3WGVB

Crystal structure of a na+-bound na+,k+-atpase preceding the e1p state with oligomycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
303
structure length
303
Chain Sequence
b'MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of a Na1-bound Na1,K1-ATPase preceding the E1P state
rcsb
molecule tags Hydrolase/transport protein/antibiotic
total genus 65
structure length 303
sequence length 303
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3wgvB00
5AVYB 3A3YB 5AVUB 5AW8B 2ZXEB 5AVVB 5AW7B 3WGVB 3WGUB 5AVZB 3KDPB 4XE5B 5AVQB 5AW1B 5AVTB 5AW0B 4RETB 5AW2B 5AW9B 4HYTB 5AW6B 5AW3B 5AVXB 5AVSB 5AW4B 5AW5B 4RESB 5AVRB 5AVWB
chains in the Genus database with same CATH superfamily
3EFOA 2FLRT 4WW2B 4APQC 3FN9A 4FG6D 4Q9QH 1I1AD 4QNPE 3G08B 3VXRB 1FL6A 1HHGB 4PAZA 5F7FA 5IROA 3EJZC 4XWGH 3GXIA 3CZFB 4YH6A 5EU5B 3WAJA 4G6JH 1BVZA 2P7TA 2PTVA 4IRZH 1WA2X 3TJHC 5DJZA 1U33A 4MGXA 4NQCA 2DQIH 4WHTB 1FFNB 4MA7H 5PCYA 1QBAA 4PS7A 2ORBH 1JERA 1TQCB 3GNMH 2VLME 4EIBA 2K9FB 2H9GB 1MCWW 2VZOA 4E9SA 5ID0A 4BFIA 4YXKL 4Y4FC 2XWTA 1OAXL 2JTDA 3QFDA 4L48A 3MYJA 1MRCH 1IKOP 1GOFA 1IT9L 5AAMA 4Y4HB 5C07A 4ISVB 4L23A 1R46A 4MQTB 5FM4A 1L7IH 3QO0B 1OL0A 1AACA 1YO4A 2I25N 2ITFA 2X3CA 3H3BC 4MKTA 1ZV9A 3BYTA 1PIFA 2Z92B 3AM8C 3EF4A 2YMOA 4JDTL 3LKQA 2HRLA 3WTUA 1JJUA 3NSYA 2MTAA 4WHYG 2P45B 1CGVA 2CLVA 2NZ9C 5C0JB 5FHBH 1L0XA 3QIWC 4LHUD 3QHFH 3FCGA 1KXQA 1N26A 1IM9B 5DT1H 1KTBA 2XQYK 1IBGH 2AEQL 1PQZB 4ZO8A 2M2DA 3FSOA 4OKVB 5DVLA 3D3VE 1ERNA 1N0XH 3CLFH 3BOVA 3HTLX 4KVCH 3DX2A 5TE6H 4GAYB 4XVUC 3S3DB 3BAEH 3NN8A 2HMIC 3UO1L 2C4FU 4NO3A 2F5AL 2HG5B 5I30H 1YN7A 4D9RD 4RSVA 4J8QA 3E8UH 1G7IB 1GHFL 3Q43A 2VDPH 3E2HB 3IXAB 2XDHA 2EKSB 2IADB 3VXPA 3COOA 2IDQA 5CLTA 4N2LA 3MLSH 2NY3B 4F7KA 4ICXA 2WNWA 1ZHNA 4KXDA 4WI2A 4P2OD 4WGVB 1KBBA 1HZHL 1N5AA 1NGWB 1UJ3B 2V9QA 3IM1A 2VW4A 3DX3A 3LPOA 2MQ0A 4LARL 1BIHA 2HH0L 3LKNB 5ILTH 3K2KA 1R19A 2N7AA 4BFKA 4YZFE 1TTGA 2OSLA 2WLZA 2WQWA 3CQQA 4UQCA 2PCXA 3BDYL 2HRGA 4F8TA 3N40F 2EABA 4MJIB 4Z0BL 1WIPA 4ZODA 5C9JA 1JTOA 1U93A 3MJ7B 3TNMA 4CMMB 1RZFL 3VWJA 1A4JA 3V9CA 2C34A 2B0SH 3QULB 2Y1ZA 1WTLA 4CILA 2HRPL 2BDNH 2CGYA 5I82A 1F13A 2CK0L 4YWGL 1FO0A 1D5IH 1OGAD 2VDLH 3UYOD 4FX5A 4XN4A 1PJWA 4JPWH 3S3PA 3ZE1E 4J7RA 4TNFA 4ETYA 5FFGA 5GISL 4MNHB 4ERSH 4N68A 1BBJB 2EVJA 4YGVB 3V0EA 4I3RL 2ZOWA 2Q2LA 4AYMC 4ABUA 5HDQL 1BF8A 3X3GH 5C71A 1MJJA 3WDIA 3DX0A 4MZRA 4JDVA 3FQYA 2RFXB 4XX1G 2DQEH 1IAIM 1HAWA 3PWVB 1RHFA 1J9CT 1J0JA 2EXYD 1XB8A 3GLDA 1XCTA 3QEUB 1FZKB 4G3YL 4P4RA 4IHBA 4WNQA 2AABL 3Q6GL 3EJTA 1SJVA 3KBHE 4XP9H 4XO3A 2ADIA 3UBXG 3UJIL 1P69B 4WHCA 3P3YA 4I0KA 5KAQF 4OZGE 3HG5A 1ZWIB 3LYRA 4PRPE 1WA0X 4A6YA 3VSVA 2GK2A 1BGXL 1EEZB 5HY9B 3VXQB 3OTTA 4NN6B 4PTUB 5DUJA 4NDMA 5C6PB 4N0UE 3SQBA 1X9UA 5DQDH 3EFFA 5L6YL 2FBOJ 3VRLF 4ZUUA 1UT2A 3NJMA 5IG7A 1EERB 4P23C 4KY1L 2JQMA 2GJ6D 2HLFC 4POUB 4BZ2L 4CSPA 4RMSA 4WI7A 1Q94B 3DO4A 3I6GB 3RIFK 5JR1H 3FN3A 4JFPB 1CTMA 3IDIA 2E7CA 5CUSL 3Q2WA 2V5RA 3GJEB 3W81A 1R3HB 2WXFA 4B9CA 4AG4H 5CEZE 1YMHB 1XTMA 3IK2A 1M9WA 3T4AB 2HWZH 5D7IB 1HL5A 3BT2H 3C08L 2EIZA 3FTGB 3ULVE 4RAVA 2OL3B 3QT2A 5DHVA 5DD3H 2NRDA 5BUAA 2C3WA 5TPWL 4E42B 4KGJA 4ZFGH 1MCLA 4EOWL 3W9EA 5C9KA 4JMXA 1JD9A 3DX4A 2XV2A 2Z8SA 1MCEA 3LNGA 3NCXA 3UCQA 3LEYH 4P05A 3PRZA 2R29H 3SE6A 2PYEB 2FT8A 2K6WA 4RGOL 1GVIA 2RHEA 3F7LA 1MFNA 1J9RA 1W72B 4WI3A 4U6VL 4ODWA 2IO5A 1NAMA 4LF3B 5HVHC 2VDKL 2WK2A 2FUQA 4WO4D 1JN6B 3CDCA 5F9DC 4PY7B 1I8LA 1OPGH 5IBLC 2EH7H 2TRHA 2DKUA 1DBBH 1VDGA 2CDGB 4AVKA 3B56A 3MLRL 5E9NA 3O9WC 2CJSA 1KF9B 3MLYH 4ZFFA 4AJ0A 3D0LB 4LXFA 5FO7A 2IDTA 4BKTC 4WI0A 4G83A 3K46A 3NCWA 2MCG1 1HH6B 1A7BA 2B3IA 2ZCHH 4RESB 4WJ5B 3LS4H 3WEMA 5KN5A 1H6UA 2A74C 4P57B 4HSCX 4D7BA 3SB3A 4IMLB 4LLQB 1UUNA 3MUJA 3TZVA 2EYRB 4IU3B 3N9GH 2W0LA 3GFUA 3MV9E 1BZ7A 1PY9A 2J8UB 3IFPB 4JRXD 2CIIA 1URZA 2IXQB 1S9WB 1HK6A 2A38A 1AP2A 1MG3C 3MV7D 5HP5A 3GWJA 5D8JL 4ZXBB 3RGVD 4NGHL 3FL7A 3PPEA 4IGBD 4NUMA 5J12C 3M45A 1TZHB 2VSCA 3ILEA 4MZ3A 2DYRB 4XOBA 5EC1A 2WXIA 2XVGA 5DC4B 3NJKA 4UNIA 5IHUL 2ZICA 1W15A 4F58L 1OGAB 2VDNB 2I9TA 4UV7H 2RCSH 4F33B 4U3HA 5DC2A 5B8CB 4BBWA 2BVTA 2XTLA 2JJUA 4JKPH 1N10A 5F3FA 2AJUL 5KSBA 4GYBA 4IOIB 2JJSC 3C5SA 4HEME 4ZMTA 4XN2A 2W0FA 1LP9F 4XPAL 3VGEA 5FYKU 2ENQA 1IBFA 3K81A 2XHNA 1YNLL 3P9WB 3P2TA 1E8ZA 5JXED 1KCSH 1OHZA 1KOAA 1BM3H 1SXBA 1X7SA 1I9RL 4NAMA 2VJ0A 4XBGB 3G5ZB 2HKAA 3CBJB 4B9GA 4EZJA 2VCOA 4KX7A 3LS5H 1IM3B 4LFHD 4PRBB 1LO5B 3FT4B 3NJHA 4QOKA 5F7AA 2VUOA 5FUZL 3U9WA 4CJ1A 5CZVL 1KENH 4GG8A 4IIQB 3QISA 4PJGB 3W82A 3F64A 5DEFA 1YPZF 3MCKB 3SDXF 3BGAA 1FG2A 3ARXA 2W60B 3ISWA 2IGFH 2V9UA 3VGAC 2X6BA 3BQUD 1WD8A 3TNNA 4HK3J 1J5HA 1B4JL 1UD3A 2DAVA 4PJHB 4RAUA 5F9OL 1XCXA 3H9HB 3Q48A 4X6CB 5ICXA 5BQ7B 3JBG7 4M1GL 3V4PB 4HCRH 4WWKD 3B6SA 3C75A 3MVSA 4X5XB 3ZMNA 3CVHH 2E7LC 1T4KB 3UJJL 4KO9A 5DO2D 3MKKA 5GRXG 2EXTA 3CHOA 3BSGA 2ADFL 1BOYA 1PLGH 3ESMA 3QIUC 4TMPA 1IFHH 2FHBA 2X4RB 4IRJC 2FB4L 2Q6WB 2RGSA 1AGEA 4UBDC 4P2RD 4CNIB 5K1NA 3VQ2C 2C8NA 2JIXD 4K7FA 1LEIB 1Z9NA 2NTSP 3N0AA 4LQFL 1IE5A 4O2CB 1RZGB 1ACCA 2X9XA 1J8RA 3H6AA 3IETB 3RL1B 4M7KH 4OGYL 5IJBC 25C8H 4JRYB 2AQPA 1AXTL 2QKIA 3BGFB 3J8F7 4W68A 5CGYD 2MCPL 2IFFH 3BVNB 4I18B 3FYIB 3NJNA 4P07A 2XPZA 3ZOAA 5FO2A 4XPGH 2YZ1A 3RJOA 4LASL 2W9DH 2WNXA 1F11A 3DYPA 3ABZA 4QRPD 1KWGA 3K71B 4XC1L 3VI3F 2AANA 2EXSA 4FNPA 2FWOA 5EZPA 2VABB 4NAJA 4L9LA 5JOPD 4GKSA 3CXFA 4R3SB 2B15A 4KKLD 4XOAA 4H8QA 1I3UA 4PBXA 2M1KA 1TYJA 2OJEB 3IDXL 4LCIH 3UGEA 1LHZA 1NC4A 3CXHJ 4Y2LA 5L4FA 3H2WA 3FCSA 5INDA 2F8XC 1SY6H 2QQLL 2BVYA 4ODXA 4PB0L 2P5ED 1IILE 1CLYL 4UYPA 4ETQB 4C4UA 3F6JA 2ZP8A 1CVRA 3ESPA 1T7ZA 3GK8L 1XF3A 4JRXB 2CK2A 3JVGC 1J9QA 3FCUB 4FNSA 4R7XA 3MV7B 4IRSD 4KPHH 3V4VA 2B08A 1CQYA 4AMXA 4WTZA 3CCHA 1KYFA 5ESQA 5T3XE 4HZ1A 2OSYA 4N0FB 2VLKD 5DWUL 5D2NC 3U7YH 1BPLB 5DD5H 2IVFC 5EOTB 5JW5B 4HEPG 5ICUA 4ZUTB 3WIIH 2V0AA 4RSYA 3VMPA 4K23H 1LO4L 5F7NC 2O93L 4FQHA 1F6AB 3PWPD 2R2EB 4N25A 4FNQA 1DBKH 3JTTB 5D1QC 5C08D 5DMIL 1NKOA 4WFGE 3US0A 1KLFB 3R06A 3TN0A 3DTXA 2YUVA 1NJ9B 1CGSL 4DZBB 4X80L 2FQDA 2QLVB 1L9RA 2EE6A 3IF1A 2OSWA 3C12A 4XMPH 2ICCA 4MMXC 1CDUA 3KHQA 1QZNA 2X9ZA 2DWEA 1A4AA 1AI1H 2ICES 2VRQA 5ALCH 2LTQB 2TSAA 2L7EA 3MRPA 3I75A 4P9ML 2OMXA 4U6YA 1FSKC 2D3LA 4G7SB 3CFMA 2OMUB 3GSNB 4W4OA 4UIKL 3TYFB 1UWYA 3TA4D 4U1MA 1T1YB 4PW4A 3P2BA 2V7NA 3FQNA 2FYYA 3UXFA 1JHLL 1KCBA 3CN1A 5GZNC 1SEQH 2A5UA 2VISA 3EYFB 2BFVH 1WZKA 1AO7B 1EH9A 2Y2WA 1PD0A 2VL5A 5CMAB 3PGCA 5EOCL 2ZX7A 3QO1A 2CNZA 3DMMB 3U46B 3UC2A 3LNEA 1HXYA 3BQUB 2H0JA 4O2FB 1JTPA 1DZBA 1UWEH 2OK0H 4CMHB 4JCMA 1JPSL 1IGIL 3L08A 5B1JA 2VC2L 1L9QA 2BSEA 3OB8A 1JZ7A 4WWKB 4J3OC 1ECZA 4X5QA 2V2XA 3IGLA 4RFEA 5DJ6A 4C56A 3E1F1 4Z7UA 1VZGA 3SQRA 2DLTA 1WP6A 4BV1A 5JHMA 2F1AA 3AXIA 1UB6A 3QNYA 3KMDA 3ALPA 4G9FD 3GINA 4QF1B 1TPXB 3HHRB 2WVVA 2OA9A 1OE2A 3BPCA 2JIXB 1UM6L 4JNXA 1DJGA 4N2NA 4RBPK 2A6DA 3EHBB 3S36L 2AEPH 3UZVB 4W9ZA 3N2JA 1JXKA 1MHCB 2XVLA 2FWLB 3HHMA 4FZEL 1W8OA 5JIQA 4YOKA 1NKGA 1P2CA 3X1GA 3G6JA 5H94B 5F3BB 1FWXA 1I4FA 3SDDD 1H3PL 5FYJE 1HWGB 2NX5D 5CN3A 4HGWA 4Y4HC 5HYSA 3WL9A 4YFEA 3HPJA 3B5TA 1IJNA 3GIVB 1XIWA 3R8BB 3VXSE 4Y5VC 3HKFA 4BIKA 4XN9A 1DTUA 2A9ML 1KGCE 1PPIA 2B20A 3RBSA 5I1DB 5JHLH 1KPVB 5ESAB 3CH8A 1I8MA 3S37L 1A8ZA 2BWIA 3TEXA 4LPVA 1SHWA 1KWKA 1SPDA 4X7DC 3C9NA 3VWKA 5D1ZB 3QB7C 2OQJA 3NIFF 4OF6A 1DLFL 4KNQA 2C9SA 4BWTA 2VH5L 3KBFA 3RX5A 2P5WE 3DXAE 4IBYA 4ODUB 2WXLA 4UQ2B 2J3SA 2ZXBA 2Y0SA 5G4MA 2F58L 1KLGB 4XHJD 3ZL1A 1IAII 3NIGE 4WSGA 1T0NB 1NIBA 3ARDD 2VXUL 5DYOA 3VFSB 1K8IA 2BP0B 3F7KA 4IRSB 3QCTL 3RWIA 2NNAB 3ILDA 4A68A 4H20L 3NCYP 3FO0H 3PP3H 2GTWB 1TZAA 2YK1H 1KG0B 1F18A 4X5PA 4Y5XA 1UGKA 3LZQA 1H5BA 3QUZB 4N9OB 2V3EA 3WMPA 4PJEF 5B39B 2ZF8A 4PJFB 3QDGE 4W93A 3BGMB 2OMZA 3GBMH 1XH1A 4KVNH 1TTFA 1CICA 4P3DA 3NK4A 4ESKA 4MA8H 2WWKT 4CADA 3LQZA 1WIUA 1O6TA 2AZUA 4R7NB 2D7MA 4LNVA 5B3SB 2HX8A 3VD1A 5KZCD 2WQSA 2XKUA 2R7EA 2D31A 4ATTA 3A4AA 4KMTL 2YAPA 4A7SA 1GYAA 5FKPB 2YUWA 1A6AB 1ND0B 3L8QA 3O0LA 2AGJL 3D06A 3KPQB 12E8H 4D0BB 3QORC 3QDJB 2CUIA 4X7CC 4LVHB 3U0WH 2A99A 3LSOB 1ES0B 2YMXH 4H8VA 2D4DA 3KEDA 3MXVH 4MMZC 4OVUA 1TQWA 3MRKB 3SGJC 2C7UB 1E7UA 4F15B 1S78D 5T5FH 1FH5H 2X4PA 1CF8H 5ANMA 1DVTA 1E6OL 3OR6A 2PTTA 3N40P 2HA1A 2CIKA 1MIML 2O26U 3Q9PA 3GMQB 3B43A 3O6LH 1EWHA 3T3MF 1QI4A 1I85A 2DIBA 4BFRA 1TSHA 3LH2L 3TONA 2NZ1A 1IC0A 1JAEA 1S7SA 1KIRA 1LDSA 2HZHA 4FRWA 4FXGB 4JFXB 4FG6C 4ECNA 1EFQA 1DR9A 5D7LE 3UTSD 1I1AC 3QJZA 3GF8A 3SOBL 4K94H 4R8WL 1U58A 1PX8A 1Z3GH 2Q8AH 2IALB 2FIRT 2CAKA 2DQFB 1NICA 2K78A 4HJGA 5E4OA 3B7TA 2K0RA 1I1FB 1WFMA 3O4OC 3RURA 1UASA 2BJMH 5C70A 1REIA 5I17A 3WIFB 4XMWA 1LP9B 1PJ9A 3KPRE 3MCLL 1BWWA 1MI5B 1R5IA 1CGTA 4R0LA 1AE6H 2WIMA 4FQ2L 3RAJL 2BSSA 4BSVB 1KIPB 2A9BA 1KZYA 1D9KD 4JQIH 1BVLB 1HXMB 3FT9A 4NN6C 1V3MA 2W59A 2D0FA 2WCPA 1FHNA 1KPUA 1X3DA 5IWLC 3MLUL 1K4DB 4J4PD 4W9KC 2WNKA 4WTXA 4P46D 4F2MA 2BNUA 2QTVA 2J5LB 5EBLA 3U4EB 4IBTA 1SQMA 4FG0A 3W9DA 2NX5B 3G5YB 1CZ8H 3KDPB 1OM3H 3MRBA 1YPZB 5D2NE 1U4FA 1X5LA 2P47B 5I5MA 2VDPB 3FRPB 4JFDB 2VITA 1BFTA 3FCTA 2CJ3A 1MNUL 4JFZH 4RAHA 4B5EA 3V0AC 2UZIL 4P59L 4F7TB 3DTDA 3AW5A 1SF3A 3APCA 4PCSA 5FFLA 1VEOA 2LOEA 4JZOA 3MLWH 3DGGA 4H2CA 4XO4A 4KZDL 1MPAL 3BE1L 1N2RB 4PSRA 4BWUA 1OAUL 1IGMH 2EE9A 1Q72H 3ARYA 3DX9A 3IJSA 1FVCB 1II4E 1R5WA 1XEUA 4NQDA 4FA6A 4XAKD 1DL7H 1AZUA 4LMQE 5TFSH 2ENSA 1U3HA 1KY6A 3P4MA 4UMGA 2GW5A 3SY0B 2WAHA 3F7PC 2JCCE 3L4TA 4QY8B 3SD5A 1IAKB 2CXKA 4HS6B 3WFHA 2ZNXA 3F05A 1QSED 3PGDA 4N2IA 5CBEA 5AOZA 3D8MA 4OLXH 4AGOA 5T1JA 5MI0B 1S9XA 3K3QA 2VDLB 1C5DA 5EUOE 4NRXA 3UO8B 1AHWC 3NZUA 4P04A 3JT2A 4A2EA 1JCVA 1K8DA 1A9BB 5CJBA 4L8CB 3VXUB 3K5RA 3VD9A 3T0ED 3BP5B 3NMEA 4LNRB 4G8IA 5E8NB 3KPNB 4AWJC 1MW0A 3VI3B 4UDUA 4X5RA 3ZYIA 4P2OC 5HHNA 2YGQA 2Y22A 2ZJSH 1EDYA 1ZKAA 5CBAA 2N0KA 1P4IH 4X2UA 1PIGA 5AKSA 2WO3B 5EFIB 5HGHA 4KI5F 1VIWA 1B0GB 4MA1C 3MRJA 4XNUH 3BUYA 2HKFL 1UYWH 1PYWB 2FJUB 3CSYB 5K9KA 2ADGA 3N1FC 5IREA 2K6ZA 5T1KA 4HUVA 2EC9U 4E0RB 2C1PB 3PQYA 1A7OL 1CL7L 2YEQA 3G7TA 4JM2A 3H9ZA 5IVNA 3AT8A 2HFTA 4WU7A 3UAJD 2VUYA 4JO8A 5FCUH 1QRNE 5K59E 1RXLA 3CQPA 5AVSB 1QTSA 4K5PA 4KTDL 1EFXB 3CN0A 3QI9D 4KKRA 1FL5A 2YXMA 3E6HA 4KROC 2PN5A 3Q2LA 1ZSHA 3EG9B 5E9DD 4UM8B 4YSEA 5BUPA 4X6DE 1DFBH 2CALA 3TWYA 2EXYC 2WTRB 4G7RB 4NC0B 5IVZB 4LBEA 3S35L 4XE5B 5DHXB 2YAFA 4BUQA 3HRZA 1MFVA 3DRTB 1GAFL 2GSIB 5IMKB 5JDJA 2EDYA 2VR7A 5DRXA 4AQEA 1T1WA 2ZSWA 4Z3EA 1D9KB 4Q2ZA 4WEBL 2E6PA 1YNKL 4K8RH 2EUVA 3FAXA 4RIRA 1AGFB 2X1XR 4W9EC 1A6ZA 4U1JA 5DK2B 4FHJA 1DBAH 3BUDA 1J1OL 3WGUB 3IAPA 3V52H 1P5UB 3STZB 1CMOA 4F5CE 4NUJA 4OSUL 3MRLA 3DKHA 4X8XA 4DKFL 1V7MH 5FB8B 1M57B 5GSVB 3EJQA 5H35A 2WWOA 4PJ7A 3TS8A 3PIQA 3RNKB 5AOLA 2ILLA 1EV2E 1WAEA 3LV3B 1KV3A 1P1ZB 4QCIB 2QFPA 4AQZA 2W95A 4H88H 4QEGA 4F7PA 3EXLA 3WKPA 4UAHA 3ATDA 4GG6E 3VYPA 2J1XA 4H5SA 4MXWL 1I1CA 3S5LG 5JDSB 1CFNA 2C7FA 3L6FB 4KDTA 5IGXH 2GY7B 1P9MA 3VFTB 2WSPA 4PSPA 2VN7A 1JI2A 4WTQA 7CGTA 2FX9H 4M6ML 1YEHL 5IESL 1FO0H 2X05A 1T22A 1BJ8A 3LN4A 4FFZL 4JFED 4ZMAT 4B0MB 3RZCA 2YARA 5EC2A 1T7VA 3D0VB 4P2YA 4WO4C 1QNZH 3S34L 3C87A 3ZIYA 2R9HD 2A6IA 2V3DA 4M8QB 2H26A 4NWTH 4EUPB 3ULUH 1VKXB 3GI8H 2WQUA 5F88B 1DYZA 2RB8A 4P3CL 5CEZL 4WV1B 5D1XE 3MBXH 4L8SC 2FJHA 4V1DE 5I0WA 3KWTA 3IU3A 3JWNC 4ZFOB 1A14L 5AW9B 3UP1A 3ULVL 1OTTC 1DZ0A 4LLUA 3K6NA 4PV8B 3QQ4B 4LSSL 4OQTA 4U3SA 2FX8H 4QGYA 4YHYB 5IV2B 3QXWA 5DZVA 2EDKA 5IBTL 4YSTA 3G9VA 4A6YH 1SGKA 4OZIA 4UCFA 3O6KL 3IJYB 1IKNA 4B96A 3JUZA 4HWEL 4U1SA 4GP8B 4XGZA 4QD2E 2BY1A 2X4SB 1DVFA 5SX5K 4QRTA 3BZEB 1DQQB 3BW9A 2QT6A 4ODVH 3GJFA 3RGVC 4TUKL 1Y6MR 3I6KB 4IGBC 4G6FD 3QXUA 3QBTB 4GEIA 2FO4B 5I1CH 4LO9A 4O5LL 3CG8A 4XCCL 3T4YA 3VRIA 3SO3B 2XWEA 4Z7QE 5JA8B 1J18A 4P5KA 3D85D 4EI5A 1L6PA 4TUJB 4MSWB 5FW8A 3SPVA 4DCQA 3MCG1 1XF4A 3J7HA 3MV11 4PJEB 5E1AA 5LGHL 4QO1A 3RFZA 4QRUB 4MRCA 4ZYKB 3BXNA 2UWEB 3CDGB 3P30L 3SCMA 3UTPD 1IEAA 3ATEA 5DHVH 4M61B 3QUMB 3CVHB 1MCKA 4AW7A 1E42A 2B1HL 1CXIA 2Z4QA 2XV3A 5CEXB 1CLZH 2N1KA 3AS0A 2LTQC 5GIRB 1G6RB 1DVZA 5JXEC 1KXVA 1IC1A 2O61B 1D6EA 2EINB 4X4YB 1JPGA 3NJLA 1M1SA 3QEQE 5H4ZA 1S7RA 3T08A 1B3JA 1KYUA 4JFFD 2NNCA 1UWXK 5SX5H 1NCTA 1Z32X 2KHAA 4DESA 3VH8A 5D5MF 1NAMH 4KI5D 2AQ2A 1YMMD 4QIRA 1CXKA 2NZIA 2IPTL 5D93B 4POZD 3QXAB 2E6JA 2BM3A 2KKQA 3KM2A 4LSPH 4E9RA 2VRKA 3DPBA 4WK4B 3HE7B 1TFPA 3IMTA 4AQAB 1YC8A 3BQUC 4MDJB 1AG6A 1ASPA 1XBRA 2YEZA 1C5CH 3EO0B 3OB0K 5AENA 3T3MB 4J3TA 1ZPUA 3QEGL 3JV5A 1JXFA 1VEPA 1BLNA 4EKJA 1PG7X 2WIIA 3TBVA 1WBXB 3C5ZD 1E9QA 3L17A 4PGDA 5BUGA 1H19A 2X7LA 2WBKA 4ZDHB 4X0KB 4DPBX 4PRHA 1IGCH 3C60D 5DO2C 4RGNB 4DK6A 3WDHA 3ATBA 3RX8A 3QP3A 4W9LC 2MCAA 3FUHA 3OJDB 3CZLA 3I9IA 2NW3B 4XVSL 5T1DH 3SGDH 3IKCA 4I88A 2R0ZH 4NZRL 2NY5C 1U42A 4ELME 5I5JA 5K33A 2BOBB 1WWBX 2C9XA 1BM7A 1I8KA 5DS1A 2MOGA 1KIQA 1LK2B 2FD6L 4F7MA 1MEXH 1PFOA 4S0TD 4HKXB 2ESVE 3X14B 4JFUA 3MFGB 3FC8A 4UOW0 2UY7A 1ZHKA 1U3NA 8PAZA 1NDMB 2OR8A 3DRQA 5CGYC 4A37A 2MQ3A 1EEUA 1E7VA 3Q8CA 1P4BL 1HHKA 2K3HA 2CSPA 4EIZC 4LKXA 4YXLH 3AUWB 1YEJH 4LLMA 1OLLA 3KHOA 3K2UH 4WHDA 4JG5A 1LDPL 4XX1E 3S2CA 3TTSA 3TURA 3L9BA 1RUAH 4OIBA 3FQRA 1C9SA 2V7HA 3D18B 4PGCB 4A67A 5BRQA 4YNYA 4JG0H 5TDPA 1G9MH 4E9LA 3GMMB 4M5SA 1B6UA 2QQKH 4PJXE 3I3DA 5EN3A 1U8CB 1QSVA 5MENB 2G2RB 2IH1B 2MKWA 2O1AA 3MJGX 3PHQB 2V17L 4UZSA 5FYLH 3RI5K 4ZUSA 1UQSB 1QVOA 2AJYH 4DPRA 3HS0B 2DI9A 2OMBA 5CJOL 1GXEA 3JV0A 1QFWL 1J0KA 2L04A 1L9PA 3QH3A 3THMH 1KEML 5C2BL 3HR5B 2FJGA 2LU7A 3QEHB 1MHPL 1TNMA 2B5IC 1BVKA 4YHMH 3KG5A 2M8XA 2X89D 5KW9H 1HIML 1S7QA 3HCVA 3SGEI 3W0WD 4AH2B 1FORL 4YQXH 1MH5B 4KTGA 5JORB 1GKOA 2UUDH 4K9EH 3VI4E 5IJKC 1MFDL 4J3VA 4TPRL 1OP3K 4EN3D 1AS7A 2GB2A 3IPFA 4M7LL 5I8EA 5ADPL 2R2CA 2BVQA 3IJHA 4FFVD 2HUHA 2XY1A 4ZFQA 5H2BB 3X11A 4OCRH 5C0IB 4Q56A 1RK7A 4I0CC 4FTVD 3K4ZA 5HYIA 2XRAL 1CD8A 2HAZA 2NQCA 5T3XL 4GSDL 1B6DA 1YAIA 3L3KB 2I85A 3EJCA 3IN2A 3QFJE 3V7MA 2JJTA 1MFEH 3VFGH 1MFCL 3X13A 4JX0A 1K6QL 2YAHA 1NGXA 4HUWA 3WXWH 2FQEA 4HHAA 5LBSL 3ARBD 3A5VA 1BW8A 3MX0A 4HLJA 2EIKB 3UADA 2XZCH 3DSNB 5FPIA 2E8ZA 2HJLA 3H9SE 3ULUF 1GS6X 3MJ8A 5C0AD 1FFPA 1H6FA 5EHFA 2IAMA 4BELD 1HWWA 5KBNC 1TNNA 5EU3B 2DRUA 5DUML 2GCYA 5E94B 2VMDA 4JGJA 1UD4A 2ZOKB 1WEJL 4PI2A 2E9JA 4XI5D 1LWHA 4FEMA 4D7PA 4UNUA 2V6HA 3V5KA 4GUCA 1VERA 3ZDWA 3FPXA 3C60B 1BF2A 4HUMB 4JPSA 4WW1B 3T3PE 4F2FA 1A7NL 5C8JA 1JZFA 4LL1A 5I1JH 6TAAA 1FCCA 3AAZA 1QFWM 1P7QD 4KKPA 1UA7A 3EGXA 4QKTA 4NWUH 1F1AA 4KHTL 5ALBL 1IC5H 3KXFE 3ZT7A 3HG1B 4ZSOE 3ETSA 3NCCB 3D3VA 2W0KA 3DUHA 1F4XL 2YPKB 1CI5A 3L5WA 3OAUL 4GAAA 3ABLB 1Q0EA 3HC4L 1YQVH 1CDHA 3DROB 2AJVL 4APXB 1ECYA 4YXKH 4QTHB 4X8GA 1AZZC 3AMKA 1XXDC 1F4HA 1SYVB 1OAXH 1UH2A 2EP6A 5C0BE 3MROB 1E4HA 3DVNB 3MO1A 4Q97A 1AMYA 2BHUA 4OB5H 1IT9H 3L3OC 1OE1A 3ZKMD 3X1NA 1GOHA 4CL7A 4DJMA 3RYMA 3TO4D 3PWLA 3LQMA 2APFA 3CD4A 3SDDC 5IQLA 4Z77A 3HLAB 4YAQA 2W65A 4WK2B 2ICEB 1YLBB 1XGRB 1KN2L 2C3XA 4YC2C 2FBRA 4JDTH 1MCHA 1WAAE 5ISZA 3TCTA 5IROD 1ORQA 1E4XL 2J57A 4NKDA 2UXFA 1W8EA 3D4ZA 5G5DA 1NBYA 1CLVA 3HE6D 4U6HA 3VA6A 4GI6A 3TBSA 3EYOA 4O00A 1AD9B 4NXSA 4ZK8A 5FM8A 5LO7A 1JVOA 1CVSC 1XCQB 5L0QB 3ZLQC 3L3DA 3GTVA 4BE5A 1SLXA 5LNEA 3FONB 1IAIH 3HUJE 4TLTA 4BK5C 1KEGL 4XHJC 3WTSA 3GBNL 4YHIB 3ARDC 1NOAA 2ZTBA 1EO5A 2AXHA 2NY2B 1CTOA 2F5AH 1JGVH 1HILB 1TEGA 2AEIT 4NQQA 4GO9A 4HXAL 3A22A 1KJVA 5FYJL 4HPOL 1GHFH 3O4LB 4Z0XA 3P69A 2ZX6A 2JFCA 3OD3A 1GIGL 4O02L 3VB9A 1P7HL 1O0VA 1RAMA 4WF7A 3W0WB 1FBIL 2H3NA 4N85A 3CU7A 5DQ9B 3VQMA 1DJIA 1JDDA 2DWDB 3QNXB 2ZUUA 4LARH 4K5NA 3LH8A 3R7QA 4P9HH 2HH0H 1I1YB 4U1NB 3TEZA 4FLOA 2XA3A 5LCVL 4MXVE 2AKRA 2B8OT 2X6AA 2FBJL 5BRZB 4OZGA 4UZUA 4PRPA 3T1WA 4Z0BH 3A6CH 5JIKA 1SOKA 1RULL 1AG0A 5BVPL 1SXSA 5E6RB 1V27A 3WE6A 3RVTD 4N0UA 4LP4A 2HRPH 3L45A 4YHLL 1E65A 1S78C 1DUZA 2CK0H 5HXMA 2CDEA 4GRWB 3FKUS 3FSZA 2MOVA 4HZLB 1T3FB 4QXVA 1XGTB 4V11A 1DFXA 1IC7L 1S9VB 4HF5H 4LPUA 3L1FA 4K8RD 3ARBB 3BT0A 1RUQH 5GISH 5KSBF 4TQEL 2FQFA 5LLIC 5CSBA 4P2QE 1A3LH 1M05A 1KNOA 3U9PL 4LCWE 1P84K 1DHKA 4LLDA 4XXDA 4IBWA 5E8OA 5HDQH 2L7UA 3DIFA 1P4LB 1ZLEA 2K4WA 1FGVL 3KPMB 3T1FA 1ZHBA 4G3YH 3DUSB 5ICZA 3TASA 1X5ZA 5IT2L 1IQDA 1WPCA 5D7HA 4HXBL 4P48A 5AAWA 1T21B 1UURA 1MCJA 4OBRA 4DUVA 3UJIH 1MHHB 1UD6A 2E6QA 1WC7B 3UTOA 3M6DA 1QBMH 1P7QB 3F5WA 3LN5B 3BPNC 4HK0A 1XR9B 2P8LA 3TA3A 1B9ZA 5AVZB 3KYNA 4XC3L 1ZLVH 3VWJD 2Y72A 5L6YH 1IEBA 5EO1B 1Z3RA 2DYSB 1UATA 2ARJQ 4HIEB 1CGYA 5E7BA 2V33A 2V9RA 4KK8C 1SMAA 4GP5B 1D5BA 1OARL 1ZS2A 3TO4B 5D5MB 3VYNA 3EFOB 3MCYA 4P46C 5CUSH 5DMJB 1JUFA 4K07A 1K3IA 1JFQL 2FTAA 5A3ID 4K55A 5CJXC 1NM9A 3RQ3A 4EQ3A 4YE4L 3ULUD 3FB7A 1LO0H 1WUNT 3O41B 3PL6A 1VGEL 3UPRA 4EZKA 3EIFA 2AQ3A 5BV7B 4X9BA 2B7DT 3C08H 1CFQB 1CIDA 2C9QA 2X2IA 3MFFA 3O3EA 4KDWA 3WUWB 5EN2A 2D2CC 1U30A 1RIVL 1XX9C 5TPWH 1OAKL 1BPVA 2E7DA 5K9JL 1EA9C 4EOWH 2VZSA 5CGBA 2FJSA 1U8KA 2G3ZA 3PAUA 2IQ9L 2QVTA 2NT0A 3MUUA 1RZJL 1HCZA 1T83A 4NQCB 2WVUA 4J3UA 1NCGA 3OPZH 4S2SA 2XG4A 3CUPA 2NY1D 5JYMA 5LQBH 4ACPA 2JKWA 4RCAA 4D3CL 1E3ZA 1UJTA 3MNZB 4UU9B 1ED3A 4PIBA 4RMUA 3WD5L 4BKSC 3QJUB 4M3KB 4U6VH 3FU8A 4BFIB 3JV6A 2VDKH 5L2KA 2DEXX 5D6DA 5IMLA 2XWTB 2XVBA 4XO5A 3IAGC 1T2JA 4UF7C 4HUKB 2BVOA 2ZIDA 3MLRH 4KJWD 5C07B 1NUDA 1JF1B 5IMOA 4Y8DC 2XNAA 1C1EL 1GGCL 5IHZA 4PP1C 3V6BR 4I8DA 3L5IA 2DLFL 3WJMB 2X4OA 1PZ2A 1GKEA 2SEBB 1J8SA 1GGUA 3EBHA 3LKQB 4FQPA 3ZKXB 5L9DL 3T0EC 4RDBA 4KRPB 2CLVB 1CF1A 1E6JL 5CIPA 4HSAC 2XTJC 1SXZA 3U83A 2NTFA 2LAGB 2CD0A 2K6YA 3BWUF 1AOHA 1HOEA 1O75A 2XX1A 3WG7B 5A6LA 4G6KL 4GQPH 1MW3A 4OLEA 1HHHA 5M94B 5F7HA 1G0YR 5KOMC 2PTUA 3ESOA 1NUFA 4JZJA 2AK4A 1GSMA 3PNRB 2Q8BH 1MCRA 2BIIA 4F58H 4PBVC 1V3JA 3NN8B 2JKTM 5FXCH 1TUPA 4JHBA 4EXPX 2EE2A 4NO3B 1FA4A 4OFPA 4OUUA 4U33A 3V0IA 4H40A 4DERA 4AZ8A 4PJ8A 3WY3A 1DDTA 2N1TE 5GGRB 1T0PB 2AJUH 1TVHA 2XPGB 4PG2A 3GMPB 4UM9A 2WLLA 4Z1PA 3VXPB 3QI9C 3B1UA 1A2YA 2L4OA 1UC6A 3CVCA 3N04A 2FH8A 2JWYA 1ZHNB 4BXSV 3KDMB 4LSUH 1N5AB 1WGOA 3WHXB 3SBWA 1V8HA 3K72A 4N6RA 1CD9B 3TZVD 1I9RH 4NC1C 1TZOA 1UB5A 4M9OA 5MHSD 4NZJA 4KTEH 4EI6B 4KGLA 3WNKA 3FULA 4XXCC 5KBMA 4N2AA 5FUZH 4ZMLA 5CZVH 1U8PB 2I9LA 5SWZA 5C9JB 3A6BL 3TNMB 4NO5B 1KB5A 3L9YA 1JZGA 4Z7OE 1DJHA 5TF0A 3A4EA 5KYYA 4EZMA 4JFTA 1FO0B 3IFLH 2OYMA 2AMUA 2VNCA 3WIAA 1R3IL 4UB0L 5F9OH 4WY7L 5HI3D 4J3SA 3FRUB 1DBJL 4L0YA 2Y4SA 1KFAL 2F54E 1ZT1A 5AYUH 2OI9C 2FO1A 4Z7UF 3W3BA 1AFVL 2DL9A 1MJJB 2C5DC 1MN4A 1NL0L 3QHZL 1QEWA 1XCTB 4P4RB 1TMCB 3I3BA 4HIIB 3APDA 3O3DB 1QWUA 5A7EA 1H9DA 2BNQB 4NI3A 4PVMA 1U6AL 9PCYA 5I2IA 1DE4A 5CZXD 5E03A 1ZVNA 2DQ6A 2PXYB 4LQFH 5T1MA 2WBJA 2DBLL 4QOKD 2NY1B 5IB3A 3ZR6A 2OMTA 1MKFA 5GRJH 5I1LB 5J13B 3G6JF 3SQBB 5FYLD 2WUBH 3OSVA 4OZHA 5DMGD 4YEEA 4AEFA 5F93C 5IG7B 3TT1H 1AANA 2G3MA 4WKXA 1NAKH 3IDYB 5FOBA 4GQQA 1GW6A 2XSKA 1MXDA 5LBSA 5I0DA 3MV8B 1FAIL 2YC1B 4Y19E 4WCYL 1INDL 4XC1H 4P23A 3AWGA 2GITA 3AZUA 4JY5H 4PPTA 4HG4J 2R9HC 4OTXL 2A6JA 2A9NL 3IDXH 4ONGL 5IY5B 4E9YA 2Y1VA 2QHRL 4X99A 2EIZB 4PB0H 4YDIH 4AT6B 1CLYH 5DHVB 1FZOA 3AWEA 5JW4N 5E8PA 1E5UI 3LRMA 5FAAA 3T0WA 3W39A 5KBLA 4Z18A 3M8OL 2H47C 3W9EB 3ELAT 2VZUA 1PTZA 4GXFA 1FYTA 2PWGA 1Q90A 1EZVY 1PZ3A 5FGCB 5JPMB 4GSRA 1CXLA 1KLUA 4H25A 1DANU 2VO5A 1OAQL 5DWUH 1FNGA 1TG8A 2YKLL 3MNMA 4ICWA 1MCIA 1QFWI 2Q87A 3HS0C 5DWPA 1PSKH 3NZ8B 4ODWB 1NAMB 1LO4H 3WENA 3U7WH 5AZEH 4R7VA 4XVTL 3FHAA 3X1EA 5DK0A 1IEHA 3ZY7A 4MYWB 4Y1SA 3VDAA 1FZJA 4JL1A 2HT3D 5DMIH 1V10A 3WFCL 2VM9A 1J1XL 4GW4A 4ZFFB 3RE0A 1CFSA 1CGSH 1JVKA 3APFA 3B9KC 5JIIA 4WDIA 2OCCB 1M71A 3Q1EA 3QR2A 3CFBA 3F2LA 1NCCL 4KO5A 3DSFH 1EO8L 3HMXL 1SOQA 4LFHG 3LD8C 4LRIC 4L3CB 4Z3IA 2W92A 1NC4D 3CN4A 1QO3A 1C5BL 4EO5A 1XSIA 2DM2A 2MPAL 1TCMA 4R2GB 4ZMPA 1EANA 3HNVH 4FNRA 4LVEA 4UIKH 1T04B 2A74A 2NCEA 1P7KA 4I1NB 3ZQWA 2P8PA 1JHLH 3WMQA 2B9AA 1AP2B 5I5IA 1J7VR 3LDBC 2Z7UA 1M3JA 1VACA 5JHDB 5EOCH 1ZVYA 1SUJA 1ZAGA 1T03L 3BMWA 4MB4A 4KI5C 3RKDD 1TQUA 6PAZA 5C3IA 3RWEA 1AKPA 2KERA 2OTWB 2YA2A 3R4RA 4POZC 3WN5C 2XWBA 1JPSH 2IH9A 1IGIH 5AQ0A 2VC2H 3DARA 2H7WA 2MEJB 4ORGB 3RDTC 2Q86A 1BQUA 4O02A 3VXSA 2ZWYA 4PJ9B 4GH7B 5KSBB 3PNWA 3TN0D 4OCLC 5DF0A 1JDCA 4OQTH 4Y2DA 1TTAA 3FZUD 1UACH 3C5ZC 4WFED 3B9VA 5KAQG 2W0FB 4B97A 4CUCA 5LCVA 2FCBA 3B5HA 2P5WA 3AXHA 3DXAA 3LRKA 5DZLA 4NN7B 4UTAA 4DTGL 2F74A 5DJDB 2NNFA 4IS6B 4NPKA 1NFIA 1UM6H 1WFOA 2DDQH 4WRLA 1FL3A 2R69L 2XTJE 3GJFH 3GUTA 4XH2A 1X5HA 3T6XA 3ZUCA 4FN0A 4DKDC 4GW1B 3ZYJA 1DVUA 4UAOC 4FZEH 1GGTA 2EDXA 4RMBA 3ZRSA 4TVPE 5E1IA 2RQEA 3GMRB 1WVZA 1JF5A 1H3PH 3A67L 3QDGA 2GBTA 2G9KA 3GYRA 4GRLC 4HETA 2IPKA 1X7QB 2QEJA 5I74C 3TJEL 5I1GL 4PRAB 4YDVA 3TXAA 4RAUB 5IQOA 5J0BA 4KJQD 5ICXB 2C1OA 2VAAA 2C3GA 2Z91B 1OCWL 3S37H 4LB8A 3PGFL 5G4OA 3QUXA 3RX7A 5LAPA 1RJZA 5I1IL 5GJSL 2Y2YA 4JVWA 4C56D 3GXUB 1RFDH 4FLQA 4DGIH 1DLFH 2BSTB 2WY3B 2Z31A 3CTTA 4JKWA 4UT7L 1BEXA 2E7LA 2VH5H 1ZCRA 4GFTB 1XVSA 4F7CA 1OTSD 1QBLL 2A7BA 2FX7H 2HJKA 2O30A 3KLLA 4ZZFA 5B39G 1AGEB 1PLCA 2QDVA 4KXZI 4EMZA 3QIUA 3QCTH 5BJTA 4K7FB 4FADA 4IRJA 5EBWB 1IQWL 1CDGA 2HLAA 1FGNL 1JZDC 3SKNA 3WO3B 1V7NL 2YD4A 5TDNA 5AVRB 1ZY9A 4FQXA 4UDTB 2W88A 1EUTA 4YSSA 3BAIA 1DEDA 2QKIB 3LZNA 2BPBA 3KGSA 3MXWH 2R1XB 3Q6FA 3NRPA 2ZQKA 2XXFA 5GGVH 4DGYL 3W38A 1JWMA 5EG6C 1F11B 1N18A 3DV6B 3FW6A 5D7LA 5JHBA 3JZ7A 3RIAK 3SGEH 2CPUA 1YN6A 1KBPA 4L9LB 4U7KA 2AP2A 1U36A 4CA4A 4KMTH 4NO0D 5DUBA 3VWKD 3FCSB 1J9TA 2QVIA 4EN3C 4ODXB 4AYFB 3TV3L 1YEIL 5DI8A 2VMFA 3KPRA 4YHOL 2Z0BA 4DOHB 3CDZA 4FFVC 4XMKL 3NDYE 4D9QD 2BSBA 4MX7A 3OMIB 3F58H 1E6OH 2F8VA 1AIFA 3V4VB 4GIPD 3CFEA 4R4FL 3CCHB 4GS7B 5EOQL 4JM2F 4LEOA 3I2CL 4OV5B 3ULSB 3KLQA 2N0MA 3T0XA 2CE6A 3LH2H 3U9UA 3L9RA 3CFKA 3QNZB 2HXAA 5D2LE 3ARBC 4GBXB 1AQDA 3P02A 3ZBMA 4FQHB 1O5DT 5D2NA 4HUCA 2W07B 2F1BA 3LVTA 3IJ8A 5F9WC 4M5ZL 5FLUA 5EZLA 4QRRD 3VQ1C 1W2KT 3SOBH 5E2UL 2OXGB 1GZHC 2NMSA 1S4IA 3R06B 2YQBA 3TN0B 3DTXB 4PY8I 2VLRA 1MQKH 2R15A 3SE4C 4ADIA 1T1ZA 1F4WL 1A6WL 4IDJL 5TF1L 2R0KH 5ABZA 1BAFL 2D2OA 4XI5C 2P1YA 4HYTB 3ZN6A 1HQ4A 4OM1L 3NAAH 4FABL 4HGMA 2ZF9A 1P4UA 5TQ0H 5IHLB 3N5AA 3MRPB 3I75B 1U41A 4GKOA 1TYEB 1JE6A 1VPOL 1R17A 2OMXB 4MMXA 4C57C 3LKSA 4OCMC 1N6QL 2I5YH 3BP7A 4ZAKA 3WELA 4FQ2H 3RAJH 2Z4TA 2FECL 2UYLB 4JRLA 4U1MB 5K9QG 2V7NB 3FQNB 1U9KA 4F9LA 4A7QA 3OV6A 5C2UB 5DZNA 2XBZA 2JCCA 3RGHA 3FRPG 4X6BB 3S48A 3FN0H 2FGZA 3MLUH 4NNYA 4PJDA 2VL5B 2JTYA 3PGCB 5AVTB 3OWRA 3QO1B 4YFLI 1DSWA 5IOPA 3ZT6A 5LDUA 2ATPA 4XNZB 2R39A 3ZKMC 4OF0A 4HJIA 1HXYB 5HYFA 5EUOA 3OG6B 3FJTA 3K74B 4PJ7F 3D7PA 3MODH 1CBJA 1KT2A 3KR3L 1MNUH 1J8HB 2UZIH 1QRKA 1XO8A 1WFJA 2XQYG 1BXXA 5IROC 4KFZC 1MJ7L 2V2XB 2VJXA 4RFEB 2CBTA 4G70B 5DJ6B 4KZDH 1CB4A 5KYUA 1MPAH 3HE6C 3LQAC 4JW3A 3T6QC 2BS8A 3FTUA 3QQNA 4AENA 4LIQE 3QNYB 1UB6B 4Y5YC 4AC4A 4GUPA 3BUIA 4BA8A 1CYGA 1HNFA 2EDQA 4ZD3L 1WLHA 4F8QA 5DD1H 3BPCB 1N7ML 4RDQF 5TGBA 3TX4A 5EEYA 1VGKA 1M56B 2YSSB 2WTOA 3VX1A 3UYRL 4CKVX 4GQ9H 2K45A 3BIBX 1UXWA 2GJRA 3NSFA 3GZOA 1P2CB 3G6JB 4G6AD 3VM7A 1I4FB 1BVNT 1QRNA 5I28A 3O8XD 3HB3D 5HYSB 1HHJA 3WL9B 3KJ4C 1ODAA 1KY7A 1XIWB 1JZ8A 2XV0A 3DDFA 1V3KA 4W70A 4RQQA 4AV0A 4BQCA 4HT1L 1I8MB 4X6DA 3U30B 3W37A 4OZIF 1R3LA 5LVEA 3BLBA 1U8MA 3C9NB 1GMEA 3VWKB 3CXHK 1CDJA 5HDBF 5A16B 4LMQI 3GKWH 2J43A 1F41A 3D39D 4HHWA 4NQDD 1JV2B 5F96L 1S7UB 1Z7JA 2GAZA 5SV4A 3S8GB 1BREA 2DKMA 4JO3L 5F3HA 1CD0A 2HKFH 2GTZA 1U3HD 4J2QA 5DYOB 5HJGA 4W6WB 3QDMD 3RWIB 1NWOA 3FQ1A 1ZMYA 4KUZL 4KI1A 4ONFL 2JB6A 2XZAL 2OKMA 1WZLA 1CL7H 1I3RB 4FQIH 5CINL 4HVBA 4Y5XB 1H5BB 2EUXA 2WGNB 1YJDH 2Y07L 3O3BA 3BO8B 4RGMB 3NESA 3OLEA 3UG5A 4XNBA 3WY4A 4PS3A 4F5CA 4N4YB 2NLJB 4QHUA 2V5TA 1CICB 2XQ0A 3FO2A 4A2FA 5FUCC 1QFOA 2BNRE 1QYGH 2G30A 3CHXA 3O11A 1CS6A 2APWA 5AZUA 5IHWA 4M43L 3JYBA 1CK0L 2CBQA 2F9BT 2R7EB 2VQ1A 3OAZH 3S35H 4AUYA 1HL9A 1XTLA 3GSUA 1Q9OA 1GAFH 1IGFL 4GAJL 5E4EC 1MRDL 2BVEA 3GM8A 3QA3A 1I31A 1B3IA 4LCCB 3CDFA 1TEYA 2I24N 4A04A 4WEBH 1NLDH 4FMKA 3ZZ1A 2X4PB 3QORA 4NFDA 3VWJC 3OR6B 4EQ2A 1ILUA 5T1KD 2CIKB 4MMZA 2E3VA 2NSMA 5DJAB 5SWSE 5GGSA 4JM2D 5BPPA 2LVEA 3BH9A 2GQHA 1X5IA 1S7SB 1KIRB 4I3GA 3MBEA 1OP5H 4GRMB 4JGUA 1BFVL 4DKFH 1XGQB 3RVUD 1XDTT 3FB8A 1ZJAA 5A3IC 4V1DA 2XUWA 1BZ9A 5D96C 2BHZA 3AADB 1FFRA 4UT9L 2HKHL 3KH3A 3ULUC 5E9AA 1CYWA 5HHVL 3HMXA 4YLBA 4WEEA 3DURA 2VN6A 3TF4A 4JPIB 4AQ1A 1KCUL 5DMYA 1S7TA 3CIAA 3ZTJH 4K3JL 1ZLUK 3L3IA 5DRNA 2CGRL 5FCSH 3RY6A 3W56A 5JOEA 2Y6TE 3T2PA 3F7VA 1OXYA 3OAYH 2DQHL 4I4WB 4WI6A 4HFWA 2ZKHL 3PJNA 4LPCA 3BQVA 1YEHH 5IESH 1Z5HA 1SJHB 4UWQB 3HHSA 1GJUA 3H42L 4EUPG 2NY1C 2QPDB 3VXRE 2PUQT 4GKNA 2BS71 2IDSA 3CQFA 3MRNA 1CDIA 1XGPA 1AZNA 3BAYA 1KPUB 4Y2OB 1N8OE 1YA5A 4AUJA 3IDYC 2BNUB 1JWSA 3L7EB 3OR7A 3S34H 2B14A 3UEZA 2Q0ZX 3MUY1 4YSPA 1MCPL 4G80B 5IWLA 2R4SL 3FDWA 4LLAA 2BSDA 4P3CH 1AJ7L 5CEZH 1H6TA 1Q0YL 4HCFA 1IRAY 4NQVB 4RLDA 3KPLA 2X4NA 2VITB 3H3PL 2D7QA 3FCTB 3EYSL 1ZGLM 3ENEA 2ZXCA 3HI1A 3ZMEA 2EICA 4DQAA 3H4HA 1R0AH 4S1QL 2X2JA 3EO9L 4ZTEA 5IBTH 1QPXA 3DGGB 3T0VA 3WN6A 4E9VA 4QXWA 5JQHC 4NUPA 4M6OL 2GT9A 4HWEH 1D3CA 1R5WB 4NQDB 4HV8A 3ZL2A 2LVCA 5F1IA 2IFGA 1JZEA 3D4YA 3QEQA 3TVMB 4TTDD 5AW1B 4LHUA 1GGIL 1U3HB 2P44B 4TUKH 5J9PA 5FW7A 3BZFB 3IEAA 3P4MB 3L54A 1BXVA 1TJXA 2MMXA 1INEL 1FNEA 4O5LH 3O0RL 4XCCH 3WFHB 4QNPF 3FB5A 5CBEB 2AI0L 1IIIA 3QRLA 4TSAL 5DMKB 1S9XB 3ZPDA 4FFYL 1I8LC 5BS0B 3C6SA 1B0WA 2PO6D 2VMJA 5I6MA 4YEFA 2BSCA 4NRXB 3HLKA 3KYKL 2VDRL 1XR8A 1BXAA 3LHPH 3P30H 3UBGA 1K8DB 4R90L 4Q6IB 1L0QA 2A83A 2R8SH 1E67A 2OYLA 3S98A 2QR0B 4KKBC 2XKSA 4HAKA 4ZX4A 2LLGA 4MAYD 4F91B 2NUTA 1JVLA 1KXHA 1WISA 4XNMB 2OMYB 3ABMB 3EJYD 5G2NA 3TZVC 5CBAB 4ELMA 3N0PB 1KXTA 4ENED 4CKQA 1AVAA 3U1QA 2PCFB 1DVFD 2AQQA 3NPSC 3MRJB 3NFSL 4OZFB 1B88A 1QLEH 4CVZB 2ESVA 2IPTH 2CBMA 5K9KB 2ADGB 2WD0A 4HUVB 5T1KB 5KBDA 1A1NA 1B2WH 2J44A 1OSZB 5LUMA 5FFOA 1M6OB 3LIZA 1L6ZA 3PQYB 3VE0B 3RNQB 2VQUA 4K3EH 4E41B 4EI5D 3QEGH 2EVHA 2WXOA 1QHPA 1BBDH 3PP4L 1FL5B 3PV6A 5HI3C 1BQSA 3E6HB 4A2MA 4AXWA 1WZAA 3SCMD 5AL0A 4QHMA 3QFGA 2DMBA 3MRQA 2C3HA 2R1WA 1GJIA 1ZXKA 2J2ZA 4AYSA 3VFWA 2DYPA 1VJSA 3WTWA 1KPRA 3VTTA 1FDLH 4LBEB 4OZ4B 1AR1D 4MA3A 4MVBD 4NZRH 4PJXA 4FKKA 4XP1L 4B95C 4DHLA 2GIMA 2VXTH 5CZXC 3WV0A 2FD6H 3GTTA 2DWYA 5DRXB 4BKLA 4UTBL 1NM4A 1NWPA 4AQEB 2ZSWB 4J6RH 2DQCH 3WEXA 4YDZA 3OF6D 4Q2ZB 3W11D 4FQ1L 5DMGC 2DTMH 5IB1A 4EVNA 4B60A 1P4BH 3OKEA 3P9LB 1TTUA 1J5DA 5MEQA 3K6FA 2LAAA 1S8DA 2VXVL 2Y9RT 1UHVA 1F58L 3FTXA 4CSSA 3PXJA 1YEWA 1RHHB 3VD3A 4WZ9A 3A0OA 5H35B 4DVBA 3VI4A 4OH2A 4PJ7B 2APBA 2O61A 4NRYA 3BP6A 1F4YL 3DHMA 1NUGA 2B77A 1AGBA 5HPMA 3SKOB 3F62A 4F7PB 2QZQA 5EF2A 4K9EC 3BPLC 2ZXWB 5FGRA 1J05A 4H5SB 4DQOL 5HHOB 3WGVB 1VCBC 5E08H 1KB5H 3S4SA 4PV1C 4E5XA 2ENPA 3IFOA 2NY6B 2KLSA 1WWCA 3HRPA 1XQ4A 2CLRA 4X9HA 3ZE1F 5B1BB 1R4XA 4N8UA 1QFWH 5AW3B 1T22B 3LN4B 1KEMH 4OD1H 1XD0A 3CX5K 3RZCB 4A55A 2QKIC 3C2AL 5BZWB 2AC0A 5EC2B 5DC9B 3H9SA 2QSCL 1XSJA 4UQEA 4R5TA 4LSVL 5C0CB 2J1YA 2J1WA 2A6IB 4G7YL 4FL4C 2JK5B 1RK0A 5GGTA 4PWHA 1U92A 4MXQC 4NAQA 4PGEA 2F53E 2FJHB 1Y0LA 4JM0A 2D7NA 4L9LC 1E4KA 2PYEE 3IU3B 5HYJB 4OZGF 3CX2A 4KV5E 4LLUB 4OFQA 4A2DA 2PPEA 1W0VA 4M7LH 4R26L 3O6FB 4O2EA 4ANKA 4MCYA 5HHPA 2V8MA 1EGJA 3FQWA 5D7EA 4ZTPL 1NGPL 4QHNB 4OZIB 3KXFA 2XRAH 3VFNA 1A65A 1WFNA 4ZSOA 4U1SB 1T5XA 3G6DL 3LZRA 5T3XH 4GSDH 5HDBB 1DVFB 4NQEB 4QRTB 4WKZA 5TH2B 4AI7A 3BW9B 1IBBA 4DPCX 3BWUC 1BZDA 1K6QH 5CCKL 1H3XA 1B0RA 1RKRA 5C0BA 3SDCA 5F21B 5LBSH 3BKYL 1QKZL 4MAUH 5JOFA 3LCYA 4Z7NE 1WBZA 4YK4C 4BQ9A 4JUTA 5IFJA 3U0TA 5AW2B 4AK2A 3VRIB 3T4YB 5IIEA 3QIBA 4IGBA 3U6XA 5JPNB 5DUMH 3SPVB 3VFVB 4XVJL 2E9IA 1TETL 5E1AB 1WAAA 4XP4L 4QO1B 4NM8L 5ERWA 2Z65C 3FAWA 3LEVL 3ILPA 4LKCB 1BSIA 4FZ8L 2G5BB 4JPVH 4XZUA 1A7NH 3FZUC 1RP8A 4CGTA 1M7IA 1WBYA 2Z4QB 5F0MB 2W9EL 1ZIBA 1XBDA 4HIHA 4M00A 5F0LB 4L3EB 1AR1B 2K7PA 1TQTA 4TOYL 4WIQA 5ALBH 3UJTL 4BCZA 4N28A 1P6AB 4JFVA 5D70L 5INCA 3HUJA 2WNGA 1AZBA 4W4OC 1JPGB 2EH8L 2JKNA 2KUTA 1XL4A 2VLMD 3PDDA 4KZEL 4JE0A 2G4GA 3O2DL 5JXEA 1XGUB 2L0DA 4GMSL 4OIIH 2DN7A 3IYLW 4MB5A 5TTRA 1HE7A 2TAAA 5GRVL 35C8L 3SD2A 1M7DA 2A1WH 4G1EA 3U1SL 3DPBB 4JDZB 4QPEA 4XNZC 5IJDC 2NXZB 3NSCA 4D0CA 1CU4L 3P4LA 5DEJA 2YEZB 1KN2H 2IAMD 2VDOL 3QZLA 3IKKA 3N43F 1E4XH 1QFUL 2DTSA 3KNBB 5B1JC 1BLNB 2WIIB 3Q0HA 1VRSA 4KJQC 3VVWA 1MW2A 5F44A 1E9QB 2P8MA 2PYFA 2QHLA 2NXYD 4PGDB 1RV6X 2X7LB 3FQUA 4PRHB 2MQCA 5F1OB 2WJ7A 3UTTB 3VMOA 1IAOA 4LVOB 2JCWA 4PWIA 4OJEH 1JGUL 4YUEL 2BIQA 4NCC2 1ET7A 2ENJA 3B7UX 4KXZH 1OTSC 4BGLA 4CBZA 3FFCE 4PJHE 3GBNH 3D3VD 5C0RL 4BGDA 2V2WB 3BAKA 1I8KB 3H2QA 4XOEA 1RZKL 4X6CE 1JGEA 3Q2NA 3T6VA 1WITA 2ZZUT 4TVPL 3DO7A 3K80A 4Z3TA 1H15A 4JZNA 2Q76B 4HXAH 4F57L 5FYJH 3K7UA 2WXHA 1DVYA 4HKZB 2HFFA 1KBWA 2UY7B 5LHDA 3DRQB 5GS2H 2Q9OA 4P2QA 1GIGH 2AFNA 4EI0A 1HHKB 4O02H 3PAZA 4LCWA 1Y6NR 2H0PA 3HKZA 2P26A 4Y9FA 5EPMB 4LLMB 1QPKA 2K7QA 2CPCA 2XBTA 4JM4H 2QTEA 1AIZA 1FBIH 5FV1L 3B4NA 3SKUD 4QYAA 4UT9A 2BP8A 2QGBA 2BSRB 1MCFA 4KK5D 1IVTA 1RCYA 5LCVH 3FQRB 4K71B 4QRPA 4NJAH 2V7HB 4HLZH 3VAEA 5I24A 5D4JA 4JRYE 4UTAH 2E76C 5G55A 2E4FA 4XBEL 3K6IA 4YHZH 4ZG1A 1RULH 1SFHA 4LAJH 5LG1A 4L29A 2CR0A 1LM8V 1E8XA 1IGJB 2YAMA 5DJXB 2AJSH 4YHLH 4ZUSB 5F71A 3HFFA 3OM3B 1QVOB 3CZJA 4JL2A 2K8QA 4MCZB 1GCYA 1MLCA 5E6ID 1BYPA 1C7SA 4JFOA 3BWZA 3V4UH 2DY2A 3QH3B 4F20A 1RK1B 3DUUB 1VA9A 4RGMC 1FN4A 4HD5A 2VLKA 4Y4KD 2XA8L 1AXSB 4WJG3 2Y6SD 3FUIA 1TTRA 4N90E 3QAQA 1A1MB 3S3SA 3HC3H 1S7QB 3HCVB 1ZANL 3I9GH 1DQML 3NPZB 1NEZB 5IT2H 5EORL 4HXBH 2ISDA 1D7CA 1G7QB 2EDTA 4G43A 5BZDA 3ZTNL 4QXTA 1MELA 1E3FA 4XB7A 4HJEA 3ETBF 3ARPA 2AV7B 5I8EB 4C4KO 4PRPD 4JFQA 2CHWA 3LX9A 3X11B 2E4TA 1A7QH 4XC3H 1Q9WA 1DVSA 1ZHLA 2AV1A 1XF1A 1Z1WA 4N1EA 4NS0A 4G9DB 5A2CA 4HUXB 4PUBL 3VJ6A 1E27A 5CHNA 2VO8A 3GSVA 4IRZA 5I15L 3MPCA 3T2OA 3X13B 4HWBL 1NGXB 1OARH 4HHAB 4Y16C 3WUWG 5EIQA 1EHKB 3ZHKA 4CVXA 5B22A 3NGBB 1I85C 2HJLB 2CBPA 3H56A 3MJ8B 1FFPB 1H0DA 1OVZA 4YE4H 2IAMB 4NKOB 5C0ND 2QSVA 2C3VA 3FU9A 1MWAL 1BXUA 1LMKA 5CEZD 1EVTC 1RZIA 1RIVH 3C8DA 1OAKH 2ALWA 7PCYA 3TBWA 1ORSA 1BFSA 3V5KB 1UKQA 3ULVD 4MJ5A 3VNYA 5I1EL 5K9JH 1AO7E 1NANI 2Z35A 4O9HL 2CGZA 4JN1H 2J73A 2IQ9H 1PAMA 2IBBA 5F6HI 1RZJH 2IQAA 1D6VL 4OZHF 3LRGA 2NY7L 3TA3D 4D3CH 2B2XL 3D3VB 3WD5H 3GDCA 4CRPA 3L5WB 4R0LC 5I8OL 4TNWK 4L4TB 4MB3A 4YLCA 4Q6KA 5EIIA 2HT2D 3GSQA 4JB9H 3UFIA 3MO1B 5IB5A 4S1RH 3E80A 2XJKA 4PREA 2XU9A 5ITFB 4DWHA 5DS8A 1S9YA 3PWJB 3O3UN 3VMNA 1C1EH 2FATH 4G6AC 1GGCH 4P5TB 3INUL 3O8XC 1NIEA 2EECA 3HB3C 2W65B 4YAQB 1TT6A 1IB5A 5B1CA 2DLFH 2ZUYA 1HQRA 4PS4L 1G0DA 3PAYA 5ISZB 3PL6D 5DDHA 1ORQB 5AG9A 1IFGA 3TPUB 4XNYL 5G5DB 1U8QB 1NBYB 2JKLA 4U6HB 4MHHI 5IF0A 1LL1A 1I9IH 4LIQL 1FQ9C 5J56B 3TBSB 3EYOB 4OLVL 5C92A 3NEXA 3EJZD 4LU5L 4TV3A 4JRFA 2OX5A 3OKLA 3MV9D 3L3DB 1OK0A 1ICTA 4KNUA 4U1KA 3D25B 4QDGA 3BLKA 1BCIA 3P40A 4OLWL 1GA2A 1QSFB 3E9UA 1QA9A 3TJHD 4LLVA 1U3HC 1P6WA 3Q2VA 1DQTA 3VGDA 1D5ZA 3DX7A 3ARDA 3ECBB 5CR8A 3ZE1B 1H8LA 1KJVB 2R0WL 5F7KC 4ZI8A 4KFMA 3L1OL 4Z0XB 3ZDYB 5C0FB 2BCKB 3NVQA 4XCEA 2BWDA 3KYMB 3LKOA 5F6IC 1NBVL 2PCPB 2WKOA 3VXOA 5D7JD 3UTQA 3VFUB 4BSWA 2H3NB 1NC2A 3NABL 4FE9A 3DGCR 4RMWA 4TNVF 3T2LA 4GEJA 4XN8A 3V10A 1T2XA 3FO9A 4PJAB 1IE4A 5E24E 4KWUA 2GI0A 2WQRA 2ITDB 2F5BL 4OZGB 4PJFE 4ELDA 1TLMA 2QGCA 4UV4H 4ZQKA 3ARGD 1JOIA 1WCBA 4N0UB 3PG2A 4BH7A 2BK8A 4ENZA 4JO5A 1FC1A 2IIJA 4LLYA 5KBPA 1WS8A 3GRGA 5E6YA 3A6OA 1XZ0B 1CXHA 2EO1A 3QHTC 4DP7X 4UB0H 2C9VA 4Y19A 1BMZA 4HDIA 4PJ8D 4JM2C 4XCNA 1DBJH 3QYMA 1NGZA 1KNOB 1HCYA 2QSTA 4LLDB 4JREB 2RAMA 2COVD 1M2VA 3QDJE 4UM9D 5E8OB 2IAAC 3VUAA 3PFUA 1AFVH 2XPYA 3DIFB 3RVUC 4X9GA 4G8FA 5KANI 3OKKA 1ZHBB 1NL0H 3QHZH 4JKNA 3JV4B 3V6ZB 1MCBA 5CJQL 5FGBC 1IQDB 1S9KC 3TBTA 1A7RH 1YUKB 3MYZA 4ABQA 1DQVA 1TZGL 3NIGF 4AM0B 4ZFZA 3UTSA 2M26A 3DYMA 1U6AH 1EJOH 2GC7C 1PZDA 3T77A 1UGNA 3NCJL 1KB9K 3HRZC 4OGQC 1BYNA 2EDOA 2DWTA 4QYOA 3QWOA 3ZKSD 2RD0A 4LP8A 1BECA 5IEHA 1HHIA 1IEBB 1QATA 1PEWA 3DPDA 4EBQL 4ZW7A 3ESUF 3SKJL 5DCCA 4GINA 2P48B 2DV6A 2JV6A 4PM1A 1BLIA 5AZ2H 2LHAA 3RWJB 5LJYH 4WCYH 5A1AA 3ROLA 1INDH 2WLIA 3CVIH 1P0SE 2GSGA 3VCLA 3TH2T 4NSKA 4WAFA 1JUFB 2OYPA 4QRQA 1VFBA 4OTXH 4NENB 3SYOA 4LVNB 4MAZA 2MNUA 1LP9E 1U95B 2A9NH 1MI5E 1Q38A 5DJYB 5I76A 4ONGH 4P46A 1VFOA 3PL6B 3UPRB 2QSQA 4APQB 1Z0NA 4RNRB 4YHPA 3FT2A 4GMTH 2DD8H 3MFFB 3ZGIA 1I7RA 3N43B 2GEQA 1N67A 1OKEA 2W1NA 4PJCA 4BFOA 4RWYL 2H32A 2H1PL 2MHAA 2QQQA 2AHIA 3M8OH 5BO1L 4CU7A 3B9AA 1Y18B 3G6AB 3MBWB 4WO0A 2WO4A 4YDLB 2KS0A 4NFBA 4XP5L 2WBJD 4EDWL 3KJ6L 4S2SB 4U49A 1OAQH 2HVKB 2YKLH 1P9MC 2IANE 4TTDC 5T3XD 4JFDE 3O2DA 1ED3B 1HOCB 4IEFA 2CO2A 5A40E 2OP4L 4YFLF 4BFGA 1MCDA 2CLZA 3BEWB 5L2KB 2YBGA 3N50A 1QLEB 4XVTH 2VRAA 4YMPA 1YEDB 3MTXA 2BVOB 1SBSL 3D33A 4AVHA 1A6PA 2DLEA 1GR7A 2OJ1A 3WFCH 1J1XH 4Y4FB 3MGOA 2PO6C 1KBGL 1MRFL 3MA7A 4WFGD 5IK3A 1QZ1A 1OCCB 1QSEA 4PV9B 5DQJB 2XOTA 3HMXH 3OKMA 5C6TL 2X4OB 2XZQH 4G42B 5ICYA 4H0GA 1D5XA 5EU6E 1HS6A 5JQ6L 2H2SD 4NOBA 4S0SD 2X38A 2MPAH 4LRNL 3OLDA 5ID1A 5CIPB 4BE6A 3HZMA 5JW3L 3OXSA 5E1HB 2AJ3A 2NTFB 1DSFH 4MAYC 1OD7A 4W1TA 3T0EA 3LNDA 5AUMA 3IGAA 3EJYC 2IGLA 5GJTL 3BRFA 3QIWB 3X3FL 1IKNC 1T20A 1X5FA 2OLDA 2ZYSA 1WIOA 3V0FA 1TTCA 3L9EA 1COBA 3Q5TA 3RB7A 2OR9H 1T03H 3VXUE 4JZJB 2AK4B 3J2PA 5IMMB 5HHMB 1ID5I 1YEKL 5J5EA 4G8GB 1AR2A 2BIMA 1H8OA 4OUUB 2P24B 4AZ8B 1U8OA 3VB8A 1PZSA 1X5YA 3RUGB 4MQ7A 2ADJB 2OBGA 2ZWLT 5EU4A 3ZXAC 1F86A 1NFDE 1OV8A 4RA3A 3RWFA 5LNDA 1CXFA 4EI5C 4FQQA 3EBAA 4D0DB 1HTYA 3U79A 3JWDL 3RFZC 2LABA 3SCMC 4IOSA 2H41A 2BOCB 1D7BA 4U1IA 1PG7L 2WXJA 4Z23A 3QI9A 2XQBL 5GS1A 5I8KH 5LG6A 5AWNL 4N6RB 2OMVB 4P4KD 4EKXA 5BW7C 1F6LL 3H4FA 3NZHL 5FHAL 1AR1C 2ZX9A 4MVBC 2HJFA 2JCCF 4LOEA 1T5KA 5J11C 1KXVC 5BMFH 4AIZA 2F08A 4PJDF 2I9LB 4FNLL 5SWZB 3TIDA 5FEBA 5T33H 1KB5B 1XL6A 1KSRA 1S7VA 1IZJA 4XXCA 3BAJA 1G87A 5EUOF 3W11C 3GI9L 5KYYB 3GS7A 1E2ZA 1PX3A 2V5MA 1RMFL 5I1GH 3TJEH 4HJJL 2PW1B 3BP4A 4QRFA 5FYJD 5HHXL 5H37A 2EE0A 2R1YA 5DRWA 5GS2D 1XH2A 1JGIA 2DQDL 1RUKH 3M1BB 1DVXA 1E43A 4JE4B 3HS9A 3VXSD 1O7DC 1LQBC 1OCWH 2D03H 1U2CA 1ZT1B 1KGCD 1RERA 1ROCA 4DKEL 2BXYA 4XN1A 5I1IH 5GJSH 1TKWA 3L3JB 4Y2DD 3IDNB 1MHEB 5JO5A 3CJJA 2G3XA 5C1MB 2B4CL 5IJVA 3IGUA 2AQSA 4YDMA 3BRDA 3BX7C 4JHAL 2TRYA 1QEWB 1FC2D 4Z7WB 1A6VH 3WXVL 1IVLA 4MJ6A 4AIEA 2H5UA 4MKMA 3REVA 3GO1L 2IWFA 2P5WD 3DXAD 3OHMB 1SHXA 2WJ5A 1OQXA 3GSOB 1NBQA 5A6IA 1DE4B 1IQWH 1G1OA 4JEGB 3QZMA 1U8HA 4TF4A 4UILL 4KJPD 5T1MB 1SVCP 3ORJA 1V7NH 2FHCA 4Q6YA 4XWOC 5IB3B 2CCWA 5LNGA 4Y7MA 2WN2A 4OZHB 5K59F 5IQ9A 2JLPA 5C3TA 4NYLB 5I8CA 1OF2B 5D2LA 3VSUA 3QDGD 4DGYH 4E36A 1PD1A 3HC0B 2OS7A 2BRRL 1XGYL 3JVFC 5CEYA 4P23B 4GO8A 4ELKA 4PLJD 3RPKA 1L4IA 4X6DF 1U8IA 2JKIS 1OB1A 1MCNA 1MWOA 1YAZA 2DQUL 2A6JB 3QUXD 4A7VA 4NIYE 4JY6A 1RLWA 3VU2A 2G9HA 1ZRUA 4XODA 3KGUA 2KC0A 1L0YA 1WICA 1KCVL 2LU3A 3NCYS 3U6XS 3VFRA 1ETJA 3LKRB 2Z31D 3RWCB 1L9MA 4X7TA 1YEEL 3TV3H 4AEHL 2XX0A 4U4IA 1FZOB 5JNYA 4YHOH 4WWID 4XMKH 4EN2A 4N2GA 2IJ0C 1PY4A 1BJMA 3QIUD 4AYGA 4YL4A 4R4FH 1FYTB 5EOQH 3DVGA 1TQVA 1UOWA 4FQXD 3P11L 3ASWA 1OD9A 3D2UA 4E9QA 1FFTB 3AROA 4IJTA 4PGZA 1GTNA 1U8LB 4U6XB 1FNSH 2OL3L 3IS1X 4A63A 5GZOA 4GOSA 4ALAL 5DK0B 1C08B 2YIHA 2WANA 3FU3A 5HJDA 2JXMA 1FZJB 2HCZX 4M5ZH 3RTQA 1TIUA 4I3SL 5E2UH 2CA3A 2C26A 4HW6A 5D7LD 2YZ8A 1CFSB 5C0DA 3HZVA 4WDIB 1DVQA 4WSKA 5TF1H 1F4WH 1A6WH 1M71B 3GBDA 4IDJH 1H3TA 1MLBA 4Q9CA 1ADQL 5HGAA 2FWUA 4XCYB 2M83A 3GHPA 3B9KA 3D05A 4OM1H 5DVOA 3UIZA 1QO3B 3R0NA 3RWGA 4KMQA 4DZ8B 1VPOH 4N8VB 3RIKA 4O51A 1L3WA 1N6QH 4N1HB 1KCRH 1S7XA 2YA0A 3KPRD 4LP5A 4LRIA 1BOGA 2A74B 2ZAGA 3VRJA 1P7KB 2P8PB 1KGIA 4XPBH 1JF6A 4YHNA 4Z3JA 2AXFA 4XMVA 1M2OA 4TM9A 1VACB 2UWEE 4NT6A 3RBGA 4L9DA 5E6SB 3QUYA 2P52A 3EJRA 4XBMA 3ZE0E 4FA8A 5CS7A 2XWBB 4YE0A 5GGTH 2YD6A 3L1GA 5E6UB 1E5CA 2Q86B 3FU5A 5DRZA 2WKGA 3IPEA 3L95B 2VZ3A 3PNWB 4FNTA 1P84J 2OZNA 4M02A 1EO7A 3RDTA 3W57A 4PR5B 3V6OE 1JNNL 2NXYC 3LKPB 3F6IA 5F89A 4OAWA 1EGJH 4HJUA 2G60L 3JWNH 2VDNL 3MJ9A 3G5VA 3PE9A 1ZTXL 2P5WB 4N5ED 4MNQB 1HJCA 3ME0B 4ZAKD 2J12B 3MHZA 5GPRA 1N7MH 1NFIB 3BPOC 3NIGB 1FL3B 3GUTB 3OL2A 5HYSG 1FF5A 3D50A 4QXGH 5EA0H 3UYRH 1EHLL 4Z7QF 2Q7YA 3ZDZE 3EOYG 1FIGL 4V33A 1UKSA 1TZIA 4FXTA 4GLRH 4RGNE 2VN3A 2WCGA 1NCAL 2IPKB 4JQXA 4NOFA 1RIHH 4YDVB 4CC0A 1WZ1L 5FDYA 2C1OB 2VAAB 4GRLA 5JW4R 3QUXB 5IUSA 4FCAA 1L5GA 3MR9A 1WTGT 4PJ5E 5KTEL 1UENA 3D5OF 5E95B 4X4XA 4K7PH 3KCWA 4KK5C 5CU9A 2Z31B 3NTCL 5KS9A 1RLBA 2UX7A 3QZWB 4F7CB 1A1OB 2KPNA 5FA4A 4H0HB 1IUZA 2GBUA 1X9QA 3Q2CA 3E3QE 4FOMA 3QIUB 5KVEE 4IRJB 1F8TL 3V4PL 4EJ1C 1ZLSL 4XNXL 4ONFH 3SKNB 4M6AA 2XZAH 5TDNB 4A1RA 5CINH 2LLNA 4FQXB 1YYCA 4IU2B 3C8HA 4JO4L 2AXGA 3B2PA 3L16A 4HWZB 4WTWA 2Y07H 5SWSA 1OAYL 2ZKWA 1SDDB 2DQTL 1I9JL 5E6IC 2XWCA 4OCSL 4NM4H 1QRND 1Q4NX 2Q2EB 3Q6FB 5DD0L 5DYFA 3WOVA 2E59A 3ZRFC 2QLYA 1Q9LA 3B1TA 3MRMA 1BP3B 2D3VA 2UZYB 1RPUA 4MWFA 4RX4A 4HMCA 4Y4KC 3WKMH 2EVFA 5MENE 3MNVA 2Y6SC 3WS6A 1JXDA 1YN6B 2X0WA 1CK0H 2GBAA 3GGWA 5IVXB 3K6SA 3BHBB 1O7DE 5DUBB 4ELMF 2YD9A 2VDMB 3H7BA 3BRGC 5EZIL 3FFDA 1ET8A 1IGFH 2X89A 2Y5TB 2KI6A 4GAJH 4FQLL 3C6LC 2XVKA 1MRDH 5CFHA 5I1AA 4XB8A 2IDUA 3MLZH 3IJ9A 2VT0A 1Z2KA 5DI8B 2VDQH 3KPRB 4M6NH 1EAQA 4ONHA 4JKLA 1GYCA 4WW2A 4MX7B 1NBZA 3TBYA 4W9CC 3G08A 1CD1B 3QJFB 2W5PA 3CFEB 4HU8A 4F1SA 2DICA 3T0DA 4G5ZL 3LXCA 4OF5A 2VIRA 4LEOB 4TNEA 1EEYB 4FTVA 3UTZB 4ZMXA 3BFWA 3FSVA 1KYOJ 1N68A 4HALA 3U9UB 3L9RB 3VXME 4LEEA 1G9NL 5TJWK 5EUKA 5D2NB 5G4NA 1BFVH 2WP3T 3VG0L 4GW5B 4FLRA 3AT0A 1M53A 2ZXEB 5EZLB 2WPGA 4UT9H 2HKHH 1FFNA 3QJXA 4RZCA 5C0NC 1P5VB 2VLRB 5HHVH 3MRRA 5GSRA 3B2MA 1IL1B 1T1ZB 2JQZA 2H9GA 5EBMA 4PJXF 4ZTOL 4WI4A 1KCUH 1GC1L 1NANH 3L48A 3GXFA 5AAWC 3ULVC 2XN9E 2CGRH 1MQ8A 3HFML 3UROR 5J6HA 3SE4A 5KEZA 1CIUA 2DQHH 1CXEA 2WN3A 1MFAH 3EF7A 2H8PA 4MMXB 2ZKHH 3AT9A 3BP7B 1GGYA 2W8CA 4L1BA 3H42H 1BG9A 3QO0A 1MAKA 4MD4A 3NJXA 3TA3C 3B2VL 5JUEL 3QORD 1FSKB 1BAGA 2CJUL 4EPSA 2JCCB 3RY5A 1WRFA 2B16A 2VLLA 4CGUB 3AC0A 4PJDB 4NNYB 2DS4A 2HT2C 1UXMA 3CPLA 5C0JA 5IQNA 2I69A 4Z7VB 1RU9H 1NCWL 1MCPH 1I82A 2R4SH 3S6CA 1AJ7H 1QG3A 1Q0YH 3GSNL 3MBED 3OQRA 4Z5RA 3VI4F 3H3PH 1ZLWK 1LE5A 4LVNC 1KT2B 5D1XD 3EYSH 4OKVA 4V1DD 3HG1E 3NH7L 5CILH 3W5MA 4HIPA 1YEFH 3FUEA 3PL6C 4S1QH 4L05A 4MCNA 5C09B 3S96B 2OFQA 4GAYA 2XXMB 1K85A 3HVDA 4G71B 4M1DL 4M6OH 1O6SA 5GXBB 2C4FT 2FT7A 2HG5A 4WGKA 4OT1H 4GUPB 4XAWH 1G7IA 3HE6A 5FKAB 4AYBA 1HN1A 3MLTA 2AJXL 1GGIH 4KHXL 1TITA 4YDLC 4AKPA 3IXAA 1T83C 1M42A 4N8CL 3I85A 4WUKL 5DGQA 4KQ0A 1NCOA 1OT1A 4Y5YA 2ZG2A 1INEH 1OGSA 4ZPTB 1PBYA 3CDYA 3MOBH 3QE5A 3O0RH 2YPLE 4F93B 2XWDA 3CNKA 3ZE2E 5KG9A 1NGWA 2MFNA 3H8NA 5D6DC 3SGKC 1UXWB 2ZUXA 3LKNA 1QRNB 3NIDF 1VADA 2W94A 5D71L 2VDRH 5HYQA 2APSA 3IRZA 1HHJB 4A2HA 1FJ1B 4R90H 3BVWA 4AX3A 3T3PF 1WHOA 1JK9B 2O6CA 1ZLWH 1F6FB 2EDBA 3MJ7A 3ZKQD 1KJ2A 1TMQA 5KJ4A 4KZ0A 5D7JC 3SDYL 1E9PB 4OZFG 4Y5VB 1R3LB 2CKBB 1U8MB 3GEWB 3FTYA 5CD3A 1EQWA 1NGQL 4R97C 5M7QA 2X1QA 1NFAA 2EDLA 3O4LE 3FUNA 1F42A 1JZIA 2GAZB 3QEQD 4OGZA 5IVOA 3UOAB 1QNIA 4DVRL 3NFSH 5T3ZE 1BBJA 4AMKH 3WYRA 5F3HB 3L5XL 1MJUL 2GTZB 3ARGC 4YGVA 3PLYA 5FW6A 3NACL 3U4BL 3U7AA 1YDPA 5E8EB 1X5XA 4JZJC 4N2DA 2JB6B 4Q74A 3QEUA 4TUOB 1FZKA 2BX5A 1QSZA 3V6FB 1E40A 5EOCJ 1WAAF 4PW9A 3TJPA 3GMLB 4O58L 5BRZE 1EBAA 1DEEB 4OCYH 4PJ8C 1ZWIA 2AF2A 3HG4A 4QHUB 2ZP9A 4PG2C 5TK4A 1ZTMA 3FO2B 5FV2A 1Q9KB 1EEZA 5HY9A 1N70A 4A39A 3VXQA 2JNZA 4NN5C 4PTUA 5D72L 3RB5A 3P77A 4PTTA 5CWSA 4TSCL 2ARJA 4M4PA 4GRWE 3HUJF 4ZS6D 3N06B 4OGXL 3SBWC 4LDLB 4JS7A 2ERJC 1KJ3L 4XP1H 3AXLB 3RHWK 2DQJL 3IBEA 4JFPA 3QA3B 3RRQA 1M7UA 4WFFE 3GC3A 2DIAA 3LRHA 4Q9QL 2AQRA 3QORB 1DDHB 3KPSB 2ESVD 4AVJA 1YMHA 1JHTA 3FUMA 2KH2B 4MMZB 4UZGA 1FLTX 4XWGL 3SE3A 3T4AA 3FTGA 4PJ6A 1VFMA 2DJUA 4FJ6A 1LD9B 5GGSB 1HKLL 3AABA 4UNTA 4E42A 1F58H 5DHDA 3HN8A 3T09A 4L8DA 4G59C 1NCDH 2PP9A 2F53A 2V5SA 1NLBL 2CXGA 4MXVF 4V1DB 1BZ9B 2DQIL 2PYEA 4BSJA 2IWGA 1RSFA 1F4YH 5FYKE 5FM5M 1W9XA 4W9JC 2DYPD 1JYWA 2V2TA 2IV8A 1I1AB 2CMRH 4KROD 3RLSA 4LF3A 1S7TB 1JN6A 4XNDA 2YHGA 3L3IB 4RDQG 1RZQA 5CNHA 3N85H 3F7VB 4ES9A 5HGGS 4FXKA 2CDGA 1DBMH 3M1OA 1J12A 5DR5L 1QHQA 4DIXA 3PHOB 3O4OB 2WBJC 5AD0A 3HHSB 4B41A 5EEWA 32C2B 4OBSA 3QQ3A 4PJIE 1PKQE 4GKNB 4AIOA 1H6EA 5IB2A 4W6YB 3MRNB 4OIAA 1XGPB 3C2AH 4P5MA 5F1SA 3IDGB 2YGPA 3ISRA 2QSCH 1CDBA 4LSVH 4Z7QB 2F8OA 1HINH 5DZ9A 4B9JA 2J4WL 3OR7B 4QT5B 3FPYA 5FHBL 5DSCB 4IU3A 1F00I 3QHFL 4G7YH 5DT1L 3IFPA 3P73A 3AS2A 2IXQA 3NOIA 4ZUWA 4NQCE 3KPLB 1AKJA 2X4NB 2X41A 4AQ8C 1TQBC 3N41F 4NIKB 3V5DB 4U2YA 1O9WA 5FO9B 2X2UA 3HI1B 1TZHA 3WJLA 2H2SC 1N0XL 2WXPA 4ZTPH 1NGPH 3WFZA 4ZMNA 1B90A 3BAEL 2J6EL 3DA0A 2HX9A 3QSKB 4F33A 5A2LH 5B8CA 3BUBA 3G6DH 4HV8B 4L37A 5C07E 3KLHD 5F1IB 3SEPA 3QEQB 1I8IA 4R5XA 2IBGA 4IOFD 2E75C 1EXGA 4LHUB 3WFBH 5J9PB 3QFJD 1QTPA 1AC0A 1QKZH 3VGGA 1OK8A 5KJ7E 2V8LA 3MLSL 1FNEB 4Q4EA 3SPGA 5B38A 1KGWA 1C12B 1QLFB 1GRWA 3FB5B