4WA 1W88B 5EJ2A 5EWLA 4ZHQB 1P80A 2GD2A 2P8JA 3NAQA 1T9BA 3PFCA 4RK1A 4TMWA 4XM0A 3ZJTA 5K20A 1YZQA 3RYIB 4CQMB 1Z4MA 3LFOA 4TZZA 2H54A 3AB3A 3G9XA 3VO1A 3IEKA 3ZCVA 2IU3A 5AW6A 3K0AA 5LYJF 3B85A 1OU4A 3WR5A 1I33A 2WHRA 1T43A 1RXUA 1Q57A 1FX0A 2AEMA 1M2VB 2KW5A 4Q3OA 2DG2A 2I7VA 5CITA 1ZOLA 2BBOA 4DQXA 1EWRA 1T5HX 2CHEA 4BMDA 5KOYA 1QFYA 3K6RA 3BN3A 1OLSA 2P6YA 4TTAA 2M6SA 5HK8A 4C5BA 4Q4CA 3RA6A 3H04A 4D5EA 5AVRA 2WIFA 1RAAA 4BO8A 2GMWA 1QMPA 2BFMA 2ZJOA 3MTBA 2L69A 2Y66A 1BYIA 4LX8A 4L7QA 3TKYA 4JBNA 3HCEA 1UDAA 1K7EB 3EZ7A 3OPQA 5JT1A 2NSHA 4KGZA 1CWUA 3PFKA 1N75A 3T6KA 5TF0A 3UGKA 3P9NA 1NW7A 1SEVA 2QMEA 1SU7A 3LXMA 2C77A 2JZNA 4GECA 5G0UA 4XJVA 1UXHA 5C3UA 5KYKA 5LVAA 2RGGA 2DLDA 2JGIA 2ZPTX 3RYCA 3W2HA 2EZ8A 2NSJA 3AEQA 5ICSA 3WNQA 1FDUA 4OSOA 1CY8A 2JGEA 2C4HA 1U0NA 4RFLA 3GFGA 4NFHA 4O33A 3ZVRA 3PU6A 1SBCA 3ESYA 3FJOA 1GCIA 1C9EA 5I9NA 1NM5A 4YAGA 3N2KB 2W2KB 2NU7B 3IAM6 3SQDA 1CFZA 3RYHA 2H5JA 2ZQ5A 4KL8S 4BAGA 3UZUA 1N0WA 5AW9A 3TR6A 3TZBA 2C29D 5KX5F 1RPZA 1G20A 5ESDA 1QHIA 4EI7A 4FS8A 4B7XA 1UI9A 3I32A 2ZFUA 2X1MA 5DYGA 2ZSIA 3LDHA 5EIOA 3FSGD 1A7UA 3H17A 1GDTA 1FRZA 2PX0A 3A6EA 1L4KA 2XCIA 1KMQA 3EGDB 4LJ7A 3CNNA 1CK4A 3JD2A 3E22B 4GLJA 2NVUA 2AFIA 2WLTA 3DL7A 3R0XA 3B5IA 2O2HA 3CN9A 3GP3A 4XXHA 4HDOB 1F0KA 1UPAA 3D0RA 4JJ4A 4NZYA 2DOKA 4R8MA 1YVUA 621PA 4YY3B 3JD4A 3OAAD 3SXUB 3TD9A 3UPTA 2QTLA 3HB5X 3HP4A 1CRLA 4IKPA 4MV3A 3LKBA 5EQTA 1DWPA 1NMEA 1QIKA 4YAFA 5G2OA 2PX8A 3GGPA 1JHYA 4XSGA 4DV1B 4LC1A 1XTKA 3SLGA 3R5HA 1P19A 3TL3A 4ZVLA 1NP6A 1J1UA 4Z9FA 1FFXB 2PS3A 5KI6A 2JIZD 4GPBA 1L5FA 3NYQA 4QLAA 4DF3A 3NAZA 2CJFA 1Y4AE 1NDUA 3WBJA 1ABFA 1QH1A 1JDBC 1OV4A 4KV9A 1W34A 3QBTA 5ALPA 2JG3A 5K7SA 1FDOA 1YI8A 3CF2A 1W0CA 3MJDA 3MWEA 1KEEA 4WNIA 1QIHA 3UMJA 3E70C 2P9FA 4MRVA 1T6ZA 2EARA 3NC1C 4DR5B 5CP8A 5IF9A 4BQEA 4B6RA 4B83A 2QJRA 3FZNA 4JWTA 3ZHSA 2F62A 1SGWA 2N48A 4EFNA 1JKJA 2Y1FA 3OCWA 2K2WA 1ZHFA 3DKIA 4B3DA 2QB5A 3VZQA 1OGIA 2QP9X 3HG7A 2QUAA 2EGHA 4I9HA 4JLOA 1SKBA 3RS2A 3PA6A 4W1RA 2WD8A 1VKRA 3EG9B 3AY0A 2PJUA 3IULA 4LV6A 4NOLA 2AMJA 4KRFA 4OUKX 4BNKA 1J0DA 1KA9H 4DCJA 3VR5A 4Q4HB 2O2GA 3CCBA 4FR2A 2NU9A 3Q8HA 1UPTA 1KAEA 2UKDA 2VDJA 2VHVA 3BM5A 4EJ6A 3KJXA 3EPLA 1DC5A 1YRLA 2D5LA 3KYCB 2JCBA 5KYXB 5CFLA 5K2OA 2VJDA 1JJ7A 2RIRA 2I4LA 1USVA 3AHHA 4HAIA 1E9RA 3BSSA 1II0A 3FF1A 1TX4B 2WA2A 2BHSA 2O0JA 2GZDA 1N34B 3LYBA 2J87A 5IVPA 2QQFA 2REQB 1XZFA 2QM8A 3H7IA 1JAYA 1UK8A 3PVZA 4WINA 5JAPA 4NCNA 4L4ZA 5FWYA 1WEHA 1JDZA 4YI5A 2VUSA 3C1UA 2PK3A 2PGIA 2ZS7A 4NZOA 4YAUA 2ZUFA 1H2YA 2D5IA 4MUKA 3SZLA 1UXGA 4CDRA 4ESEA 3F5DA 3FYUA 4LTNA 1ZGBA 2B21A 3KB2A 2QAJA 1FE8A 2JZOA 3R8XA 4HAOA 3J7TA 2GHQA 3H5RA 3DP9A 4ZQGA 5I9TA 1JI0A 4ABTA 1RMYA 2OM2A 1M76A 2QSUA 3RVJA 3WKAA 2JAQA 3WLHA 3ZQKA 3IQZA 2Q5LA 4C4YA 1J00A 2I3ZA 5EIBD 3TLGA 3CCSF 5HY0A 5HCUA 5I7OA 5A1TA 2H8CA 3VPCA 3LC7O 3ZDAA 1V9CA 2OILA 2IYAA 2PVPA 3ABSB 5GZ3A 1J4AA 2PR2A 1ABBA 1YD7A 2VWQA 5B2ZA 1I6WA 4LDJA 3MJHA 4TV9A 4EARA 5CH3A 2BFAA 4PYIA 5ABPA 2X4DA 2RONA 2ZSEA 4PAWA 1A1SA 2B7CA 4JR1A 5SZHB 2CXPA 4U2GA 5AIBA 3TCNA 1KTIA 3D7SA 1ZAYA 5NLLA 3ES9A 3WLQA 5FH9A 1RMTA 3HAXD 2WP0A 1C1XA 3HWWA 3OC6A 1UBCA 2A1TS 3VHXB 4UUBA 3RVMA 1NVXQ 3ROXA 2WMYA 3OUTA 1YQNA 1IHDA 3BMNA 4MJXA 2FN3A 2WG2A 1QQ7A 2YVQA 3WA6A 3IRUA 4G23A 4ISBA 4AT1A 3MHTA 2XW6A 2M6LA 1MX9A 3LO5A 5BV7A 5K0SA 3JD0A 3NHAA 1WAMA 3W8EA 4GYYA 4DB4A 4YROA 1FLAA 3HM2A 3GNTA 3PJDA 3QSYA 1QC5B 1QG0A 2EJTA 3U7JA 5J3JA 4D42A 4ERNA 5CB4B 1QO0A 5EE5B 1CR6A 3KXLA 5ELLA 2DC1A 3T5AA 3DPSA 3I01A 2X76A 4PFKA 1NVBA 4JLWA 2YV5A 3SHQA 3RIHA 5KNCD 4W5OA 1UXJA 1ZK0A 4E08A 1W36D 4JI7B 3MIZA 1L8OA 3R7WB 3UJ8A 2FWJA 2ZITA 5CK4A 5HUHA 1B8UA 3VTKA 1U0JA 4DUGA 2ZATA 4BLVA 1BS1A 1XVTA 2CDCA 3DBHA 2W58A 3NNDA 4WCFA 2INGX 1YVDA 3PLNA 4YMWA 3ODGA 2AMLA 5HZKA 1JHXA 3MG9A 1TRKA 5IBRA 4B0OA 3TB6A 4Q15A 4WKNA 4HC4A 3EVGA 3WRWA 4B75A 3WZLA 4REQB 3R74A 3A6PC 1W94A 4UARA 4TUYA 2Q5OA 2O2YA 5FLKA 4HNTA 3IODA 4YV1A 2Z9BA 5I7RA 1WXEA 1Z2PX 4IHJF 1U8CB 1S2DA 2ZU0C 1YO6A 3RD5A 3A2KA 3WLAA 3BXFA 4CI0B 1N6NA 2ZVJA 4LSMA 1JQEA 2EWWA 4F46A 4L85A 4H7JA 3UC5A 4B2PA 1H5UA 4BGDA 2I7TA 2CFOA 2LBPA 3U9SA 4ZVTA 4ZAZA 1ZNYA 2VRCA 1ZRHA 3GGCA 3HBMA 3ODPA 4F72A 4EFMA 4Q6BA 5L3ZA 3BWXA 1E9FA 3AIMA 2FFJA 2ZP1A 1A71A 4IDPA 1DHTA 4MUYA 3V2IA 1ZW6A 2HCFA 4KQ6A 2H65A 3N2LA 4LXHA 4KVAA 1RYBA 5E6UB 3HEAA 4OI0A 1S8AA 4FYXA 2DULA 1NDQA 1OF1A 5EJ5A 3G2QA 1UFQA 1F9AA 1G66A 4L9WA 2AR9A 2FJUA 2WRZA 2FWIA 3HDJA 5DLDA 5IARA 2UUOA 1E9EA 2I66A 3Q9NA 1FSSA 1VBMA 1QQ5A 2VSXA 3M1IA 4OGGA 2W2LA 3ZS8A 4BNHA 4HQKA 3L18A 1IC6A 3B1KA 5ECWA 3RUIA 1B3RA 1ZICA 3LTEA 4EG8A 1Z2OX 1C3EA 2JCXA 1CQZA 3IP5A 4PXAA 2RK6A 1S1CA 4KKVA 2GPNA 3MUNA 5DNYB 1ZHOA 3G6EF 3U61B 3OPMA 4M46A 4HYEA 4BT3A 3AR6A 3MS7A 2D2FA 2FWMX 2VL7A 3Q7QA 5DRTA 5J4LA 5HJ5A 1YB6A 5IZCA 1U63A 1EBBA 2O8EA 1ST3A 1VP9A 1ZD1A 2RI0A 4BNDA 4NUTA 2W43A 4EATA 2AC7A 1GG8A 1GO1A 5DTQA 3JQ9C 1QOZA 4AAYA 5KNDD 1X0XA 1B76A 2E48A 3LT4A 1X2EA 2WMOB 1YVPA 1NYLA 1XMPA 1R4MA 2ZIXA 4DW8A 4IMPA 4PN7A 1LCIA 3C24A 4LSWA 1QVVA 4ZT3A 2QW8A 3GWZA 5JAOA 2QVCA 2IV2X 1HZJA 2IPNA 5H5JA 3OSUA 5GWXA 4IUCS 3LWVC 1P0IA 4RKEA 3SFZA 1UF9A 2TS1A 4GZLA 2FWAA 3G9QA 2YXLA 3J7AC 3LSYA 5SYAA 1H7MA 1KO7A 1M2GA 2J67A 4I9GA 4Z1MA 1CNEA 1Z38A 3G8DA 5LUAA 1P72A 4KXWA 2J4FA 5EEHA 4DDVA 2PZEA 1ORIA 1N5LA 3BMCA 3BAZA 4DV5B 4OQLA 1QV7A 3OFJA 4YMUA 4NXMB 1GPNA 4RD3A 4B5LA 1KI3A 4BMSA 2C2BA 3MOIA 3CZQA 1DIRA 5KYYB 1DRWA 2UXDB 1CQIA 3PEUA 4JL5A 4LC0A 2RC5A 5HE9A 4Y8VA 2I1VB 1IWPB 3LT2A 1UWLA 2J9RA 4LVCA 1T0JB 4R16A 5SY6A 2BWJA 3U80A 4A7PA 2AN5A 5C1PA 3ROFA 4TRJA 1VJDA 1QOPB 3B3AA 5CNKA 4BC1A 4PAOA 4EVQA 3AY6A 2QM0A 1HE3A 2B7LA 5TT0A 2Y1DA 2FV8A 3LWQC 2FR1A 1VQ1A 3FTFA 1CS4C 4GKVA 1L8QA 5HIKA 3V9PA 2QW0X 1PYGA 2TMYA 2C3OA 3C4QA 3PSAA 3VI4B 1N78A 1TQDA 4OXIA 3EFHA 3WS7A 4LCKA 2P3OA 5C35A 3MWLA 3JASB 2KQUA 3HYLA 4KBYA 4AF8A 3JPYA 1JIQA 1OCEA 4E4TA 1PR3A 1BD3A 3M5DA 4S3MA 4R1QA 5TDHA 5HK9A 2ID8A 1T6NA 2FFHA 3ZQJA 1QRUA 1ORVA 4KLAA 3ZDRA 1PL0A 2IA5A 5LLDA 2WKWA 4NJEB 5DTIA 1ORHA 1Q19A 2A9PA 3WRXC 1EVEA 1SEPA 4WUVA 1UT5A 4FGUA 1KPHA 1CS0B 3V42A 4FFNA 5KTRA 2G67A 3K9WA 2OOSA 5JH7B 5FJJA 1EWVA 4FKZA 1CSEE 1D6NA 3SZGA 3CCLF 2KI5A 4FT4A 4A0FA 5EHXA 1NT4A 1NVTA 2BAGA 2BBWA 2VDUE 1F60A 2Y2UA 3REGA 1MEEA 3IESA 4P0QB 2QZ4A 3PFHA 2JGJA 5G1OA 5DNVA 3CY6A 4LCEA 3GVIA 4UTOA 1E2BA 2MINA 2RSLA 1QIIA 1U3GA 1ISMA 1PFGA 3GD5A 5JC1A 4KOEC 1KVSA 1C0KA 2G6TA 1F2UA 1ZH0A 1Y5RA 4PLYA 1NOIA 3AOGA 2UUCB 2C2HA 4CXMA 3H4IA 1NXTA 1FU4A 1X1EA 4CIVA 2DUNA 2J07A 3PX3A 4IW3B 4LHXA 4GC9A 4RD6A 2H18A 1EFAA 1U4NA 1FRVA 4AJHA 1GA4A 5HP7A 2VPIA 1NRJB 3Q4GA 1FU8A 1T3SA 2P9HA 5JD6A 1CZNA 3PUKA 5ADHA 5IT5A 2P4UA 1UH5A 2NZWA 3KL4A 3E0XA 4MHTA 4LF6B 4PSAA 3R3JA 3KG2A 2Z57A 1SKUA 1ZI6A 5EZQA 2HH9A 4HNAB 1TCBA 5HFAA 2HQSC 1VP3A 3CNOA 3A3NA 4OLJA 4KUGA 4P3XA 2UYHA 1A1VA 2A14A 2JFFA 3W8FA 4TTIA 3OQIA 2ZJ6A 4BX2A 4B3XA 2FQWA 1YE5A 2ZYUX 4RDIA 1DQPA 3M81A 1HL7A 6CHYA 5KWVA 1UOQA 4QQFA 4RPGA 4KU4A 4HVTA 1B3BA 2ISSD 4ERXA 1JLLB 2D2IA 1FYEA 1I2ZA 3ETHA 3K15A 4WBNA 1ZUWA 3GEPA 3INYA 4UBIA 4XQCA 3ZWXA 4JSTA 2HR1A 2X3YA 5KSZA 1PT9A 2VBIA 3LA8A 4LF4B 1UWCA 4YAWA 4RAOA 2QAGB 2IDMA 4DLYA 1GZHB 4BW0B 4NU5A 3T1HB 1WZEA 2B20A 3OPNA 2ZB4A 4U2EA 3TW4A 4JJGA 3TZLA 3PJEA 2H5EA 1Q0QA 4RSMA 4ZO6A 3ZS9A 5IKEA 1KI1A 1R88A 3HV2A 4FM9A 4AM8A 2KBFA 4YWJA 1GR0A 4TQ9A 3AHEA 5BMVB 1DAEA 1L1RA 1NVEA 1NX9A 1U28C 2QP4A 4KFUA 4QEKA 1NW8A 5DLPA 2AOTB 1J9GA 2OSVA 2I4TA 3AF1A 5IVKA 1SA0B 2CXOA 3DFKA 5CH5A 5H4GA 1W87A 3P9SA 4Z54A 1A8UA 1KI7A 5I9LA 5JFTA 3HBFA 2XADA 1NUSA 1YR8A 3T5MA 5ALQA 1QCCA 5F21A 4QPZA 2BTQA 2F8SA 1HDEA 3UXHA 2P6UA 5L7YA 1DDGA 1N25A 2PPVA 3GX1A 3KB1A 3KT0A 3LPAA 4Q18A 4US2R 4R40B 3BOSA 4L15A 3OH8A 1EBFA 1BS9A 1CZLA 3M9LA 4OA8A 3SNKA 3X0DA 3J81A 3QYJA 4NYJR 3LT0A 4G8CA 3TQSA 4A8JC 3OX4A 3BBPA 1W5AA 4A91A 4Q7QA 3HA2A 2DAPA 2QZ9A 3KOXA 2E1RA 4GXRA 1PG5A 2WSIA 3MAGA 3NATA 4MKXA 3F4LA 1U5AA 3I52A 5REQA 1NPDA 4BVQA 4IJ5A 4OO3A 1PSZA 3EXFB 4JBGA 5KTNA 1JA9A 2XCSB 3PR3A 2C8JA 1KVRA 3R09A 1OWMA 4GOKA 4K9RA 3H97A 4JYMA 3VYTC 1XDUA 4TWBA 4ASUD 2VXOA 4TL7A 2IUUA 3N7TA 3EPPA 3WWCA 5BP7A 2DFPA 2GCEA 2A94A 1EVKA 4G36A 2ZYAA 3AJ9A 4P7JA 5FRDA 3CRZA 2RGDA 2OEPA 5IJ9A 1E3EA 2C7QA 2BEWB 2GT1A 5H1YA 2QN8A 4HX2A 1RTKA 1HFKA 3FGNA 4JKIA 3IDAA 5CDUA 2GHTA 3OZFA 1F2DA 3SBEA 2A88A 1R9GA 2CLLB 1OA1A 3FWYA 3G79A 3ZVLA 1GILA 2GAFA 1JN1A 4P4GA 5TRTA 3J81k 4ZA2A 1IBKB 2WB2A 1P5FA 5IAEA 1W5SA 1F5NA 4RFSB 3SY8A 1M1NB 2A9RA 4NPAA 4N3AA 3FWKA 4Y2PA 3A14A 3DEFA 5B7QA 1Y4DE 4LJYA 2VTBA 2Z1FA 2YFHA 2C0PA 1FDTA 4IV0A 3M4NA 4AWBA 2PTGA 1RHUA 2EFJA 4IRXA 3I62A 2NW6A 2P11A 2NZVG 4ZV4A 5HP8A 5EIBC 4EMSA 4MQMA 3GLFB 4YUVA 5CB6A 3BHMA 4FR0A 2YTZA 5A2GA 3QTLA 4BMXA 4DMGA 2I9KA 1OH6A 1FDRA 1UZLA 3BJIC 5AH0A 3MLBA 3CG4A 3B82A 3I9LA 3LP5A 4GT1A 4MYRA 3VNBA 3GL9A 2V96A 3OJLA 3FD5A 1V3QE 4F86A 2R65A 1OU0A 4ND6A 1QYWA 4TMYA 5DH9A 5LNK1 1CQJB 1PZHA 1QU3A 4RLHA 3VO9A 2JIMA 4CEJB 2PLFA 3UMVA 3R0IA 5DGTA 2FWBA 4BQQA 4C88A 1KQ3A 4NPHA 2GEJA 4EI8A 3S99A 4IXTA 3HJFA 4JYAB 3V8NA 3T12A 3SIXA 3AF3A 3ZQ6A 2F64A 4BB6A 3NDBB 1XZ8A 5EN4A 4TVOA 1I9CA 1RBZA 1RPAA 2EZTA 2PEZA 3EAGA 2Q6TA 2ZR8A 3NBFA 1XDBA 2QTTA 2V5UA 4X1IA 3HCBA 3N7UA 4HB2A 4MWCA 2OD2A 3C3KA 3C3CA 4IF6A 3QELB 2A9QA 5ALGA 5SV2A 4OP2A 2VZ9A 3RSOA 1YAJA 3RVPA 5HXZA 2VLBA 5AKJA 3OP1A 3O2QB 3WHPA 4P3KA 3AVTA 2HV8A 2BTOA 1GSIA 3RSCA 1S2IA 2O5RA 5JD3A 3IC5A 3MW8A 5D3QA 1YFZA 4QOFA 3ZLJA 4CM8B 4H3HB 3M1LA 4YP9A 4JLUA 1BWSA 3UJPA 3LCRA 4FCCA 3KWJA 1NKTA 2CNWD 4GOLD 5EQFA 3LWZA 4CMKA 4MGKR 1HV8A 4UM8B 4K28A 2J6CA 4DQDA 3JVIA 2WQ6A 2FOXA 4V24A 5A3RA 3W04A 5G4KA 1WZ2A 4XFDA 1X77A 4ENRA 4DA4A 2I6GA 2VJMB 3I09A 4UQOA 4E6EA 3SQWA 3L6DA 4MRPA 3FH0A 3M6UA 3O3OB 1QYVA 1VB3A 4GR9A 1DKQA 4O4IA 3ENWA 5CVUA 3B48A 2HSGA 2NSLA 4FX2A 5I4BA 1W4AA 3QUCA 1HNZB 4PFQA 1ZIXA 1RADA 3FHOA 4HDRB 3LUAA 3OEHD 1II8A 1VL6A 1Z6QA 1GY8A 1USGA 3O7WA 4IWYA 1JA1A 4IOKA 4WZAB 1SC3A 2CNBA 4ZVKA 4QM6A 1CEXA 3BH7A 3BXZA 4N48A 3G2PA 2A0XA 2JNWA 4HLUC 3TI7A 5EHZA 2W6ZA 2OR3A 2GX6A 1P8JA 2OFPA 3AFIA 3M9WA 4Q1DA 4F3RA 1ZRNA 1TO1E 1YI1A 3AILA 1WXIA 1QSGA 5EUBA 3STWA 4NK5A 5ADVA 1VE5A 4JXKA 5TT1A 2Q3FA 4LXTA 1LK5A 2XSZD 5E1OA 1JIJA 3TGLA 4YRLA 3NWJA 2CNNA 3DV2A 5I9MA 1HT2E 4J29A 3LY5A 3SF8B 4D0SA 3V80A 2RIPA 2Z04A 5LB2A 3W05A 4UE6A 4PYMA 3PQ2A 2I2BA 4BQOA 4HAUA 3M3DA 3TSZA 3HUEA 2QRVA 4IIXA 3EC1A 4IKOA 2RHCA 2H0RA 3GLRA 3Q8KA 1PQUA 4YALA 3I6QA 1YK1A 4QE3A 3WLJA 4XYBA 2P2NA 5DYWA 2ZODA 5K03A 1XRLA 3VPFA 3RRNA 4HN2A 1V6SA 1TD9A 3ANYB 4JQOA 2H1SA 1O08A 4Q03A 4AUKA 1KI9A 4BRWA 1NU8A 1GKYA 3WGMA 3BJRA 2X4IA 1EGQA 4RA6A 3RBAA 3OTIA 3GUHA 3WFIA 3Q7EA 1FCJA 1UM9B 1ZMXA 2WBLC 1Z8HA 3G0IA 1ONNA 5IUNC 1N2HA 1NUQA 4TV8F 1ZVVA 4JELA 4BUZA 2NMUA 3NK6A 5MFZA 2PX4A 1J0EA 4PZAA 3PD7A 1J70A 4C43A 4FN4A 2JAWA 3HB9A 1Y1KE 1WQ3A 2GVDC 2N3ZA 3L7AA 4EZEA 4FQ8A 4P54A 4PZLA 1W85A 1UC9A 2COEA 1XTZA 4AY6A 4M1WA 3NM5A 1YS6A 1Q1BA 3QVJA 1L5ZA 1M6YA 3SDSA 1JDJA 1WXWA 3ROQA 2WM2A 1RYNA 1DUIA 1RE1A 4QTTB 2BKLA 2OAEA 4M1SA 4LSZA 5IM4A 3CFYA 1G8SA 1EEXB 4IFIA 5DYIA 5J5VA 3O1HB 1X8KA 2WE7A 4L8WB 5BSEA 1ZR2A 1N3IA 3E18A 4NRDA 1V41E 3TW8B 4D4JA 4XDHA 2DLCX 5LOVA 3I9JA 3UM9A 1YBFA 2DFLA 3O5AA 2D1YA 3R3SA 3NNSA 3WAJA 4Z4GA 2ROQA 2PNFA 1P9NA 1XL1A 2XT6A 2UZAA 5A9RA 3EZLA 4O0LA 4Q3BA 3ZCQA 4X60A 5BYKA 4RNCA 1XMVA 4YMIA 5AM0A 2F3PA 2FZEA 3VR6A 3HWRA 4M87A 3DL2A 4H18A 1WDWB 1Y5IA 3TAHA 3DZKA 3ITKA 3TD5A 4PGHA 4DC1A 2BHNA 1VC2A 2X9VA 1SHUX 5DGCA 3RT7A 3EQ9A 1GRNA 1XF9A 5BORA 3BXOA 3R6LA 3QNUA 2V3VA 4MKGA 1N2ZA 4KV7A 4J91A 2IELA 2F1RA 2VUHB 2D5CA 1U8UA 1WUIS 2WJYA 5F3RA 5BOSB 1KFCB 2ID7A 9ATCA 1J8VA 2ZKIA 1SUSA 3KT8A 3WMXA 4D4GA 3NFYA 2W4MA 4X66B 1AUPA 3H4MA 3QEOA 3H87A 3PF8A 2XAUA 4Q9LA 1Z18A 4OVKA 4EHBA 2VJLA 1SC6A 3NH6A 2ZBUA 3ZE6A 5KWJA 5LQSA 2IY8A 4UASA 3IPAA 3JYPA 4RPHA 4C5CA 4O2AA 3CUEF 1A2KC 1MPTA 2DWCA 1RHJA 2DFNA 4AJ2A 1Q83A 3BGOS 3P2JA 3GFPA 2GN2A 4HFJA 1DTWB 5A5VA 1Z5VA 1MB2A 1G59A 1ELOA 1ZNQO 3IOYA 3M34A 3D6NB 3NORA 4K6CA 1EZZA 1LNSA 2HRUA 1X1AA 2FQXA 2NPIA 2GO7A 3LBAA 4MCHA 3T0GA 3CPWF 4L5JA 4BNJA 4C89A 3MCAB 1UP4A 2JJ8A 1H8EA 3U3OA 5EFOA 4Y0NA 5GV7A 3WIOA 1L7VC 3URKA 4E1BA 2I3BA 3EPHA 1B0PA 1ODTC 1VL8A 1SK9A 1UPFA 3DQQA 2ACWA 4GPIB 2BF7A 2R7LA 5J2UF 1RWWA 5AYVA 1QVGF 3TINA 3P5SA 2XMBA 1HNNA 1DUSA 2G0AA 3CO0S 5B58T 5JDCC 2GJ8A 4EF4A 4ENSA 2ZBVA 3D8NA 1Q92A 3ORYA 1V96A 4KQCA 3W7AA 1J20A 3IUJA 3FFXA 2FX2A 3I01M 4PFSA 1CRQA 1LPPA 2RC6A 4HN4B 5CYOA 3PJGA 3WK4A 4MWZA 4TOIA 3IBTA 5CA1B 2BHTA 4GKAA 1G21B 1O94A 3IE2A 3V4ZA 4KQMA 1ENOA 4A2CA 2GF9A 3D00A 2O2IA 3QEKA 3EH2A 3THWA 2ZWAA 4JX8A 5DDIP 1X14A 3FFBA 5THKA 1MQ9A 2V0CA 2XNDA 1IV1A 4IKEA 1HZZC 3I30X 4J1TC 5K8VA 3CQ9A 2R68A 4HG2A 3VAAA 3RYFB 1USKA 3HBJA 3C41J 3DF7A 4L72A 1L9XA 1YB7A 4FJ0A 3DZHA 4KXNA 4AZ0A 1Z2CA 3EGXB 3LHKA 3VJLA 3WB0A 2WQ7A 2HPHA 1E1RA 3I1YA 5LU9A 2HRBA 1VQ6F 5FI0B 5CDHA 1KBOA 3I2FA 8MHTA 1N7HA 1KO5A 3C3PA 4OHCA 4V0RA 3V8QA 1UDBA 4D4HA 5ISMA 4UVIA 3EXEB 2G8LA 4JMPA 1CVRA 2B1JA 5CM9C 4YPOA 1KMMA 2ZJ0A 4OQFA 4CIDA 1GM5A 3GVCA 3K31A 3P96A 3TFWA 2IEDA 2ZAMA 1C30B 2OUIA 2PL9A 1G98A 2WHQA 3QE4A 1P9LA 4N40A 4PIVA 4BNLA 5DWVA 3NUZA 4ZOLA 1IBMB 4OHRA 3RVSA 2IS4A 3AR9A 4WCVA 1T35A 2FPWA 4Z9YA 3T52A 3WGNA 4WXYB 4CFSA 1OWNA 3KZ1E 4ZODA 5BURA 3IKMB 2HADA 3QXCA 3UA4A 2BKVA 5EMJA 4W5NA 3OQ6A 2V55B 1XAHA 3VNAA 4MQFA 4QPNA 3TRHA 1SUIA 4HGPA 5AW4A 2D5AA 3KDPA 2K1SA 1P29A 5DBHX 2X0EA 3T1VA 4JB2A 2JAHA 4ML3A 4YJHA 2P0AA 3HFRA 4FI3F 4HRXA 4BC0A 6ABPA 2WVHA 1BJTA 4J03A 3TLXA 1CF2O 4C4PA 5D1NA 2FEMA 4Q9KA 3JRNA 2B0CA 3ONFA 1WBJB 1CQXA 4HWRA 5FTLA 2VHJA 4BCCA 1T4MA 2P77A 5KVSA 1M8KA 2RHLA 3O85A 3CX7A 4DMRA 1MOQA 4YJ3F 2HDNB 1GLGA 4H4CA 4PX3A 1JPUA 1KSJA 4HLDA 3ANNA 2PT5A 2GCNA 1S2OA 1OFIA 3D6TB 3LLCA 3N8IA 1JDNA 2P9CA 4RH3A 4PWTA 1U0EA 2AG1A 2CFIA 2WJVA 1P73A 1ACJA 2R47A 3HV0A 3TB4A 2VUIB 2D4AA 4H31A 3GDOA 2C78A 3Q8XB 1VJRA 4TLCA 4XIJA 3IEMA 3THXB 2LD4A 3HL4A 3IBSA 1PX0A 5I7SA 4WPGA 3KHNA 1FPMA 1C3OA 1G2OA 1KJ8A 3MDOA 2BC9A 2LP4Y 2HUPA 2I67A 2R1UA 2R8OA 2Z2YA 3TSYA 3V34A 3ZLTA 1RACA 1H93A 2EFCB 2PJRA 4KWTA 1Z7GA 1KNKA 4X84A 3HPQA 3ZU2A 1AJEA 1I2CA 4AW9A 1BQ4A 4ZAFA 2WYVA 2RCNA 5E6RB 3L8ZA 2OYSA 4D9MA 2E89A 2EJBA 2V7VA 2ZYGA 2V5AA 2R8RA 2Y0PA 3MYRA 3LMKA 3UXEA 2GRAA 5C8YB 1G5IA 3SVZA 1ECBA 1BZYA 3GFBA 5LQUA 5LYJA 3TEFA 2EERA 3BTVA 2P3SA 3X43A 3PDIA 1FLDA 1DI0A 1GOTA 5T41A 2GEBA 3W4KA 3VKGA 1SU8A 3K2IA 4IFTA 3FZGA 3MBOA 4ND3A 4ALIA 4DWJA 1B00A 1QK3A 2AN1A 2RARA 3ZR4B 3R44A 4WNAA 1P0MA 4KPUA 4N1AA 1UMDA 2JJ1A 2Q6OA 4RD0A 3V7UA 5HSGA 1NWCA 2AW3A 1UK7A 3V55A 3ET5A 1QFXA 4GLBA 1OVMA 3EN0A 4BFCA 5AW0A 1PBNA 1GYRA 2H85A 1I6KA 2MJLA 2VQFB 2F4NA 3HCPA 4YCSA 1MU0A 2I54A 3Q3EA 2IT1A 4ZHWA 3L3BA 4JIGA 2HK7A 3RWMB 4WK0B 2YW9A 4CG0A 2G4VA 1TXGA 3QUWA 2GESA 1ZL2A 2HI0A 3JX9A 4XUDA 4NBWA 1UZAA 4CCSA 3EASA 4CT0A 1CUUA 1AN9A 5B2FA 1QB8A 2ZWVA 3K5IA 4R7ZA 1OI2A 5SYMA 5B55A 1GV1A 4B62A 3VHQA 3L8FA 2DHRA 4PS1A 2Z4SA 3L4BC 4MRMB 2OB1A 2V7PA 5CLGA 3P32A 3ROZA 2YNMA 4ADSG 1N0IA 1KAQA 1J8YF 5KX5A 1QJ4A 1JL3A 2G1UA 4R2LA 2EIXA 3Q2OA 4NE7A 2Z5GA 2B2NA 3GQBB 3GLHB 4LECA 3UTDA 1BEEA 4CM9D 1J2JA 2FK7A 3C3EA 2QL7A 3T9DA 3ORHA 1OT5A 3GPDG 4AU1A 4YDSA 4KR7A 2NUAB 4CL0A 5AJXA 4MYUA 4CM1A 3FNRA 3DE6X 4ZMRA 3AF2A 1IZZA 1IHXA 1LS6A 2E55A 4WSOA 4MS4A 4ZOAA 4DBLC 2UZ1A 1PWYE 1I0IA 2WWFA 3E7XA 4ZQEA 1P1FA 3E2PA 3MTAA 4H15A 4PPQA 2AKYA 3TR5A 4Q16A 3JYOA 4BVJA 3DOHA 2PGOA 1RYYA 2ETVA 3FHCB 1EJ0A 1JDTA 3GFQA 3UW1A 1Y7LA 1PDVA 3FPIA 2Q1WA 5E95A 4EYGA 2D7JA 3JATA 1DB3A 1ZZGA 3ELBA 3L8MA 3FB4A 4C03A 4XQ9A 5F73A 3AG6A 1PHRA 1Z4OA 5BT8A 1EXMA 3PR2B 5CW2A 1T3HA 4LJRA 2EXXA 3FSEA 3CW2A 3EIUA 3LBYA 3RRYA 4OBEA 2OV3A 5FL7A 4OY3A 1JNYA 3N53A 2Y71A 4FWIB 4R05A 4BVBA 1QHXA 1ZRSA 3S81A 4BX0A 4NBNA 4PQFA 1ZMRA 2CHUA 1JMVA 1XTJA 2A9VA 3CV3A 2Q3HA 1E5XA 1NUTA 4M54A 1FS6A 2RGNC 5M7EA 2W2LD 4MR7A 4EEKA 4I5FA 1CXZA 1PO7A 1REQA 2FR0A 4IDNA 4NNJA 4HQ6A 3ZE9A 1F4PA 1EK1A 1UWKA 1T3TA 4WGFA 3ISTA 2HF8A 3H5AA 4M76B 4Z4EA 3S3TA 2OCBA 4UAUA 5CYFA 3SF8A 3U3DA 4PO8A 3L0YA 4IINA 2J6IA 3EK2A 4PPYA 1V3UA 3CVWA 1XU9A 4DG8A 4LC9A 4FE3A 2PPLA 1OFGA 1X1BA 1E69A 2C8VA 4K0KB 5T7BA 5A0VA 4LGCA 1A8QA 3SIVA 1X8LA 4KQEA 3QOYA 1WQ1R 1BRTA 1VIMA 4Q7MB 4F2GA 5IFLA 1R66A 3I72A 4W82A 2G63A 1ENZA 3PHJA 1WDKA 5CB8A 2OMKA 2CCJA 2IPMA 3C7TA 2B35A 4K9OA 1I30A 1JF8A 3EGEA 3AVOA 3D8UA 1IN7A 4HPWA 5EESA 3V1LA 1V8ZA 3FPFA 3ZIUA 4JBIA 4KMMA 4PYQA 3J81M 3KYJB 3V2UA 2XLBA 4BP8A 3H5TA 4QUDA 4E03A 1HR0B 4CTKA 4KVGA 2Y92A 1WOYA 4NHEA 3S28A 5HHTA 1RI2A 4HQNA 1L4LA 1N9ZA 3VOSA 2OORC 5L3SB 4FMCB 2RH4A 2XQFA 3GYQA 5B3KA 3NGLA 4V0NA 4EL5A 2PRIA 2QE6A 3DBRB 3HDTA 1MO2A 5E3JA 3QUSA 4PSVA 4PRLA 4UAVA 5T64A 5I6DA 3QW4B 4XLZA 2WAMA 3ULKA 2JI7A 2DFDA 1N0VC 3DNFA 3I5UA 3KHSA 1BWQA 4G4JA 1IUOA 1GR1A 5LJIA 5LP6F 1EUQA 2HPZA 1XHEA 1H2EA 2ZBDA 5AVKA 5HS4A 3ZY5A 3D6FA 3O4RA 4I55B 4TTPA 1P6UA 3EWNA 3AJ8A 4INAA 4EOGA 5D51S 4RK5A 2GJSA 1BW9A 4YVFA 1JHZA 4G09A 4KOAA 4JR2A 4M0PA 3ZWNA 2QTMA 3B36A 5EMHA 3JQFC 5AR1A 3GOHA 3CG6A 3LHIA 1U2QA 3BPSA 3UK7A 4ACBA 1M2HA 1RWOA 1ZESA 4GBMA 4HMPA 3GA0A 3OECA 3IILA 3SIPA 5A5GA 3CSUA 1XCBA 2P4SA 3BH6A 4EGCB 5IW8A 4BO2A 3H0KA 4AJEA 5HXUA 2OBXA 1GZVA 4RPJA 5AVOA 1O87A 4BHTA 1GRQA 1TEHA 3F0GA 2D1RA 2R5NA 2OLEA 2JFUA 4EMUA 1V25A 4N39A 4FBGA 1LTQA 1SOMA 5CBPA 1ZN8A 2AX3A 2PIAA 1VHAA 3D6MA 4OATA 4UM9B 3R3HA 2J4DA 3O2SB 4ED9A 1ATZA 1QLJA 3WGZA 1TL7C 3GBVA 3IAM1 3OTWA 3UMFA 5CFQA 4BWYA 4OXRA 2NNLD 3KL2A 4IRUB 2ENUA 4JUAA 1GVNB 4KQKA 1JJ2F 5FHRA 1GNSA 3EIHA 3ZGLA 1GL9B 4P36A 1I5EA 4KE8A 3FPJA 4AXXA 1EUCB 2FMKA 3QFSA 1DQYA 1RE0A 3ND8A 4CBVA 1OX5A 4KHZA 1JSZA 2PGJA 2WOOA 1GAXA 3C8LA 1T4CA 3QKIA 5GOZA 1Q7YH 3JQBA 4I66A 3E8XA 1UMKA 3UTCA 4GDFA 4I36A 2DPLA 4FC7A 2HS0A 1KD1H 3A2LA 1B2RA 1YRAA 2ZTHA 3EGCA 3LX6A 4RENA 2A9OA 2C0QA 2JL1A 4IMIB 3CPHA 3KAKA 1RWPA 4MYSA 2VJPA 3AGKA 1RTTA 2C9BA 3CX8A 4IJKA 3SSOA 4CM7A 1VYTA 4E33A 2XUJA 4HAZA 2P9QA 4K05A 1HX7A 1OXSC 2QWXA 3HS3A 3MOGA 4RWEA 4U3JA 2B0JA 4WN9B 5EP1A 3OA2A 5EWJB 3RM3A 4DPMA 4E0BA 4F4CA 1S2GA 5HX7A 1GD1O 4X8OA 4P5PA 1FJGB 5DXJA 4H0FA 3SKXA 2FKAA 1IZ7A 4FDUA 5ULLA 4ZIRB 1XZLA 3NOQA 5AKKA 4IHJA 1PJRA 3PC3A 2Q7DA 1F7UA 2E18A 1Y8CA 2CFSA 2CYBA 2HYDA 1QK5A 3JQAA 4A0HA 2ACEA 4F4UA 5IFKA 4M38A 2ET6A 2LCQA 1FNKA 4GFDA 5G3ZA 1J90A 2DTXA 4XVRA 5DHRA 2GNPA 3LBIA 2NO1A 2PD4A 3H0CA 4F21A 3SEZA 1IDN1 1V7QA 5H16A 1Z13A 1QMGA 4PR3A 1JHAA 3I45A 4XAQA 4F5EA 4K9QA 1FSFA 5MGBA 1DQRA 1MUUA 1HI9A 2BGMA 2QNBA 2VHEA 3QXJA 4ZXFA 2DHCA 4GI5A 4M21A 4CFYA 4DR2B 1D8AA 3EQ2A 4LK2A 3VTIC 2O9JA 1U4OA 2ARKA 2RBKA 5I7HA 2W2OA 1Q0TA 3FPGA 4TT3A 3ZJ5A 1DEXA 3B52X 4FIDA 3C6KA 1SB8A 5KOHA 2QIPA 2VQEB 1KBQA 3FGPA 5FQOA 4YRSA 3GXOA 5IJAA 3H5WA 3W1EA 1U0LA 3CUKA 3NTRA 4F85A 5IG2A 1MXHA 3RSFA 2UVQA 1QP7A 4I08A 4Z86A 4LHZA 5EUMA 5H83A 1HXHA 3E9QA 4ZJUA 4D41A 5CJJA 4DJTA 1WOMA 3CWCA 4V0KA 1MOPA 1T5OA 2CUZA 2W6QA 2XWQA 5CAEB 1FP1D 4HSGA 1RAFA 5GINE 2BP7A 4FW8A 1DDOA 1SO8A 5HGJA 2P68A 1SY7A 4I3HA 2H4YA 1RRMA 4NZPA 4HNGA 3ICEA 3KWFA 1UL1X 3VAYA 2XMDA 2XZPA 1ZYUA 1F17A 2O3RA 3QBDA 4J76A 4ND5A 3CMAF 1JY8A 1LZLA 1ORDA 2X4GA 4B6FA 4K1LA 2ZT6A 3HXTA 3D3KA 3TTUA 1NJFA 3EMBA 3IT2A 2W2TA 3EIQA 4QREA 1R4AA 3L6UA 2B1QA 1QYDA 3FMIA 3VC3A 5AVYA 3WLKX 4IDGA 2CLDX 3W9SA 1O8CA 1RZRD 1C0LA 2LE0A 1EFHA 4IIJF 4R2MA 1X38A 2ONCA 5CLHA 3S40A 1NFRA 1V5EA 3WLIA 5WRFA 3LV8A 2WF9A 1Z4NA 4G0PA 2VXBA 4MUAA 5CB0A 3LY9A 3DLPX 1VQ4F 5CEJA 4HH1A 3VHRA 4US1R 2YL2A 4TYPA 4BP1A 5CTAA 4WNCA 4I4IA 1XWIA 1DC4A 2ICAA 2PZKA 2EKQA 5J47A 4H77A 1KQNA 1FMLA 4XWYA 1P1JA 5FA5A 4AIIA 3QVLA 1U11A 2QN3A 3NHUA 1VPEA 1MT3A 2EFYA 3BXEA 3KPVA 1O1YA 3L0CA 2RHOA 3CN7A 2VCHA 4JKYA 4LJAA 5FWAA 1A8SA 4E4RA 2WNHA 1LFDB 4Q4JB 1HFWA 1R12A 2OT3B 1E6WA 3C1TA 4R3WA 1MW8X 3VDNB 5J1SB 4W63A 1T5BA 3R6DA 1YA6A 5ITZA 2ZROA 4EHIA 4F9FA 1XKTA 3A9WA 4O1MA 4OUDA 1Y7TA 3AKZA 4CLDA 4OU4A 4KZPA 2DX7A 4U2DA 3VX4A 3HDQA 4YRGA 2YXBA 4PXSA 5JZBA 4IJMA 4OXQA 1N6OA 2AOXA 4NJOA 3TIIA 2FYTA 3MCZA 1NC3A 2RMKA 4PVDA 4IVNA 4MLCA 3ZW7A 4ZZIA 1QHHB 1JKXA 2FPXA 1KC3A 2W00A 1N8KA 2ZE6A 3A32A 3LW8A 2VHTA 1WX1A 3KSZO 3KYDB 2PKXA 1G20E 3QE3A 4ZZ2A 2J41A 3BAFA 3C15C 4HWKA 4JU8A 4NZNA 5F7JA 4A2WA 4D7AA 2X9NA 5AVQA 3PFGA 2VI5A 3D02A 1F8UA 3L6CA 4P22A 1T13A 4WEOA 2GAIA 3UJ7A 4TYNA 3ROEA 1LSUA 2H5LA 3RPEA 5D5QA 1Q7BA 1Q12A 3WZMA 4YRMA 3PYLA 2H9YA 2J32A 3K09C 2HU8A 4F5DA 2ODBA 2XUAA 4MW6A 4BUCA 4G9GA 1PJQA 4MQEA 1U2RA 3AT1A 3RRJA 3WB2A 2FPIB 3QLVC 1CY0A 3WLPA 5BPHA 3GMSA 4CKBA 4F3NA 1T2UA 3QVMA 4QRHA 3RKSA 3AUUA 2Z6QA 1EGHA 4OX9Y 4W4TA 1E2MA 3MTDA 5BSRA 2WMNB 3SS8A 1TM4E 4EY7A 1OPXA 1LBEA 3MD9A 4L16A 1C0EA 2W6MA 5F23A 3LVRE 4AX4A 2IYRA 4UTZA 4YK7A 5HQJA 1NPYA 2XB9A 2MSNA 1FRNA 1B6GA 4CMEA 3U60B 1TA9A 2VK4A 1FA9A 1Y6ZA 2IU6A 4L78A 4A1FA 3QVVA 5JNRA 1OXBB 2PCJA 1TF7A 3RNOA 1TKBA 3MQ4A 3I3SR 4AZWA 1I01A 3H86A 1KVQA 3LOQA 1FNDA 3ER6A 2ZRBA 2YHAA 3FCEA 3KLMX 4ES6A 4YO7A 4CKCB 3O8OB 2Z5VA 1VE1A 2IZ1A 2YX1A 3IIEA 4K88A 2PT7A 4KNWA 2A78A 4JI8B 1P7WA 3G2LA 2YJ5A 3BKXA 5E9JA 5CIQA 1NBHA 2IDKA 1Z6TA 3MM4A 5DSZA 5MFPA 3INRA 1GSOA 1NI4A 2VDPB 2XVZA 3FVRA 4MNTA 4QVGA 1XNQB 2I6RA 5AJYA 2MDTA 1ETHA 2R8XA 4BY9D 2J46A 5L3QA 5EAZA 4IBOA 4MV9A 3KAJA 3OIDA 2BT4A 3H2JA 5DRYA 4KIJA 3ENKA 1BDMA 2MSLA 4INOA 4BO1A 5A4AA 1PJZA 2FW1A 3CZMA 2Q4OA 2XB6A 2G72A 3B12A 1IXKA 1Z82A 3HR8A 2J3LA 2WWTA 1G1MA 4MITA 3TR0A 2F3SA 3AEYA 1PDOA 1WUHS 1J7JA 1GA6A 3VI6A 1N2CA 2FWPA 2JCSA 4Z5XA 1YJNF 1CDDA 2YRFA 1Q15A 3M3PA 2Q28A 2VGNA 4CM4A 4DG9A 4RJIA 3RG8A 2QUIA 1CDOA 5DTEA 2VZ8A 4JL6A 4RY0A 1X15A 1VPVA 5G0VA 1MT0A 2MR6A 3RAPR 3KQUA 1GU7A 1RXSA 1OGJA 2IZ5A 4FZJA 3KQSA 1MIHA 1NQ3A 2CXXA 2JDID 3O8DA 3OIWA 2Q3BA 4C05A 4D02A 3V3KA 3QY0A 1M2EA 3BHNA 5E3IA 3D6JA 3EUAA 1CVIA 5F33A 4W5WA 1NVWQ 1KMNA 3ZE0B 4EJMA 1YQ9A 4MAFA 5I4CA 3ENNA 4CL3A 1E4VA 1G3UA 2R6GA 4HL6A 2IE0A 2VJBA 5ARDA 1OWLA 1Z9BA 4O3FA 3PGLA 2HTFA 4B87A 2Q3JA 1OLXB 1VGVA 4M0MA 1QS0A 4DMFA 1ST2A 3L2OB 1GYPA 1SVKA 2QRPA 2J85A 2VUTA 2CXNA 5C7YA 2A67A 2WM8A 2F43B 4CU2A 2HRCA 1P3DA 2R9VA 1XRJA 1KRWA 5AOBA 1VZ3A 3K35A 5UKDA 3EVCA 1B7GO 4DRYA 1PZNA 4GP6A 3FNHA 1BVRA 2DSTA 4JB3A 4X71A 2P2LA 3AXTA 1IBSA 3IA2A 4D0NA 2JS7A 3RT1A 2YRWA 4FHFA 1P4HA 4HQOA 2Y8EA 2FEPA 3GRYA 1V1RA 1E1CB 4NNPA 5D3MB 4GOXA 1BGXT 4R9UC 3AU8A 3CW8X 2PYDA 1U7OA 1PUXA 2PBFA 1Y7IA 1ZFNA 2AYYA 1KETA 1E0DA 1TMGE 1ISFA 4L5CA 2F90A 2J30A 3UGQA 3KJJA 4PBRA 1PF7E 3ZWYA 2O8FB 3GUYA 4B48A 2XCLA 2JFYA 4JCCA 5EHNA 5FI1B 1E3IA 3U31A 4DLLA 1LB1B 2IHTA 4D3DA 1N5MA 5HPYB 1Q7TA 2C61A 2VGMA 1YJXA 2JFWA 1OX4B 2HLHA 2WSMA 4GKKB 3W5CA 1GKLA 3E3NA 4W7SA 3DV0A 4LJ6A 1H9BA 3WBFA 1H22A 4UNIA 4D9CA 3X2EA 4EPYA 5BQXA 3CRQA 3H9UA 1KJZA 2MYTA 2VK1A 3L5OA 4EDFA 2P5YA 4CMJA 1K5HA 4Q3AA 2I76A 3FSRA 3IDSA 3N2GA 1NV8A 1WULS 4P83A 4F4JA 4RQTA 3TYXA 3QHDA 2GPTA 4O4LF 5EZYF 4ZTUB 4AECA 1KDTA 2VYVA 3GAFA 1PTKA 3NM6B 1JHQA 1Z0DA 1ZN2A 4M7PA 4XUCA 4H7EA 4BNXA 3M49A 1TYAE 3F6SA 4CHGA 4FDMA 4MW2A 3GT4A 5JQWA 2FLKA 3ESJA 1XQ6A 2I87A 4I81A 3IDQA 5EEGA 3IKEA 2JIBA 2ZS9A 3C6ZA 4P0TA 1GAEO 2HX1A 3MN1A 4RSHA 4BIMA 2XVAA 3RJZA 4OFXA 1FU7A 5MDHA 1U5CA 4NBTA 2A9JA 4WK6A 4HWOA 5HP4A 4TMVA 4HX5A 4LQ4A 4BKPA 1MTOA 1SJ9A 2YS7A 3I2HA 3RHFA 1TUBB 1RBMA 4HKTA 4COOA 1O77A 3K6KA 2Y1KA 3CZ9A 4MRAA 2QG9A 1FL9A 1NSTA 3NOOA 5I4KA 3ON1A 3COWA 3FROA 3HP1A 4CLHA 1Q0PA 2AUMA 3DHNA 1Z15A 1SCBA 3L6BA 1D7OA 1F0PA 4WXEA 5CTJA 2HPVA 4I9UA 4M22A 4KKXB 2FOIA 5BQPA 1ZCFA 3IBYA 5LWQA 3TJRA 4JZKA 4CLOA 3M6LA 3DEYX 4OJMX 2JLYA 1OT3A 1YDGA 1LD3A 1EG2A 1WHTB 1PF5A 1P45A 2O8DB 3WYDA 1EH5A 4EKGA 3OONA 1KK2A 3W7BA 2VH2A 2YY6A 3KV3O 2GCIA 2RKWA 1IAVA 1OREA 2PSDA 2CFRA 3GMDA 4FXPA 4CV1A 4E5UA 1T1RA 4LXYA 1CUZA 3P19A 3F2VA 1WB5A 3I2KA 4NCAA 3PRKE 4FE4A 1GPWB 2GCOB 2NZ8A 3TE6A 5F1PA 5JCZA 2LRHA 1KAMA 4E70A 3E9ZA 2M32A 2G1KA 2G83A 1G7RA 1T4DA 3GZNA 1COMA 1TO6A 3P94A 5JAQA 3S8MA 2VA9A 2CNKA 1WO8A 4B2YA 2PMCA 1EX9A 1RHMA 3ELDA 1YZ3A 4L4YA 4X54A 1G2QA 2GYUA 4P34A 4X7BA 3RRBA 3KK0A 3VO8A 1X1CA 4GOMD 4D2IA 4F8JA 4QYXA 4F11A 3ZWWA 4RO0A 4XEUA 1ZVQA 2PGDA 1GDDA 1NKSA 2G82A 3AINA 5KNCH 1I94B 3BK2A 4BDTA 2CEKA 4UDXX 4Y0AA 2O20A 5CHYA 4ZCLA 4U39A 5B3AA 4GXQA 4RF2A 3RVOA 2VDVE 1QZTA 1EZ4A 3N9IA 2HF9A 4Y1FA 1KEVA 3HO1A 3S8EA 3OCCA 5EKUA 1KDYA 2JGMA 3DHEA 1J2UA 2C54A 2CLSA 2P65A 3KPUA 2Q0HA 2L19A 4TT8A 4V0LA 5CM8B 4CQLA 2YWJA 3Q98A 4JROA 1W29A 2D62A 4NENB 3UOWA 2ECOA 4GE3A 1UBKS 1PFWA 5LQCA 3A26A 3E8SA 2DR3A 3ISVA 2B33A 1USIA 4TWZA 1UJ5A 2NADA 3C5CA 3ACBA 4UU7A 3HSSA 3NHYA 2QTFA 4R01A 4Y6LA 5JAIA 1IV4A 1L4YA 3D7RA 4KTVE 3P9PA 1F12A 1S8OA 2PXCA 2FR8C 4MW0A 5BN3B 1OTYA 2IUSA 1JSXA 5JLAA 3G7UA 3SJZA 2GZHA 2CBZA 1NAHA 3AR8A 3K0BA 3PGKA 1XNHA 2PGAA 1KFKB 4EYOA 2PUAA 3IV9A 2DM6A 1XNJA 5I5GA 2OGWA 3DBOB 3KSUA 3H1FA 4ID3A 3Q8WA 2F55A 2WK1A 2P5TB 1B43A 1LJLA 2DBYA 2FLWA 3QKTA 5FWNA 4G1EB 1BS2A 4D9BA 2QT1A 3N76A 4IWNA 3HCAA 4W5TA 3V8PA 1U8AA 1UFYA 1T36B 5GZ1A 1U2SA 2VPXA 2JFXA 3NVDA 2HVYD 5DU2A 3S03A 5TPWA 4W9NA 5DM1A 2HNAA 2OO3A 5EUCA 1E61A 4TV8A 5EPOA 2AMFA 2YJGA 5JW6A 2NSYA 3LSTA 4ARZB 2GPYA 4MWTA 4Y1RB 2PGNA 1A69A 3L7JA 4CMCA 5KWEA 1YR2A 3FTEA 3UHJA 3A04A 6REQA 3RSQA 5A1JA 4AN4A 4C01A 2PZBA 3OT4A 2VAXA 3AF4A 5JNTA 2ZYSA 3T61A 2PSFA 2C4MA 4AX8A 4B6OA 1HKUA 1HYBA 5DX0A 3N70A 2IKSA 4Y2HA 2FY8A 3T4UA 4RSGA 1SXJD 3FCXA 5K8UA 4U9HS 3RC3A 3UCFA 1BCRA 3G8BA 3H9EO 1KI8A 3U3KA 1E3WA 3FCAA 4OQDA 1AY0A 3RR2A 2QD3A 2MSEB 4BPRA 4GW3A 1V7CA 3BFKA 3H2ZA 3ONEA 3O8RA 5KNDH 1ACLA 3IMEA 1U3LA 1NXWA 1UFOA 3WSVA 4I7EA 1P4JA 1I4TD 3U4MA 3CLRC 3QVSA 5DYNA 1DMSA 2J5XA 3PZBA 1OHHD 2JKYA 4I5DA 2PA3A 3RFVA 2IYVA 4P4NA 3S27A 2IYSA 2J33A 2WHPA 1NVDA 3LUGA 1IIRA 1R74A 2EHDA 3CLUD 5CVVA 3KEMA 1YB4A 5G1NA 1WR8A 4C0XA 3QUAA 2MCFA 2XQKA 4A73A 1UBOS 2C4WA 3NYIA 4GZMA 1ORRA 1U9IA 3F9CA 4J7XA 2HMTA 4HV4A 4N18A 5K3SA 3ZEIA 4L3VA 4AP9A 1ITZA 2AE1A 1FYFA 4WBXC 3AR7A 1DP4A 3CPQA 1LPNA 4Z4CA 5KCMA 1IXZA 2XTNA 4ILKA 3U62A 2XOEA 2AK2A 2QTAA 1HF3A 4CPDA 1PR4A 4WOCA 3WLEA 4XQGA 4LYHA 1OASA 4HEQA 1EUDB 4H27A 3DZDA 2CHVA 2PN1A 3HXQA 4GVXA 1VBKA 2CZWA 1ZD9A 4EPTA 3QPUA 3TQIA 1L7AA 2HXYA 2Q8QA 2XXBA 2YZKA 5DX8A 1RM0A 2H31A 3ZN2A 1Z0ZA 5EJIA 1MVNA 3VISA 1WA5A 5H68A 3G8YA 3KQPA 4GWLA 5JBIA 3R7NA 3TX2A 1ABEA 1ZXLA 2Q1UA 4HTFA 3ZHOA 4DOMA 5BV8A 5F52A 4L9RA 2HSZA 1OH5A 4GNKA 4YYZA 2C94A 1COWD 1JFTA 1GRRA 1H3NA 2J59A 3R76A 5J2UA 3CXRA 3D0KA 1GKUB 1TC2A 2O0MA 3HUFA 4CF7A 2ZRMA 1IPFA 3H84A 4KWCA 4B2LA 4Y7DA 4YLYA 4X1KA 4CGYA 1SRQA 1JZTA 1CIVA 1X92A 1IY9A 1PJ4A 1QIEA 1C4XA 2QL5A 2XMQA 3TNYA 1K5GA 1HOTA 1RPJA 2PANA 1ZD5A 4H7PA 4AQDA 4M3NA 4O2LA 4BOYA 3UCXA 1JILA 3EQZA 5FPSA 4E13A 3F96A 3WA7A 1M1KH 2V6BA 3DE5X 5JSHA 2ZUSA 3AR5A 3E82A 2V45A 3CKKA 4KBFA 4MS3B 4F45A 1QPBA 2ABWA 4F9GA 1HKHA 3O0TA 1IY0A 2H1IA 5LXTB 2H9IA 2Q41A 4II7A 3H18A 4F8YA 3D6AA 2Z8YA 4BQRA 4OMFG 4PNHA 3S7ZA 3F8SA 4YLEA 4AO7A 1FW8A 5IHPA 1IQUA 1BMDA 4RL4A 5KPDA 3OZVA 2O14A 4LX0A 5U1PA 4I8DA 1WHSB 5DM60 3QPWA 2D4HA 3QIVA 4QFBA 2NU8B 4AMUA 4J43A 4S1OA 1U3FA 1JJAA 3IQHX 3IJEB 3VPAA 5JHHB 3AI2A 3ND9A 2JFGA 2H9AA 2NN3C 5FQNA 3RUFA 4ZVVA 3K8YA 1TM7E 2XPCA 3ZVKA 1QP8A 1A5BB 3CHYA 3JRWA 3Q87B 3O74A 1IAQA 2XAAA 4YBZA 3WWEA 2CNOA 3QA3E 1VCOA 1M67A 1NNUA 3PPYA 3E5HA 1YB2A 2RGXA 1EFPB 1ZEMA 2VT6A 3L41A 4JBHA 1CKEA 3L0SA 5KSWB 3AESB 1DAOA 3I6YA 2H1CA 3S2SA 1ZVKA 1G2PA 2DERA 3HVUA 4MCJA 1KYXA 3H75A 3OZDA 4UCWA 2GBFA 1E0KA 2I33A 4IG4A 4NOKA 1I7LA 1D09A 3R3WA 1JKFA 2Z98A 2O6HA 2A35A 3L49A 3ZY4A 5C37A 3FOFC 4D9FA 2AR0A 1IHPA 3UA3A 3L07A 1SVIA 1VCIA 4NATA 4FDAA 4D8WA 1ZCJA 4TS1A 1WDMA 4QO8A 2DP4E 5B1YA 1T5SA 1EM8A 1R8YA 2HP0B 4DV2B 3WHKA 4JR0A 1KDRA 4IIBA 3V7QA 3R9WA 2P62A 4LMAA 3K0CC 4S1WA 5FUYA 4BNFA 2JHPA 4C7MA 4DA6A 2XRFA 3A7EA 3PD0A 5FADA 3EC2A 5HDQA 3REQB 3VV3A 1BCSB 3BCRA 3P4YA 3ZXYA 3RASA 5JMPA 3J80A 3B2QA 3DVQX 3ZHTA 5KJEA 4BO4A 2XUKA 4F3KA 1ZD4A 3VIUA 1QJCA 1YR7A 2FWNA 3QY9A 4ZRNA 5J59A 3KXDA 4DM7A 4HVLA 1VA4A 1NBEA 3QBVA 3IAHA 1RP7A 1UIMA 4LV8B 3GNQA 2H1OA 1V6AA 2NYRA 1DHRA 3C70A 4EVIA 3SS7X 2ZVPX 4BO0A 1VH8A 3AM4A 3K3PA 4LWZA 2E5WA 5KC9A 3DOFA 3E0QA 3T5GA 3V7NA 3WJ7A 5FBKA 3G6KA 4B46A 2EQBA 4I4TF 4M9SA 4WA8A 2QA4F 2C2WA 1W4RA 2RBGA 2X3UA 2H1WA 1HDRA 2IPLA 2PH5A 1JAZA 2PVCA 3EVAA 1DAIA 3JRXA 3KTAB 3LY7A 2G04A 4G97A 2R8EA 4LPKA 4JLJA 4YV2A 4K9DA 3MWGA 4IRMA 1JFFB 3TTYA 1R8QA 1JTFA 4TL6A 4HXYA 1MG5A 1Z62A 3MINA 3MJEA 4HQLA 1QP0A 4CQJA 4ETMA 4I19A 1W2HA 2YYYA 1EX6A 4AY5A 5AVTA 2WJJA 1JKMA 3DG9A 2QR5A 2W70A 4CDMA 3WKBA 5EJ8A 1RJDA 4LYJA 4CKYA 3AW9A 5K5EA 1YQXA 3TMYA 5AQEA 4NDNE 5D6OA 5BWBA 3W3AD 2CEAA 1YS7A 3JWJA 1P81A 1YB1A 2ZYDA 4OXNA 1YH3A 2AGVA 4DXDA 2V7GA 3R4VA 5EJFA 4UDOA 5GP1A 3UKDA 3VSAA 5B1EA 6PFKA 1XWWA 1BJKA 3Q7SA 4EMBA 3GP8A 1XHOA 2FZ5A 1BH6A 3FWZA 3K20A 4W8GA 1RXEA 3ECSA 2GN4A 4I9NA 3OEED 4HUTA 3CB4A 2PUWA 1X94A 1NATA 2FXVA 2J9ZB 1RYDA 4D9IA 3ETEA 2FXIA 5DCWA 1GCUA 1RAGA 2XNJA 3GRRA 3DC2A 3DE2X 1DIBA 3HFJA 2PZGA 3MCUA 5TR9A 1XCOA 3GW8A 4ALJA 1JRLA 4A0RA 3A1NA 1H5NA 4C0LA 2L82A 3OZIA 2UUBB 1DOAA 2FSVA 1KZYC 2QRMA 1T5TA 2WIAA 4KXQA 4LCJA 3RVDA 4EJ2A 5K0TA 4ZWNA 1I80A 1CQPA 1W19A 2GAOA 2HHJA 4BWGA 3NTVA 2PFGA 3BMQA 4BUJA 3OT1A 3PUHA 3GLKA 3ZE1B 5BSTA 3ECAA 4OQQA 1YJ5A 5JZ9A 4K8OA 1L5WA 4ALNA 4M1OA 2BDEA 3R9XB 2X9QA 3I6MA 3NBAA 1NLFA 1S2NA 5TJ9A 3UG7A 2YKGA 2XB2A 3AI7A 1WVGA 4YONB 5C31A 4YRIA 1KAGA 3A8TA 3V8MA 3CRMA 4KE6A 5CD1A 5A3JA 2VT7A 3PC8C 2DSNA 1FVXA 2H16A 2X8WA 1K0FA 1NNLA 5CM2Z 2QORA 2NZYA 1QCYA 1E7RA 3HWX1 3T3OA 2NX2A 2AJCA 3HMQA 2H92A 3DBLB 2V4ZA 3HEBA 3O8NA 5DHTA 5DZSA 3SQLA 2QEXF 1IN1A 4I1PA 3R0JA 4EHAA 4EJSA 2NT4A 5JQGF 5JTUA 3Q85A 2ZJFA 2Q6LA 3FGZA 3VPBA 2E37A 5C3MA 1VHQA 4W5JA 1KSGA 3UHOA 1E0SA 4FFOA 1MABB 4MH0R 4UJ3A 4C2BA 4CKEA 5A0TA 3OZXA 1EIWA 1P5HA 2ON6A 3KE9A 2BBSA 3E84A 3NIGB 2WJHA 2TSYB 2GAJA 3D1JA 4J3JA 3LGXA 2ZCJA 1H1LB 1B0AA 2J0QA 1DRKA 2JJYA 1Z2DA 2W6IA 3ZWOA 9MHTA 1AHHA 4Y9RA 1WSAA 2GI4A 2Y27A 2Y6VA 3KPJA 4MQBA 1NOKA 4PX2A 3WIBA 1TJPB 2X8BA 1ZK2A 2BN4A 1TU0A 3EZ9A 4P3YA 4XRGA 4P4TA 4YJKA 3OOSA 3TK1A 1M34B 3LQ1A 1HUQA 3FPSA 4A92A 1S3FA 4Y2JA 3CTMA 1SELA 1N2IA 4PZPA 5KWIA 1J07A 2IPXA 1C4WA 2BFWA 2AX4A 4EKYA 1PJLA 5ICCA 1ODIA 2XJ4A 4MW9A 3SHFA 3EWIA 2R0QC 2A0KA 1O03A 3AC0A 3T7CA 4ROTA 1U3WA 1O95D 4LNUA 2XOKD 1BXRA 4PHHA 2HWXA 2W0MA 4IS3A 4MS1A 2W8BC 3MPOA 4TMTA 1GZSA 3DSRA 1SCQA 2I5PO 3L46A 4WJKB 1Z06A 1VQPF 2IYQA 4Z9BA 3TOXA 5T8KC 1CUYA 1DGQA 4YP0A 3EZ6A 2Y1GA 3LXRA 4D98A 1QR2A 2HLPA 4CKWA 3JARA 1L5LA 1YC5A 1XBTA 5EIAA 4Z8XA 2YHSA 3NTLA 4GM0A 1EGVB 2F3QA 4W7HA 3DOUA 1Y3CE 2GEUA 4J4TA 1SWVA 3V1UA 1YR9A 4CDNA 3WAKA 4UM5A 2KMLA 4DBZA 2H6LA 2AFVA 3AGQA 1IN8A 1F6DA 1I4LD 3O84A 4IQFA 5AHXA 3TRFA 4BBAA 1T5IA 3L84A 1U2ZA 1Z34A 2IXFA 3ILSA 5G0SA 1YU6A 1BNCA 3IHLA 3ANSA 3VH1A 3TOZA 3D5EA 3BXPA 3I76A 4R8SA 4TLLB 2SCUA 2MYUA 2IZZA 1J2RA 3SKYA 4YO8A 4J9VA 4BJ1A 3WRYC 4D4LA 1JFLA 2B1GA 4P53A 4NYMQ 5IJ0A 4P31A 1MAUA 2CW4A 4S35A 2XWSA 2K87A 2R66A 3MGGA 3GJ6A 4WZAE 2WIKA 3DFFA 3QLJA 1SVSA 1C3XA 2Z8XA 4L8GA 2CLOB 5IYZF 2BMDA 5FJ4C 2I3GA 1W40A 3FOBA 4C0QC 2FW9A 1ZKMA 4KITB 5ALKA 1E2IA 3IVCA 3KELA 3UK0A 1E2HA 3LUFA 5B1HA 2IV3A 4F9EA 2AKEA 3HSYA 4LCBA 4LZOA 4CM5A 2P2DA 4MV7A 1IHUA 1LI7A 3MXTA 4IJQA 4Q5IA 4P08A 4QUJA 1XKQA 1XXHB 3UAOA 4BBZA 1XDSA 2GN8A 4JVNA 2CE7A 3MRTA 2AUNA 1W5BA 2FW7A 3F3YA 3L05A 1ZXXA 3RS7A 4Z3OA 5K3EA 5LP6A 1BFDA 1ZS9A 2HF2A 3VPSA 3D3WA 5FNVB 1P2GA 3UAYA 1PEYA 2ISCA 4O59O 4IZOA 1GAWA 3F6CA 4IUBS 4X6XA 5EERA 1O8BA 2C1ZA 1NJ1A 4ZDKA 5KSOA 3RFUA 1KJYA 1RLIA 2CVOA 3ONWA 1AKQA 4U63A 3DW3X 4AJIA 4IP0A 3ILHA 5JS8A 1PW7A 3MILA 1R15A 4MQ6A 1B0UA 3ZIAA 4ZT7A 3PQCA 1D2MA 4HRVA 1AX9A 1S6YA 1SULA 4IYJA 3L4JA 4GLFA 3M6XA 1XZJA 4JSRA 2NXNA 2XF8A 3AKDA 1XCPA 2PZ8A 3CLUC 3H8SA 4HJXA 1FBNA 4M60A 4PRZA 4TRNA 1U7PA 2WM9B 2Y05A 2XQVA 4FFPA 4P3NA 3VZCA 4B81A 1E1QD 2PVSA 2PRJA 4MYDA 1AURA 1K2VN 1SZQA 3F0EA 4IZ6A 2VJCA 1E20A 3EXIA 4AS2A 1EHIA 3FDZA 4K9NA 3RUEA 2BFCA 4ND4A 4FN5A 4FOSA 2ATCA 3VH4A 4G0YA 3HZOA 2NP7A 1GO2A 1TVKA 1K1EA 3RRFA 4X65B 1X13A 1ZLYA 1BG6A 1R6VA 2MSKA 2QX8A 3OKPA 4FWBA 2Z95A 3DEKA 1MG0A 1HK7A 1LLDA 2E49A 1NI5A 2BMVA 2ZIEA 4ZMBA 2V1UA 4R2WA 4CT4B 1ZOOA 4L07A 3WO0A 1DKMA 4G1VA 2BBTA 3PCXA 4U8HA 4B3TB 1EP2B 1PAUA 1YZUA 4P4SB 4Q4AB 4JI2B 4DCVA 3H2IA 4HDKB 4Z49A 1NG9A 1C2YA 5FTNA 1M5UA 3HBLA 4X85A 2IIQA 5J43A 3WGIA 4QYMA 5JSUA 5TQ2A 1O6FA 4BVRA 1G5QA 1JQLB 2OZLB 4MVWA 4LY6A 3R9KA 2GCGA 2JGLA 3UUFA 4UNRA 2RHJA 2HJSA 3QHAA 5A6SA 3AEUA 5A4DA 4CCYB 5T4FA 4KGXA 4N12A 3V4DA 4N7MA 4LJKA 1NR7A 2HWUA 2C3UA 2HAEA 4TPKA 4KQXA 2XUPA 5CCEA 2HWWA 4FFBA 4RYDA 2CD7A 4YFYA 4I1VA 1PNRA 3LC2O 4QU0A 1RAEA 2YY7A 4YMLA 4TXMA 4IWXA 3VR2D 2V7XA 3MOSA 2RFLA 3HNRA 4YRJA 1VYUA 3OM1A 3TUIC 3B6ZA 3HKDA 1I6LA 4RY8A 5L95A 1UADA 3D3NA 5FR1A 4BXOA 5JNWA 1SQFA 2WAAA 4C0KA 3MGAA 4NFYA 3MMSA 4NU8X 4GE0A 5M3BA 3A6DA 3U0BA 4N3GA 3JQCA 4EF5A 1CU1A 3UICA 3OPYB 1KGSA 2HS4A 1PT6A 2VTDA 3T7TA 4ZCSA 3ETNA 3TOVA 4LN1A 3CE9A 4RHEA 1ZITA 3IERA 1T8RA 5DV9A 1MA0A 1YITF 4RKWA 3KZVA 1EJ2A 3JQGB 2OG1A 3HMKA 3DTVB 2OTLF 5EQJB 1I7QB 3OSZA 3QJYA 3RVNA 5TPZD 4BV3A 1A77A 4EWLA 3LYHA 3COJA 3AGPA 3RK1A 2FG7C 3WL8A 2CVQA 3DR3A 4PZEA 1Z4JA 4G01B 1NBMD 4L27A 3TVDA 3A06A 4HGZA 1JV2B 4XTCS 4HRAA 2VJOA 3SS9X 3EMKA 5TMDA 4ARIA 1B8NA 2XDAA 3DULA 4WW0A 1SWWA 4D1YA 2ZWOA 2X1VA 2I34A 3PXBA 1Z3CA 4QDZA 3K72B 2HA6A 4WN3A 2ZJAA 1KEZA 1JU3A 1NX6A 2JCVA 1W581 3G1TA 4OHOA 3N3AC 4IS2A 1SD5A 4XX0B 4NWIA 2X2EA 3AR4A 1GZUA 1D2AA 1XEXA 2CLCX 2ZSAA 5CLLA 2ZAIA 2X5JO 4DLTA 2CJWA 4M1MA 4GNRA 1N5DA 1G21E 3ZWVA 2VAMA 2QUKA 3IB3A 3PICA 3UMRA 5ESXA 4G26A 4EJFA 2JVIA 4JEHA 1L7MA 5CT4A 4ZJYA 2H1VA 1C1HA 4RPKA 3TCKA 1KVUA 1JIXA 1RWBA 2GTHA 4NMXB 3RRXA 2FQYA 4L3WA 3VSDA 3QPAA 3SYTA 5JDIA 2PSJA 4W5HA 1ZSNA 3UUEA 4KPYA 3EVFA 4IIJA 2Q2NA 1W4ZA 4UPVA 4CQMD 3OIUA 4NS4A 2SICE 5HUQA 2XVYA 2XJ9A 4AYXA 2SNIE 1YR6A 1KH1A 3LECA 1VJCA 3HRIA 3N0TA 4B7CA 1U1GA 1FYWA 1P1BA 4KCGA 2EEPA 4RD1A 2C8KA 1HEUA 3PP8A 5ALEA 1A4IA 2OFOA 4PN3A 2BDTA 1VQKF 1ZQ9A 2XTMA 1OFVA 3TBKA 2R7KA 1GXSB 3WGVA 4ETIA 3MGCA 6GPBA 3IMCA 3ORRA 1DG1G 1J8QA 3OF5A 4TKUA 2DXIA 2AD1A 4IXWA 4ZO8A 1UFRA 3K14A 1HE2A 2CWWA 2I4RA 1C9KA 2VLIA 3C8DA 3FFMA 4ECEA 1Q84A 2JLAA 3QVXA 1U02A 1ZC4A 4PU0A 4OGKA 4TS9A 5HRUA 3GRZA 3OM8A 4K8RB 5HE8A 4YJ2F 1Z0IA 1ZA2A 1QH8A 1W35A 2XDYA 3NUQA 4G4XA 1O4WA 1YOBA 4M0CA 1C7JA 4QUIA 1DVRA 1LLCA 1D07A 1JEQA 3PLAC 4ZD6A 4EPWA 1ZWLA 3BL5A 4K9SA 3P4UA 1K98A 4FUTA 1TKCA 4AL4A 4BNTA 1AKNA 1UBEA 2X1HA 4NDZA 2QMHA 5JASA 3VOBA 4J4BA 3QEBZ 2BFFB 5H9VA 2FSFA 2H7CA 2Y4NA 1G2IA 4IDFA 5GGXA 2A3NA 2O54A 2R62A 3H11A 2OCIA 3MK31 3PC2A 1Y33E 3ROTA 4G4WA 4YJGA 4CF4A 5JRJA 1QZZA 2QT0A 1XK6A 2YFQA 2WU3A 1K89A 3E7DA 5CA0F 2CXQA 3OC0A 5IVDA 1ZISA 2CD9A 2QTWB 4IX9A 4JNKA 1TZCA 1DFHA 5AJWA 3SC2A 4TSFD 1YVEI 2EWVA 4KR0A 1DWUA 3UV6A 1N7IA 3VCZA 4HI0E 4MCIA 4HH4A 5COAA 1Y1PA 1MAAA 2DVMA 1MIOB 1ZUNB 1YHYA 1SZPA 2W8ZA 1M83A 3KQVA 3ONNA 4XGRA 1ULUA 5I45A 3CSSA 4YRFA 2YR0A 3BSYA 2GRUA 5FB3A 2F17A 5BVGA 4A26A 2YS6A 3D6VA 4ZVUA 2PM8A 2OBLA 1TCVA 4HDSA 4B6GA 5HF6A 1ID8A 2PD3A 4NFSA 3COVA 3HR4A 3NM4A 3Q9UA 4N5IX 1DBPA 1FC0A 3G5LA 1T2VA 1BQ3A 1Y5LA 2FN7A 2NO0A 5EHGA 2OGTA 1GT91 1Q95A 1CDEA 2IBMA 3NW9A 3STXA 2XHZA 2K2QB 3THRA 2NYAA 4YS6A 1Z5WA 3GIDA 1L5SA 2GNOA 2X6TA 13PKA 3I23A 4ZJZA 4A5OA 1QGAA 3PUWA 1S3GA 1Y3HA 2YJ6A 3GAAA 2AHOA 4GSLA 3W78A 1XAIA 4A16A 2V0GA 2PRKA 1UBRS 1G3MA 1TC1A 1BMFA 3ZDQA 3PHCA 5JZVA 4HATA 5K3OA 2HJWA 3Q5EA 3C0KA 1KDZA 3W4IA 4IG9A 2XYPA 5A02A 4MDFA 5EZ6B 3ZK8A 2HIGA 1U9JA 3IOCA 1CUDA 2HM7A 4GR4A 4CETA 1H65A 3B6EA 1BHO1 4RJLA 4XFJA 2OG2A 4BVSA 1QE3A 3LPCA 1RLMA 3KVYA 3E61A 1M5RA 1YS9A 1DBQA 2E1PA 9LDTA 1EP9A 3DH0A 1QO9A 1WSBA 4OJKA 4Y2RA 5LLTA 2IH5A 5ALZA 3WDMA 3W06A 1FNNA 1WXDA 2VBFA 4GICA 4ARBA 1XZHA 1G7CA 3II6X 3AKEA 3E9DA 4G65A 2PAAA 4WY2A 4B17A 2PWYA 3O2JA 1E1MA 4I9FA 4U7DA 3NHLA 3UMSA 4XA8A 4O1IA 4BE9A 2Z8YM 3T3MB 2B5WA 4FHCA 1EE1A 1QG4A 1FK8A 2IHZA 2JJQA 4L2IA 5TARA 3IQWA 3IVRA 1SQGA 5ED0A 5G3YA 2IIPA 1WIWA 2JBWA 2TECE 5THQA 1T9GR 1PX2A 4H7FA 2IS2A 2FP3A 3LOPA 2LIVA 4I14A 3AR2A 2P9ZA 2V4MA 2Y1WA 1R50A 3V8RA 5GJBA 3AM3A 1QXSA 3VTFA 3IKFA 2CNDA 1MO5A 5EXTA 1KIAA 2WWWA 4FLMA 1MX1A 1WVIA 1TKRA 1O95C 1ORWA 1RZ3A 2P75A 3AFHA 4ZREA 4ZJPA 3OMWA 2II6A 4G9BA 3HXLA 5BRAA 1JDSA 1TW3A 1Z25A 3CEJA 1FB5A 1YE8A 1AQLA 5DGDA 3BJMA 4C4ZA 5HRCA 1L8XA 3HRKA 3ZLVA 3PXCX 1JUDA 4L6IA 3DWFA 3K0TA 1PFQA 4KN9S 4R1TA 3WOVA 3X1DA 1K4KA 1R4NB 1KEKA 2R8BA 5KJ6A 4CIXA 3DAYA 4NV0A 3WB9A 3MAJA 5BN5A 3DA8A 2QAIA 3TIFA 5ADWA 2BLNA 4MGEA 4TS4A 5LZ9A 3JWEA 2WSSA 4HSEA 4CEHB 5SZIA 4FP9A 3GD7A 1L7NA 4TXHA 3EXHC 1KYYA 2QRGA 1FLNA 1FFWA 1ZOIA 3DAPA 3IBCA 3JSXA 4N5LA 4Q19A 4CE6A 4QG3A 2ECPA 4KPEC 3BRWA 1X52A 5FPHA 5TY0A 1SBQA 3LM8A 1IPAA 2D2XA 3QJGA 3KQTA 1DT9A 4QWMA 2XUOA 3VNQA 4C0SA 2QTGA 2LKDA 1WUTA 4JC5A 5KPJA 3J80M 3OJFA 4K2AA 1BE8A 4RAQA 3QIAA 4GYJA 2I62A 4X97A 1PVOA 3COPA 3DZFA 4UD6A 4ZCRA 2HTEA 4M53A 3I8OA 1CZKA 4R9NA 1VSTA 2BEVA 2CK3A 2RI6A 2YV2A 3EW7A 1I1HA 4B8YA 4TWAA 2G5GX 1Q1QA 1WLYA 2HGSA 3RIGA 1JHRA 1SHTX 1EWYA 1U94A 1RIFA 3T7KA 3TQFA 2XGSA 1BFUA 2QZPA 4PSCA 3IP8A 1N5KA 1QAMA 2Q45A 3M6IA 3QXSA 3K5WA 3AUTA 4MR8B 1W75<