3WGVB

Crystal structure of a na+-bound na+,k+-atpase preceding the e1p state with oligomycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
303
structure length
303
Chain Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of a Na1-bound Na1,K1-ATPase preceding the E1P state
rcsb
molecule tags Hydrolase/transport protein/antibiotic
total genus 65
structure length 303
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3wgvB00
5AVUB 4RETB 2ZXEB 4HYTB 5AW0B 5AW4B 4RESB 5AW6B 5AVXB 5AVTB 5AVZB 5AVVB 5AW5B 5AW7B 5AVSB 5AW9B 5AVQB 3WGVB 5AVYB 3WGUB 5AW8B 5AW1B 5AW2B 5AVWB 4XE5B 5AVRB 3A3YB 3KDPB 5AW3B
chains in the Genus database with same CATH superfamily
1BVLB 4XWGL 5H94A 5HGDA 3PWNB 5KZCD 5MP6L 4GMTL 5FKAA 3R4RA 4GUOA 2R2EB 3CVHL 1IC7L 3MJGX 4H0LC 1QASA 2ZAIA 3KYNB 2NZ1A 3GKZA 2RR3A 1IM9B 3BKCL 1QSFD 3WN6A 4XP1H 5DDHA 2WXNA 5HP5A 2XQYK 5CEXB 2R83A 2X4SA 5DQDH 3O45B 3WIHH 1T0MB 1D5ZB 2K8MA 2QGEA 5JQHC 1JIBA 1ZANL 3GSUA 3HG2A 2EXSA 5T1DH 3VD9A 3SBRA 4ZS6C 5C09B 3ME0A 3WV0A 5IMMA 3GIVA 4JB9L 3GPSA 4PGCA 1YZZA 2EACA 1NUNB 4GQRA 1TQCC 5JPMC 1X5LA 3KS0J 1ILSA 4LHUD 4NKDA 2D3NA 3ZHFA 4FHBD 1BMWA 3ZDYF 1XH0A 3ZUCA 1QW8A 2QR0A 2G75B 2YPLE 5EUKA 3UTPD 4O2CB 1QNZL 2BS71 4M4RB 2YSTA 3B9AA 2GBAA 3FT3B 4M7JH 4FFZA 4W9JC 1A4JA 2F7PA 3GRWH 3IMRA 4JFZL 4OIFA 1SDAB 5D7HA 2EYTB 3LRLA 2EDMA 2XZQH 1KJ2B 3GMRA 3JWNH 1VACB 1DLFH 1JZIA 3BQUC 1MCOL 2A0LD 3ML8A 4L5FH 1BM3H 1EAOA 3FU0A 3LZNA 3MZGB 4UV7H 2YSSA 1K2DB 3GS4A 1VHPA 1AQDA 3BKML 1HX0A 3H9SE 4YHNA 3VVWA 4F5CE 3IVKA 2BY1A 2Y06H 2Z9TA 3QIWD 3U0WL 2ZCZA 3NCWA 4WK4B 4QD2E 2JLPA 5CFHA 2K6WA 2XFXA 2X4NB 4X6CF 4G9DA 4QOKE 2CHDA 3EFFA 2VZTA 4BSJA 4FXLA 4BDVB 2EKJA 5C08E 2ZG3A 4DPBX 4ELDA 1D5XA 2A6DB 2QDVA 4O9HH 5FHBL 2WYZA 1KG0B 1OEZW 5DUML 2PABA 4EDWH 3GSOB 1NCIA 2JJVA 2RCSL 4UYQA 2IJ0C 4TQHA 2UWEB 4XOEA 1U95B 1HL8A 1D6VL 4R2GC 3V6ZA 1RZGA 4GKNB 5HVGB 3MUJA 3NH7H 3EUUA 3T3MB 2V7NB 3ZE1B 4FLSA 4LAQL 1DSYA 2FL5B 1N26A 1N3NB 1TQCB 3PIQB 4YDIL 5GSRB 1OKEA 5JPMB 4AMKH 2LW3A 2IV9A 3PWPA 4XX5A 2WLLB 4BD4A 4POYA 3NTCH 4XCCH 3GQFA 1MRDL 1YEHL 3CSBA 1RUPH 2Q6WA 3EJJX 1X6LA 3BESR 1XIWD 3G7TA 1PZAA 1MF2H 3K2UL 1USZA 1JUFB 1E4KA 15C8H 3D9AL 3OQRA 1ZE3H 2I69A 4LE8A 2Z8WC 1EJOL 3MU3A 2BXZA 1X9RA 3QORA 3BQUB 1S7UB 5EU6A 4KK5D 1BVLA 1FH2A 4O2EA 5ISZB 2G3XA 1WS8A 5CP7A 5J9PB 3O8XD 3VE0A 2VERN 5I15H 2R2EA 1F90L 2XKSA 1FVDB 3GUTB 4R8WL 3FAWA 3KYNA 3VWJA 1KTLB 4YDLC 2K6YA 4YHKL 4YDJB 5IVZA 4L2YA 3FDWA 2FEDD 2EABA 4F7CB 3LNGA 4GIOA 2BCKA 4W4OC 1VFUA 4DN3L 5CEXA 3MGOB 1IJ9A 2B0SH 2W07A 1VLXA 3H6JA 1T0MA 1D5ZA 4FQIH 2H0EA 4JM4H 4OIBA 1LDPL 2CHWA 1S7SA 3UBXG 4NQCA 1HILB 3KPSB 5AKRA 5C09A 3K1KC 2EUZA 3VTAA 2QTVA 4LVHC 1CIUA 4NYLA 3SZ6A 4FMVA 3STLB 2B08A 1WO2A 2NZIA 5DFVC 1WFTA 4R2GB 3S97C 5E95B 4L1SA 2DMBA 2ZOKA 4ELME 4W6WB 5HTSA 4M7LH 4U31A 4WU7B 2G75A 2UVFA 1F86A 1AHKA 2YD6A 5JXED 4O2CA 1KUMA 1WFNA 1C16B 4HGWB 4KKCD 2X38A 3NSCA 1MRCH 5F7WC 4N1CA 3UX9B 3PJNA 5EBMA 1EZVX 1OE2A 1NSNH 3ZL4L 2VB5A 3ARZA 3HE6A 2H2PC 1NTDA 5I1DA 3QI9C 4N2AA 1KJ2A 4UQDA 2PYFB 1F45A 3DHMA 5AYUH 1NAKH 3STZB 5HYQA 1GR7A 3B5TA 2GI0A 1AACA 2WLZA 3IETB 4LKXB 2A9ML 1NC2A 1E28B 3FTSA 1R5WA 3QZWA 4ODWA 2GHWB 4TQPA 1E2VA 2F0CA 4L4TD 5D4HA 5D55A 4RMWA 3X13A 1A7NH 5I71C 1KCRL 1OQXA 1E5AA 4HPYH 1MW2A 1UGNA 1XXDC 3G6JF 3N85L 4KJYB 1IEBB 3IJYB 2F1AA 1R46A 4M6NH 2Z93A 3I9GH 4FF9A 4YDLB 4WJ5B 1WT5C 3MFFA 4F3FB 5DRNA 1HQRB 1KG0A 4AK1A 1NMAL 3FU8A 3KLHD 2UY6A 3GSOA 3BSGA 1GYCA 4XPHL 3CDFA 1CU4H 4ONHA 5FW7A 1WAEA 5B1AB 2UZYA 3F7KA 2BSCA 5HHOA 5E5UB 3QIUC 1RZFL 4YSPA 4PGJA 2P46B 3ARTA 4GLRH 4LVHB 5GSRA 3RGVC 1XF2B 4Z0BH 3IS1X 2YD4A 1G1OA 3LEVH 1FRGH 1NGZB 2WLLA 4LK4A 1FVEB 3WNOA 2D3JA 1O7VA 3UJTH 5TD4A 3KS0H 5CGYD 1AC6A 3I9PA 3UAEA 2EDBA 4J3OD 2BZCA 3MJWA 4YSOA 4JS7A 1E3XA 1N70A 3UPCA 5F7FA 5CJQH 2OQJA 2YQ2A 5IZ7A 3QI9B 3UADA 4FN0A 1T83A 2EE6A 1D5MA 4XN1A 4AVIA 1VESA 2BVTA 3HZMB 3NMEA 2VR7A 4PBXA 2CCLA 3ZTJH 5LNGA 1S7UA 5EO1B 2ED6A 3WKQA 1PZUB 4NAQA 2OX5B 3ZYOA 5LQBH 1WQVT 1INDL 5TH2B 4ACPA 5LJYH 3SE8H 1V7NL 2CPCA 4IRSD 1GHFL 3FMGL 3G3LA 4FLQA 3KDMB 5GJTL 3GUTA 2Z1PA 3S2CA 4IDJL 4MJ5B 3QQDA 1Q90A 5I71B 2FX9L 2YGOA 4MVBC 2WJ7A 4QGYA 3Q9QA 3ZHNA 4R7DA 3G5ZB 1W72A 3I3DA 2L7EA 1NCNA 2MKLC 4GRLC 1TVDA 3EW3B 3FT9A 3PJLA 1J1XH 3AADB 2HJFA 2CBOA 3UAAA 4UQ3B 3DGCR 3VA6A 4GKZA 3QUYC 4ZNEE 4NM4H 1QG3A 3ZHKA 4Z7WF 3STLA 1NC4B 1OCWL 1IGCH 3NEEA 1XAUA 3HNSH 4HGMA 2JB5H 2V6HA 3I6LD 5I6MA 2F9BT 5JW4Q 3F6IA 1IL1B 4C56E 1GGUA 1MHPL 3L7FA 2Y4SA 3CN1A 3QIUB 4WU7A 5I8KL 4HGWA 5DMKB 1C16A 4NC1E 2AKRB 5GZND 3VXRB 1IGFH 3RGVB 1THCA 4KO6A 1F0LA 4JO3H 3DV6A 4GMSL 2XTJC 3O2VL 1AP2B 4IU3B 1DQKA 3R7QA 1CBVL 2WZ6A 5AG9A 4DOHE 2PYFA 2C9PA 3KYMB 1OF2B 4RGNC 3QCUH 4NO0A 3S8WA 4AG4H 1E9OB 3T77B 5C6PB 3V5DB 2DM3A 2H2SD 1OM3L 1R3IH 4I7ZC 5KS9F 3KPLB 2XVKA 4HPOH 4OLUL 4PUBH 5F3BB 3MRHB 2Q86B 1E28A 4RLDA 1HQ4A 3M86A 3CFNA 3U9PH 5LBSH 2YD2A 1C12B 4PJHB 1U9KA 4QXTA 4HJTA 3N1PC 1GZPA 2BW4A 4YE4L 4AT6A 3DX9A 2ZPKH 1OARH 4AQAA 1IEBA 4NGHL 1AQHA 4N0RA 5FYJU 5GGRY 5DMJB 1ERNA 4LIQH 4K5MA 4F3FA 1JF6A 3MLXL 3MLRH 1C08B 2XY2A 1T7YA 2D9CA 4GRLB 4HWBL 1NBQA 2OTUB 4LASL 1LEIA 1TZHA 4G3YH 5FPIA 3NJNA 3FUDA 4PRBB 1A64A 3PLYA 4OLXL 5DQJA 1EMTH 5G4MA 4BE5A 3GO1H 3QUYB 5DRXA 1XSIA 2CMRH 2VN5A 3DLQR 3L3GB 3MBXH 5DVLA 2YO3A 2X4UB 4DVBA 2X6VA 1N5YH 1FVEA 4TN9A 5I16A 4DKEH 2R2HB 4XI5C 5CKGA 1QTPA 2YKLH 2CO1A 4I5BA 3LB6C 1GL4B 4HWZB 1DVFD 4MDJA 3VWKC 2D7TL 4HZLA 2ZWZA 1Z5HA 4Y7MA 1GTNA 3B56A 4XNQA 2XTJB 2J55A 3JWOL 5T3ZH 3WFHA 5AL8A 4YBLC 2W0PA 2ZUQC 5JPNA 5PCYA 5HHVH 4QJ4B 2HN7A 5I26A 3HZMA 4RGNB 1IBGL 3OKEA 5EO1A 4X7DC 4XAWH 4YHZH 1JV2A 2WNGA 3LHPH 4AENA 2ATAA 4IOFC 3SOBL 5IK3B 2HKAA 4H8WC 1AJ7L 2GFBB 3KDMA 5AAMA 1S7TB 5L8KB 3QDJE 5TPWL 2X4RB 3FYEB 1S9XB 3I85A 3PHOB 5FYJD 3K5SA 4OTXH 5B7EA 4YX2H 2IANB 5EBGA 3SPVB 4A2FA 3QRGL 3N3EA 2VN7A 2LU4A 3ECVA 1BHGA 4JFSA 1U8LA 4DK6A 4NZTH 1YUHA 2YRBA 1NC4A 1KF9B 3CUPB 2WXGA 3GD1C 5EU3B 1U8MB 3WFEL 4BXSV 3CMGA 4XVOA 1BVZA 4X9HA 2AJZA 4BQ6A 5DMKA 4GO6B 5E9NA 2YD1A 1WBXB 4NJAH 5HYSG 2AI0H 5D1ZA 1P5UC 1F3JB 2WQ8A 3V4VL 3AS1A 1UG9A 1V3JA 3C8KA 4BWWA 2CA4A 5IB4A 3QNXB 4DJMA 2H6UA 4PJ6A 1HIMH 4XMLL 1LP9F 1T1ZB 1C5DA 1OF2A 2OZ4H 4N8VB 3MV9B 1E9OA 3VWKB 3TEUA 1YECH 1WAAE 4ONFL 5EEYA 1U93B 4YBLB 2ZUQB 2GK0B 5JIKA 5CZKA 2DMCA 2ZOUA 1DQQA 3IDJB 4Q0XH 2CHZA 4PJ7B 2DQGL 4JO1L 5TF0A 2G60H 3KWWA 2FIKA 3LTVA 4YXLH 4JFFB 3IVKB 4HMCA 4FEIA 2WC7A 5GGSY 4TQ8A 4CC1A 2ZUXA 5B3SB 4XMTA 1GGIH 4OCWL 3EO0A 4YHML 4JDEB 2IWGA 4B27A 4ZMLA 2OYMA 1C08A 1G9NL 3MYZA 1FH5H 5T3XH 3FFCD 1RL1A 3FK3A 2K70A 2BNQA 4M4PA 3AU0A 4DN4L 3F84A 5GRXG 3WFZA 2NZ9C 4PRBA 1WD9A 3MRCB 2OMTB 3HKZA 3ZRSA 1YEJH 1UCBL 1MFVA 3GBLA 4PY8I 5E2WL 1KENL 3CXFA 5KBLA 5EU5B 1BQLH 4K5PA 3PDDA 1MDTA 2X4UA 4KO7A 2XWEA 1PEWA 2WO3B 1BQKA 1G9HA 2QPEB 4Y16D 1UA7A 4OJAA 2V8MA 1P5UB 1R19A 2JKSA 3U4EA 4XPTH 1CFMA 4NQDD 5DHYB 4LL9A 2AJXH 2O72A 5FO2A 5CLWA 1ZY9A 1GIGL 2JKXA 2Z92B 4HS6B 4JRYB 5F21B 2ZWKA 4YO0A 1DVUA 4MA8H 3FQNB 2AJUH 2BNRE 3WY4A 2IWKA 4L0YA 2XBDA 3UPRA 1MJ8L 2DTSA 4PN6A 5GRJL 5IK3A 4DFIA 2GFBA 3JWDL 3TCLB 3GZKA 1WYJA 4G59C 3BVWA 3MJ8B 3PHOA 4AZ8A 4YPGB 2DLIA 4FNPA 2XG5A 4Y8DC 1QSED 1YYML 2IANA 3P1VA 4Q2ZA 1IC1A 3BMVA 3DV4A 4OZIF 1L9OA 5LLIC 3G9AB 4Y1AB 3V0DA 1AS6A 2FBOJ 4G7QB 3X1GA 5J6SA 1FZKB 4IGBD 3QO1B 4A66A 1HH6A 5G55A 3ULVE 2DL2A 4PJ5D 4DERA 3ROLA 1NANH 1Q94B 1LWRA 1JDDA 2B2XL 4FYQA 4XP6H 2W94A 2GY7B 4IMLB 5E1QA 3MO1A 5CWSA 5T1KB 1IQWH 2H1PH 3HVDA 4XPAH 2VWEE 5CM1A 5DZPA 1CZ8H 4FDWA 2D0GA 5KANI 3ZDXF 3UACA 3S3SA 4G9FE 2OK0L 1F3JA 1I9IH 1QI4A 2LLLA 2Q2LA 3D3VB 2Y1YA 3ZPDA 5KVFL 2EKSB 3ETSA 5FS5A 3FN0H 4PWEA 4G80B 3A21A 4QHKI 4E9VA 3BD4A 3HS8A 3EFOB 3VWKA 2VDOB 5G5DA 5F72S 1PG7X 2IG2H 4UQ2B 4UIMB 5CN1A 3B3BA 4UBDD 2VQUA 1TSHA 4KTDL 1YEKL 5T5NG 3LNDA 1X5ZA 2ATPB 4BH8B 5FYKL 3TEZA 3BZEA 1UVQA 2HX9A 4NWUH 5EDSA 1AZUA 1M53A 2NY0C 3TF4A 4ORGB 2CLRB 3CZFB 1B0GA 3QJZA 4JKMA 5EEWA 5EEVA 2YMTA 2CLZA 4UOZA 4MQTB 3EJPA 5AFAA 1ETA1 4QJ3B 2HT2D 3CH1B 5IBUB 5I1AB 4RAVB 1L0PA 2D2OA 1DBAL 4JDEA 3O3BA 4I2XA 5F7BA 3NIFF 2GSGA 5CHNB 1XGYH 4P06A 4HDIB 3OF6A 1VADB 3B43A 2OJEA 1BGXL 1OAUH 2DPKA 4Z0XA 3R06A 4BA0A 3EYSH 1LO4L 3A0OA 3HPLB 4UT6H 3FO0H 2PWDA 1S9WA 3PFUA 2LU7A 2NSXA 5C0NC 5H4ZA 2W1NA 3VRJB 4KBPA 4JKLA 5JLZB 4WK2B 1A4KA 2CDFB 3NCCB 1TETL 1FHNA 3O6KH 5F7NC 2XVGA 2Q7NA 3F2LA 2W59A 1IE4A 3WKMH 3BN9D 5F1SA 1PY9A 2E75C 2XIDA 1XGUA 3QWQB 3U4AA 4FXKA 3LH8A 2J2ZA 2PW2B 2BINA 1QFPA 1PD0A 3NA9L 5EA0H 5F88A 1P5UA 1KLGB 4K9EC 5TDPB 2VT0A 3X1BA 2B77A 4GW1A 1A9BA 3R19A 4OLYH 4GFXA 1M7IA 3SPIA 6FABL 1I75A 1NGYB 2Z92A 4IKIA 3B7UX 4M8VA 4WTWA 2E47A 2G4GA 4LL4A 1ZHKB 1CK0L 4OJEH 4I13B 4K23H 5GS0L 1DSFH 1X7TA 2OKMA 4FP8L 4EI5C 1UB5A 3TH2T 4NRYA 3LDBC 4G70B 5GSVB 1O6VA 3PFQA 3ZKQD 35C8L 2IALA 1ZPUA 1Q9OB 4Z7NF 2D03H 5JR1H 3IXTB 1PYWB 2NY0B 2G4EA 2BNQE 2JF1A 2R29L 3FONB 5HY9B 2Y1AA 3S36H 1FZMA 3E38A 1KB5B 4Y1AA 4XPGH 3RKDD 2JE8A 3DRQB 4KXDA 1CLYL 3WL9A 3TIEA 5ADOL 3QO1A 3QGVA 3S8GB 1JVLA 1VERA 3JUYA 4BFBD 2FNBA 4Y5XA 1Q94A 2WO2B 2WNWA 4JL1A 4P59L 3DVGB 3GZOA 4P46C 4QRAA 3GMOB 5T1KA 2NNAB 2WANA 4A2GA 1DVZA 3UTQB 3W81A 2CNYA 2Z64C 4ZS6D 3LNHA 4D9RE 5DFTA 3ZIYA 1AIZA 4QRFA 1HSAA 1I7TB 2OMBA 4N2CA 3Q2LA 3UG4A 4IBTA 1MWAH 5FA3B 4J3WA 4H8VA 4IU2B 4M8RA 2CBMA 2DJMA 1OK8A 3D3VA 4NEHB 5EDXA 5F7KC 2EDEA 2EKSA 5HXMA 2YWZA 4F37F 4LBEB 3B1TA 4I3RH 5SWQB 4QCIA 4FNSA 5BS0A 3EFOA 1N0XL 5I23A 1Z9SB 5DO8A 4UQ2A 5K9JH 2C1OA 1TZIB 4PJ9C 3QHFL 4Q97A 2DIBA 2WLIB 4ZW8A 5M95B 4U1JB 5F2FA 1G9MH 3GI8L 4JRLA 1E9PA 3GC3A 1DBBH 3LKPB 4LO9A 3BQUD 4ONOA 4I87A 4ORGA 1J5OL 4EI5B 4UTAH 5ISZD 3A4FA 1NFDF 1SY6H 3LDBB 3ATAA 4XVUC 3VFMB 1ZLUH 3BWUF 3L81A 1SNRA 3KGUA 4YSUA 5HHMD 2Y36L 3RWEB 5F96H 3C6EA 2E8YA 2FE0A 2BIOA 2HLAA 3KVDD 4Z3JA 1N9PA 2FYYB 1ASOA 1F1AA 5B22A 2TRHA 4U1KB 5DGQA 4KNTA 2CBTA 3LQAL 2O6CA 2E3VA 4P49A 3GK8L 3B8SA 3IYLW 3Q6GL 5PAZA 1YMMD 2WLNA 3KPSD 1MAMH 1KY7A 4GP5B 5F0JB 2W0FB 3SBWA 1CFQB 4P46B 1WP6A 4MXWL 3LNFA 4OCNC 3T65B 2Y07H 3U4BL 1A02N 4B0MM 5GS2H 4R2GD 5KVDH 1NOAA 5BXFB 3II3A 3VXSE 5SWZA 2PW2A 3BEWA 1EZUA 1TENA 4HLJA 1UOLA 4HALA 3CFBA 4NKOB 4ENZA 4C57C 1J10A 2WVTA 4X6DA 2R0LL 1TYJA 4DNLA 4F7TB 5LGJB 2BJMH 5HGBB 2CO7A 5FYKD 5L2JA 4LZKA 1TYEB 1ZHKA 3RTLA 1YNLL 3RWJA 4QRBA 2F74B 5A43C 4WSGA 3DARA 2EDRA 3MUGA 1MCNA 3OPZH 4PJ9B 3T0XA 1YCSA 1Y7VA 5GSVA 1LEGA 2ARWA 5HY9A 4X8CA 1ECYA 3E7JA 1BLIA 5BO1L 1M71A 2DQCH 1KB5A 1PG7L 3UDWC 2Y69B 4GNKB 1IFHL 3DRQA 2WQSA 4EZLA 3QRFM 1OB1B 3S9DB 1BJ8A 1JNNL 2VDPB 1M3JA 2J12B 4G8EB 4JJ5B 4JFEA 3E6FA 1GMIA 4X8JB 1MY7A 4KH9A 4Z3HA 2D31B 1D9KD 4GW5A 3HKFA 5GGRB 5JQIB 1ZGLA 1HHHA 4P05A 2C1PB 1EH9A 2NNAA 5AW4B 5LGHH 3VMPA 4LHQB 1HINL 3PP3K 3V0GA 4F15C 3OKMB 1U92B 4GINA 4LOVA 2FJHB 1JYWA 3V79C 3O6LL 3EOYG 1KGJA 3CMOH 3FTGA 4L05A 4QF1B 2CU9A 2F54B 2BVUA 4NZRL 5FA3A 1UM4L 5DFVD 1SJVA 1QRKA 3II1A 4IU2A 4XN2A 2BP8A 1T6VN 3UBXB 1A65A 4PJBB 3ILEA 4G6MH 3HG3A 4QJ5B 3Q1SL 1MG2C 3D4YA 4LAJH 4W1TA 4I3GA 1Z9SA 1R24B 2A1WL 1G0DA 5GS0D 1NCBH 4X6EA 1BLNB 1YSOA 2WLIA 3HFMH 4FFTA 3QI9D 1XGPA 4QXWA 5L6YH 2MQ3A 5BRQA 3MMEB 4YFLI 2UYLB 3LKPA 1ROWA 2N7AA 1E2ZA 4QMEA 5CGTA 5BOZG 4L3EA 3S88H 2ZCKH 4I8DA 2AVGA 4N8CL 4EZJA 3VFMA 2YBGA 4JY6B 1D7BA 1FHGA 3KAAA 1MH5B 1QFUH 2W95A 4WFFE 2IDSA 4V11A 3CFDB 1MCDA 5K33A 2FYYA 4LCWB 4BUHA 3JVGC 3DX2A 1J88A 4H8WL 4KHTL 3BWSA 1QPPA 5A6IA 1Y6KR 4QHUA 5CCKH 2WBWB 3B2VH 4WCYH 4HS8L 4AQEB 1U6AL 3UC0H 1C1EL 3TO4D 1T04B 2VMFA 1PMYA 3O4OC 4BFIA 3T1WA 1CFQA 3EADA 1YEFL 1KCUL 2Z8VC 5A6LA 3WGUB 1NGXA 3OAZK 3T65A 3LN4A 2YEVB 3EZ8A 1RURL 2XUWA 3CSTA 4F15B 5AOMA 3IJEB 1CYGA 3B7SA 4MA3A 2XPGB 5BS0E 3RL1B 4NUGH 5BUPA 2LGNA 2UZPA 5I5RA 4LEOB 3QIUD 1GPOL 3PABB 3UTTB 3VXRD 5D5ME 2VN3A 3COOA 2YOAA 1A8JH 3CSYA 3P4MB 4JR9L 2O26U 4LSRL 5AOLA 3RGVD 4M8QA 5CZXC 4UF7C 3VXOA 3IMBA 2JB6A 2O4EA 4ZAKC 4PJEB 4R83A 4FABH 4M62L 2LU5A 3F7QA 3MJ7B 2X1PA 1E5BA 3RDTC 4YHOH 5E2UH 1NAML 2WBJC 4CADB 4R3SB 2M1KA 3L5XH 4S2SA 4V2BA 4PJ9A 3INOA 1AYRA 4HJ0C 3AQZA 1BBDL 1VEPA 4UT7L 5KBKA 4IDLA 3QPXH 3SE4A 1IAIM 3AREC 1EHXA 1HZKA 2X7LB 3D30A 3QNYB 4TVPH 5AUMA 1G4MA 1G6RA 2D8KA 2PCPA 4ZOCA 5K5YA 3QYCA 4OFDA 4M48H 1AKJB 2ENJA 3CXDL 3PUCA 1OB1A 1SF3A 3ES6A 2Y7QA 4E41E 4G8EA 1H8LA 2WKOA 1UA3A 4N0UE 3SKNB 4MVBD 3ELAT 5HYJE 1HN1A 3VD1A 4GAAA 5GGSB 4JHAH 3KYOB 4PIBA 3T3PE 2ETWA 1UURA 4GRLD 2L4OA 3WG7B 1J0HA 4U6HB 5TQ2L 5ID0B 3PREA 3ISYA 3JYBA 4PJXA 4ZSOE 1WRFA 3SGJA 3OKMA 5SWZE 2J3SA 1CL7H 4K94C 3SDCD 3VGBA 4ODXB 1SVBA 1WG3A 3O4OB 4BUQA 4RFNC 3QUYD 4DGYL 2V3FA 3IU4H 5JQ6H 4ODVH 4X6DE 5I1JH 3AROA 4X9IA 1T5WA 2FSDA 4MYWB 1WVZA 1F4YH 4PWFA 5GRYA 1HCVA 5IUCA 2AXFB 4WEMB 3GJFB 5ITBH 3T4AC 3PY9A 4PGDB 1CLCA 3D4GA 4QRPE 4ZAKB 2DMHA 5KSVB 1VGKA 3S6CA 1T3FB 3SB3A 1HSBB 4LVNC 3RDTB 2ZYHA 1LO3L 2WBJB 4DKFH 4RGND 5J06A 1H3PH 3T2NL 4B5ZA 4TSCH 4UM8B 2CUAA 1RUML 1WFOA 4M7KH 1GVIA 3HPJA 3T0EC 1QSFE 3ULUC 4L4TA 4L8BB 5D7EA 4Z95H 1OHQA 2NLJA 3T71A 1NJ9A 2YK1H 4JFEE 4U1MB 5I18H 1A4BA 2EDTA 4PREB 2J1KA 2BWDA 3AREB 4BK4A 5CINH 5HD8C 4APQA 3ZTJG 3CFDA 1XX9C 1S78D 4LCWA 5FF6A 4DSYA 4XPFL 4MNHB 5KYUB 1PD6A 3I6GA 4ABVA 4O58L 4M6OH 4P2YA 3AU1A 4GG8B 3FPYA 1KCSH 5EULV 3VXQB 2G3MA 3UC2A 4WKXA 4EI6B 4XCYB 1HYRC 5FDYA 4JZJC 3RPKA 1O6TA 3LMJH 4OB5H 3UTPE 3MCKA 1FWXA 3OKKB 4E68A 5EN2B 4IRZA 3GNML 1A5FL 2YAQA 2XPGA 4YHYB 32C2A 2FQEA 4U4IA 3VFUB 1IKNA 3CLEH 4RFNB 4AYID 1JWSB 2UUDH 3MREB 3PABA 4JQIH 3UTTA 2MOGA 1MCJA 2DLHA 3P4MA 1RI8A 3V10A 3UXFA 4ATTA 3BKJH 4LB8A 1I31A 1JPST 4PJEA 4APXB 3EJYD 4ZUSA 1CLZL 4ALAH 3DOIA 4M43L 3QUHA 3MV9D 3T4AB 3ISWA 4IBSA 5F1OB 1QSVA 2JKWA 4JFHD 2FUTA 3N04A 2A9CA 3WXVH 1UD6A 5JORB 4LVNB 2LAGB 1LE5A 5T5FL 4XVSL 4LPTA 4FRWA 1MIEL 2BFVL 2GCYB 4U6XB 3HMWL 2X7LA 3FSWA 3QNYA 3PRZA 3T0EB 5FM8A 1MFDL 4OR1A 3ZGIA 2ZZUT 4JFFD 4Z5RA 3OSKA 5F7EL 4JFXB 5T1MB 1KLFA 3V0VB 3SCMD 3N9GL 5MI0C 1B9KA 4OIIL 4XP9H 1A21A 7PAZA 3TEWA 2Y6SC 3O3EB 3SKNA 2OTWA 4P9ML 1EFQA 5F7DB 3WXWL 5D72H 3JVGA 5GGTL 1E8ZA 1QMUA 1MJUL 4WW1B 3SDXF 3K71A 3GM0A 1EQWA 1SJXA 4TLUA 4KKPA 4HCIA 2HFFB 4U6HA 1L6XA 5FO9B 5ID0A 4LRNH 5D7LB 5EO0B 1RLWA 5DYOA 2DN7A 5GIRB 4BH7B 1FC1A 1OD9A 4JZJB 5F89B 4ZUUA 5JO5A 2F5BH 2O6EA 4Y9FA 4DGIL 2JCCE 2AJ3A 1BXVA 4QLRA 4EE2A 4EN2A 3LIUA 1ADQL 3ZYZA 1ACXA 5T1LD 3FS9A 3MLZL 1CGXA 2K7PA 3W0WD 3BZFA 5FW8A 1F1GA 5L4MA 1MNNA 3G9VA 2NY1D 1I3RA 1RHHB 3TBYB 1BA9A 2A9NL 3AUVA 3QZBA 2B1HH 4DZBB 2WBJA 4LVEA 4JRYD 3US9A 5D7IE 1MFCH 3V6FA 2UZIL 3HHSA 4Y88A 4AGNA 1YNTB 3NGBC 4FNUA 1XF4B 2R2BA 2DYSB 5HYSB 4A38A 2FX7L 3QR2A 4XP4H 5DD0L 3OGCA 2CR6A 1WS7A 3O2DL 4U1MA 1CDGA 2A6JB 5EC1B 4D0BA 5K59F 4ADGA 5IG7B 5F6HI 4MNHA 2FO8A 3O2WH 5KYUA 4U1IB 2YMOA 2PPDA 2QKSA 3ZHDA 3UCQA 5MI0B 5FV1L 3L9YA 5BW7C 3EOBA 4GG8A 4L4VD 4QTHA 4HQQL 2DYPA 2JQZA 4MJID 4LMQE 1YN7A 4GSDL 5FKPA 3P0YH 1E30A 2GT9A 2DWTA 2ZOLB 3ABGA 4IJ3C 1QEWA 2NZ9D 4WQOA 4WTZG 4JGUA 5EN2A 1YVLA 1IBHA 4AQZA 5GPRA 1JWSA 4ZUWA 3Q44A 3VAEA 2AJVH 1PAMA 1CE1H 4HFUL 4QHMB 43CAB 4C54A 3VG9C 3ZMEA 4NJ9H 3GKWL 1AAJA 3FO9B 2H0JA 2ZJSH 4C4KO 1Q1PA 1XCQB 1PCXA 1DVFA 3EUDA 3VVVA 1FLRH 2CK0L 5MENB 4YHPB 5EOCL 4AYSA 4L4TE 1GAFH 3K81A 5I1IL 2NY4D 2BHUA 1UA6H 3ETTA 5JORA 5EUOB 4DKAA 1SGKA 1X3DA 4BINA 2ICEC 4ES9A 3NGBB 3AABA 3V55A 1N0LB 4QYAA 1UWEH 3QDGB 4JFXA 3V0VA 2AQSA 3S34L 5CN2A 3L7EA 3MV7B 3APMA 1ZS2A 3PG2A 4J1UA 1MDAA 5KJRH 2YPKB 1C8PA 3OMNB 1U8HA 4WW1A 1L9RA 2PR9A 2CQVA 2EXTA 5FO9A 5AZEL 1D7FA 4Y5VC 2EYRB 2A5UA 4GG6E 4G8AC 1R3KB 5GIRA 1PSKH 4PP2B 4JREC 4IHOA 4IJ3B 1LE9B 2H32B 1EK3A 4GRWE 5J0BA 2ADGA 2IH1B 2V2WB 4H0GA 1XL4A 2VDNB 2APSA 4V1DB 5DT1H 6TAAA 4KPHH 3FFDB 4KUZH 4JX0A 2DQTL 1MIML 3VFWA 5BZZA 4MNGE 5E2VL 4YLCA 2HJKA 2WMPB 1NIBA 3VG9B 4RWYL 4QHLA 2NX5D 3I84A 4HV8B 5IQ7L 2X2JA 2NW2B 4HISA 4JO5A 3EJSA 3BIKB 5BZWA 1RUAH 1MJ7L 4KRPC 2EUVA 2V0AA 3EYVB 3LNIA 1KN4H 1MFAL 1SXNA 1IC4L 2XQYG 1OT4A 4JFUA 4A55A 2CM6A 3NQIA 3QJHB 4J3XA 4O51B 5D2LA 2VMJA 5HYSA 3DECA 5ILTH 2X9YA 4OGXL 3VFPB 2DRUA 1P6FA 3BD5A 4RMQA 2ADJA 3KPRA 1OB0A 4TNVK 4NZDA 3QQ9C 2ICEB 1RK1A 1MSPA 5AZ2L 2K4AA 1WEJH 4U1IA 3REVB 2AXWA 4A2LA 4U1SB 1E4XH 1OGTB 2A73B 2P1YA 2QGCA 2R1WA 3U36B 4HCRA 3UGXA 4XOCA 3I6LE 3LKSA 5I76A 3QUZC 3K91A 4HF5H 3V6OC 2I60L 4Y9GA 1LVEA 1UJ3A 2ZOLA 3HNTH 2XQ0A 4BKSC 5I0DA 4OCRH 5E8PB 4OQTH 4Y5VB 3F65A 4OT1L 5FGBC 5KSBF 5C0ND 3UZVA 3ZE0B 2R4RL 1KC5L 1JWUA 2GTWB 3TLRA 4JREB 4L4JA 2EXYD 1FDLL 4G6KH 4S1QH 4ZXBC 3KJ4C 4DETA 4AL8H 4DTGL 4JRXA 4HMDA 1BZ7A 3D12B 1FIEA 1XCQA 3C6LB 3LOWA 4YHPA 2EEXA 3HNVH 5KJ4A 1H15A 7PCYA 1U21A 3V52H 3ECBB 3FUKA 4Z7OF 5C0BB 3PP3H 2R56H 2B8OT 2DQEL 4OFVA 2G9KA 1XEDA 1NICA 1LNUA 3DUSA 5EUOA 3S98A 3U6XA 5J11C 4KRPB 5DA4A 3MC0A 1QTYT 4WVRA 4M5YH 1CMOA 1E2WA 1DL7L 4ZUVA 2P4AB 2MCG1 2AV1B 3C8DA 4EI5D 2OMXB 2J72A 1ZXQA 4N20A 3MV7A 1PZDA 1I8AA 1MCSA 5GRZA 3H3PH 3V0HA 5K69A 4HKJB 2GABA 1DVQA 3NCJH 5FOJA 4ZFZB 3ZYIA 3LH2L 3L4ZA 2D9QB 2YAHA 4HWBA 4ZMOA 4LOUC 3HC0A 4RISL 1Z3GL 2JI2A 2JJSC 3Q2CA 1CBJA 3NJGA 4JUSA 5D2NC 5BW7A 3G5WA 2V8LA 4PG2C 2LE9A 5B8CA 1R3KA 3QUZB 1UFGA 4E42A 3P3UA 3ZRFC 1TJGH 3U82B 2XA8H 1ZOXA 5E23A 4AW4A 5CEZD 2H32A 4P46D 5INDA 4ANXA 5I8OH 5ABZA 5KVEL 2V2WA 1U2YA 5DEFA 4BZYA 5A2BA 4X7FC 5HVFB 1QHQA 5F9AC 4IKJA 5DURD 3GXNA 3CHQA 1TLKA 2EADA 2B7DT 3P0VH 3VXPB 2EO9A 3AZUA 1BIIB 1KBGL 1T4WA 5ALBH 5I6XC 3IAQA 4ZXBB 3KJ4B 3MLUH 2G5RA 1FZJB 4WFGD 4XXCC 2WGNB 5DMGC 3KE0A 3TS8A 1EFXD 3HUJF 1KJMB 1IILE 1E67A 3PPEA 4YSSA 4OD1H 3SBQA 1Z66A 3FU3A 9PCYA 1IFGA 3NT0A 4FYSA 1J8SA 1KYDA 1X5JA 4PB0H 2FB4H 5FYJE 5C0AB 1UWFA 3QJHA 3VFRB 3OAZH 3OHXC 4JKWA 2BDNL 2WBKA 3VFPA 5DZVA 5J11B 5EBLA 2B14A 2Z31D 2ICWA 4PJFF 1NCTA 1WFMA 1ZJAA 4NCC1 3QYMA 3HC3H 4TTDC 5LB1A 2ZCLL 3VQ2C 2IQ9H 4U1SA 1KTRL 2BK8A 4XVUD 2A73A 2OFQA 4H8HA 1NBVL 2F19H 3FXIC 3WEXB 4WEBH 3JWNC 2KZKA 5C9JB 2G9HB 1R0AL 4JPIA 1WWWX 1SFHA 2BSTB 3H7LA 3WTVA 3BT0A 5AD0B 4H25A 5H2BB 4ODUB 3WMPA 4AWJC 5D2NB 1Z9OA 4NLAA 4R4BB 3KJ6L 4XC3L 5E8PA 2YHGA 3BP6A 3LXBA 3KMDA 2AQ3A 1FFNA 4DEUA 4N1HB 5DWUH 1E40A 2GEEA 3C6SA 4HH8A 2YAFA 3V4VA 3ULSB 4W9LC 5FYLH 5EZLA 1OAXH 1SYSA 2F54D 4YDNA 5I1HL 4PJIE 4KHXH 3MA7B 5AW1B 4HC1L 3E8UL 4MD5A 2P44B 2FGWH 2PR4H 4U1HB 3ZE2F 5CJXA 3Q5TA 3C6LA 1QP1A 3P54A 4G8FA 4ZMTA 4L0PB 2XZCH 5I6XB 4HUWB 3P4NA 5E8NB 1JN6B 5DZJA 4HD9A 4YPJA 2LOEA 1UQSB 4DF9A 2GJ6D 5C0BA 4U6VH 2H0PA 3DSFH 1SRDA 3QPQD 3T4YA 1L6ZA 3WN5A 4ZFGH 4FI7A 2HB0A 3T2OA 4UI2A 1FNSH 5E8OA 2AAAA 3JYCA 1I8IB 1NBYA 1P4LB 1CGSH 4ENED 3OHXB 3SGDI 2XX0A 5IW6A 5HPOA 5AVYB 5HGHA 3MRQB 3NFNB 5IGXH 3V4PA 4MJJA 3KH3A 4HKJA 2KT6A 3H9YA 4XHQA 2Z7WA 1DLHB 1KTDB 2B1AL 3ILQC 5DS1A 1DVSA 2WINB 4ELKB 3POHA 1OP5K 2W80C 2RIKA 4L8CA 1M7XA 1T1YB 4TSAH 1E4JA 4YL4A 3WFDH 5DK0B 1PG7W 2FYVA 2FATH 3BZ5A 2Q76B 1ZE3C 1E9QB 3QJFB 3QUZA 1I9EA 2IDQA 3LNEA 5CUSH 2OYKA 4HUVB 2ITEA 5EHFA 2R8SH 2EE0A 2XG4B 3UERA 3VI3A 4LSVH 3NUKA 4Q9QL 4MJ6B 5EZIL 3D05A 4HKBA 5HDOA 4AYMC 4ZUTB 3FUJA 4NQDE 5IFHH 1W9XA 3TBSB 2VQ4A 1QLFB 1EEYB 4OZHE 3NIFB 5INCA 1BIIA 2IADB 4D8PB 4HKZB 1KXQA 3RWHA 4WW2F 5DCCA 1ZPLA 4LLYA 4BXVA 2DQ6A 4Z7VA 2MTAA 5KW9L 3CLWA 1KJMA 1OY3B 5CLTA 4PU2A 3NSYA 1FVCA 2WCPA 3KCWA 4JFTA 3MRMA 2VL5B 4M61B 4I18A 2ZX8A 1FL6B 3K80A 4QO1B 1OGAA 1EGJH 1QSEE 3U0TA 3MCLL 4X80H 3D4CA 3G5VB 5ID1A 2LFEA 1OLZA 1U3ZA 1CJYA 4G8IB 5EIQA 3W1ZA 1QFHA 2NY5H 4IIQC 4IOSD 3ULAB 4QTIL 2VN6A 4PJ5E 2L7JA 4QRRA 1TITA 3M1OA 2EZ0D 1AKJD 2JVUA 4FFVC 3K1DA 2F1BA 3WEXA 3WEMA 4FG0A 3ZZLA 3ZQ9A 2DL9A 4I0PC 1MNUL 1XCTB 3HEIB 1CG9A 4K3HA 2W91A 3D06A 4K3EH 1K6QH 5TE4H 2IOOA 3KCPB 3AMKA 4R4BA 1H9DA 3L2NA 3VGDA 3VFSB 4XO4A 4PG2A 3MRKB 1FORL 3BWUC 3AS3A 2EO7A 3WI9A 3TURA 3KPTA 4ABUA 1E42A 1QBMH 1PX4A 4XPBH 2D7QA 1Q9WB 4R5TA 3HN5A 1JK9B 2VLRA 1S7QA 5KSAC 4NO5B 3LEYL 1AGFB 4GAJH 5FIEA 2WIIA 2O5ZL 1QWNA 1UM5L 3QG7H 5A6MA 4Y4KC 4G5ZH 1JN6A 4PLKC 4KDTC 4FD0A 1UQSA 2X4PB 2ZSWB 1D5IL 3HA0A 3BUPA 4BZ2L 3DBXA 3KWTA 4ZAKD 3K6DA 2J4WL 4AE1A 4FLRA 5IB1A 4U2ZA 4PTUA 2DLFH 2K78A 3SE3C 5KYNA 4U3HA 3LD8C 3HE7D 5DO2D 2NUPB 4HJ0D 2VDKH 4PBWD 4BFFA 5IF0A 1O6SA 1HJCA 1UZGA 1C7TA 3NFNA 4KQ4H 3VTTA 1EO7A 1RZ8A 1LEKB 1I8LA 3MNWA 1S7WB 1TVBA 3ARED 4ZDHB 1H3VA 3B2UD 3PS6A 4IIQB 2WXHA 1DLHA 3QA3B 4NERA 2TSBA 4RCAA 4MZIA 4LLMB 5C0RH 1PKQA 5JUEL 3GSNA 3SKOA 4S1RH 4I0PB 1E9QA 3QJFA 5AW2B 4Y19D 3HAEH 2XV3A 3ASWA 2H3KA 2VABB 2VO8A 4HUVA 1FO0B 2GY5A 3WE6B 5I5MA 3HI6H 1NFDB 5IM7B 4LCVA 1RAMA 2BSRB 2IAMA 4MJ6A 4AX3A 3IWVA 1JGEB 1RIUL 4XT1C 1HE8A 2K4WA 2WYIA 1NLBH 3D50A 3WS6C 2GAZB 1FGNL 4K7FB 4AUUA 2JKNA 5HDBF 3MLVL 2XJLA 2BC4B 5KSAB 1UZ6E 2BVPB 2CXGA 3MRJA 3STBA 5C0GB 3NZHL 1VAHA 2DDQL 3BAEL 4J3TA 4X7SH 3GLZA 3FULA 1F4XH 2QQKH 4BK5A 2Y2WA 3GXIA 1GZQB 4Y4KB 4WKZB 1UUNA 3IRCA 3A6CH 4LCYB 4LP4A 3Q6FA 2CCWA 3MNVA 4N25A 3FT4B 4QO1A 5F6IC 5DJZB 4CW1A 1NBCA 3AY2A 5LNDA 3GHPA 4HYTB 2R29A 3L3JB 1U4EA 3LD8B 2HKFH 3GYRA 3T0ED 5DEZA 3ULUD 1JDCA 3C08L 3L9EA 1E4WL 1OE3A 2DTML 4AVHA 2V2TB 2ALAA 4FQJH 4N6RA 5IVXF 4YSCA 12E8H 1UD5A 3T8MA 1UZ8B 3HG1D 3C87A 3OJVC 2QZQA 4KU1A 4ANKA 3ZBMA 5SX5H 3ZE1E 5DJ0B 1N7MH 2P45B 5D7LD 1KXQE 2YXVA 4YQXL 3LN5A 1MN4A 1B88A 4RGOH 2WTRB 1QD0A 5DD1H 1V7ML 5E51A 1Q9WA 1JK9A 1QHOA 4FFZH 2B4CH 2NYYC 1JXKA 1A6UH 4NO5A 2C7UA 3DX7B 3QIBC 3OZKA 4DP8X 2J88L 5DI8A 3GTVA 2O5XH 2V4LA 3OR6B 1JMXA 3EJQA 2ZSWA 2QFRA 5TFSH 3TX4A 4ANUA 5GGQL 1HHIA 1MRFH 3WLWD 5ISZE 4GBXD 5ERWB 1UXSB 1Q9KA 3KHOA 1MFBL 1ZLWK 1ONQA 4WV1A 3BVVA 5KBMA 1O7DE 1NGQL 5HHME 2YMXH 1OF0A 2NUPA 5F6IB 4BSVB 1GS6X 2XWDA 3EH5B 3QCTH 4GPVA 4P5MA 1AZNA 3MR9A 4TNEA 1JF5A 3UIZA 2UZXB 4OAWB 4PWJA 1L7IL 4IIQA 4MCNA 4UB0L 1IC5H 3GMNB 1I9RH 1YMME 5I1LB 1I3GH 3AQYA 2WK2A 4IIZA 2FWSA 2JELL 3VU1A 1IT9L 5TGBA 1H6TA 1A3RL 2Y6SD 4KI5F 4HK3J 3UO1L 2YUWA 4I0PA 3EJRA 4FERA 4PJCA 4XMWA 2O93L 1CGWA 1GGBH 3ZKNC 4GKLA 4Y8AA 3O41B 4F8LA 2VABA 1FO0A 1Q1JL 4JFWA 1E27B 4GXVH 5KVFE 2F5AL 1UFUA 2NY6C 5AW7B 2G3ZA 1BX2B 1DDHB 4DESA 5FOBA 5AW9B 3LZQA 3KYKL 4NUPA 1AO7A 1B2YA 1X6NA 1I7RB 5FYKE 2BC4A 4F7MB 5K9OA 5EEUA 4MQ7A 5F1IB 3BAKA 2VM3A 3KLDA 1GZQA 5MEND 4CC4A 3NIDF 4WKZA 1OAZH 1P7KB 4KDTA 4U49A 3KEHA 3HS9A 1VKXB 2DH2A 5DJZA 5DFAA 3FQ1A 2VDQH 2B15A 4L18A 5F9JB 4OV5A 1EIBA 3F7LA 1AGCB 3WFBL 3CC5A 2Q0ZX 3L3JA 4AEEA 1UB6A 1I1AC 3CVCA 3D7PA 2QSTA 2DQIH 4JANB 3NCBB 2CJUH 4PRHD 4XC1H 2LHAA 3ZMRA 1PKQE 8FABA 3O6ML 3QDGD 4RBPK 2PTVA 3MRPA 1ICTA 2Y3NA 3VG0H 4ZMNA 4H40A 2V2TA 1CWVA 1NEPA 3ZHLA 2F58H 1UZ8A 1JHTB 2FBJH 2VSMB 3D0LB 3CLFH 4R7NB 2HVJB 5DRWB 2XZAH 4QEGA 1DBJH 1ULVA 3GHEH 4R4FL 4Y9CA 1YPZF 2X88A 1A1MA 4F9LA 5K9QI 1NGPH 1KPUA 4C47A 5L2KB 4N2IA 4CVXB 1IAOB 1L7TH 2ZX9A 1AQ8A 2NY6B 1UATA 2VJXA 3L1EA 3HMXL 4BHUA 5E03A 5C0DB 4YFLF 5E1GA 1AI1L 4V1DD 4BFJA 4M29A 4G42A 2DMKA 1UKTA 1XMWA 2BOCB 2VMEA 3WS6A 3IDNA 3OR6A 5AB2A 1DEDA 3KL5A 1JOIA 1CLVA 4RQQA 4YBHA 4FQXC 5L7XL 2A77L 5DMIH 1XTMA 2C9QA 3ATEA 1UXSA 1HHGB 2VDLH 1I1YA 2MPAL 4WEUD 4FA8A 4F1SA 5JW4R 1ETB1 2P24B 2FAUA 3WIHL 1KIUB 2OSWA 4BELD 4BSVA 3FTUA 4KXZI 5LVEA 5T1DL 2A74A 3NSJA 5D9SB 2H5UA 4HHGA 1KMGA 2XZZA 4Y4HD 1I1AB 1FG2A 3GMNA 3B8YA 3SCMA 2DEWX 3NPSC 5KEZA 3WHE0 3RKPA 5HHQA 1HL4A 1MLCB 2KH2B 3CQFA 3UIYA 4EMZA 2EC8A 3P30H 3MA9L 1NUDA 1QO3A 2NOYA 1E6OL 4M7JL 1W2KT 3HR5B 3U6RB 3O41A 5KVMC 3GRWL 4YMPA 1E27A 1PZBA 5IB2B 5JHDA 1EXUA 5FO8B 3RPBA 3GF8A 4LLVA 1TVHB 2ZWLT 1JL8A 7TAAA 1DLFL 4ZW5A 3HLAB 4JAMA 3SGDH 3BO8A 2YD5A 4X2UA 5LBSA 4P4RB 2R27A 5T33L 3KL3A 4R7LA 3FRUB 2WZPD 5IHBA 2VUYA 4K0OA 4F7MA 4PRDB 4XHJC 4AV5A 1K72A 5IHWA 4GIPD 3VGAC 4ZO8A 1J87A 4X9GA 1NAMA 2B20A 4ZX4A 5JZ7C 2APXA 2Y06L 1BG9A 3DK2A 2BVOA 2F18A 1CDYA 1P7KA 2MCMA 5ESQA 1HH9B 1NLDH 3LRHA 4FQXB 3D85B 5LCVL 2BRQA 3O6FC 4PJHE 2BCMA 4QRPD 1I7ZA 4KVNH 3RURA 4XNMA 1KWKA 4FG2A 4WUUD 5F9JA 3NDYE 4K8RH 2PKDA 3OR7B 1AGCA 1EO8L 2XX1A 1INEL 3NIGF 4R5VA 1OXYA 4UDUA 3P77B 1HCZA 1VFMA 2RA1A 1UXLA 2WHVA 1TO5A 3C5SB 4A67A 1CPUA 2VXSH 2DWYA 1AH1A 1W72H 2QHRH 4PJCE 1PZ5B 2ZXQA 5AW6B 2FR4A 3IM1A 4WY7H 2AABH 3QQ9D 1W0WB 4J12A 3IGAB 5FDWB 5C0CB 3NH7L 4WO0A 2HJLA 3E1ZA 3NPSB 3PGDB 1NEZG 5KBDA 3D0LA 2E4FA 5CO1A 1VPOL 5D6CB 5IQ9B 2KERA 2CHXA 1VZHA 2HVJA 4AIXA 5BRPA 1JZGA 3DO7A 5JIPA 4ZQTA 1JHKL 3HJ0A 3NTCL 4KMQA 4JRWA 1YEIH 1W8EA 1WZKA 1RUPL 2FO1A 2GC7C 5AWNH 4XWOC 4OM1L 3K6NA 3VCLA 1IAOA 4ABQA 4PJ8D 5C0DA 15C8L 3I75B 3AQDA 4KX7A 1ES0B 3RWGA 3DJSA 2XIIA 2VAAA 4J3OF 2YPVL 4ZXBD 1HXMA 1AY1H 3BAIA 3KVPA 2VLKA 1KTCA 3QNZB 5I15L 2FNWA 4WTZA 5CU9A 3VGAB 2AERT 3HCVB 2BPBA 3K4AA 3PWUB 5DS2A 5I19L 5J6GB 3D34A 2B0SL 5C0AD 3RUGA 4EN3C 5F71A 2I7OA 3DI3B 7FABH 4GKSB 1BZ9B 3O6FB 4FQIL 4XVTL 4KQ3H 2WXMA 1XF1A 3OKOB 1B4JL 3IFPA 1BV8A 4OF5A 1NKGA 2V7HB 4XH2A 5KYWA 3LS5H 2OL3A 3JV5A 3BSZL 4BRJA 3ASOB 1R3JB 3RY6C 3FB5B 4Y2OB 1MLCA 2OJZH 1ROCA 4KMLB 4M7LL 4YWGH 4KKBD 5EEXA 3DOHA 1R3HA 5IHUH 2AITA 4E9RA 4AM0B 3VH8B 1AGDA 4LOUD 4PGEB 1N4XL 2WWOA 3EJCA 5FO8A 1KJ3L 1MQKH 2CJ3A 2P7TA 4BCZA 1TVHA 3EH1A 5IEHB 2ZUWA 1MVUA 3DHUA 3V4LA 1P9MC 5K9KB 2H3XC 4MSWA 3B2MA 4KOCA 2ZX7A 4HKXB 2IOIA 2L0DA 4DFHA 5DFWH 1WFUA 4JFHE 5AW8B 5JIMA 1X44A 3FB6B 2DJ4A 1A7NL 1GOFA 1EVUA 5E9DB 5D8JL 4HPYL 1B6DA 5HJBA 2G30A 4PYGA 4QNPE 1SEQH 3DX8B 1HH9A 1KEML 4CVWA 4E0RA 1LMIA 1ZLVK 3GINA 3D85A 5DMGD 4M6NL 3V2AR 2OW6A 4JFFE 4Y9EA 3L08A 3SJVB 2BFGA 2QQLH 4EN3B 4HW6A 1UOVA 3C5SA 1CU4L 4H1LH 2Y25A 5IB5A 3B5GA 1IKFH 1PZ5A 3TO2B 1CFNB 3QULA 4HXAH 3OLGA 1BYPA 3BVDB 4WDIB 5GGTA 3B34A 1RSFA 3ZR6A 3KWXA 1B3IA 4F9PA 4X7CC 5C0IB 3SYCA 1XSKA 2XQYA 4Z0BL 4ZMWA 4YBQC 3LEVL 1RVFH 2WLYA 4UV4L 2Y7MA 1FRGL 4JFYB 3ZTNH 5JDJA 3IMVA 3QQ4B 1GS8A 2PP9A 4QRUB 4MB4A 3GXMA 1ETZA 1G9MC 3IFOA 2EH7H 5IBTH 4XTRD 5CJQL 4Z7QB 4M9PA 3W0WE 1EZLA 3VW3H 4DCQA 1WV7T 3MLSL 1SLUA 1SOKA 5D1XC 2P9RA 3RJOA 1K8DB 3P3TA 1RPKA 4PYHA 1OGSA 2J21A 4TF4A 3IF1B 1ES0A 2Q8BH 2YD9A 4I85A 5LQBL 3F3HA 3SE8L 4JRYE 4UM9B 3EXJA 1J1OL 4J3VA 3QWOA 4OCSL 4B41A 5FA4B 1ORSA 2GW5A 2PF6A 4M6ML 3GMQA 1TDQA 3MRIB 4AEHH 1G7JB 3FW6A 3TT1L 4AJYV 1KJVA 4YDZA 1J8KA 4CSTA 5EC2A 1HXKA 3JTTB 2YFOA 3S35X 1J8HB 3PXHA 3O6FA 5B21A 3O2DA 5IROA 2EE9A 1J1XL 3EBIA 3DMMD 2I26N 2EDXA 4TVSa 4B3VA 1T6WA 2X2UA 3SDDA 5LWYH 4KJWD 4L4VE 5C0JA 4HCGA 4FLHA 3DC0A 4XBGB 4MJIE 3CK0H 1IGMH 4RX4A 1IGCL 4Z23A 1MWAB 4R90L 2JB5L 3K8MA 4Y2OA 4WFED 1CD1A 1J5DA 4OZGF 2HH0H 1PD1A 3ZTCC 1IGFL 1WGVA 3ILQD 3FOMA 4AM0A 1CQKA 1GC1H 2B9BA 4CSZA 1JZDC 2X3AA 1CT8A 3BUBA 1I1CA 1V5JA 3KVQA 1I85C 2PWFA 4TL4A 2QGBA 4AITA 1Z6JT 1OP3H 1QBBA 2UXGA 4LVOC 4AG4L 1H3TA 4UINH 3HC4H 1S7XA 1R3IL 5IW1A 3K6SA 3I02B 4Y2DA 4ZYKB 2YEZB 3FQWB 4HPOL 1MCLA 2ED7A 2ZNWA 2B16A 1FYTB 3MRLB 1DQDH 2E9GA 1DHKA 4H26B 5D1XB 2FH6A 2G5UA 1E5CA 3FB6A 4NSKA 3U9PL 1U8KB 2UXVA 5AAPA 4PJDA 2FSEA 2H41A 1QKZH 1CTMA 3L9RB 3RZWA 4ZTOH 1FNAA 1WFJA 5A2KH 2ZPKL 2IGFH 4N5EC 5IT2H 3FO2B 4WNSA 5C86A 4L3AA 5KSBB 4LIQL 3W38A 3APCA 3D39A 1MCPH 3MLRL 3KPNB 3B9DA 4F7PB 4EQ2A 2X6BA 1P5VA 4G3YL 2Q1EA 3RIAK 3UBXI 2R0ZH 4GP4B 2Z31A 1CFNA 1EMTL 3HB3D 2CGRH 3GO1L 1JYXA 5DD3H 2GUYA 2G2RB 3GBEA 3HZVA 3ZW3A 3MBXL 3AUWB 3GSRB 2AGJL 2UXTA 3NRFA 1BFOB 3N44B 4R7XA 3LIZH 3E6HB 4PSRA 3GSWB 3X3FH 4DKEL 3SDAC 1E5ZA 1TTAA 2DIJA 2YBRB 2YKLL 4Q6IC 1ZLWH 3UCRA 4UTBA 2XXCB 4JZOA 4YUEL 2WUBH 3A4EA 1U91B 4XO8A 5T3ZL 5HHVL 3Q7JA 1ETJA 4LOFA 4KZEH 4LVOB 2NX5E 1SEBB 2OM5A 3VTMA 4UAHA 2J8UA 4XAWL 2EEAA 4LL1A 4KAQL 3UTSD 4YHZL 4WUKL 1E65A 4KZDH 3LHPL 3ZQWA 5AOIA 4K15A 5KSAD 4PJAB 3C12A 1CXFA 1GZHC 3DJ9A 1PTZA 5IJCC 1KYUA 2JIXB 4PRPD 5DUPL 4OGYH 4QYOB 4YX2L 4B9FA 4X8GA 2NR6C 3DYMA 1MHHB 4Y4KD 2EYSB 2ZQKA 3B1UA 1Z9MA 1JZHA 4FQ1H 2EC9T 2FRGP 1P4IH 1NGWB 1AKPA 3ARPA 3BWZA 4OLWH 2X3BA 1ZHLB 2CDEB 5DHVA 1T1WB 3TXAA 4NZTL 2VUKA 1P7HL 2IQAB 1WCBB 2IBBA 2PMZA 1YEDB 3CFCL 4YLBA 3EKCA 2PTTB 3OB0K 4WGVB 4HHAA 4R7VA 1ZT7B 4NJAL 2AI0L 4HBQA 4KNSA 5F0PB 5D70H 2VQ1B 4HFWB 3FKUS 1CDIA 3Q9PA 3SDAB 1HIML 3IMSA 3GJEA 4FQ2H 4JFOA 4OSUH 3L4TA 4M1DH 2VXVH 2OZ4L 4Q6IB 3Q06A 1FFPA 5I1EH 4MRBA 2BSSA 1XL6A 3AG2B 43C9B 1IE5A 3FQWA 5HGAB 3PCYA 1I7UB 4NT6B 5DJYA 4CA4A 1WF5A 5ACLA 5HI5C 4H26A 5D1XA 3PYCA 4Q0XL 3EOAB 1VFAA 4Z7UB 2I9LA 2EDKA 1KTKE 1U8KA 2G60L 2CK2A 5LHDA 1EHLH 1S5IH 4LLAA 5DXWA 2FHCA 2WLKA 3OKNB 3RWFB 3MTXA 1GGIL 2XBZA 3FO2A 3VUAA 4AK2A 4ERSH 2BS8A 3IBOA 2YD0A 3ARBC 1H5BC 3U83A 4PV8B 5T3XL 4F7PA 2OR9H 4RZCB 3UBHA 4BGLA 2AQQA 2I25N 4ODTH 4ZTPH 1UKQA 4WW2C 1TLMA 3S3BB 4XVJH 1BEYL 1MHEB 2E7HA 2B59B 4I9XA 3VFVB 1YEJL 2C34A 1ZT4A 3BGMA 4G1EB 3ZE2B 2VRKA 3RBSA 2QQNL 3L4VA 2F53B 4AEIH 5F9OL 3S35L 3X17A 2IBZY 3GSRA 5JTWA 1PQZB 1JHLL 4B9JA 4YZFE 2ZCHH 3DHJA 3E6HA 3GSWA 3T0DA 5JMOC 2H3NB 5I2IA 3VU2A 2MQGA 2YBRA 3RHWF 3IDXH 3QARA 3MGTA 4JG5A 4E9XA 2R0KH 4YR6A 2XCMC 4XPTL 1WZ1H 5DD6B 1V27A 3ZX1A 4YAQA 4HSCX 4MB1A 1GTFA 1HWGB 3D18B 4L1BA 1Y6NR 4PJDE 4WFGE 4KTEL 2VCOA 5IHZA 3G04A 2AJUL 3TBBA 3ARFC 4X6CA 4BCYA 5TQ0H 3O3DB 4LSTH 2NYYD 4NZ8A 4QR7A 3D39E 1UD4A 4FFWC 5JXAH 2I27N 5D7JC 2OXGB 3FCBA 3QIBD 4GUPB 2FUQA 3B9KC 3H54A 4OFIA 4QYOA 1O7SA 2BOLA 1JDAA 2WXRA 4L1HA 4QY8B 2P28B 4EQ3A 3RNQA 5EF3A 3FB7A 4L29B 5I30H 1RERA 3HRZC 4NBYB 1PEZA 1AZZC 1KB9K 2A4CA 3X12B 3W9DB 5HI3C 3ARBB 1H5BB 1ZHLA 3HE7A 1FCCA 1T1WA 1NPJA 3A22A 3FQRB 1AR1C 3C5ZD 3U1QA 1GYWA 5TF1H 3VA2C 4MB5A 4HBCH 5KYYB 2VH5L 4WW2B 1GKEA 4NZFA 1I3UA 4EIGB 1ZHBB 2H1PL 2XYCA 5F0LB 3TNMB 3GXUB 3QUML 1JAEA 2XT1B 4NC0B 4ALAC 1SXCA 4D3CH 1SUHA 3WTUA 3I6SA 3CV5A 1I9IL 4JZNA 3U9UB 5I0YA 3UZQB 3BH8A 4HIJA 5F97E 5T3ZD 1MFEL 1A9EB 3CDZA 1ZIBA 4PJGB 3SDAA 2J8UE 2UWEF 3SSGA 1KXTB 2EUWA 2F54E 5JIHA 3ZKND 4NRZA 1M7UA 4U3SA 1KELH 1KBBA 3BZ4A 4PJBE 4PLOB 3T3MF 3DVIA 4BWTA 5IB3A 1IM3B 5L2KD 1I7UA 4MJ2A 1KNOA 5E94B 3U7WL 2GJ6E 4Z7UA 5BVPH 3CFTA 1DQLH 4UCFA 3ARFB 5C92A 3L2MA 1SF5A 3L3DB 1EA9C 4JPKL 1T7ZA 3SBPA 1P84J 2EDJA 4Y1SA 1YHPA 3G5YB 3MRNB 4AMXA 5D7JB 4U1NA 4XCFL 3B9KB 3MTRA 1G7MB 4IRJA 1Y18B 4R0LC 1ZRUA 4AJWA 2NR6A 4K07A 1T80A 4LNRB 4PV8A 5AVZB 1K3IA 1M2OA 1U8NA 3CZUB 3K2MC 4YVNA 4RZCA 3QS3A 5KG9B 2BVQB 7CGTA 3HRZB 1OAUL 1DANU 3CFKA 1KB5H 4XCNA 1HCFX 5DMYA 1MHEA 3EYSL 2HPOA 5B38G 2FX8L 2IWEA 4UT6L 3FO0L 3MZTA 4JKPH 3HI5H 4G1EA 2WQXA 2DLTA 1AR1B 3OKLB 2F53A 2YA2A 4B53A 1A7PH 2WOYA 2BX5A 3O6KL 4UIKH 2E9JA 3DDGA 5IIEB 1R17A 1AD9A 2MJWA 1KACB 4Y4FC 3HG0A 3RX7A 2H3NA 1VGEH 1ZEAH 4KKRA 2AF2A 1O0VA 2VKWA 3H0TA 3CVDA 3FU5A 5EA0L 5B1JA 5DHDA 4OD3L 4X4ME 5DD6A 3L5WA 4AKQA 1DQTA 1NBZB 1JZ2A 2L7UA 5C6TH 2E7LC 3BIAX 25C8L 2LFGA 2VM4A 3P2BA 1U8PB 3CX2A 4K23L 2BSED 1DSFL 1L9MA 4TSBH 3L13A 1F56A 3FU7B 4JFDD 4EVNB 1PIFA 1NUGA 1VB9A 1G1YA 1ZT1A 3DX6B 2CG9X 2OXGA 3CFJA 5JR1L 2D03L 4B9IA 2CJTA 1QRND 5EIIA 4LF3B 4X0KA 4GSQA 1CF1A 4TQEL 1MREH 1GY2A 3GBML 3ZDYE 3GTNA 5T3XD 3AS0A 3BVUA 4N3TA 4FQXD 3Q48A 3F12B 3N55A 1A1NA 3QDMD 2E7BA 1CDBA 1NCGA 4OCYH 2KKQA 2JSFA 4OUUA 1H5BA 5D7KD 3PL6C 4YXKL 3IDIB 5JDSB 1HNGA 2X89A 1OD7A 4HAGA 3S4SG 1FE8L 3T6ZA 2BRRH 2FECL 3DTXA 1BZDA 2X4QA 3QFJB 5IMOA 3DPDA 3KYAA 2DW5A 1T2JA 3Q3GB 2IIJA 2MIZA 3IJ9A 3JV4B 3TNMA 2P5PA 1FZOA 5C0CD 5D4IA 2QADC 3EGXB 3LVEA 3SYQA 4EJ1C 5IWLA 3FOLA 3QDHA 5KVEE 3IKCA 4HJJH 4MCMA 3UZQA 3QXDB 1S9VB 4Y4FB 2QLVB 3BVNB 4PJGA 4I48A 2FWLB 4I3RL 1KXTA 4X6CE 3FB8A 1KYFA 4OJFH 4PIRF 3IKKA 3QVAA 3LYRA 1N59B 3PWLA 4OD2B 4QLWA 4XCEA 5K9JL 1XDTT 2HRLA 3QWRA 2WYTA 4I4WB 4QHNB 4Z3FA 2C9SA 4FEMA 2EO1A 3GIZH 4FTVD 2EIZA 4TLSA 4WU5A 1JGUH 1XGRB 4MMYB 2Q8AL 1JPGA 3IXAA 3GSVB 5JW5B 4JPWH 1FV1A 2V9TA 2VZOA 5IVXB 2Q3ZA 1L9PA 4UTAL 4S1SH 3IFLH 1BD2B 1DUZB 4F1ZA 4MA1C 3DROA 2WWKT 3G5YA 4XHJD 4FXGA 5B4MC 3H56A 2X9XA 4MZRA 1BAFH 3CC1A 5JZ7D 3P4OA 1G7MA 1Y18A 5IV2B 5E24E 1Z3RA 5F7LB 4NP4H 5SX4I 1OO2A 5IJKC 2XETA 5KG9A 1Z1WA 2R15A 3HRZA 5DS8B 1G6RH 2O61A 3S8FB 4KK9C 2CIKB 3F7YA 4P2OD 1NFIA 1ZA6B 3PHSA 3QZWG 3PL6B 1MAML 3PP4H 2HXAA 3OKLA 4ZW7A 1JVOA 1WHPA 4N8PA 1FNGB 2VZ3A 4RDBA 3SQBB 4BSWB 4DQAA 5G4OA 1CXLA 4MQXC 3SE9L 5ADPH 3MOAH 2NY2D 4UMSA 4P8QA 4Y19E 2Y07L 2WOBA 1Q0XH 1RUQH 1UGKA 2ZKHH 2PW1A 2QADB 2WZ0A 3G6DH 2NT0A 1EX0A 5KS9A 5FGCB 5FFGA 1XR8B 2OJ1A 3AT8A 4H4NA 2AV7B 4LKCB 1RJLB 5CJ5A 1JWMA 1F3RB 3F5WB 4U6YB 4CU7A 2H26A 4WO4D 4U6TA 5TK2A 2HMIC 1AHMA 1X7QB 1IU1A 2QSQA 1NIEA 4XWOD 3VMOA 5DSCB 3VSTA 1NEZB 3OPZL 3FTXA 4HIPA 4LU5H 2FT8A 3WS3B 2JKTM 3DX6A 3JXAA 4TULH 2DKSA 4ZS7H 1DBKL 5CILH 1JGLH 2DQCL 5E9DD 1KB3A 3LZLA 1AFVH 4CMMB 5LBGA 4MA1B 1XTLA 4GMTH 2FLBT 3T0EE 1AD0B 2EP6A 3CFMA 1SHXA 4Q74A 2YC1A 4XMKL 3BKCH 2N4IA 3N1GC 4ZT1A 5FXCH 3OJ2C 3QEUA 4RESB 1BP3B 2XU9A 5HI4C 4P9HH 4IEFB 4OLVL 4WHDA 3RI5K 3SJVD 4EN3D 3P9MB 4G6FB 1O9WA 2XWBB 2ZSVB 1S4IA 2R9HC 4NUMA 1IGJA 3SQOH 3TYFA 1ZANH 4GT7A 3JV4A 3HG1E 3P9LA 4P5KA 4AL8C 3UL4A 5I1GH 1JK8B 4XN8A 4EUPA 1KB9J 3CMOL 3LEXA 4PRAB 5D7LE 1PNCA 2EIKB 5F7YC 2NT1A 4JB9H 4JVUA 1TEGA 1HHKB 3HG5A 1Y6MR 1S9VA 3HVNA 2A4EA 5CNHA 3BVNA 3VXMB 4IRZH 2WCSA 3G6JE 4G6ML 3OLEA 3L1GA 4NAJA 3VNZA 4PRNB 5J13C 1N59A 1QNZH 3IRPX 1OTUC 1NCBL 4I4WA 2ZUSA 4HJGB 4QHNA 5J1AB 4QIRA 1G4RA 3VXUA 5L6YL 3K6OA 5I0ZA 3KG5A 4GRWH 2PYEA 4MMYA 1RZIA 4JCMA 3GSVA 2OP4H 3TJEL 4UM9D 1N64H 1BD2A 1DUZA 3F58H 1A8ZA 3ZT6A 4B60A 3V9CA 3N5AA 2L8AA 6PAZA 3CJJA 5IV2A 3FUFA 4JM2C 1YPZB 2K6ZA 4NO3B 4BYHA 1VENA 4OCXH 3VI4A 1DQIA 5FW6A 1J8HD 3B2VL 1CDJA 4WCYL 2XNAB 2CRIA 1NH6A 1QFWI 1ZA6A 2WUCL 1EDQA 2VITB 3DURA 3HJEA 3OJMB 1IVTA 1CFSA 2PPEA 4O02A 1FAIH 1FNGA 2C9VA 3MBED 2IPKA 4OKVA 1HESA 1WZMA 5DUMH 3TN0C 3R1GL 4ZFQA 3UGEA 4GAYB 3KPMA 1LP9A 4K5OA 4NUGL 2P5EB 2I24N 4GAGH 5HJ3A 5AB9A 4Z77A 2K9FB 3RTQC 4IBQA 4LAQH 1HKLL 4YBQD 4IQHA 3DYPA 4PS4L 4Z3IA 3HLKA 4FABL 1P1ZB 2AFNA 1RJLA 1CFTB 4YHOL 4J4PD 3W57A 1CICA 2KYIA 2VN4A 3UH8A 5J13B 1A9VA 1X7QA 3L5XL 1MRDH 2FD6L 1YEHH 5DSCA 1NEZA 5CSZA 2IPUK 2VDRH 5MENE 3K2UH 3WS3A 4V2CB 3MROB 1FYTD 2OMWA 2EEDA 3D9AH 4KO5A 2XPYA 1A0QL 3ZOAA 4Z7WE 5KN5B 4TVPL 3QQ3A 2AJYH 5H37G 4ORZC 1KXHA 1HI6A 4F33B 4PI0A 3MODH 4JO2L 2VZSA 4X5RA 1AD0A 1F90H 4PRHE 1UXWB 2XWCA 4R8WH 3FTWA 3TV8A 4JM2B 4YFDB 3AMLA 5IJKA 4PJ7F 1CN4A 4IEFA 1DO6A 3P73B 1VFBB 1B0RB 5HVWA 2XV2A 2NPLX 2ZSVA 5E5MA 4D9LH 1QAWA 4RNRB 3DX0A 1JGIA 2XC8A 5GS2D 1LM8V 1QUNA 3HS0C 5KS9E 3LKRB 5ANMB 3ILPA 4JFPB 2WV3A 3IMUA 2VXQA 3TN0B 5IBLC 2DY2A 4NNXA 4YN3A 5JQ6L 1P7QB 3DRTA 5I1JL 3TIDB 5BQ7B 1HHKA 3CDGA 2I9TB 2Z7UA 3FN3A 4H1LG 2X9ZA 2DLGA 1F4YL 2NDGA 2L7QA 2O5YH 5FFLA 1SHWA 2P5WB 2D2CC 2YQGA 4YXHH 3H2WA 4K94H 3RTQB 3LKOA 4PRNA 4V1DE 5BRZB 3L54A 3AG1B 4OM0H 3NFPB 3P40A 2E7MA 4HJGA 1SJHA 1T5KA 1USQA 5D1QC 3FZUC 4H8UA 1WFIA 2E7DA 3BP7B 1AIFA 3EYOA 4NQEA 5DEGA 3WIFB 4WWKD 4JHWH 3ZXAC 4CUCA 1T03H 5TDOB 2X41A 3M07A 4AE0A 4OZIA 4TSCL 1LO0H 4M7KL 2IXQB 1U42A 2Y7SA 4ANWA 1I1FA 4MX7B 3WHXB 3RWDA 5KAQG 3QT2A 5I18L 1UOWA 2A9MH 4MASA 1X4XA 1JJUA 4P4KC 1TQVA 5CINL 2ICWJ 1G43A 4P5TA 4UUJB 4HUXA 4PS7A 1XR9A 4W9CC 1MXGA 3V8CA 5C8JB 3BT2H 3S96B 2H45A 4DWHA 4ZNCD 1EEZB 4EDXB 4M6OL 3GHBL 4AY0A 4N5ED 3N85H 3HW7A 1KCSL 5TJWK 5D6DC 2WXJA 2ZXWB 4F91B 5HPMB 1JFQL 1CC3A 5BUGA 5ACZA 3AT9A 3VFOB 4WAFA 4KZCA 4OB5L 1NMAH 3GSQB 4RMTA 2PO6C 3CH8A 3RU8L 2W65A 4WSKA 1NIFA 3OAYH 1WLHA 2YUVA 3BP4B 3HS0B 3CLEL 3QSKB 4JQIL 4P2QB 4PD4K 2QPSA 2IH3B 4M03A 4X9FA 3WEOA 3D25A 4HHWA 1SXZA 1RZQA 3FQUA 3BKJL 1JPTH 2ARJB 1P4BH 1XBRA 1M1XB 4QT5A 5IKCB 3GBDA 4ALAL 2O1AA 1T1XB 4EEEA 1VDGA 2DQHH 2ZX6A 3WIAA 2NY5C 3GEWB 4YHIB 3RPIB 4KOBA 1S8DA 2DWXA 5D1QB 3WXVL 4X6BB 3MROA 2IGTA 5KSUB 1PAZA 3LRSB 2JTYA 3QP3A 3DUUA 1CFBA 4PTTB 2IFGA 5JIQA 1AXTH 4GP8B 1YNKL 4N0FB 4TNFA 4WUUE 3TA3A 2KMWA 4HUUB 5FX3A 5AVQB 3GB7B 5LCVA 4XMVA 1V7NH 5CSBA 4OFYD 3TC9A 4XNUH 1GHFH 3FN9A 3FMGH 3BXNA 4P4KB 3IJSB 1UXWA 3PHQB 2Y22A 2OW7A 4NO2B 4X42A 5IFAL 2W60A 5D72L 2OXHA 2C3VB 1N6QL 4PG9B 3IDMB 3HN8A 3QZLA 3P73A 4EOWL 4KVPA 4S1DC 3B7YA 1LP9E 2CM5A 1R5VB 1U58B 1F5WA 2KLTA 3DOSB 2N0MA 4POZD 3GZPA 1TSRA 4JFPA 1ZWIA 1OHZA 2OMZA 4JN1L 2XVLA 4HCRH 3TN0A 2G2PA 4FG6C 3KXFB 2PO6B 3T09A 3AXIA 2YPLB 1NMBH 4N2KA 2I9TA 1OCWH 4NQSB 3ARRA 1C5BL 1Q9LA 2J7LA 1WBZB 2H47C 4KROD 2AJSH 3RTQA 5I8KH 3OPUA 1IGYA 5DVKA 5BRZA 3NFPA 3EDJA 1SBSH 3EYFB 1LLAA 5DEJA 4XB7A 2YRZA 1JPSH 2WQUA 4MXQD 5DR5L 5HDLA 1BZOA 3WIFA 3VRIA 1SDDB 4G1MA 3CE1A 4FTDA 1ZLSL 4DZ8B 4RAUB 2YPVA 2A3TA 4TVPD 4NHUB 1OM3H 1SJMA 2EILB 4KK6D 3H9SB 1RLBA 4XP4L 1NCCH 5HI5D 1SLVA 2GG1A 3NJIA 1HT6A 4OLUH 1EO5A 5C0AE 2WXQA 3SDDD 3RNKB 3PQYD 4BFNA 4HU8A 3S96A 4QOKB 3AG3B 5IJDC 3JV6B 5A16A 1KGYE 4MWFA 1OTTD 2B39A 3CX5K 3L1OH 1C8QA 3DXAD 5C08B 2TAAA 4I3SL 3P11H 4EXKA 2Q5BA 2K7QA 2P52A 4NGHH 3KPOA 3MCG1 5HPMA 1L9NA 2FJFA 2K45A 4BKLA 3NK4A 4P2RD 1IUZA 4Y5YC 3VFOA 1QR1B 3BSZA 3GSQA 2AZAA 2B3IA 4HG4K 4HWBH 3OBAA 4LASH 2IBZX 1OL0A 1NCDH 1U8JA 4LBAA 4PB9L 3N2JA 4NLHA 4FQQA 3RJDA 2V5YA 5B39G 4MAYA 5D2NE 2AJVL 1R34A 2MWCA 1CE1L 4XMXA 3Q8CA 5DJ2B 5FK9B 4NQEE 1EAJA 1KN2L 4NJ9L 1ZVNA 1QNIA 5FLUA 1W16A 2ARJA 2H32H 5KANG 4LSSL 4LPYA 4Z7IA 3H6AA 5SX4H 2QPFA 5IKCA 1UCTA 3RWCA 4OZIE 1FLRL 2VDNH 4ILDA 2Y1VA 1AE6H 1ZVSB 1DVYA 3GS0A 1OP4A 1YY8A 3WJMB 4OF0A 1I9JL 3EG9B 5D1QA 1OAJA 1UA6L 2EXWC 2VJ0A 1IM3D 2W9LA 2VDKB 1K4DA 1ANUA 3JWOH 1P0SE 1NCJA 1TKWB 4PTTA 1E43A 1WC7B 2FWOB 2Y7NA 4WNQB 1IBGH 2Q3AA 3ARFD 1K5NB 4HUUA 1KZQA 4M02A 3PAVA 4FL4C 4PRPA 4P4KA 1AJ7H 3HI1A 5D7JD 3ZDXE 4MQSB 1FFQA 3B9KD 1GCFA 1PLGH 3QHZL 4NO2A 1KEGH 5LAXA 2WP3T 4DAGH 2XDHA 2NY3C 3IDMA 4PG9A 5KBPA 3VX1A 2DI7A 2YZ8A 2NMSA 3I2CL 1IIKA 1G7QB 5LDSA 3FCSB 5C0FB 4KJPC 2B4CC 1U3HA 2C4FT 5EU4B 1WJ3A 1FGVH 5DJXA 4AIOA 1PSKL 4ZZKA 3QQXA 3G5XB 3GI9H 4Y5YB 1AR1D 3DGDA 4ELMB 2Y9RT 4CRPA 3JWNE 2YPLA 1PZSA 1OT1A 2J20A 2WM0A 5DT1L 1TJIH 3ISRA 4KPHL 4WI0A 3QUKA 2LLGA 1A22B 4LLUA 4H5SB 2RFXA 2HG5B 1L9QA 3PU7A 4MZ3A 3V4VH 4EPSA 5H94B 1A6TA 5HGDB 1PLCA 3NIFE 3PXLA 4YSEA 1JXJA 1X9LA 5FKAB 1SDDA 1RUAL 2O6PA 4XMLH 3SY0B 4DZ8A 1ZS8B 4U0RC 5ABAA 4X5WB 4FQLL 4HEMA 1KYOJ 3L5HA 3H9SA 5DDHB 4HWEH 5ILTL 4AIZA 3W5MA 3RX5A 2VXUH 1ZTMA 2X4SB 1M57B 3EH4B 4AM0Q 4B50A 1OOAA 1NCAL 3GSUB 1I8KA 1QLEL 2BY0A 3EBAA 1DEEA 2BY3A 4JO1H 3U0PA 5LNEA 3OKDA 3ME0B 4RGMC 3GIVB 4FL4B 4N22A 2ZG2A 1R3LA 4FKHA 3CVIL 4OCWH 2BSDA 1CURA 4PW3A 3NJLA 2NY3B 4WFEE 3V4PH 1GOGA 5JHLL 2GTZA 3EYQC 4OVVA 1G9NH 2QR0B 4G8GD 5EUKB 5J7CC 3LV3A 3QFJD 1RZPA 2VC2B 4OCRL 3QE5A 3JTSB 4LPCA 5DZAA 1A4JB 1UH4A 2WD0A 3MDJA 4NI6A 3UZEC 4LHJB 4HIEB 2AEQH 1E4KC 1UJTA 1UCBH 2WKOF 3DK0A 3GMRB 1KENH 4G6KL 5E2WH 5FK9A 1IGTB 5DJ2A 1S2EA 1HVXA 4RSVA 1K9TA 3K72B 5AL0A 4AL8L 4Z7NE 2CE6A 1OWWA 3T0AA 2MMXA 2NXYC 1A1OA 3ZO9A 4Y4FD 2GJJA 2YSSB 4KX9A 4PJXF 3HNVL 4K4KA 1ZVSA 1AQDB 4M00A 2VNCA 1LYQA 2IFFH 4IKKA 3VWJC 4DK3A 5JA9A 3V52L 1O75A 1HXYA 4QAWA 2R56L 2XFXB 3EO1B 1LXMA 2J25A 4B9GA 3SGEH 4G9DB 1TKWA 3QZOA 4GQQA 4U0RB 4M5YL 4P3CL 4NHCH 4HJ1A 5B3JF 4JE0A 3DJRA 2QPDB 3D69A 4WI7A 1MJJB 4FJ6A 1U8QB 1HAUA 3JWDH 3BGFC 1COBA 3H3PL 2BW5A 3NCJL 4XGZA 4Z8FH 5B1KA 1OAQL 2GITB 3V6ZB 1RZGB 1F00I 5A2IH 4RGMB 4XZ4A 5C0FA 3D8MA 2VUOA 4PMEA 3PWPB 1A2YA 3LRKA 3OXRB 4B9PA 2ZYIA 3HE6C 3PL6D 3B9VA 3U4KA 1TJGL 5SWSA 2XA8L 1T5XA 2P8MA 3N1QC 4GW4B 1KGCD 3JV0A 2Q6WB 4R96A 1GYUA 4OF6A 2X70A 5LGYA 5E6YA 3HN3A 3MYJA 1VZGA 1NFDE 2QADD 3P0VL 4H5SA 4X99A 3JVFC 2DBLH 4XAKE 1PJ9A 2OK0H 4TPRL 1ZXKA 4DOHB 4O2EB 2NXYB 3UTSE 4DHLA 5CP7B 2VDQB 1OSPH 3VE0B 2YA1A 2Z8RA 2E9WA 4YGAB 1ZS8A 3SY0A 3WU1A 4X5WA 3VWJB 2F15A 4PB0L 2FB4L 2MH4A 5IVZB 1JPEA 2LU3A 4PRPE 4FADA 4QUOA 2AMUA 4LHUG 2BCKB 4G7SB 5CEYB 2HWZL 1BFTA 1JP5A 1YEKH 2W07B 4P57A 2K8QA 5AW5B 3S37L 1QTSA 4PJEF 1JERA 2P80D 3QJSB 4ZPTA 4KI5D 1S7SB 4NQCB 2XJKA 3HC3L 3T1FA 2IQ9L 1F58H 4NYLB 3BGFB 1M9WA 2F19L 2HT3C 1P6AB 5CD5C 1DBAH 3T2QA 3NSXA 1C7SA 4WEBL 2NXZC 2ZOKB 3AWEA 1B6UA 3BFWA 4NBZB 3K2KA 4UT9A 3S2AA 1L9SA 4G6FD 4KK9D 2ERJC 3JTSA 2M2DA 3IE9A 3WUWG 1N19A 4NENA 5EBMB 5A7EA 4LOEA 1G87A 4JN2A 5AOZA 1LO4H 3HE6B 4HIEA 3GSNH 3F7VA 5I1DB 4XN9A 1GH7A 1T83C 2MKWA 4CU8A 3MJ9L 1IGTA 1F4HA 2C8NA 3K72A 1GSKA 5FYLL 1OAXL 1TETH 4LARH 5DZLA 3S5LG 2NCEA 5HYQB 5B38A 3RL2B 4ZOEA 1W91A 4JKKA 3VXMD 1G7PA 1NC2B 2QVMA 3QZWB 1R5WB 4HEME 2VDLB 4ODWB 2XZCL 3FRPG 3JBG7 5FCUL 4HG4J 4K8RC 3V5HB 3X13B 4A7VA 2DJSA 3IAPA 1CF8L 3NA9H 1AQKH 1T0OA 4ZMXA 3AY4A 4JY5L 4LGRB 4GFTB 4U6VL 5EF0A 3EO1A 4FQHA 4DUWA 5D7SL 1FNSL 2Z93B 1Z7JA 2HMID 3X1EA 5E4OA 5I1KH 2K3HA 3MFFB 1CK0H 2DF3A 3QDJB 1CGSL 2MPVA 5EBWA 5DRNB 3RIFF 1M3IA 4FULA 5IGXL 4B3EA 1MJJA 2UY6B 1QRNA 2QVKA 2OBGA 1J9CT 1U8QA 2HFTA 4LSUH 4XO5A 35C8H 1KLUA 4ONHB 4RFOH 1CGVA 2GITA 2UZYB 2R29H 1F2XK 5HHOB 2ILLA 3CVBA 3ABKB 1J5IA 2OAAA 2WCGA 1XCXA 2BY2A 2D0FA 1J18A 5ADOH 1NCWL 2TSAA 2FATL 4ZNEA 3OXRA 2NXZB 3B3IB 2VR8A 3TVMA 5IFJA 1DTUA 2DWDB 1XVSA 2R8SL 4GW4A 1CUOA 4C56A 2ERJB 2R9HD 5D71H 4JO4L 1CTOA 4KKZA 3UZEA 2OQJB 1NANI 5IFHL 2DMGA 3TOPA 2P5ED 2QHLA 1X7SA 1D5MB 4IOIA 3QEHB 4LEXH 4LESA 3S4SA 2YOCA 4JBSA 2E59A 1OGPA 2BWIA 1KBKA 1QYGL 2HCZX 3OL2A 2XXFA 3TPKA 4JEGB 3Q2NA 3K2IA 2VERA 5ES4B 1A25A 1PL3A 2X53A 3QQDB 1N0XH 1F02I 4NM8H 4NNYB 3A4DA 4LIQE 1EGJL 1SFDA 4MYPA 5CEYA 3AS2A 3L8QA 3QHFH 3N42B 4R7DB 1W72B 5E8EA 3UYOD 4JHUA 3LKNB 1SYVB 1QACA 2NY5L 2CBQA 2HJFB 4HVBA 2C5DC 1A6VH 2CO6A 2I7SA 4K55A 3SDXA 1J5OH 4GKZB 4L3CB 2JV6A 5SWSE 1DBML 4ZFOL 4I77L 2H4EA 4B95C 1G0YR 3L7FB 4K3EL 4Z3GA 4FFYA 2V5RA 2OMUA 2NTFA 3U9WA 2VWEC 3ZT5A 3EBHA