3WHBA

Crystal structure of fadr from bacillus subtilis, a transcriptional regulator involved in the regulation of fatty acid degradation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
189
structure length
189
Chain Sequence
b'RPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid metabolism regulator protein
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 76
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whbA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whbA02
4AF5A 3FISA 2FQ4A 1Z0XA 1ENHA 3KKCA 4I76A 2KDZA 1ETKA 3S1RJ 2X9DA 2GM4A 1BW5A 3ZQIA 4QTRA 4DZJA 2R92J 3GTMJ 3HE0A 3QQAA 5GPAA 4KWAA 4A3DJ 4FE7A 1MBKA 1HLVA 3OOUA 2AHQA 2LVSA 2MG4A 1MH4A 2XGCA 3WHCA 5EGOA 2R93J 2L7MP 2XPVA 2HDDA 2ZOYA 3HIMA 3NARA 2O8KA 2EZLA 2ECCA 1QVUA 5IP9J 3HGYA 3CMYA 3BR5A 2N8GA 5F0HA 2LP0A 2VKVA 2LKXA 1MBFA 4Y52J 4A3KJ 3G1OA 5DTDA 5K7ZA 2YUSA 3CJDA 2Y9YA 4I6ZA 3HEFA 4DYCA 2XSDC 2HOSA 5IPAA 4A3FJ 2Y0SN 9ANTA 3A01A 5K58A 2IEKA 2UXPA 2LR8A 3KNWA 2DMTA 2I10A 2LY9A 1PUFB 3CRJA 1APLC 1XS9A 3B6CA 3LNQA 2E2HJ 3UKGA 1VNDA 2E2JJ 4IHWA 3PO3J 2NP3A 1TWCJ 2L7ZA 4UUTA 5IP6A 3LWJA 1TWFJ 5M5YJ 5C3EJ 4LOCA 1NTCA 3TEDA 5FLMJ 3JRBA 2FX0A 4B4CA 3JREA 5FMPA 2CUEA 2NS7A 2R5YB 3MVPA 3HOWJ 3I4MJ 5CXGA 1MBEA 4GFKA 4MLOA 3VVYA 2WV1A 1BJZA 1TWAJ 3PPBA 3VOXA 3ZOBA 2GUHA 3PM1A 5EZHA 5K7FA 3S5RA 3VW1A 1RKTA 3VIBA 3CDLA 1FTZA 2DJNA 1ZTRA 2EBIA 3WHBA 2ZCNA 4UDSA 3VVZA 2NVQJ 2D6YA 4RBOA 1Y1WJ 1LFUP 2M9HA 4BY1J 4DYQA 4Y7NJ 3JR9A 2GENA 2R5ZA 3MKLA 3NI7A 3BR0A 2UXUA 2M2EA 1ORKA 4BBRJ 4XK4A 5EF6A 3IH2A 1AKHB 1WCMJ 2WUIA 3DPJA 1ETOA 5D18A 2MW8A 2DMNA 1IGNA 2H8RA 1ETVA 2HXIA 5F1JA 4IHXA 3S14J 3S2DJ 4FISA 1POGA 5M3MJ 1JGGA 5DS9A 2Y9ZA 3W6VA 4XRMA 2DN0A 2XPWA 3VOKA 5FKNA 4D5FA 3HM5A 3IH3A 1SGMA 4QSHA 2GFNA 1WH7A 2DA7A 4DZPA 3CWRA 3JRGA 2QCOA 2X6OA 3S1QJ 2W48A 2QKOA 1H8AC 4CYCA 3BTLA 4MXMA 3JRDA 4IEJA 5FKMA 1JKPC 1B8IB 2R7ZJ 2K40A 1AU7A 2G0EA 5C44J 2YS9A 1I6HJ 4YZEA 3VW0A 3VP5A 2DMUA 1DU6A 3CQZJ 1YRNB 1HF0A 1D5YA 2HKUA 1VFCA 3Q3SA 1JKQC 3BR3A 1W0TA 4FTHA 2HYJA 2WB1N 1NK2P 3QPSA 5EGOB 1W0UA 4ME9A 3HB9A 5GPCA 1LE8B 2PMZN 1HCRA 3PASA 2COBA 3RZOJ 4S0HB 4XRSG 1MBJA 4D5CA 3QPLA 2X48A 1LFBA 2RASA 1I50J 4GCLA 1IRZA 5E3MA 4W1UA 2V57A 3LOCA 3C07A 3G1MA 3F1BA 3IUVA 1ETWA 2WAQN 2E2IJ 4JKZA 1QRYA 1QVTA 3HTHA 1HDPA 3A01B 1ZKGA 3HKZN 2CU7A 4MIMA 2EQRA 2ELKA 4GCTA 4M3EA 5M5WJ 2Y30A 1RPWA 1OJLA 5D19A 2YVEA 2DMQA 3ZQLA 2IU5A 2H1KA 2CRGA 1I3QJ 4JP0A 1ZGWA 4NELA 1MBGA 5IYDJ 2K9QA 1RESA 2TCTA 3LSPA 3ANGA 3FRQA 5F27A 4FE4A 1DU0A 5C4JJ 2QOPA 5FGLA 4CGRA 2DA2A 5EYRA 3HTJA 2HOTA 4HKUA 5J1RA 5J3LA 1CQTA 1IJWC 4C3HJ 3BR2A 3CCYA 1MBHA 3HOXJ 2G7SA 2XDNA 4V2GA 1F43A 4BY7J 2UXHA 3JRCA 1P7IA 3OIOA 2HOAA 1MSEC 1T33A 3NPIA 1XC5A 3HOYJ 3Q0WA 2K9NA 3JSJA 4HNVA 3GTLJ 3DCFA 1K83J 1Z77A 3M4OJ 4EEFG 2VUMJ 3OSFA 4MK6A 1IDZA 2XGDA 1WPKA 2ID3A 5M3FJ 3L1PA 2Y31A 1BL0A 5IOZA 2DG7A 3SFIA 3VW2A 3LSGA 4B1RA 3SJMA 2JA5J 3E7QA 2NVXJ 2ME0A 3S1MJ 3DEWA 1S7EA 4A3EJ 2R5ZB 5EZGA 2REKA 4GFLA 1U78A 1PUFA 2WGBA 3IH4A 1JT0A 2JJ7A 1A5JA 2MGQA 2FJ1A 2HQ5A 3TW7A 1K61A 3VPRA 3MNLA 3K2AA 4A3LJ 1EF4A 5CW8A 4D7MA 3ON2A 4V2FA 1X2NA 2XB5A 3GTOJ 3EGQA 3AQTA 1TC3C 2ECBA 2KT0A 3AQSA 5IYBJ 3RZDJ 2XRLA 1JUPA 5BNGA 1JTYA 1IC8A 4JL3A 1GV5A 2L0KA 2CUFA 2ZCMA 2LFBA 1ZQ3P 4M3DA 1MSFC 2JA6J 3LHQA 1RKWA 4B3AA 3KZ9A 4A3MJ 1U9OA 3A02A 2O7TA 4JYKA 3GTPJ 1JT6A 4DYRA 1GV2A 3HGGA 2UXOA 4AC0A 1VI0A 2F07A 2W53A 1H89C 5F04A 1JKRC 5FHPA 5J1UA 2VI6A 3E7LA 3VVXA 5HAWA 2VKEA 4AUXA 2D5VA 4G12A 4PXIA 3KKDA 3GTKJ 2ID6A 2B63J 3VUQA 2M34A 3ZQFA 1JJ6C 2JMWA 4NDLA 2DG8A 2G7LA 5F0FA 3ANPA 2EH3A 1ZR2A 4AC6A 1FIAA 2YU9J 4A3CJ 4ACIA 1U9NA 4C3JJ 2JWTA 1AKHA 5AQCA 1ZR4A 2UXIA 3EUPA 2HYTA 4ABZA 1NK3P 3GZIA 5HSZA 3BHQA 2R0QC 5F0CA 3GBGA 1AHDP 2Y2ZA 2IAIA 1ETYA 2DA5A 2Q24A 3LJLA 1RR7A 1Y1VJ 2QF7A 1GUUA 2GLOA 2RHAA 5J1YA 3IV5A 4JX4A 2LK2A 3JRFA 1WH5A 3M3YJ 2QIBA 2TRTA 3O8HA 3S1NJ 2K9SA 2NOGA 4UUSA 3HOVJ 4JX5A 3QBMA 5M5XJ 3OSGA 3ZQCA 1OFCX 1B72A 2M0CA 3RH2A 1YRNA 3H0GJ 3ZQGA 3BTCA 3D1NI 2CQQA 2M8GX 3B6AA 1P7JA 2AO9A 1U8BA 1UMQA 2DA6A 1F36A 1SANA 1Q1VA 3GTJJ 2G3BA 5C4YA 2RAEA 3A03A 1WGXA 5EG0A 2HXOA 1OCTC 1LE8A 2EZHA 2L7FP 3O60A 5CXIA 1HDDC 1SFOJ 3P9TA 5FJ8J 1UG2A 2OPTA 3O8GA 1TWHJ 2ME6A 4FCYA 1H88C 3HDDA 2ZOZA 5IP7J 4A69C 4X6AJ 1MH3A 3HTAA 5FKLA 3C2BA 2DA1A 3FKIJ 1OCPA 4QIWN 4A93J 5C4XJ 1ITYA 4A3IJ 1GVDA 3S16J 3BQYA 4A3GJ 2XGEA 2MSYA 1GDTA 1UI6A 1ETQA 2P81A 1UHSA 1JUMA 4D7NA 1IV6A 4MO7A 4MFDA 3MN2A 2JA7J 1HOMA 3BNIA 5EDNA 3FIWA 1JJ8C 3BCGA 1IUFA 2XB0X 3ZQHA 3I4NJ 3G56A 2NX4A 1GT0C 4BXXJ 3BG5A 4W97A 3S15J 5E3LA 2QWTA 4M6VA 3H3VK 2CJJA 3ON4A 2NS8A 4GFBA 3HTIA 4M3BA 1O4XA 4GCKA 1ETXA 3RKQA 3BRUA 3BT9A 3JRAA 1QPIA 3G1LA 4RDUA 3BQZA 1FTTA 2LTPA 2LD5A 1G2HA 5IOYA 2FD5A 4A3JJ 1X58A 3BJBA 4BKXA 2IBDA 3BTIA 5HBUA 2O9LA 4C2MJ 2R5YA 5FKKA 4M3GA 5FLVA 1T56A 1X2MA 2CQXA 4MFEA 3SDGA 4JNNA 3RQIA 5E3NA 4IHVA 1IDYA 2HI3A 5GP9A 4CYCB 3S2HJ 3BG9A 4NN1A 3NAUA 2L9RA 2NVTJ 2G7GA 2FBQA 3GEUA 2VPRA 1A6IA 4XIDA 4AYBN 4IHYA 3V6GA 2DMPA 3QKXA 2DA4A 3K7AJ 5HODA 1XG1A 4A3BJ 1JTXA 3BR1A 2DTZA 3NNRA 1UI5A 3BR6A 2PBXA 5K7HA 2JA8J 2OERA 1ZK8A 2EZKA 3V78A 2JN6A 1MNMC 5JLXA 2XPUA 2GBYA 4XRSA 3LSRA 5EFYA 2PZ9A 1BW6A 5JLWA 1R9TJ 4L5EA 2LLKA 4BBSJ 3NRGA 2E19A 3FK6A 3JRHA 3TP3A 5DAJA 1VF9A 2EZIA 4M3FA 2OI8A 5E3OA 3Q0VA 5F08A 3G7RA 3F0CA 2NP5A 2O7OA 4X1EA 3HOZJ 1FIPA 1IG7A 4UUSB 3TW6A 4J19A 1TWGJ 4XICA 3GTQJ 3PO2J 2QTQA 3RD3A 4JX6A 3GTGJ 1JUSA 2E1OA 3BG3A 3B81A 4DW6A 2YVHA 2ZB9A 3BTJA 3FK7A 5EEAA 1E3OC 4ICHA 4L62A 3TP0A 5D1RA 5FKOA 1B72B 3NXCA 1RETA 1BA5A 2NVYJ 3S17J 5H9TA 3HOUJ 1FJLA 3LSJA 2ZCXA 3Q0UA 2DA3A 5IYCJ 3T6NA 1WI3A 3JRIA 1JKOC 2JK3A 1B8IA 4C3IJ 1FEXA 3HBLA 2OF7A 5EG0B 3COLA
chains in the Genus database with same CATH superfamily
4OMZA 2D2WA 1TZLA 2KDZA 3VSLA 2DYRH 2M1BA 3M1CA 5ILSA 3C2GA 4G7OF 3GTMJ 2ZCWA 5JVTA 1HLVA 3OOUA 5HOOA 3HIMA 2LRDA 2XPVA 5DM6F 2YSRA 2ECCA 5FD5A 4U87A 5CPRB 5F0HA 2LP0A 4RM2A 2VKVA 1HSTA 4LD5A 1MBFA 2JSCA 1KU9A 4P1WA 4G8XA 3ZMDA 2LKXA 5K7ZA 2COMA 2Y9YA 1R36A 4DYCA 2XSDC 2DPDA 2HOSA 2RQQA 5IPAA 2DFHA 4XN3A 2BHZA 2HKOA 3GFJA 2DFEA 4Q48A 3ZMZA 1J5YA 2LY9A 2RNGA 2OZ6A 1BC8C 3B6CA 3LNQA 1Y39A 4BEHA 2F5DA 3DWLE 5EJCA 2XSJC 2ZXJA 1TWCJ 5CVRA 2STTA 3ROUA 4PZJA 2IT0A 3KETA 1MMAA 3W6JB 1FBSA 3K1PA 2FE3A 3H5NA 1A6QA 5HDGA 1H9TA 2FX0A 4B4CA 3JREA 3E97A 2V1NA 3M8EA 2CUEA 2CW8A 1ERDA 5CXGA 1B1BA 4L18B 2JPBA 3KYDB 4NC6A 4EM2A 4GFKA 1V5EA 3I9V2 3G3ZA 1Q1HA 2RREA 4JOMA 2ADUA 1D0XA 3E5QA 3J81Z 1VQNI 5K7FA 2GUHA 4R8HA 3NRVA 2Y75A 1FTZA 2DJNA 4CZCA 1ZTRA 3BDDA 3CZ6A 2KZVA 1TT0A 3FXRA 2NVQJ 5D8LB 2DK5A 1ON2A 3HKZA 1G59A 1MW7A 2BEOA 1U5TC 2RDPA 1X3ZB 3COAC 2F4OB 2HVSA 4NC8A 3JR9A 3MKLA 3DXJF 3FBIB 4MHGA 3J7ZI 4G94A 4XK4A 1R5GA 1RZ4A 3TMOA 3L2WA 1AKHB 5J4YA 1C0WA 3BJOA 5GAGJ 2IGKA 2MW8A 2DMNA 3K8PC 5A2QK 5F1JA 1LFPA 2X4HA 1DPUA 3J80K 5M3MJ 1JGGA 4II3A 3SYTA 5DS9A 2KMUA 3VOKA 2JT1A 2G7HA 2OA4A 2EINH 2XKOA 4MTDA 3JAMZ 1FC3A 4XLHA 1ZG1A 2O6GE 1T0FC 3KZIC 1H8AC 3IC7A 3BTLA 4MXMA 4IEJA 1B59A 5FKMA 4XQFA 3PFYA 5J4VA 2DCEA 3S32A 2BY1A 4CYDA 1AU7A 2EA2A 4I7HA 2EK5A 2ZXHA 2HWVA 3SFZA 1I6HJ 2VPLA 3R6SA 1D0ZA 4XLPF 4B44A 1FSEA 3DBLB 1YS7A 3VP5A 2HKUA 3LFUA 3H9GA 4DBRA 4FX0A 2PEXA 1OYYA 3ZGKA 3A4CA 3CDIA 1E3HA 3BZCA 1WJCA 4FTHA 3J7AY 1NK2P 4IPAA 3TOAA 1U8RA 1BR1A 1Z1DA 1LE8B 2D1VA 2Q8KA 4XRSG 4FT8A 4D5CA 5CKTA 3QPLA 1YW7A 1LFBA 3M7GA 4XKVA 5HLHA 2G9WA 4W1UA 3LOCA 3F1BA 1ETWA 3FXQA 1XGNA 4Y15A 1QVTA 1XDSA 3AAFA 4YIIA 1KQ8A 1RUNA 1RRJA 3CCJI 2OU2A 3RCOA 3RKXA 1T95A 1TBXA 4M3EA 4E7KA 2E7WA 4N4OB 1RPWA 4BEHB 4A0ZA 1UAAA 4ZZLA 1BI2A 4ZDLA 2MYSA 1VQPI 2GOMA 1VQ5I 2VE9A 2M7AA 1ZH5A 3EUHC 3O3KA 3ANGA 3FRQA 3MKWB 2QUFA 2DA2A 5CYVA 4IVNA 3D5RC 2M87A 5DV5A 1XD7A 4B48A 1IJWC 2FEZA 3K70D 2G7SA 2XDNA 4CCLA 1MMNA 5EEGA 4BY7J 3M9AA 4MGRA 3JRCA 3OIOA 2HOAA 2R4GA 3EUHA 1XC5A 5DUIA 3JSJA 1YW9A 2DOEA 3GZ5A 4A6DA 5DUKA 3GTLJ 1HKSA 2JA2A 4C2MA 4E7SA 1YIOA 3F72A 4GRIA 3S3MA 4AVZA 3OSFA 2KIFA 2XGDA 3FDYA 4XKCA 3LSHA 5E79C 4B09A 2RC4A 4PSWA 5TISC 2CW7A 2RV8A 1ZN2A 3IAS2 5D8KB 2JA5J 3E7QA 2NVXJ 3W6KB 1S7EA 5HNFA 1SEUA 4OIOF 2F5VA 2QM3A 2JJ7A 2MGQA 2GQQA 3OYCA 1XSVA 1T38A 3LSKA 1K61A 4BE1A 4WXCA 1R58A 3K2AA 1J2XA 2BY3A 2HTSA 1EF4A 5DEQA 1IN8A 4M71A 2F5FA 3K2ZA 1A36A 4P5OA 2NXNB 1XGSA 5LEJA 2FUG2 3AQSA 4QWQA 4BJ5C 4LG3A 2AXTC 4JL3A 1GV5A 2L0KA 3IKVA 2ZJRF 2M4GA 1IN4A 4MQVA 1ZQ3P 2GAUA 2JA6J 3CLQA 3A0HC 1RKWA 3LHQA 3TO6A 1SAXA 2O7TA 2HTJA 4CCJA 3GTPJ 2VJ4A 1MD0A 4EJUA 4C2UA 2ISYA 3IUOA 5D4SA 2X6XA 4AC0A 5LGTA 2W53A 2V4JC 5F04A 1YW8A 4I01A 1H89C 5J1UA 2ZJ2A 1JKRC 2VXDA 2V6CA 3E7LA 1RC9A 5HAWA 2VKEA 3H36A 2NRAC 3V8LA 4LMYA 2ID6A 2QEXI 1BI0A 4AU7A 2JMWA 3VTIA 2DOAA 2X51A 4KT6A 5H20A 2DG8A 1W4MA 2HFHA 4ACIA 3K1NA 1U9NA 1VQKI 5AQCA 3I56I 3CESA 3EUPA 5HSZA 3T8RA 3P7NA 1BIBA 3BHQA 1V55H 2R0QC 2HPMA 5EEHA 4Y4RA 1AHDP 2DK8A 2Y2ZA 4PFOA 2XKPA 2DA5A 1MDMB 3HPHA 1Y1VJ 4F93B 4WWCA 3E0JB 3OIPA 4RGUA 4UUVA 3IL2A 2QBYA 1HW2A 3JRFA 2ZJQF 1B4AA 5BMZA 1WH5A 4EJTA 5HS8A 2TRTA 1YTYA 3CF2A 2KQRA 2K9SA 2NOGA 1PVEA 3QBMA 4YFXF 2FBKA 5M5XJ 4KIBA 4ENMA 1OFCX 4XNFA 3RH2A 1P4WA 2XF5A 2Z3YA 2M8GX 1OQYA 1F36A 3F8MA 1SANA 4C30A 3RQ4A 4DJAA 1XDUA 1WGXA 5EG0A 2HXOA 1IF1A 2EZHA 3U1KA 1T08B 4KFCA 1PP8F 3P9TA 1QZEA 3EYIA 3O8GA 4Y3OA 2ME6A 2ZOZA 1YOVB 4LG0A 4U0VA 2V1DA 1D0YA 5K5QA 5C4XJ 2L5QA 4XOPA 2PFVA 1GDTA 2XAHA 2H1LA 3IAM2 1UI6A 1G3TA 4HRIA 4GGGA 4A5MA 1QQIA 2QQBA 1NG6A 3BNIA 1Z7LA 2GA1A 2W25A 4BL0B 3G56A 1F9NA 1SFEA 4RB3C 1SD4A 3L09A 3CCVI 2ZXWH 3H3VK 3CCLI 1O3SA 3DPLC 2LREA 3ON4A 3GXOA 1SAUA 2IA0A 2MLKA 4PJLA 1V5GA 4UNOA 4M3BA 3I55I 3ABLH 2E60A 1KONA 3MZ8A 4L9NA 1DGWY 1EH6A 3G1LA 2QVOA 1FTTA 1G2HA 4PK4A 1VQ7I 5IOYA 4QLCU 1UCRA 2KJCA 4KJZA 3AFHA 2M30A 4BE2A 5HBUA 3ZQQA 4Q47A 3ASNH 2L9SA 2E34A 4C2MJ 4BQNA 1TT5B 4LITA 2R5YA 5FKKA 4M3GA 4NQWA 1T56A 5A2QZ 4GDFA 4MFEA 3RIRA 3SDGA 3WU0A 5E3NA 2HI3A 1SD6A 4AVPA 5GP9A 3S2HJ 3OS0A 1RIOH 4NN1A 2NOJB 3NAUA 3DF8A 3EUKL 4AYBN 1J7KA 5DCFA 3QKXA 2XHKA 4A3BJ 4EJWA 1XG1A 1ZLJA 3MFKA 3H1CA 3BZKA 2DTZA 2VBWA 1FYMA 1TW3A 1UI5A 2PBXA 2W4SA 5K7HA 3P9KA 3CCSI 5JLXA 2DQRA 5L3EA 4XKBA 4XRSA 3AG1H 1UZCA 1X1CA 4L5EA 4BBSJ 3ECHA 1L0OC 3FK6A 2RN7A 1VF9A 2XAUA 2MH9A 2EZIA 3L2UA 4KA4A 5FFZA 2QBYB 2OI8A 3G7RA 3TQNA 3F22A 5E8GA 2NP5A 3BJ6A 1YQAA 4HPQA 1O3RA 2VQGA 2H94A 3TW6A 3R60A 1TWGJ 2MD5A 1Z6RA 1JUSA 2LDUA 5EEAA 1VQOI 1E3OC 1O7FA 1R4NB 3NS4A 2Q0OA 2K9MA 5FKOA 4EM0B 1RETA 3CD6I 5H9TA 5DDGA 5E18F 2DA3A 2F48A 3VSKA 2CUJA 3JRIA 1JKOC 4ESBA 4XMYA 4C3IJ 4B47A 4ZYAA 5FGMA 4FASD 5EG0B 2P0WA 1WJBA 2HDWA 1UELB 2DFFA 5AIQA 4R79A 4ZZDA 2IA2A 3KKCA 1ETKA 4HV6A 3K4NA 3WTSC 4C2TA 3ZMUA 3ZQIA 2V9KA 4DZJA 4ZYGA 3WTUC 1BI1A 1I3AA 2A6TA 2R92J 2R7SA 3HE0A 1BM9A 3QQAA 5GPAA 4KWAA 2DAOA 4FE7A 3OYIA 3HTUA 3OYLA 2MG4A 4WF2A 1YO5C 3WHCA 1Z7UA 2L7MP 2L54A 2EV5A 3HYIA 3NARA 1RUOA 2O8KA 2A68F 3DEEA 2DJIA 2LNBA 5ERIA 5IP9J 2N8GA 3EPZA 4RAGA 4NB5A 2A61A 4Y52J 4A3KJ 3EUAA 3G1OA 5DTDA 5LHGA 4G6QA 1YJ9I 3CJDA 4ZYDA 3AG2H 1LNWA 2H27A 2OJED 3MKYB 3LWFA 1I39A 2K3FA 4A5NA 4I99C 9ANTA 3A01A 3OWTA 2IEKA 2LR8A 4KN4X 2V1UA 3TO9A 3HTSB 4RA2A 2JTVA 1XS9A 2E2HJ 3OYJA 1HW5A 1T98A 1U2WA 2GWRA 4F91B 2E2JJ 3MEXA 3IRQA 3GMEA 1DP3A 2NP3A 2VJIA 4XKWA 4ZH4F 5IP6A 2WA0A 3GFMA 2EPFA 5JFRA 3Q5FA 1VQ4I 2Y48A 2YX7A 2LKSA 1NTCA 3V7SA 1PJRA 5D6EA 2FSWA 5BPIA 2PG4A 1DGRM 1UG0A 4CHUA 5FMPA 2R5YB 4U7BA 5HLIA 1XPXA 4IOAF 3GO5A 4NQWB 1MJ9A 1BJZA 4I0AA 2W7NA 2EIJH 2WAFA 4KN7X 1F5TA 1FSHA 4UVAA 1ZGAA 3S5RA 2JRTA 5CVUA 2ZCNA 4K2EA 4UDSA 3VVZA 4RS8A 2D6YA 3WODF 3WGIA 1Y1WJ 1YX5A 3OL4A 1LFUP 1JE8A 5D5VB 1YX3A 3BG7A 4E4HA 1FY7A 5D4RA 3VB2A 3BR0A 2UXUA 1WZ2A 3LL7A 1MGTA 2E1MB 5KNLA 4BBRJ 4G9YA 1WJ5A 1WCMJ 2LF8A 3I4PA 2R7RA 3KEYA 4HAMA 4CZZA 5D18A 4XRFA 4O6JA 3JTHA 1O57A 3NEUA 1BOAA 2XPWA 1IN5A 4D5FA 2PN6A 2WC2A 2Z5UA 3CUQA 3HM5A 3KZZA 3L2QA 3A1YA 2WTEA 4A2UA 1WH7A 3HOTA 1S9HA 2GFNA 2WWYA 4DZPA 3H5RA 2QCOA 4ZTJA 3NWTA 2V9PA 2QKOA 1FBQA 4CYCA 2J5OA 3RKWA 1YLFA 3IWZA 2R7ZJ 4DOZA 2XVCA 2G0EA 3ZPLA 5LBQA 5JVGF 1WQ2A 2K4BA 4YZEA 2QSHX 3BJAA 2DFIA 5FRMA 1DU6A 3CQZJ 2V7FA 4ZDOA 4HBLA 2FNPA 1VFCA 2HKXA 2OQRA 1PP7U 1JKQC 3CTAA 2CS3A 3QPHA 4WK8F 1W0UA 2HQRA 4RB2C 2VBZA 3K4BA 1OLTA 1S5LC 2PMZN 3O2PE 5LHIA 2EILH 3JW4A 1S3JA 1HCRA 4GCVA 3RZOJ 4RAYA 2QWWA 1MMSA 5FROA 4BDYA 1TQPA 4GCLA 5HNHA 1XCVA 3CCRI 3LA2A 3JSPA 3CCEI 4O3MA 4G6TB 3IUVA 2F4IA 2YVXA 5B5EC 2WAQN 2O61A 2EJRA 2ELJA 3GZ6A 1YITI 3A01B 2DDBA 2EQRA 3CMEI 3ZQ7A 3PNVA 3BP8A 2WY8Q 1SMTA 2MH2A 4JP0A 1I27A 4NELA 1E2XA 3HHGA 3K0LA 4CDGA 1XGOA 1IXCA 1RESA 3LSPA 3FXOA 1UFMA 4FE4A 2XC7A 1DU0A 3ASOH 2QOPA 5EYRA 4HEA2 2ICWG 3V8KA 4HKUA 1G3YA 3S93A 1XSXA 1QNTA 3FWEA 3AG4H 5J1RA 1CQTA 4L5JA 1IW7F 1W5SA 3CCYA 3D5SC 3HOXJ 4HW0A 3NPIA 1OYIA 5LHHA 1IN7A 3Q0WA 3DKYA 2P7VB 1FP1D 1D1AA 1LUJB 4HSTA 5K5OA 2BY2A 1Z77A 4EEFG 2VN2A 3KPHA 4KIFA 3I64A 1WPKA 2ID3A 2RNJA 3JTGA 2PMUA 3L1PA 2Y31A 2LY2A 3VW2A 4ESFA 1G8XA 2Z33A 1D3YA 4P55A 3U2RA 3Q9SA 4A3EJ 4FX4A 2REKA 3QP6A 4GFLA 5KHDA 2WGBA 1PUFA 3ABTA 4B43A 1YFHA 1A5JA 1GVJA 1LVAA 4IF4A 2HQ5A 3MNLA 3VPRA 1YJWI 4KIGA 5KK1A 1TNTA 1CF7A 3CUOA 4A3LJ 3LQQA 3TOBA 3EGQA 3AQTA 3RPUD 4N0BA 1BIAA 4IKFA 2KT0A 1BR2A 2W85A 2XRLA 1JUPA 3K6GA 4M72A 1T39A 4G6DA 2FBHA 4M3DA 3K4MA 3H9JA 1HBXG 4EGYA 4B3AA 4A3MJ 5E1WA 1Y56A 2HVQA 4ENKA 2DI3A 2ZMEA 3IRRA 3LSMA 4QPQA 1TQIA 3I59B 1BC7C 2O8XA 1JT6A 3GEZA 4HYEA 3QOEA 2OTLI 4BQQA 1MNEA 2R7FA 2X6WA 3HGGA 3WG7H 2ACJA 3E3VA 4KT5C 2HNHA 2AQEA 4AUXA 4HDUA 4M6XA 4G12A 4PXIA 2B63J 1RI7A 2Q2EA 2QGUA 4II2A 3ZQFA 3K70C 5CQEA 3ESWB 4QPOA 2G7LA 3QU3A 3GX4X 1ZR2A 4AC6A 1FIAA 2YU9J 2CQNA 1LB2A 1ZR4A 2UXIA 3CC7I 2QZ8A 2H09A 4ABZA 1FLIA 3OL3A 1AA7A 3FMRA 2X1DA 2CUZA 1IRGA 2Q24A 2FF4A 3MZYA 1R5HA 2FA5A 3O6BB 2RHAA 3KEQA 4ASNA 2ESHA 2DT6A 3WTXC 3M3YJ 2QIBA 3FF5A 4ESJA 2V6EA 5DD8A 4M9ZA 3S1NJ 5D5XB 4UUSA 2IRFG 1FX7A 2VKDA 1U6GA 2E35A 3OSGA 3TDUC 3OYHA 1UJ8A 2DDAA 3FM5A 4RM3A 2H6BA 1L3LA 4MNUA 1K6OA 3B73A 1XMKA 4OAYA 2CW0F 2RVCA 1YRNA 4HQEA 3ZQGA 3FHZA 3D1NI 3FXLA 2AO9A 2D1HA 4PUSA 1FNNA 1KU2A 4J00A 2X1CA 1HQCA 4HSRA 2G3BA 2VT3A 2FJI1 5B3SH 4RGRA 3W2AA 2L7FP 3O60A 4U9NA 5CXIA 1HDDC 2L02A 3CMAI 2DXIA 5FJ8J 5FB2A 2VXZA 2OPTA 4EM1A 4AIKA 3HDDA 5FRNA 4BUPA 4R1HA 4A69C 1LVKA 2VOOA 2XDVA 1K7AA 3HTAA 1ON1A 3EDPA 4A93J 2UV1A 3FKIJ 5CVVA 5KVRA 4A3GJ 1F4KA 3BQYA 2Y69H 3GLXA 3DEUA 1DDNA 1EH7A 1W7PD 3DKWA 5LLQA 3FXUA 2IP2A 1JUMA 4D7NA 2KIQA 1FOWA 4MFDA 3MN2A 1LDDA 4IXAA 1KQ0A 2XB0X 3ZQHA 1K79A 2E71A 4CSWA 1JI8A 3OYMA 1GT0C 5F6FA 5E17F 2V9VA 4W97A 4XN0A 1VQLI 3BCBA 5E3LA 4KMUX 1DQUA 4Y33A 5CLSA 1LEBA 1MNDA 4M6VA 1X1PA 2K3PA 1REPC 2CJJA 3I5UA 2NS8A 3CJNA 4GFBA 1VQ6I 1OKRA 1XTAA 3E6BA 1O4XA 2IA1A 4GCKA 1ETXA 3RKQA 3DLLF 3DLAA 4CH7A 4YELA 4RDUA 3BQZA 2LD5A 4A3JJ 2P5LC 2HQAA 4BGDA 4AIDA 2QYOA 3ML6A 4OIRF 2IBDA 5ICCA 4I2OA 2ZMEB 4KICA 2A6EF 3SWHA 2O9LA 4XSXF 4BU2A 2WAQA 3IP4B 1STZA 1W1WE 3Q9VA 1X2MA 3FMSA 2K27A 4HQMA 5J8FA 4L0YB 2KDOA 3F8FA 4LJZF 4N9HA 3V4GA 2CSOA 5CVIA 1HA8A 2L9RA 2FRHA 4XONA 2VLAA 2VPRA 2Q2EB 2VC1A 3V6GA 2DMPA 3ZN1A 4M9SA 5HODA 2W82A 1JTXA 2P7CB 1OISA 3KP3A 4HF2A 1KA8A 4O5VA 1UHMA 2V1XA 1X3WB 3V78A 1B6AA 2JN6A 1MNMC 4BE0A 2LC2A 2XPUA 3LSRA 1WFXA 5ICFA 1EJ9A 2PZ9A 1BW6A 1R9TJ 2LLKA 3BPXA 3FX3A 3NRGA 5DAJA 3I71A 5B1BH 2ZXIA 1DPRA 4V19K 5F08A 3RYPA 3WU2C 2O7OA 2M8EA 4PFPA 5ICGA 5FLXK 4UUSB 2CV2A 4ZYHA 2V79A 2EFWA 4LLGF 4J19A 4XICA 2B9SA 3PO2J 2QTQA 2GZWA 1J0RA 1V3FA 2E1OA 1HKQA 3BG3A 4HF0A 2YVHA 3E1SA 3FK7A 4L62A 2W24A 3N05A 2O3FA 3NXCA 1I5ZA 2KIUA 3S17J 2UUZA 2XRNA 1QPMA 1FJLA 1A35A 1RNLA 1TW2A 3BCAA 3OYAA 2TDXA 3Q0UA 5GAHJ 4XLCA 3HSFA 1ZAOA 1XMXA 1B8IA 3ZN0A 3KX2A 1FEXA 3HBLA 5IT9Z 1OCZH 4I02A 3COLA 3EYYA 3FISA 2HDCA 2FQ4A 3SZPA 1K78A 4YRVA 3PL8A 2IW5A 1IUYA 3S1RJ 1HW1A 2X9DA 2DU9A 1R71A 4H0EA 1BW5A 3L2CA 3DTIA 3R0JA 2L4MA 2DODA 4A3DJ 1R5ID 2AHQA 2R93J 5EGOA 1FMVA 2XGCA 4I0BA 1TNSA 1XSDA 1SVLA 4RB1A 2EZLA 1V54H 4IL6C 1OCRH 1V5FA 3C1DA 4CGZA 3MCZA 1RR8C 2AQFA 3DU6A 3HGYA 3CMYA 1I1GA 2FOKA 1SFUA 1EA3A 4U0WA 3WG9A 2M5WA 3K4CA 2YUSA 4PJNA 2ZFWA 4KYWA 4DBQA 3T0YA 4H4KC 4BJ6C 3RSNA 1N25A 2DT7B 3HEFA 4I6ZA 4S05A 4D0PA 2K5CA 2Y0SN 3T1BA 1CGPA 5K58A 2HOEA 3GZNB 3OMYA 3H5AA 1T6SA 2CG4A 1Z91A 3MMYB 1APLC 4UV9A 3UKGA 1VNDA 1GLNA 3PO3J 2A69F 4IRVA 1G3SA 2X85A 4UUTA 5ILUA 4LIUA 1MJAA 1TWFJ 1YYVA 2M45A 2KPMA 3TEDA 5FLMJ 4ENNA 3JRBA 3CCQI 4YFKF 3MVPA 3HOWJ 3I4MJ 1MBEA 3KYCB 2DT5A 1FBUA 4XLNF 4MLOA 3VVYA 2ZFUA 3N4MA 2WV1A 3FBNB 2FOWA 3ZOBA 3CC2I 4DGWB 1SVOA 2XASA 5EZHA 3OY9A 1FYKA 2K9LA 3DU5A 1RKTA 4PJJA 2EBIA 3WHBA 3SDBA 3KLOA 5GTHC 2GIVA 3VOEA 2CYYA 4E7JA 4RBOA 3J80Z 2M9HA 3P9CA 4M73A 4IQJA 2EIKH 3X2QH 4BH9A 2BVMA 2GENA 2R5ZA 1R4MB 1R6RA 2NAZA 1WJDA 2M2EA 4AIHA 2CWEA 3L2VA 2E1MC 3J81K 2OTJI 1ORKA 1NG7A 1WSUA 4IRIA 5ICEA 5HS7A 3KYLA 1ETVA 2HXIA 3S2DJ 4FISA 3PIOF 3RDIA 3W6VA 3L2RA 2WBMA 2VQLA 3ZMTA 5FKNA 5L3DA 2P5KA 4FQGA 1OCCH 2DA7A 3CWRA 3JRGA 3J7YJ 3H9QA 2VQCA 1P6RA 2CFOA 2J5PA 2YPRA 3WU1B 3ECOA 4GO1A 2Q1ZB 3GVAA 1B8IB 2PLYA 4GYIA 1VQ9I 2DYSH 1YS6A 3GUDA 3HZJA 4OD5A 1K78B 3DP7A 1D5YA 3HRUA 4GXOA 3Q3SA 2P4WA 2M0MA 3JAMK 3MZHA 3BR3A 3F8BA 3R4KA 3ZRGA 5LRSA 2O5RA 3D0SA 2HYJA 2WB1N 1H0MA 1FWZA 5EGOB 4ME9A 4BXUA 1B9MA 2BW3A 1SVMA 4EV0A 5GPCA 3P9IA 4EMSA 3PASA 2COBA 2HVRA 1MBJA 2EWNA 2X48A 1I50J 2ZO4A 4ON0A 1FPQA 4LG0B 1IRZA 5E3MA 2ZNZA 4HLYA 3HUGA 3C07A 1EKEA 4IHSA 2VASA 2QA4I 4Q5SF 4JKZA 4CO8A 2OQGA 2ZSHB 3LMMA 3KFWX 3HTHA 1HDPA 3DKXA 1ZKGA 3HHHA 3AG3H 3WTTC 3HKZN 2CU7A 3TO7A 2ELKA 4GCTA 5L3GA 1OCOH 1PDNC 4DQ2A 5M5WJ 2Y30A 5D19A 1OJLA 2YVEA 2IVMA 2M7BA 1N75A 1R1TA 2CRGA 3ULQB 3V7RA 3LSTA 1VZ0A 3ZQLA 1I3QJ 2H1KA 2QENA 1X4PA 2QQAA 2QQ9A 5BPDA 2TCTA 1OR7A 5TGTA 1Z05A 3EQLF 4YIRX 5ED4A 5C4JJ 5FGLA 2DBBA 4HF1A 4CGRA 1Y0NA 3HTJA 1LEAA 3F21A 1IV8A 1W5TA 5H6QA 5J3LA 1SMYF 3BR2A 1S7OA 2OBPA 2BXZA 3KCCA 3GCMA 4JK1X 2HU9A 4V2GA 3K4KA 2UXHA 2YX4A 3OR2C 2XROA 1S8NA 2VB6A 3MD2A 1MSEC 2WAEA 3HOYJ 3KLNA 4HNTA 5LGUA 1KU3A 4XLFA 2MC3A 1S7AA 3DCFA 4HNVA 1XMAA 1K83J 3M4OJ 1K6YA 4BYYA 2L01A 4Z6YA 4MK6A 1IDZA 4U7DA 2IJLA 1HKTA 3QU6A 3KZYA 1K4SA 5IOZA 2DG7A 3HC7A 5CQGA 3LSGA 3ABUA 2W84A 4OIQF 3WE2A 3S1MJ 3DEWA 1T2KA 3BG6A 3L00A 2R5ZB 5EZGA 1LPQA 4U9LA 4JQFA 3PNTA 2QKMB 1U78A 1R1VA 3FHNA 3IH4A 2Z1DA 4YIFA 1MMDA 2H6CA 1Y8RB 3TW7A 1P92A 2W1OA 4EVIA 2WADA 2IGOA 4IOCF 3DBRB 2L4AA 3ON2A 1XGMA 5CJ9A 2ECBA 1D5VA 2K85A 4UB8C 3KP6A 3C3WA 3I54A 3CUQC 1ACIA 5IYBJ 1JHHA 1HXDA 1XCBA 5BNGA 1JTYA 1YJNI 1IC8A 1KU7A 3ERMA 3L7WA 2ZCMA 2LFBA 2CQ7A 2DO7A 1MSFC 3W2WA 4WCGA 3D5LA 5IT3A 3H0DA 3ERED 3KZ9A 3HRTA 4HA8A 3A02A 1G6NA 4JYKA 2OCCH 4OU0A 4EJOA 3BOQA 4DYRA 1GV2A 2R7DA 1D1BA 3L9FA 3PUFA 2UXOA 4L9VA 1B9NA 2PMHA 4ENJA 2E36A 2B3WA 2VI6A 3F6VA 3MAJA 2P5VA 2EFPA 1ZRDA 3SEQA 2D5VA 2F6CA 4OOIA 1K4TA 1ZYRF 3ZMVA 1ZG3A 3U21A 3OYKA 1IRFA 1W5CC 3QRFF 2M34A 1JJ6C 1VQMI 3HSRA 5KAFC 3OYDA 2BW3B 3KEOA 3ANPA 2MD0A 1IXRC 2VOPA 3VFZA 2KFDA 3PFIA 4A3CJ 2L9VA 2GXBA 1O3QA 2STWA 1AKHA 2GXAA 3I3LA 3MKZA 4A6EA 2R7WA 1NK3P 2HYTA 4XORA 2XGXA 1I6XA 2BOLA 2FNAA 3S3OA 3H92A 1M1EB 1W36D 2H8WA 1RR7A 1X1BA 2M4KA 1GUUA 2QF7A 4E7ZA 1ZREA 2GLOA 4HZFA 4WX9A 1BN5A 5J1YA 4Z2YA 3M07A 3QYEA 2WY7Q 4U88A 3F23A 2LK2A 5LRRA 3CDHA 2ZBKA 2RGVA 2E5NA 4BJTA 3OS2A 3O8HA 2D45A 3N97A 4DVYP 3KP2A 3HOVJ 3F9KA 4JX5A 2K7LA 4UXNA 1OMIA 1MMGA 1J59A 1WKMA 2NNNA 3ZQCA 2HQNA 4D9JA 2EB7A 4AD9A 3H3ZA 2CV1A 1ZLKA 2PJRA 4AYBA 4RAFA 4UVBA 3T8TA 4P9FA 4XL9A 1X3UA 3B6AA 1U8BA 3OR1C 1SFXA 4EATA 2Y0MA 3AKZA 1Q1VA 1WHUA 2VQHA 2JRMA 2RAEA 1T8IA 2OD5A 3ISPA 1LE8A 3E6MA 4TV7A 1SFOJ 2X6YA 2PBIA 3PUBA 2GOXB 2KJBA 3RPUA 2ESNA 5LFAA 4X6AJ 2LOOA 4UB6C 3ABKH 3C2BA 2DA1A 2B7EA 2BYVE 4IJAA 1BBYA 4QIWN 1TL8A 3S16J 2Z99A 1J9IA 2XGEA 4N4NB 5AONA 4ETSA 2P81A 1UHSA 4Q4ZF 1HOMA 1IV6A 2F5CA 4MO7A 3HOSA 5EDNA 3HRSA 1JJ8C 3BCGA 1IUFA 2NX4A 2V26A 4BXXJ 3TL4X 3WE3A 1WJFA 2A2FX 2XAQA 2QWTA 1YE9A 3V42A 4EJVA 1OPCA 1TTYA 4WXDA 4F7ZA 3HL2A 1USTA 3HTIA 3DBHB 5JHFA 4CCOA 2WB1A 2R7QA 1FT9A 5ILVA 3SXYA 3F8NA 4CUGA 1LQ1A 1WVRA 4OMYA 4E7IA 2LTPA 2QSFX 4IO9F 3I0TA 3SZGA 1WI9A 1X58A 3BJBA 3K4LA 2FQ3A 4EQQA 4BKXA 3BTIA 2ZMEC 4NNJA 2DW4A 1XX5A 1NHAA 2VC0A 1R49A 3CMMA 1MZBA 2ZNYA 1ZHFA 3CUQB 4HNUA 2HZTA 3RI4A 4UY8I 1G4DA 5FLVA 3VDXA 3K4JA 1ZGJA 1S6LA 2CQXA 4JNNA 1R00A 4IHVA 4L9JA 5B66C 4CYCB 4IRGA 3BG9A 4LIVA 1BR4A 4XIDA 2DQLA 4BQAA 3DPUA 4IHYA 5DM7F 2LBFA 4I09A 1UHWA 3K7AJ 3KE2A 3BR1A 4M74A 2BE5F 2I8DA 5D5UB 1TQMA 2EZKA 4HX8A 1U5TA 4RB0A 2LY1A 4IQ4A 3G73A 2PJPA 1MKMA 2K86A 2ZJPF 2GXGA 2VIXA 2E19A 3B02A 3TP3A 4OD4A 1BJAA 4M3FA 2UZKA 3Q0VA 1Y0UA 3V8JA 3F0CA 2VJ5A 4RLQA 3CC4I 2B1EA 1QHGA 3HOZJ 2O03A 2IGNA 1IG7A 3U1DA 3QP5A 3GTQJ 2HR3A 1SFKA 4P9UA 2PI0A 3GTGJ 3DTKA 4DW6A 3BTJA 1WRJA 2KLOA 4CCNA 3G2BA 4E7LA 5D1RA 1LDKB 3C2HA 4BXFA 4CXFA 1BA5A 2PJRB 1T0FA 3VYSB 2OC6A 5IYCJ 2RQPA 1W7PA 1WI3A 4JBAA 1UB9A 2ELHA 3SEZA 3UR3C 1QA6A 4NC7A 3NQOA 3IKTA 3H3UA 4BHCA 2A07F 4A12A 5K1YA 5LD2C 2ZC2A 4AF5A 1ZARA 2YU3A 1R1UA 3HG9A 4LGWA 5FD6A 1Z0XA 1ENHA 4I76A 3REOA 3V7CA 1KZHA 1EH8A 2GM4A 4QTRA 4L5IA 2W00A 3GFLA 3ZR8X 3W3CA 1MBKA 3OYFA 4XR6A 4ZYEA 2LVSA 1S72I 1MDMA 1MH4A 2ZOYA 4M9XA 1Z3YA 2HDDA 1QVUA 5TJJA 3GYHX 2DOFA 5BQTA 2DTRA 2L2OA 3BR5A 2VKHA 5F1RA 2QKLB 5GADJ 3U9GA 5J8CA 1D8JA 3LFKA 1Z6TA 4BHBA 1IAWA 2LF7A 3BROA 1VTNC 5HDNA 1N77A 1QZZA 3EETA 2X0LA 2LSOA 2HS5A 3HJEA 2KKOA 2GA2A 4A3FJ 1J09A 4A0YA 2MC4A 4L0ZB 1FOXA 2VJJA 2UXPA 3KNWA 2DMTA 2I10A 2MBFA 1PUFB 1QO0D 2G7UA 2BBYA 1R7JA 1X4OA 3CRJA 3ABMH 4IHWA 1QU3A 3F3XA 1CF7B 4LFUA 1ULYA 2L7ZA 4P96A 1ONVA 3ZP5A 2MABA 4BDZA 4DIQA 3DV8A 3LWJA 1LKXA 1USSA 5JI6A 5M5YJ 3LA7A 4LOCA 5C3EJ 2VL8A 4PJMA 3SQNA 5BS6A 3VEPA 2C6YA 2NS7A 1LDJA 2PMZA 4CCKA 3J7AO 2E1CA 5AIPA 4NBQA 1TWAJ 3PPBA 3VOXA 3FM3A 3ZMSA 5KAIC 2EFNA 3WGGA 3PM1A 5DCMA 3VW1A 2F2EA 2QLZA 2JSPA 3ZCOA 1IO2A 3OYBA 3RYRA 3VIBA 3CDLA 1BOBA 2OCEA 3RPQA 2FBIA 2LBFB 3ELKA 3FKJA 3LQRA 4ANJA 5GAEJ 4RGSA 1D8KA 3WTZA 2LMDA 1X1DA 4BY1J 1U5TB 2F4MB 4DYQA 1TLHB 1KGSA 4Y7NJ 3UNGC 5E8IA 3OOPA 3NI7A 5FO5A 3JCUC 5H6RA 4KITB 2Z9OA 4G7HF 1MJBA 1GHCA 2R7TA 5EF6A 3IH2A 1SC7A 4DNCA 2WUIA 3DPJA 1ETOA 1D1CA 4XLEA 4RMNA 1S29A 4Y13A 1IGNA 4X0GA 2H8RA 1EV7A 4IHXA 3S14J 2ZY9A 1POGA 3KP5A 1WWXA 4MQ9F 5JR3A 2DN0A 4XRMA 2Y9ZA 3WTWC 1DP7P 3GF2A 4IX7A 1FOKA 1KQ9A 2K02A 1GXQA 5J40A 1P4XA 3IH3A 4IRHA 4G7ZF 1SGMA 5JHUA 3RJPA 4QSHA 3DTEA 2X6OA 1SD5A 2KHMA 4UVCA 1PYVA 4F55A 2W48A 2VONA 3S1QJ 4WIBA 3T5XA 1W7PB 1N78A 3JRDA 1E3PA 2A05A 3A0BC 3PQKA 4U0YA 1JKPC 2XAJA 2K40A 3MWMA 2R7UA 4RAZA 2BXYA 3IHUA 5C44J 2YS9A 3WTVC 3VW0A 2DMUA 1I1SA 1YRNB 2E1NA 2R3SA 3PSFA 5J6XA 1HF0A 2VT2A 2QQ8A 3E5UA 1IXSB 1W0TA 4LLLA 3G6EI 4D1QA 1KYWA 5DYMA 5TRDA 3QPSA 3QPTA 3BY6A 3HB9A 4AWXB 2A6HF 4UV8A 3OYGA 1P9QC 3VYRB 2HGCA 4S0HB 2NNYA 1JGSA 1TP4A 3CF5F 2RASA 5B1AH 3OYEA 5L3BA 3WTYC 3W2VA 1DUXC 2EIMH 1MIJA 2V57A 3M8FA 5HLGA 3G1MA 1GXPA 3F8CA 4RGXA 2E2IJ 1QRYA 5D6FA 3GWZA 2IS2A 4MIMA 4HOBA 4HV5A 2L7KA 6PAXA 2CMPA 2DMQA 2IU5A 2CQKA 2KIMA 4A0XA 2CV0A 1ZGWA 3KIOA 3CO7C 1MBGA 5IYDJ 3TDZC 1ZRFA 3BPVA 2K9QA 2CGPA 3BWGA 2AXLA 5F27A 4BHPA 2HYFA 2LKPA 4FETA 5GTIC 3QAHA 4WXHA 4BAYA 2HOTA 2BY0A 3BZ6A 4I98B 4YEJA 4C3HJ 4AIJA 4ITVA 2XUBA 1MBHA 1F43A 4PSXA 4BNCA 1P7IA 3QWLA 1T33A 1IRXA 1E17A 1X1AA 1ODDA 3K1MA 2K9NA 3QOPA 4F3QA 2EA4A 5DCMB 3OS1A 2VUMJ 2CFXA 2KRCA 2W57A 2I5UA 3E5XA 3QYFA 4BS9A 3HRMA 2IS4A 5M3FJ 1BL0A 4J01A 3SFIA 2OV7A 2ZSIB 4IHTA 4B1RA 3A2KA 2MA3A 3SJMA 1ZELA 4PGHA 2ME0A 4XLAA 3QODA 5LEKA 4E70A 3M8JA 1FYLA 5J47A 4RLFA 4KDPA 1JT0A 2FJ1A 4S04A 1O3TA 5IY5H 2LYCA 5CVJA 1HC8A 1VQ8I 2OAZA 1YIJI 4XSZF 5CW8A 4D7MA 2JZYA 2HYGD 4V2FA 3CJQB 1X2NA 2XB5A 2XAGA 2DPUA 3GTOJ 1TC3C 4NUBA 2KISA 1A31A 3LA3A 5LGNA 2CO5A 2LG4A 1U0JA 3RZDJ 3OYNA 2NVUB 3RTRA 1WJEA 1P4AA 2CUFA 2XF7A 1O7LA 2JUGA 2XV4S 5E1ZB 4E6KG 5K5RA 2RKHA 1PUEE 2VBYA 3S2WA 1U9OA 2BZTA 4CA0A 4Y17A 4L9TA 2BVLA 3TGNA 1BI3A 3KP7A 2YR2A 3VYUB 1SD7A 1VI0A 2F07A 5FHPA 2L9NA 1IZ1A 4OINF 3VVXA 3CCMI 2NS0A 1LJ9A 1E0EA 2L3DA 1U3EM 2ISZA 2IS6A 2A3SA 1A04A 3HXLA 3RKYA 2A5YB 3KKDA 3GTKJ 5L3CA 3K10A 3M1EA 3G4SI 2ETHA 3FXKA 2Z2SB 3VUQA 1IN6A 4NDLA 5F0FA 3FMQA 4FHTA 2EH3A 2OUMA 4E7HA 2XAFA 5HVQC 1Z21A 4C3JJ 2JWTA 1FOYA 3GZIA 5F0CA 3GBGA 3BC8A 2EFOA 5H2FC 2IAIA 1ETYA 2BGCA 1ZRCA 3LJLA 3QYBA 3PIPF 3FZVA 2O0YA 3R61A 4F52A 3LAPA 1AOYA 3IV5A 2BV6A 4JX4A 1NH3A 3PSIA 2ZKZA 3HIFA 2JPCA 4B3XA 2M3AA 3AL0C 2R7XA 2HEOA 2IS1A 3F6OA 4M6YA 3FXJA 2FXAA 1OR7C 3PQJA 2KRHA 1R22A 5L3FA 3CCUI 2FMYA 2LH9A 3GW2A 3S8PA 4CICA 3ZXSA 5HLTA 4MEXF 3GLLA 4UHTA 1B72A 4YFNF 2VE8A 2AS5F 2M0CA 3VYTB 3H35A 3VODA 3H0GJ 4CCMA 3BTCA 4XBFA 2UWMA 2CQQA 1P7JA 1UMQA 1WJAA 2JVHA 2DA6A 2GIZA 3KP4A 3GTJJ 3K69A 4HDVA 5C4YA 3A03A 1R23A 1Z3XA 4ZTFA 1Z9CA 2PQ8A 2EV0A 3I53A 1OCTC 4OIPF 1AWCA 1FZPB 2NYXA 2QSGX 2VBXA 1UG2A 4FCYA 1TWHJ 4ZJZA 4N9IA 1H88C 2VODA 1QGPA 5IP7J 4KNYA 2FMLA 1MH3A 1QHHD 3CO6C 3DFGA 5FKLA 1OCPA 3OV8A 1Z67A 3ONQA 5D5WB 1GVDA 4A3IJ 3E6CC 2MSYA 3CP2A 4LK1F 1QZYA 1ETQA 1YHQI 2IPQX 2IGMA 2MLGA 3PNYA 2KRFA 2P6SA 3TBIA 4LLNA 2JA7J 1G3WA 3CLOA 3FIWA 4ZDPA 2OZUA 5HDKA 1QBJA 4HX7A 1ZG5A 4BACA 2A5WA 3I4NJ 4PCQA 3CJTB 2MFZA 3BG5A 3S15J 2B0LA 2Z16A 3BLYA 1YI2I 4KMFA 2F5EA 1JXSA 1F1ZA 4GYGA 2E7XA 4PJ0C 2EFQA 1W36C 4YG2F 3BRUA 4OAZA 3BT9A 3JRAA 1QPIA 4LB6B 2FD5A 2BHYA 1FP2A 4EGZA 1YG2A 5E1XA 1H9GA 3S3NA 3SZTA 3FXMA 2JVGA 3GFIA 2KZGA 1J75A 1Y8QB 1Y6IA 5E20A 4C9YA 2JUCA 2HPIA 4F92B 4HLXA 3C7JA 1V4RA 3TKYA 2R7VA 4BQOA 3RQIA 1IDYA 2P6TA 2XIGA 1HSJA 1X19A 2G7GA 2NVTJ 3GEUA 2FBQA 1A6IA 1XN7A 3CJRB 3I58A 5HS9A 1KYZA 4MEYF 2DA4A 2Y0SA 3CP8A 4XM3A 2PX9A 4KUMA 5FLXZ 4IZZA 3NNRA 3BR6A 5KCMA 2HZDA 2JA8J 2OERA 1ZK8A 3NWSA 4PGGA 4XOTA 3P5JA 3VWBA 3G71I 2JQ7A 2GBYA 2DLLA 5EFYA 5JLWA 5FFXA 1JHFA 2EV6A 4KISA 3MQ0A 3JRHA 2FU4A 3K9TA 2IXSA 1XB4A 5E3OA 2WV0A 1OYWA 3SHFA 3IWFA 4LK0F 2P8TA 3LSIA 4PDKA 4X1EA 3HSEA 3HUGB 1FIPA 1P2FA 1ITYA 2CH0A 1FMWA 2R7OA 4OWRB 3RD3A 4JX6A 3DQVC 3B81A 4HG2A 2UXXA 3C18A 3I59A 3E6DA 4NHJA 2X1EA 2XF6A 2ZB9A 5DD4A 4ZC3A 4ICHA 3LAJA 3HPGA 3TP0A 1B72B 3OIQA 2NVYJ 4AM3A 3WGHA 3HOUJ 2KL4A 3AL0B 3LSJA 2ZCXA 3T6NA 4B8XA 3DPTA 2UXNA 5F64A 4HX4A 5BOXA 3JSOA 3R0AA 4MTEA 2K4JA 2JK3A 5IT9K 2PFBA 3PJRA 2E5ZA 4LB5A 2OF7A 2KP6A
chains in the Genus database with same CATH topology
4AF5A 3FISA 2FQ4A 1Z0XA 1ENHA 3KKCA 4I76A 2KDZA 1ETKA 3S1RJ 2X9DA 2GM4A 1BW5A 3ZQIA 4QTRA 4DZJA 2R92J 3GTMJ 3HE0A 3QQAA 5GPAA 4KWAA 4A3DJ 4FE7A 1MBKA 1HLVA 3OOUA 2AHQA 2LVSA 2MG4A 1MH4A 2XGCA 3WHCA 5EGOA 2R93J 2L7MP 2XPVA 2HDDA 2ZOYA 3HIMA 3NARA 2O8KA 2EZLA 2ECCA 1QVUA 5IP9J 3HGYA 3CMYA 3BR5A 2N8GA 5F0HA 2LP0A 2VKVA 2LKXA 1MBFA 4Y52J 4A3KJ 3G1OA 5DTDA 5K7ZA 2YUSA 3CJDA 2Y9YA 4I6ZA 3HEFA 4DYCA 2XSDC 2HOSA 5IPAA 4A3FJ 2Y0SN 9ANTA 3A01A 5K58A 2IEKA 2UXPA 2LR8A 3KNWA 2DMTA 2I10A 2LY9A 1PUFB 3CRJA 1APLC 1XS9A 3B6CA 3LNQA 2E2HJ 3UKGA 1VNDA 2E2JJ 4IHWA 3PO3J 2NP3A 1TWCJ 2L7ZA 4UUTA 5IP6A 3LWJA 1TWFJ 5M5YJ 5C3EJ 4LOCA 1NTCA 3TEDA 5FLMJ 3JRBA 2FX0A 4B4CA 3JREA 5FMPA 2CUEA 2NS7A 2R5YB 3MVPA 3HOWJ 3I4MJ 5CXGA 1MBEA 4GFKA 4MLOA 3VVYA 2WV1A 1BJZA 1TWAJ 3PPBA 3VOXA 3ZOBA 2GUHA 3PM1A 5EZHA 5K7FA 3S5RA 3VW1A 1RKTA 3VIBA 3CDLA 1FTZA 2DJNA 1ZTRA 2EBIA 3WHBA 2ZCNA 4UDSA 3VVZA 2NVQJ 2D6YA 4RBOA 1Y1WJ 1LFUP 2M9HA 4BY1J 4DYQA 4Y7NJ 3JR9A 2GENA 2R5ZA 3MKLA 3NI7A 3BR0A 2UXUA 2M2EA 1ORKA 4BBRJ 4XK4A 5EF6A 3IH2A 1AKHB 1WCMJ 2WUIA 3DPJA 1ETOA 5D18A 2MW8A 2DMNA 1IGNA 2H8RA 1ETVA 2HXIA 5F1JA 4IHXA 3S14J 3S2DJ 4FISA 1POGA 5M3MJ 1JGGA 5DS9A 2Y9ZA 3W6VA 4XRMA 2DN0A 2XPWA 3VOKA 5FKNA 4D5FA 3HM5A 3IH3A 1SGMA 4QSHA 2GFNA 1WH7A 2DA7A 4DZPA 3CWRA 3JRGA 2QCOA 2X6OA 3S1QJ 2W48A 2QKOA 1H8AC 4CYCA 3BTLA 4MXMA 3JRDA 4IEJA 5FKMA 1JKPC 1B8IB 2R7ZJ 2K40A 1AU7A 2G0EA 5C44J 2YS9A 1I6HJ 4YZEA 3VW0A 3VP5A 2DMUA 1DU6A 3CQZJ 1YRNB 1HF0A 1D5YA 2HKUA 1VFCA 3Q3SA 1JKQC 3BR3A 1W0TA 4FTHA 2HYJA 2WB1N 1NK2P 3QPSA 5EGOB 1W0UA 4ME9A 3HB9A 5GPCA 1LE8B 2PMZN 1HCRA 3PASA 2COBA 3RZOJ 4S0HB 4XRSG 1MBJA 4D5CA 3QPLA 2X48A 1LFBA 2RASA 1I50J 4GCLA 1IRZA 5E3MA 4W1UA 2V57A 3LOCA 3C07A 3G1MA 3F1BA 3IUVA 1ETWA 2WAQN 2E2IJ 4JKZA 1QRYA 1QVTA 3HTHA 1HDPA 3A01B 1ZKGA 3HKZN 2CU7A 4MIMA 2EQRA 2ELKA 4GCTA 4M3EA 5M5WJ 2Y30A 1RPWA 1OJLA 5D19A 2YVEA 2DMQA 3ZQLA 2IU5A 2H1KA 2CRGA 1I3QJ 4JP0A 1ZGWA 4NELA 1MBGA 5IYDJ 2K9QA 1RESA 2TCTA 3LSPA 3ANGA 3FRQA 5F27A 4FE4A 1DU0A 5C4JJ 2QOPA 5FGLA 4CGRA 2DA2A 5EYRA 3HTJA 2HOTA 4HKUA 5J1RA 5J3LA 1CQTA 1IJWC 4C3HJ 3BR2A 3CCYA 1MBHA 3HOXJ 2G7SA 2XDNA 4V2GA 1F43A 4BY7J 2UXHA 3JRCA 1P7IA 3OIOA 2HOAA 1MSEC 1T33A 3NPIA 1XC5A 3HOYJ 3Q0WA 2K9NA 3JSJA 4HNVA 3GTLJ 3DCFA 1K83J 1Z77A 3M4OJ 4EEFG 2VUMJ 3OSFA 4MK6A 1IDZA 2XGDA 1WPKA 2ID3A 5M3FJ 3L1PA 2Y31A 1BL0A 5IOZA 2DG7A 3SFIA 3VW2A 3LSGA 4B1RA 3SJMA 2JA5J 3E7QA 2NVXJ 2ME0A 3S1MJ 3DEWA 1S7EA 4A3EJ 2R5ZB 5EZGA 2REKA 4GFLA 1U78A 1PUFA 2WGBA 3IH4A 1JT0A 2JJ7A 1A5JA 2MGQA 2FJ1A 2HQ5A 3TW7A 1K61A 3VPRA 3MNLA 3K2AA 4A3LJ 1EF4A 5CW8A 4D7MA 3ON2A 4V2FA 1X2NA 2XB5A 3GTOJ 3EGQA 3AQTA 1TC3C 2ECBA 2KT0A 3AQSA 5IYBJ 3RZDJ 2XRLA 1JUPA 5BNGA 1JTYA 1IC8A 4JL3A 1GV5A 2L0KA 2CUFA 2ZCMA 2LFBA 1ZQ3P 4M3DA 1MSFC 2JA6J 3LHQA 1RKWA 4B3AA 3KZ9A 4A3MJ 1U9OA 3A02A 2O7TA 4JYKA 3GTPJ 1JT6A 4DYRA 1GV2A 3HGGA 2UXOA 4AC0A 1VI0A 2F07A 2W53A 1H89C 5F04A 1JKRC 5FHPA 5J1UA 2VI6A 3E7LA 3VVXA 5HAWA 2VKEA 4AUXA 2D5VA 4G12A 4PXIA 3KKDA 3GTKJ 2ID6A 2B63J 3VUQA 2M34A 3ZQFA 1JJ6C 2JMWA 4NDLA 2DG8A 2G7LA 5F0FA 3ANPA 2EH3A 1ZR2A 4AC6A 1FIAA 2YU9J 4A3CJ 4ACIA 1U9NA 4C3JJ 2JWTA 1AKHA 5AQCA 1ZR4A 2UXIA 3EUPA 2HYTA 4ABZA 1NK3P 3GZIA 5HSZA 3BHQA 2R0QC 5F0CA 3GBGA 1AHDP 2Y2ZA 2IAIA 1ETYA 2DA5A 2Q24A 3LJLA 1RR7A 1Y1VJ 2QF7A 1GUUA 2GLOA 2RHAA 5J1YA 3IV5A 4JX4A 2LK2A 3JRFA 1WH5A 3M3YJ 2QIBA 2TRTA 3O8HA 3S1NJ 2K9SA 2NOGA 4UUSA 3HOVJ 4JX5A 3QBMA 5M5XJ 3OSGA 3ZQCA 1OFCX 1B72A 2M0CA 3RH2A 1YRNA 3H0GJ 3ZQGA 3BTCA 3D1NI 2CQQA 2M8GX 3B6AA 1P7JA 2AO9A 1U8BA 1UMQA 2DA6A 1F36A 1SANA 1Q1VA 3GTJJ 2G3BA 5C4YA 2RAEA 3A03A 1WGXA 5EG0A 2HXOA 1OCTC 1LE8A 2EZHA 2L7FP 3O60A 5CXIA 1HDDC 1SFOJ 3P9TA 5FJ8J 1UG2A 2OPTA 3O8GA 1TWHJ 2ME6A 4FCYA 1H88C 3HDDA 2ZOZA 5IP7J 4A69C 4X6AJ 1MH3A 3HTAA 5FKLA 3C2BA 2DA1A 3FKIJ 1OCPA 4QIWN 4A93J 5C4XJ 1ITYA 4A3IJ 1GVDA 3S16J 3BQYA 4A3GJ 2XGEA 2MSYA 1GDTA 1UI6A 1ETQA 2P81A 1UHSA 1JUMA 4D7NA 1IV6A 4MO7A 4MFDA 3MN2A 2JA7J 1HOMA 3BNIA 5EDNA 3FIWA 1JJ8C 3BCGA 1IUFA 2XB0X 3ZQHA 3I4NJ 3G56A 2NX4A 1GT0C 4BXXJ 3BG5A 4W97A 3S15J 5E3LA 2QWTA 4M6VA 3H3VK 2CJJA 3ON4A 2NS8A 4GFBA 3HTIA 4M3BA 1O4XA 4GCKA 1ETXA 3RKQA 3BRUA 3BT9A 3JRAA 1QPIA 3G1LA 4RDUA 3BQZA 1FTTA 2LTPA 2LD5A 1G2HA 5IOYA 2FD5A 4A3JJ 1X58A 3BJBA 4BKXA 2IBDA 3BTIA 5HBUA 2O9LA 4C2MJ 2R5YA 5FKKA 4M3GA 5FLVA 1T56A 1X2MA 2CQXA 4MFEA 3SDGA 4JNNA 3RQIA 5E3NA 4IHVA 1IDYA 2HI3A 5GP9A 4CYCB 3S2HJ 3BG9A 4NN1A 3NAUA 2L9RA 2NVTJ 2G7GA 2FBQA 3GEUA 2VPRA 1A6IA 4XIDA 4AYBN 4IHYA 3V6GA 2DMPA 3QKXA 2DA4A 3K7AJ 5HODA 1XG1A 4A3BJ 1JTXA 3BR1A 2DTZA 3NNRA 1UI5A 3BR6A 2PBXA 5K7HA 2JA8J 2OERA 1ZK8A 2EZKA 3V78A 2JN6A 1MNMC 5JLXA 2XPUA 2GBYA 4XRSA 3LSRA 5EFYA 2PZ9A 1BW6A 5JLWA 1R9TJ 4L5EA 2LLKA 4BBSJ 3NRGA 2E19A 3FK6A 3JRHA 3TP3A 5DAJA 1VF9A 2EZIA 4M3FA 2OI8A 5E3OA 3Q0VA 5F08A 3G7RA 3F0CA 2NP5A 2O7OA 4X1EA 3HOZJ 1FIPA 1IG7A 4UUSB 3TW6A 4J19A 1TWGJ 4XICA 3GTQJ 3PO2J 2QTQA 3RD3A 4JX6A 3GTGJ 1JUSA 2E1OA 3BG3A 3B81A 4DW6A 2YVHA 2ZB9A 3BTJA 3FK7A 5EEAA 1E3OC 4ICHA 4L62A 3TP0A 5D1RA 5FKOA 1B72B 3NXCA 1RETA 1BA5A 2NVYJ 3S17J 5H9TA 3HOUJ 1FJLA 3LSJA 2ZCXA 3Q0UA 2DA3A 5IYCJ 3T6NA 1WI3A 3JRIA 1JKOC 2JK3A 1B8IA 4C3IJ 1FEXA 3HBLA 2OF7A 5EG0B 3COLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AF5 A;  3FIS A;  2FQ4 A;  1Z0X A;  1ENH A;  3KKC A;  4I76 A;  2KDZ A;  1ETK A;  3S1R J;  2X9D A;  2GM4 A;  1BW5 A;  3ZQI A;  4QTR A;  4DZJ A;  2R92 J;  3GTM J;  3HE0 A;  3QQA A;  5GPA A;  4KWA A;  4A3D J;  4FE7 A;  1MBK A;  1HLV A;  3OOU A;  2AHQ A;  2LVS A;  2MG4 A;  1MH4 A;  2XGC A;  3WHC A;  5EGO A;  2R93 J;  2L7M P;  2XPV A;  2HDD A;  2ZOY A;  3HIM A;  3NAR A;  2O8K A;  2EZL A;  2ECC A;  1QVU A;  5IP9 J;  3HGY A;  3CMY A;  3BR5 A;  2N8G A;  5F0H A;  2LP0 A;  2VKV A;  2LKX A;  1MBF A;  4Y52 J;  4A3K J;  3G1O A;  5DTD A;  5K7Z A;  2YUS A;  3CJD A;  2Y9Y A;  4I6Z A;  3HEF A;  4DYC A;  2XSD C;  2HOS A;  5IPA A;  4A3F J;  2Y0S N;  9ANT A;  3A01 A;  5K58 A;  2IEK A;  2UXP A;  2LR8 A;  3KNW A;  2DMT A;  2I10 A;  2LY9 A;  1PUF B;  3CRJ A;  1APL C;  1XS9 A;  3B6C A;  3LNQ A;  2E2H J;  3UKG A;  1VND A;  2E2J J;  4IHW A;  3PO3 J;  2NP3 A;  1TWC J;  2L7Z A;  4UUT A;  5IP6 A;  3LWJ A;  1TWF J;  5M5Y J;  5C3E J;  4LOC A;  1NTC A;  3TED A;  5FLM J;  3JRB A;  2FX0 A;  4B4C A;  3JRE A;  5FMP A;  2CUE A;  2NS7 A;  2R5Y B;  3MVP A;  3HOW J;  3I4M J;  5CXG A;  1MBE A;  4GFK A;  4MLO A;  3VVY A;  2WV1 A;  1BJZ A;  1TWA J;  3PPB A;  3VOX A;  3ZOB A;  2GUH A;  3PM1 A;  5EZH A;  5K7F A;  3S5R A;  3VW1 A;  1RKT A;  3VIB A;  3CDL A;  1FTZ A;  2DJN A;  1ZTR A;  2EBI A;  3WHB A;  2ZCN A;  4UDS A;  3VVZ A;  2NVQ J;  2D6Y A;  4RBO A;  1Y1W J;  1LFU P;  2M9H A;  4BY1 J;  4DYQ A;  4Y7N J;  3JR9 A;  2GEN A;  2R5Z A;  3MKL A;  3NI7 A;  3BR0 A;  2UXU A;  2M2E A;  1ORK A;  4BBR J;  4XK4 A;  5EF6 A;  3IH2 A;  1AKH B;  1WCM J;  2WUI A;  3DPJ A;  1ETO A;  5D18 A;  2MW8 A;  2DMN A;  1IGN A;  2H8R A;  1ETV A;  2HXI A;  5F1J A;  4IHX A;  3S14 J;  3S2D J;  4FIS A;  1POG A;  5M3M J;  1JGG A;  5DS9 A;  2Y9Z A;  3W6V A;  4XRM A;  2DN0 A;  2XPW A;  3VOK A;  5FKN A;  4D5F A;  3HM5 A;  3IH3 A;  1SGM A;  4QSH A;  2GFN A;  1WH7 A;  2DA7 A;  4DZP A;  3CWR A;  3JRG A;  2QCO A;  2X6O A;  3S1Q J;  2W48 A;  2QKO A;  1H8A C;  4CYC A;  3BTL A;  4MXM A;  3JRD A;  4IEJ A;  5FKM A;  1JKP C;  1B8I B;  2R7Z J;  2K40 A;  1AU7 A;  2G0E A;  5C44 J;  2YS9 A;  1I6H J;  4YZE A;  3VW0 A;  3VP5 A;  2DMU A;  1DU6 A;  3CQZ J;  1YRN B;  1HF0 A;  1D5Y A;  2HKU A;  1VFC A;  3Q3S A;  1JKQ C;  3BR3 A;  1W0T A;  4FTH A;  2HYJ A;  2WB1 N;  1NK2 P;  3QPS A;  5EGO B;  1W0U A;  4ME9 A;  3HB9 A;  5GPC A;  1LE8 B;  2PMZ N;  1HCR A;  3PAS A;  2COB A;  3RZO J;  4S0H B;  4XRS G;  1MBJ A;  4D5C A;  3QPL A;  2X48 A;  1LFB A;  2RAS A;  1I50 J;  4GCL A;  1IRZ A;  5E3M A;  4W1U A;  2V57 A;  3LOC A;  3C07 A;  3G1M A;  3F1B A;  3IUV A;  1ETW A;  2WAQ N;  2E2I J;  4JKZ A;  1QRY A;  1QVT A;  3HTH A;  1HDP A;  3A01 B;  1ZKG A;  3HKZ N;  2CU7 A;  4MIM A;  2EQR A;  2ELK A;  4GCT A;  4M3E A;  5M5W J;  2Y30 A;  1RPW A;  1OJL A;  5D19 A;  2YVE A;  2DMQ A;  3ZQL A;  2IU5 A;  2H1K A;  2CRG A;  1I3Q J;  4JP0 A;  1ZGW A;  4NEL A;  1MBG A;  5IYD J;  2K9Q A;  1RES A;  2TCT A;  3LSP A;  3ANG A;  3FRQ A;  5F27 A;  4FE4 A;  1DU0 A;  5C4J J;  2QOP A;  5FGL A;  4CGR A;  2DA2 A;  5EYR A;  3HTJ A;  2HOT A;  4HKU A;  5J1R A;  5J3L A;  1CQT A;  1IJW C;  4C3H J;  3BR2 A;  3CCY A;  1MBH A;  3HOX J;  2G7S A;  2XDN A;  4V2G A;  1F43 A;  4BY7 J;  2UXH A;  3JRC A;  1P7I A;  3OIO A;  2HOA A;  1MSE C;  1T33 A;  3NPI A;  1XC5 A;  3HOY J;  3Q0W A;  2K9N A;  3JSJ A;  4HNV A;  3GTL J;  3DCF A;  1K83 J;  1Z77 A;  3M4O J;  4EEF G;  2VUM J;  3OSF A;  4MK6 A;  1IDZ A;  2XGD A;  1WPK A;  2ID3 A;  5M3F J;  3L1P A;  2Y31 A;  1BL0 A;  5IOZ A;  2DG7 A;  3SFI A;  3VW2 A;  3LSG A;  4B1R A;  3SJM A;  2JA5 J;  3E7Q A;  2NVX J;  2ME0 A;  3S1M J;  3DEW A;  1S7E A;  4A3E J;  2R5Z B;  5EZG A;  2REK A;  4GFL A;  1U78 A;  1PUF A;  2WGB A;  3IH4 A;  1JT0 A;  2JJ7 A;  1A5J A;  2MGQ A;  2FJ1 A;  2HQ5 A;  3TW7 A;  1K61 A;  3VPR A;  3MNL A;  3K2A A;  4A3L J;  1EF4 A;  5CW8 A;  4D7M A;  3ON2 A;  4V2F A;  1X2N A;  2XB5 A;  3GTO J;  3EGQ A;  3AQT A;  1TC3 C;  2ECB A;  2KT0 A;  3AQS A;  5IYB J;  3RZD J;  2XRL A;  1JUP A;  5BNG A;  1JTY A;  1IC8 A;  4JL3 A;  1GV5 A;  2L0K A;  2CUF A;  2ZCM A;  2LFB A;  1ZQ3 P;  4M3D A;  1MSF C;  2JA6 J;  3LHQ A;  1RKW A;  4B3A A;  3KZ9 A;  4A3M J;  1U9O A;  3A02 A;  2O7T A;  4JYK A;  3GTP J;  1JT6 A;  4DYR A;  1GV2 A;  3HGG A;  2UXO A;  4AC0 A;  1VI0 A;  2F07 A;  2W53 A;  1H89 C;  5F04 A;  1JKR C;  5FHP A;  5J1U A;  2VI6 A;  3E7L A;  3VVX A;  5HAW A;  2VKE A;  4AUX A;  2D5V A;  4G12 A;  4PXI A;  3KKD A;  3GTK J;  2ID6 A;  2B63 J;  3VUQ A;  2M34 A;  3ZQF A;  1JJ6 C;  2JMW A;  4NDL A;  2DG8 A;  2G7L A;  5F0F A;  3ANP A;  2EH3 A;  1ZR2 A;  4AC6 A;  1FIA A;  2YU9 J;  4A3C J;  4ACI A;  1U9N A;  4C3J J;  2JWT A;  1AKH A;  5AQC A;  1ZR4 A;  2UXI A;  3EUP A;  2HYT A;  4ABZ A;  1NK3 P;  3GZI A;  5HSZ A;  3BHQ A;  2R0Q C;  5F0C A;  3GBG A;  1AHD P;  2Y2Z A;  2IAI A;  1ETY A;  2DA5 A;  2Q24 A;  3LJL A;  1RR7 A;  1Y1V J;  2QF7 A;  1GUU A;  2GLO A;  2RHA A;  5J1Y A;  3IV5 A;  4JX4 A;  2LK2 A;  3JRF A;  1WH5 A;  3M3Y J;  2QIB A;  2TRT A;  3O8H A;  3S1N J;  2K9S A;  2NOG A;  4UUS A;  3HOV J;  4JX5 A;  3QBM A;  5M5X J;  3OSG A;  3ZQC A;  1OFC X;  1B72 A;  2M0C A;  3RH2 A;  1YRN A;  3H0G J;  3ZQG A;  3BTC A;  3D1N I;  2CQQ A;  2M8G X;  3B6A A;  1P7J A;  2AO9 A;  1U8B A;  1UMQ A;  2DA6 A;  1F36 A;  1SAN A;  1Q1V A;  3GTJ J;  2G3B A;  5C4Y A;  2RAE A;  3A03 A;  1WGX A;  5EG0 A;  2HXO A;  1OCT C;  1LE8 A;  2EZH A;  2L7F P;  3O60 A;  5CXI A;  1HDD C;  1SFO J;  3P9T A;  5FJ8 J;  1UG2 A;  2OPT A;  3O8G A;  1TWH J;  2ME6 A;  4FCY A;  1H88 C;  3HDD A;  2ZOZ A;  5IP7 J;  4A69 C;  4X6A J;  1MH3 A;  3HTA A;  5FKL A;  3C2B A;  2DA1 A;  3FKI J;  1OCP A;  4QIW N;  4A93 J;  5C4X J;  1ITY A;  4A3I J;  1GVD A;  3S16 J;  3BQY A;  4A3G J;  2XGE A;  2MSY A;  1GDT A;  1UI6 A;  1ETQ A;  2P81 A;  1UHS A;  1JUM A;  4D7N A;  1IV6 A;  4MO7 A;  4MFD A;  3MN2 A;  2JA7 J;  1HOM A;  3BNI A;  5EDN A;  3FIW A;  1JJ8 C;  3BCG A;  1IUF A;  2XB0 X;  3ZQH A;  3I4N J;  3G56 A;  2NX4 A;  1GT0 C;  4BXX J;  3BG5 A;  4W97 A;  3S15 J;  5E3L A;  2QWT A;  4M6V A;  3H3V K;  2CJJ A;  3ON4 A;  2NS8 A;  4GFB A;  3HTI A;  4M3B A;  1O4X A;  4GCK A;  1ETX A;  3RKQ A;  3BRU A;  3BT9 A;  3JRA A;  1QPI A;  3G1L A;  4RDU A;  3BQZ A;  1FTT A;  2LTP A;  2LD5 A;  1G2H A;  5IOY A;  2FD5 A;  4A3J J;  1X58 A;  3BJB A;  4BKX A;  2IBD A;  3BTI A;  5HBU A;  2O9L A;  4C2M J;  2R5Y A;  5FKK A;  4M3G A;  5FLV A;  1T56 A;  1X2M A;  2CQX A;  4MFE A;  3SDG A;  4JNN A;  3RQI A;  5E3N A;  4IHV A;  1IDY A;  2HI3 A;  5GP9 A;  4CYC B;  3S2H J;  3BG9 A;  4NN1 A;  3NAU A;  2L9R A;  2NVT J;  2G7G A;  2FBQ A;  3GEU A;  2VPR A;  1A6I A;  4XID A;  4AYB N;  4IHY A;  3V6G A;  2DMP A;  3QKX A;  2DA4 A;  3K7A J;  5HOD A;  1XG1 A;  4A3B J;  1JTX A;  3BR1 A;  2DTZ A;  3NNR A;  1UI5 A;  3BR6 A;  2PBX A;  5K7H A;  2JA8 J;  2OER A;  1ZK8 A;  2EZK A;  3V78 A;  2JN6 A;  1MNM C;  5JLX A;  2XPU A;  2GBY A;  4XRS A;  3LSR A;  5EFY A;  2PZ9 A;  1BW6 A;  5JLW A;  1R9T J;  4L5E A;  2LLK A;  4BBS J;  3NRG A;  2E19 A;  3FK6 A;  3JRH A;  3TP3 A;  5DAJ A;  1VF9 A;  2EZI A;  4M3F A;  2OI8 A;  5E3O A;  3Q0V A;  5F08 A;  3G7R A;  3F0C A;  2NP5 A;  2O7O A;  4X1E A;  3HOZ J;  1FIP A;  1IG7 A;  4UUS B;  3TW6 A;  4J19 A;  1TWG J;  4XIC A;  3GTQ J;  3PO2 J;  2QTQ A;  3RD3 A;  4JX6 A;  3GTG J;  1JUS A;  2E1O A;  3BG3 A;  3B81 A;  4DW6 A;  2YVH A;  2ZB9 A;  3BTJ A;  3FK7 A;  5EEA A;  1E3O C;  4ICH A;  4L62 A;  3TP0 A;  5D1R A;  5FKO A;  1B72 B;  3NXC A;  1RET A;  1BA5 A;  2NVY J;  3S17 J;  5H9T A;  3HOU J;  1FJL A;  3LSJ A;  2ZCX A;  3Q0U A;  2DA3 A;  5IYC J;  3T6N A;  1WI3 A;  3JRI A;  1JKO C;  2JK3 A;  1B8I A;  4C3I J;  1FEX A;  3HBL A;  2OF7 A;  5EG0 B;  3COL A; 
#chains in the Genus database with same CATH topology
 4OMZ A;  2D2W A;  1TZL A;  2KDZ A;  3VSL A;  2DYR H;  2M1B A;  3M1C A;  5ILS A;  3C2G A;  4G7O F;  3GTM J;  2ZCW A;  5JVT A;  1HLV A;  3OOU A;  5HOO A;  3HIM A;  2LRD A;  2XPV A;  5DM6 F;  2YSR A;  2ECC A;  5FD5 A;  4U87 A;  5CPR B;  5F0H A;  2LP0 A;  4RM2 A;  2VKV A;  1HST A;  4LD5 A;  1MBF A;  2JSC A;  1KU9 A;  4P1W A;  4G8X A;  3ZMD A;  2LKX A;  5K7Z A;  2COM A;  2Y9Y A;  1R36 A;  4DYC A;  2XSD C;  2DPD A;  2HOS A;  2RQQ A;  5IPA A;  2DFH A;  4XN3 A;  2BHZ A;  2HKO A;  3GFJ A;  2DFE A;  4Q48 A;  3ZMZ A;  1J5Y A;  2LY9 A;  2RNG A;  2OZ6 A;  1BC8 C;  3B6C A;  3LNQ A;  1Y39 A;  4BEH A;  2F5D A;  3DWL E;  5EJC A;  2XSJ C;  2ZXJ A;  1TWC J;  5CVR A;  2STT A;  3ROU A;  4PZJ A;  2IT0 A;  3KET A;  1MMA A;  3W6J B;  1FBS A;  3K1P A;  2FE3 A;  3H5N A;  1A6Q A;  5HDG A;  1H9T A;  2FX0 A;  4B4C A;  3JRE A;  3E97 A;  2V1N A;  3M8E A;  2CUE A;  2CW8 A;  1ERD A;  5CXG A;  1B1B A;  4L18 B;  2JPB A;  3KYD B;  4NC6 A;  4EM2 A;  4GFK A;  1V5E A;  3I9V 2;  3G3Z A;  1Q1H A;  2RRE A;  4JOM A;  2ADU A;  1D0X A;  3E5Q A;  3J81 Z;  1VQN I;  5K7F A;  2GUH A;  4R8H A;  3NRV A;  2Y75 A;  1FTZ A;  2DJN A;  4CZC A;  1ZTR A;  3BDD A;  3CZ6 A;  2KZV A;  1TT0 A;  3FXR A;  2NVQ J;  5D8L B;  2DK5 A;  1ON2 A;  3HKZ A;  1G59 A;  1MW7 A;  2BEO A;  1U5T C;  2RDP A;  1X3Z B;  3COA C;  2F4O B;  2HVS A;  4NC8 A;  3JR9 A;  3MKL A;  3DXJ F;  3FBI B;  4MHG A;  3J7Z I;  4G94 A;  4XK4 A;  1R5G A;  1RZ4 A;  3TMO A;  3L2W A;  1AKH B;  5J4Y A;  1C0W A;  3BJO A;  5GAG J;  2IGK A;  2MW8 A;  2DMN A;  3K8P C;  5A2Q K;  5F1J A;  1LFP A;  2X4H A;  1DPU A;  3J80 K;  5M3M J;  1JGG A;  4II3 A;  3SYT A;  5DS9 A;  2KMU A;  3VOK A;  2JT1 A;  2G7H A;  2OA4 A;  2EIN H;  2XKO A;  4MTD A;  3JAM Z;  1FC3 A;  4XLH A;  1ZG1 A;  2O6G E;  1T0F C;  3KZI C;  1H8A C;  3IC7 A;  3BTL A;  4MXM A;  4IEJ A;  1B59 A;  5FKM A;  4XQF A;  3PFY A;  5J4V A;  2DCE A;  3S32 A;  2BY1 A;  4CYD A;  1AU7 A;  2EA2 A;  4I7H A;  2EK5 A;  2ZXH A;  2HWV A;  3SFZ A;  1I6H J;  2VPL A;  3R6S A;  1D0Z A;  4XLP F;  4B44 A;  1FSE A;  3DBL B;  1YS7 A;  3VP5 A;  2HKU A;  3LFU A;  3H9G A;  4DBR A;  4FX0 A;  2PEX A;  1OYY A;  3ZGK A;  3A4C A;  3CDI A;  1E3H A;  3BZC A;  1WJC A;  4FTH A;  3J7A Y;  1NK2 P;  4IPA A;  3TOA A;  1U8R A;  1BR1 A;  1Z1D A;  1LE8 B;  2D1V A;  2Q8K A;  4XRS G;  4FT8 A;  4D5C A;  5CKT A;  3QPL A;  1YW7 A;  1LFB A;  3M7G A;  4XKV A;  5HLH A;  2G9W A;  4W1U A;  3LOC A;  3F1B A;  1ETW A;  3FXQ A;  1XGN A;  4Y15 A;  1QVT A;  1XDS A;  3AAF A;  4YII A;  1KQ8 A;  1RUN A;  1RRJ A;  3CCJ I;  2OU2 A;  3RCO A;  3RKX A;  1T95 A;  1TBX A;  4M3E A;  4E7K A;  2E7W A;  4N4O B;  1RPW A;  4BEH B;  4A0Z A;  1UAA A;  4ZZL A;  1BI2 A;  4ZDL A;  2MYS A;  1VQP I;  2GOM A;  1VQ5 I;  2VE9 A;  2M7A A;  1ZH5 A;  3EUH C;  3O3K A;  3ANG A;  3FRQ A;  3MKW B;  2QUF A;  2DA2 A;  5CYV A;  4IVN A;  3D5R C;  2M87 A;  5DV5 A;  1XD7 A;  4B48 A;  1IJW C;  2FEZ A;  3K70 D;  2G7S A;  2XDN A;  4CCL A;  1MMN A;  5EEG A;  4BY7 J;  3M9A A;  4MGR A;  3JRC A;  3OIO A;  2HOA A;  2R4G A;  3EUH A;  1XC5 A;  5DUI A;  3JSJ A;  1YW9 A;  2DOE A;  3GZ5 A;  4A6D A;  5DUK A;  3GTL J;  1HKS A;  2JA2 A;  4C2M A;  4E7S A;  1YIO A;  3F72 A;  4GRI A;  3S3M A;  4AVZ A;  3OSF A;  2KIF A;  2XGD A;  3FDY A;  4XKC A;  3LSH A;  5E79 C;  4B09 A;  2RC4 A;  4PSW A;  5TIS C;  2CW7 A;  2RV8 A;  1ZN2 A;  3IAS 2;  5D8K B;  2JA5 J;  3E7Q A;  2NVX J;  3W6K B;  1S7E A;  5HNF A;  1SEU A;  4OIO F;  2F5V A;  2QM3 A;  2JJ7 A;  2MGQ A;  2GQQ A;  3OYC A;  1XSV A;  1T38 A;  3LSK A;  1K61 A;  4BE1 A;  4WXC A;  1R58 A;  3K2A A;  1J2X A;  2BY3 A;  2HTS A;  1EF4 A;  5DEQ A;  1IN8 A;  4M71 A;  2F5F A;  3K2Z A;  1A36 A;  4P5O A;  2NXN B;  1XGS A;  5LEJ A;  2FUG 2;  3AQS A;  4QWQ A;  4BJ5 C;  4LG3 A;  2AXT C;  4JL3 A;  1GV5 A;  2L0K A;  3IKV A;  2ZJR F;  2M4G A;  1IN4 A;  4MQV A;  1ZQ3 P;  2GAU A;  2JA6 J;  3CLQ A;  3A0H C;  1RKW A;  3LHQ A;  3TO6 A;  1SAX A;  2O7T A;  2HTJ A;  4CCJ A;  3GTP J;  2VJ4 A;  1MD0 A;  4EJU A;  4C2U A;  2ISY A;  3IUO A;  5D4S A;  2X6X A;  4AC0 A;  5LGT A;  2W53 A;  2V4J C;  5F04 A;  1YW8 A;  4I01 A;  1H89 C;  5J1U A;  2ZJ2 A;  1JKR C;  2VXD A;  2V6C A;  3E7L A;  1RC9 A;  5HAW A;  2VKE A;  3H36 A;  2NRA C;  3V8L A;  4LMY A;  2ID6 A;  2QEX I;  1BI0 A;  4AU7 A;  2JMW A;  3VTI A;  2DOA A;  2X51 A;  4KT6 A;  5H20 A;  2DG8 A;  1W4M A;  2HFH A;  4ACI A;  3K1N A;  1U9N A;  1VQK I;  5AQC A;  3I56 I;  3CES A;  3EUP A;  5HSZ A;  3T8R A;  3P7N A;  1BIB A;  3BHQ A;  1V55 H;  2R0Q C;  2HPM A;  5EEH A;  4Y4R A;  1AHD P;  2DK8 A;  2Y2Z A;  4PFO A;  2XKP A;  2DA5 A;  1MDM B;  3HPH A;  1Y1V J;  4F93 B;  4WWC A;  3E0J B;  3OIP A;  4RGU A;  4UUV A;  3IL2 A;  2QBY A;  1HW2 A;  3JRF A;  2ZJQ F;  1B4A A;  5BMZ A;  1WH5 A;  4EJT A;  5HS8 A;  2TRT A;  1YTY A;  3CF2 A;  2KQR A;  2K9S A;  2NOG A;  1PVE A;  3QBM A;  4YFX F;  2FBK A;  5M5X J;  4KIB A;  4ENM A;  1OFC X;  4XNF A;  3RH2 A;  1P4W A;  2XF5 A;  2Z3Y A;  2M8G X;  1OQY A;  1F36 A;  3F8M A;  1SAN A;  4C30 A;  3RQ4 A;  4DJA A;  1XDU A;  1WGX A;  5EG0 A;  2HXO A;  1IF1 A;  2EZH A;  3U1K A;  1T08 B;  4KFC A;  1PP8 F;  3P9T A;  1QZE A;  3EYI A;  3O8G A;  4Y3O A;  2ME6 A;  2ZOZ A;  1YOV B;  4LG0 A;  4U0V A;  2V1D A;  1D0Y A;  5K5Q A;  5C4X J;  2L5Q A;  4XOP A;  2PFV A;  1GDT A;  2XAH A;  2H1L A;  3IAM 2;  1UI6 A;  1G3T A;  4HRI A;  4GGG A;  4A5M A;  1QQI A;  2QQB A;  1NG6 A;  3BNI A;  1Z7L A;  2GA1 A;  2W25 A;  4BL0 B;  3G56 A;  1F9N A;  1SFE A;  4RB3 C;  1SD4 A;  3L09 A;  3CCV I;  2ZXW H;  3H3V K;  3CCL I;  1O3S A;  3DPL C;  2LRE A;  3ON4 A;  3GXO A;  1SAU A;  2IA0 A;  2MLK A;  4PJL A;  1V5G A;  4UNO A;  4M3B A;  3I55 I;  3ABL H;  2E60 A;  1KON A;  3MZ8 A;  4L9N A;  1DGW Y;  1EH6 A;  3G1L A;  2QVO A;  1FTT A;  1G2H A;  4PK4 A;  1VQ7 I;  5IOY A;  4QLC U;  1UCR A;  2KJC A;  4KJZ A;  3AFH A;  2M30 A;  4BE2 A;  5HBU A;  3ZQQ A;  4Q47 A;  3ASN H;  2L9S A;  2E34 A;  4C2M J;  4BQN A;  1TT5 B;  4LIT A;  2R5Y A;  5FKK A;  4M3G A;  4NQW A;  1T56 A;  5A2Q Z;  4GDF A;  4MFE A;  3RIR A;  3SDG A;  3WU0 A;  5E3N A;  2HI3 A;  1SD6 A;  4AVP A;  5GP9 A;  3S2H J;  3OS0 A;  1RIO H;  4NN1 A;  2NOJ B;  3NAU A;  3DF8 A;  3EUK L;  4AYB N;  1J7K A;  5DCF A;  3QKX A;  2XHK A;  4A3B J;  4EJW A;  1XG1 A;  1ZLJ A;  3MFK A;  3H1C A;  3BZK A;  2DTZ A;  2VBW A;  1FYM A;  1TW3 A;  1UI5 A;  2PBX A;  2W4S A;  5K7H A;  3P9K A;  3CCS I;  5JLX A;  2DQR A;  5L3E A;  4XKB A;  4XRS A;  3AG1 H;  1UZC A;  1X1C A;  4L5E A;  4BBS J;  3ECH A;  1L0O C;  3FK6 A;  2RN7 A;  1VF9 A;  2XAU A;  2MH9 A;  2EZI A;  3L2U A;  4KA4 A;  5FFZ A;  2QBY B;  2OI8 A;  3G7R A;  3TQN A;  3F22 A;  5E8G A;  2NP5 A;  3BJ6 A;  1YQA A;  4HPQ A;  1O3R A;  2VQG A;  2H94 A;  3TW6 A;  3R60 A;  1TWG J;  2MD5 A;  1Z6R A;  1JUS A;  2LDU A;  5EEA A;  1VQO I;  1E3O C;  1O7F A;  1R4N B;  3NS4 A;  2Q0O A;  2K9M A;  5FKO A;  4EM0 B;  1RET A;  3CD6 I;  5H9T A;  5DDG A;  5E18 F;  2DA3 A;  2F48 A;  3VSK A;  2CUJ A;  3JRI A;  1JKO C;  4ESB A;  4XMY A;  4C3I J;  4B47 A;  4ZYA A;  5FGM A;  4FAS D;  5EG0 B;  2P0W A;  1WJB A;  2HDW A;  1UEL B;  2DFF A;  5AIQ A;  4R79 A;  4ZZD A;  2IA2 A;  3KKC A;  1ETK A;  4HV6 A;  3K4N A;  3WTS C;  4C2T A;  3ZMU A;  3ZQI A;  2V9K A;  4DZJ A;  4ZYG A;  3WTU C;  1BI1 A;  1I3A A;  2A6T A;  2R92 J;  2R7S A;  3HE0 A;  1BM9 A;  3QQA A;  5GPA A;  4KWA A;  2DAO A;  4FE7 A;  3OYI A;  3HTU A;  3OYL A;  2MG4 A;  4WF2 A;  1YO5 C;  3WHC A;  1Z7U A;  2L7M P;  2L54 A;  2EV5 A;  3HYI A;  3NAR A;  1RUO A;  2O8K A;  2A68 F;  3DEE A;  2DJI A;  2LNB A;  5ERI A;  5IP9 J;  2N8G A;  3EPZ A;  4RAG A;  4NB5 A;  2A61 A;  4Y52 J;  4A3K J;  3EUA A;  3G1O A;  5DTD A;  5LHG A;  4G6Q A;  1YJ9 I;  3CJD A;  4ZYD A;  3AG2 H;  1LNW A;  2H27 A;  2OJE D;  3MKY B;  3LWF A;  1I39 A;  2K3F A;  4A5N A;  4I99 C;  9ANT A;  3A01 A;  3OWT A;  2IEK A;  2LR8 A;  4KN4 X;  2V1U A;  3TO9 A;  3HTS B;  4RA2 A;  2JTV A;  1XS9 A;  2E2H J;  3OYJ A;  1HW5 A;  1T98 A;  1U2W A;  2GWR A;  4F91 B;  2E2J J;  3MEX A;  3IRQ A;  3GME A;  1DP3 A;  2NP3 A;  2VJI A;  4XKW A;  4ZH4 F;  5IP6 A;  2WA0 A;  3GFM A;  2EPF A;  5JFR A;  3Q5F A;  1VQ4 I;  2Y48 A;  2YX7 A;  2LKS A;  1NTC A;  3V7S A;  1PJR A;  5D6E A;  2FSW A;  5BPI A;  2PG4 A;  1DGR M;  1UG0 A;  4CHU A;  5FMP A;  2R5Y B;  4U7B A;  5HLI A;  1XPX A;  4IOA F;  3GO5 A;  4NQW B;  1MJ9 A;  1BJZ A;  4I0A A;  2W7N A;  2EIJ H;  2WAF A;  4KN7 X;  1F5T A;  1FSH A;  4UVA A;  1ZGA A;  3S5R A;  2JRT A;  5CVU A;  2ZCN A;  4K2E A;  4UDS A;  3VVZ A;  4RS8 A;  2D6Y A;  3WOD F;  3WGI A;  1Y1W J;  1YX5 A;  3OL4 A;  1LFU P;  1JE8 A;  5D5V B;  1YX3 A;  3BG7 A;  4E4H A;  1FY7 A;  5D4R A;  3VB2 A;  3BR0 A;  2UXU A;  1WZ2 A;  3LL7 A;  1MGT A;  2E1M B;  5KNL A;  4BBR J;  4G9Y A;  1WJ5 A;  1WCM J;  2LF8 A;  3I4P A;  2R7R A;  3KEY A;  4HAM A;  4CZZ A;  5D18 A;  4XRF A;  4O6J A;  3JTH A;  1O57 A;  3NEU A;  1BOA A;  2XPW A;  1IN5 A;  4D5F A;  2PN6 A;  2WC2 A;  2Z5U A;  3CUQ A;  3HM5 A;  3KZZ A;  3L2Q A;  3A1Y A;  2WTE A;  4A2U A;  1WH7 A;  3HOT A;  1S9H A;  2GFN A;  2WWY A;  4DZP A;  3H5R A;  2QCO A;  4ZTJ A;  3NWT A;  2V9P A;  2QKO A;  1FBQ A;  4CYC A;  2J5O A;  3RKW A;  1YLF A;  3IWZ A;  2R7Z J;  4DOZ A;  2XVC A;  2G0E A;  3ZPL A;  5LBQ A;  5JVG F;  1WQ2 A;  2K4B A;  4YZE A;  2QSH X;  3BJA A;  2DFI A;  5FRM A;  1DU6 A;  3CQZ J;  2V7F A;  4ZDO A;  4HBL A;  2FNP A;  1VFC A;  2HKX A;  2OQR A;  1PP7 U;  1JKQ C;  3CTA A;  2CS3 A;  3QPH A;  4WK8 F;  1W0U A;  2HQR A;  4RB2 C;  2VBZ A;  3K4B A;  1OLT A;  1S5L C;  2PMZ N;  3O2P E;  5LHI A;  2EIL H;  3JW4 A;  1S3J A;  1HCR A;  4GCV A;  3RZO J;  4RAY A;  2QWW A;  1MMS A;  5FRO A;  4BDY A;  1TQP A;  4GCL A;  5HNH A;  1XCV A;  3CCR I;  3LA2 A;  3JSP A;  3CCE I;  4O3M A;  4G6T B;  3IUV A;  2F4I A;  2YVX A;  5B5E C;  2WAQ N;  2O61 A;  2EJR A;  2ELJ A;  3GZ6 A;  1YIT I;  3A01 B;  2DDB A;  2EQR A;  3CME I;  3ZQ7 A;  3PNV A;  3BP8 A;  2WY8 Q;  1SMT A;  2MH2 A;  4JP0 A;  1I27 A;  4NEL A;  1E2X A;  3HHG A;  3K0L A;  4CDG A;  1XGO A;  1IXC A;  1RES A;  3LSP A;  3FXO A;  1UFM A;  4FE4 A;  2XC7 A;  1DU0 A;  3ASO H;  2QOP A;  5EYR A;  4HEA 2;  2ICW G;  3V8K A;  4HKU A;  1G3Y A;  3S93 A;  1XSX A;  1QNT A;  3FWE A;  3AG4 H;  5J1R A;  1CQT A;  4L5J A;  1IW7 F;  1W5S A;  3CCY A;  3D5S C;  3HOX J;  4HW0 A;  3NPI A;  1OYI A;  5LHH A;  1IN7 A;  3Q0W A;  3DKY A;  2P7V B;  1FP1 D;  1D1A A;  1LUJ B;  4HST A;  5K5O A;  2BY2 A;  1Z77 A;  4EEF G;  2VN2 A;  3KPH A;  4KIF A;  3I64 A;  1WPK A;  2ID3 A;  2RNJ A;  3JTG A;  2PMU A;  3L1P A;  2Y31 A;  2LY2 A;  3VW2 A;  4ESF A;  1G8X A;  2Z33 A;  1D3Y A;  4P55 A;  3U2R A;  3Q9S A;  4A3E J;  4FX4 A;  2REK A;  3QP6 A;  4GFL A;  5KHD A;  2WGB A;  1PUF A;  3ABT A;  4B43 A;  1YFH A;  1A5J A;  1GVJ A;  1LVA A;  4IF4 A;  2HQ5 A;  3MNL A;  3VPR A;  1YJW I;  4KIG A;  5KK1 A;  1TNT A;  1CF7 A;  3CUO A;  4A3L J;  3LQQ A;  3TOB A;  3EGQ A;  3AQT A;  3RPU D;  4N0B A;  1BIA A;  4IKF A;  2KT0 A;  1BR2 A;  2W85 A;  2XRL A;  1JUP A;  3K6G A;  4M72 A;  1T39 A;  4G6D A;  2FBH A;  4M3D A;  3K4M A;  3H9J A;  1HBX G;  4EGY A;  4B3A A;  4A3M J;  5E1W A;  1Y56 A;  2HVQ A;  4ENK A;  2DI3 A;  2ZME A;  3IRR A;  3LSM A;  4QPQ A;  1TQI A;  3I59 B;  1BC7 C;  2O8X A;  1JT6 A;  3GEZ A;  4HYE A;  3QOE A;  2OTL I;  4BQQ A;  1MNE A;  2R7F A;  2X6W A;  3HGG A;  3WG7 H;  2ACJ A;  3E3V A;  4KT5 C;  2HNH A;  2AQE A;  4AUX A;  4HDU A;  4M6X A;  4G12 A;  4PXI A;  2B63 J;  1RI7 A;  2Q2E A;  2QGU A;  4II2 A;  3ZQF A;  3K70 C;  5CQE A;  3ESW B;  4QPO A;  2G7L A;  3QU3 A;  3GX4 X;  1ZR2 A;  4AC6 A;  1FIA A;  2YU9 J;  2CQN A;  1LB2 A;  1ZR4 A;  2UXI A;  3CC7 I;  2QZ8 A;  2H09 A;  4ABZ A;  1FLI A;  3OL3 A;  1AA7 A;  3FMR A;  2X1D A;  2CUZ A;  1IRG A;  2Q24 A;  2FF4 A;  3MZY A;  1R5H A;  2FA5 A;  3O6B B;  2RHA A;  3KEQ A;  4ASN A;  2ESH A;  2DT6 A;  3WTX C;  3M3Y J;  2QIB A;  3FF5 A;  4ESJ A;  2V6E A;  5DD8 A;  4M9Z A;  3S1N J;  5D5X B;  4UUS A;  2IRF G;  1FX7 A;  2VKD A;  1U6G A;  2E35 A;  3OSG A;  3TDU C;  3OYH A;  1UJ8 A;  2DDA A;  3FM5 A;  4RM3 A;  2H6B A;  1L3L A;  4MNU A;  1K6O A;  3B73 A;  1XMK A;  4OAY A;  2CW0 F;  2RVC A;  1YRN A;  4HQE A;  3ZQG A;  3FHZ A;  3D1N I;  3FXL A;  2AO9 A;  2D1H A;  4PUS A;  1FNN A;  1KU2 A;  4J00 A;  2X1C A;  1HQC A;  4HSR A;  2G3B A;  2VT3 A;  2FJI 1;  5B3S H;  4RGR A;  3W2A A;  2L7F P;  3O60 A;  4U9N A;  5CXI A;  1HDD C;  2L02 A;  3CMA I;  2DXI A;  5FJ8 J;  5FB2 A;  2VXZ A;  2OPT A;  4EM1 A;  4AIK A;  3HDD A;  5FRN A;  4BUP A;  4R1H A;  4A69 C;  1LVK A;  2VOO A;  2XDV A;  1K7A A;  3HTA A;  1ON1 A;  3EDP A;  4A93 J;  2UV1 A;  3FKI J;  5CVV A;  5KVR A;  4A3G J;  1F4K A;  3BQY A;  2Y69 H;  3GLX A;  3DEU A;  1DDN A;  1EH7 A;  1W7P D;  3DKW A;  5LLQ A;  3FXU A;  2IP2 A;  1JUM A;  4D7N A;  2KIQ A;  1FOW A;  4MFD A;  3MN2 A;  1LDD A;  4IXA A;  1KQ0 A;  2XB0 X;  3ZQH A;  1K79 A;  2E71 A;  4CSW A;  1JI8 A;  3OYM A;  1GT0 C;  5F6F A;  5E17 F;  2V9V A;  4W97 A;  4XN0 A;  1VQL I;  3BCB A;  5E3L A;  4KMU X;  1DQU A;  4Y33 A;  5CLS A;  1LEB A;  1MND A;  4M6V A;  1X1P A;  2K3P A;  1REP C;  2CJJ A;  3I5U A;  2NS8 A;  3CJN A;  4GFB A;  1VQ6 I;  1OKR A;  1XTA A;  3E6B A;  1O4X A;  2IA1 A;  4GCK A;  1ETX A;  3RKQ A;  3DLL F;  3DLA A;  4CH7 A;  4YEL A;  4RDU A;  3BQZ A;  2LD5 A;  4A3J J;  2P5L C;  2HQA A;  4BGD A;  4AID A;  2QYO A;  3ML6 A;  4OIR F;  2IBD A;  5ICC A;  4I2O A;  2ZME B;  4KIC A;  2A6E F;  3SWH A;  2O9L A;  4XSX F;  4BU2 A;  2WAQ A;  3IP4 B;  1STZ A;  1W1W E;  3Q9V A;  1X2M A;  3FMS A;  2K27 A;  4HQM A;  5J8F A;  4L0Y B;  2KDO A;  3F8F A;  4LJZ F;  4N9H A;  3V4G A;  2CSO A;  5CVI A;  1HA8 A;  2L9R A;  2FRH A;  4XON A;  2VLA A;  2VPR A;  2Q2E B;  2VC1 A;  3V6G A;  2DMP A;  3ZN1 A;  4M9S A;  5HOD A;  2W82 A;  1JTX A;  2P7C B;  1OIS A;  3KP3 A;  4HF2 A;  1KA8 A;  4O5V A;  1UHM A;  2V1X A;  1X3W B;  3V78 A;  1B6A A;  2JN6 A;  1MNM C;  4BE0 A;  2LC2 A;  2XPU A;  3LSR A;  1WFX A;  5ICF A;  1EJ9 A;  2PZ9 A;  1BW6 A;  1R9T J;  2LLK A;  3BPX A;  3FX3 A;  3NRG A;  5DAJ A;  3I71 A;  5B1B H;  2ZXI A;  1DPR A;  4V19 K;  5F08 A;  3RYP A;  3WU2 C;  2O7O A;  2M8E A;  4PFP A;  5ICG A;  5FLX K;  4UUS B;  2CV2 A;  4ZYH A;  2V79 A;  2EFW A;  4LLG F;  4J19 A;  4XIC A;  2B9S A;  3PO2 J;  2QTQ A;  2GZW A;  1J0R A;  1V3F A;  2E1O A;  1HKQ A;  3BG3 A;  4HF0 A;  2YVH A;  3E1S A;  3FK7 A;  4L62 A;  2W24 A;  3N05 A;  2O3F A;  3NXC A;  1I5Z A;  2KIU A;  3S17 J;  2UUZ A;  2XRN A;  1QPM A;  1FJL A;  1A35 A;  1RNL A;  1TW2 A;  3BCA A;  3OYA A;  2TDX A;  3Q0U A;  5GAH J;  4XLC A;  3HSF A;  1ZAO A;  1XMX A;  1B8I A;  3ZN0 A;  3KX2 A;  1FEX A;  3HBL A;  5IT9 Z;  1OCZ H;  4I02 A;  3COL A;  3EYY A;  3FIS A;  2HDC A;  2FQ4 A;  3SZP A;  1K78 A;  4YRV A;  3PL8 A;  2IW5 A;  1IUY A;  3S1R J;  1HW1 A;  2X9D A;  2DU9 A;  1R71 A;  4H0E A;  1BW5 A;  3L2C A;  3DTI A;  3R0J A;  2L4M A;  2DOD A;  4A3D J;  1R5I D;  2AHQ A;  2R93 J;  5EGO A;  1FMV A;  2XGC A;  4I0B A;  1TNS A;  1XSD A;  1SVL A;  4RB1 A;  2EZL A;  1V54 H;  4IL6 C;  1OCR H;  1V5F A;  3C1D A;  4CGZ A;  3MCZ A;  1RR8 C;  2AQF A;  3DU6 A;  3HGY A;  3CMY A;  1I1G A;  2FOK A;  1SFU A;  1EA3 A;  4U0W A;  3WG9 A;  2M5W A;  3K4C A;  2YUS A;  4PJN A;  2ZFW A;  4KYW A;  4DBQ A;  3T0Y A;  4H4K C;  4BJ6 C;  3RSN A;  1N25 A;  2DT7 B;  3HEF A;  4I6Z A;  4S05 A;  4D0P A;  2K5C A;  2Y0S N;  3T1B A;  1CGP A;  5K58 A;  2HOE A;  3GZN B;  3OMY A;  3H5A A;  1T6S A;  2CG4 A;  1Z91 A;  3MMY B;  1APL C;  4UV9 A;  3UKG A;  1VND A;  1GLN A;  3PO3 J;  2A69 F;  4IRV A;  1G3S A;  2X85 A;  4UUT A;  5ILU A;  4LIU A;  1MJA A;  1TWF J;  1YYV A;  2M45 A;  2KPM A;  3TED A;  5FLM J;  4ENN A;  3JRB A;  3CCQ I;  4YFK F;  3MVP A;  3HOW J;  3I4M J;  1MBE A;  3KYC B;  2DT5 A;  1FBU A;  4XLN F;  4MLO A;  3VVY A;  2ZFU A;  3N4M A;  2WV1 A;  3FBN B;  2FOW A;  3ZOB A;  3CC2 I;  4DGW B;  1SVO A;  2XAS A;  5EZH A;  3OY9 A;  1FYK A;  2K9L A;  3DU5 A;  1RKT A;  4PJJ A;  2EBI A;  3WHB A;  3SDB A;  3KLO A;  5GTH C;  2GIV A;  3VOE A;  2CYY A;  4E7J A;  4RBO A;  3J80 Z;  2M9H A;  3P9C A;  4M73 A;  4IQJ A;  2EIK H;  3X2Q H;  4BH9 A;  2BVM A;  2GEN A;  2R5Z A;  1R4M B;  1R6R A;  2NAZ A;  1WJD A;  2M2E A;  4AIH A;  2CWE A;  3L2V A;  2E1M C;  3J81 K;  2OTJ I;  1ORK A;  1NG7 A;  1WSU A;  4IRI A;  5ICE A;  5HS7 A;  3KYL A;  1ETV A;  2HXI A;  3S2D J;  4FIS A;  3PIO F;  3RDI A;  3W6V A;  3L2R A;  2WBM A;  2VQL A;  3ZMT A;  5FKN A;  5L3D A;  2P5K A;  4FQG A;  1OCC H;  2DA7 A;  3CWR A;  3JRG A;  3J7Y J;  3H9Q A;  2VQC A;  1P6R A;  2CFO A;  2J5P A;  2YPR A;  3WU1 B;  3ECO A;  4GO1 A;  2Q1Z B;  3GVA A;  1B8I B;  2PLY A;  4GYI A;  1VQ9 I;  2DYS H;  1YS6 A;  3GUD A;  3HZJ A;  4OD5 A;  1K78 B;  3DP7 A;  1D5Y A;  3HRU A;  4GXO A;  3Q3S A;  2P4W A;  2M0M A;  3JAM K;  3MZH A;  3BR3 A;  3F8B A;  3R4K A;  3ZRG A;  5LRS A;  2O5R A;  3D0S A;  2HYJ A;  2WB1 N;  1H0M A;  1FWZ A;  5EGO B;  4ME9 A;  4BXU A;  1B9M A;  2BW3 A;  1SVM A;  4EV0 A;  5GPC A;  3P9I A;  4EMS A;  3PAS A;  2COB A;  2HVR A;  1MBJ A;  2EWN A;  2X48 A;  1I50 J;  2ZO4 A;  4ON0 A;  1FPQ A;  4LG0 B;  1IRZ A;  5E3M A;  2ZNZ A;  4HLY A;  3HUG A;  3C07 A;  1EKE A;  4IHS A;  2VAS A;  2QA4 I;  4Q5S F;  4JKZ A;  4CO8 A;  2OQG A;  2ZSH B;  3LMM A;  3KFW X;  3HTH A;  1HDP A;  3DKX A;  1ZKG A;  3HHH A;  3AG3 H;  3WTT C;  3HKZ N;  2CU7 A;  3TO7 A;  2ELK A;  4GCT A;  5L3G A;  1OCO H;  1PDN C;  4DQ2 A;  5M5W J;  2Y30 A;  5D19 A;  1OJL A;  2YVE A;  2IVM A;  2M7B A;  1N75 A;  1R1T A;  2CRG A;  3ULQ B;  3V7R A;  3LST A;  1VZ0 A;  3ZQL A;  1I3Q J;  2H1K A;  2QEN A;  1X4P A;  2QQA A;  2QQ9 A;  5BPD A;  2TCT A;  1OR7 A;  5TGT A;  1Z05 A;  3EQL F;  4YIR X;  5ED4 A;  5C4J J;  5FGL A;  2DBB A;  4HF1 A;  4CGR A;  1Y0N A;  3HTJ A;  1LEA A;  3F21 A;  1IV8 A;  1W5T A;  5H6Q A;  5J3L A;  1SMY F;  3BR2 A;  1S7O A;  2OBP A;  2BXZ A;  3KCC A;  3GCM A;  4JK1 X;  2HU9 A;  4V2G A;  3K4K A;  2UXH A;  2YX4 A;  3OR2 C;  2XRO A;  1S8N A;  2VB6 A;  3MD2 A;  1MSE C;  2WAE A;  3HOY J;  3KLN A;  4HNT A;  5LGU A;  1KU3 A;  4XLF A;  2MC3 A;  1S7A A;  3DCF A;  4HNV A;  1XMA A;  1K83 J;  3M4O J;  1K6Y A;  4BYY A;  2L01 A;  4Z6Y A;  4MK6 A;  1IDZ A;  4U7D A;  2IJL A;  1HKT A;  3QU6 A;  3KZY A;  1K4S A;  5IOZ A;  2DG7 A;  3HC7 A;  5CQG A;  3LSG A;  3ABU A;  2W84 A;  4OIQ F;  3WE2 A;  3S1M J;  3DEW A;  1T2K A;  3BG6 A;  3L00 A;  2R5Z B;  5EZG A;  1LPQ A;  4U9L A;  4JQF A;  3PNT A;  2QKM B;  1U78 A;  1R1V A;  3FHN A;  3IH4 A;  2Z1D A;  4YIF A;  1MMD A;  2H6C A;  1Y8R B;  3TW7 A;  1P92 A;  2W1O A;  4EVI A;  2WAD A;  2IGO A;  4IOC F;  3DBR B;  2L4A A;  3ON2 A;  1XGM A;  5CJ9 A;  2ECB A;  1D5V A;  2K85 A;  4UB8 C;  3KP6 A;  3C3W A;  3I54 A;  3CUQ C;  1ACI A;  5IYB J;  1JHH A;  1HXD A;  1XCB A;  5BNG A;  1JTY A;  1YJN I;  1IC8 A;  1KU7 A;  3ERM A;  3L7W A;  2ZCM A;  2LFB A;  2CQ7 A;  2DO7 A;  1MSF C;  3W2W A;  4WCG A;  3D5L A;  5IT3 A;  3H0D A;  3ERE D;  3KZ9 A;  3HRT A;  4HA8 A;  3A02 A;  1G6N A;  4JYK A;  2OCC H;  4OU0 A;  4EJO A;  3BOQ A;  4DYR A;  1GV2 A;  2R7D A;  1D1B A;  3L9F A;  3PUF A;  2UXO A;  4L9V A;  1B9N A;  2PMH A;  4ENJ A;  2E36 A;  2B3W A;  2VI6 A;  3F6V A;  3MAJ A;  2P5V A;  2EFP A;  1ZRD A;  3SEQ A;  2D5V A;  2F6C A;  4OOI A;  1K4T A;  1ZYR F;  3ZMV A;  1ZG3 A;  3U21 A;  3OYK A;  1IRF A;  1W5C C;  3QRF F;  2M34 A;  1JJ6 C;  1VQM I;  3HSR A;  5KAF C;  3OYD A;  2BW3 B;  3KEO A;  3ANP A;  2MD0 A;  1IXR C;  2VOP A;  3VFZ A;  2KFD A;  3PFI A;  4A3C J;  2L9V A;  2GXB A;  1O3Q A;  2STW A;  1AKH A;  2GXA A;  3I3L A;  3MKZ A;  4A6E A;  2R7W A;  1NK3 P;  2HYT A;  4XOR A;  2XGX A;  1I6X A;  2BOL A;  2FNA A;  3S3O A;  3H92 A;  1M1E B;  1W36 D;  2H8W A;  1RR7 A;  1X1B A;  2M4K A;  1GUU A;  2QF7 A;  4E7Z A;  1ZRE A;  2GLO A;  4HZF A;  4WX9 A;  1BN5 A;  5J1Y A;  4Z2Y A;  3M07 A;  3QYE A;  2WY7 Q;  4U88 A;  3F23 A;  2LK2 A;  5LRR A;  3CDH A;  2ZBK A;  2RGV A;  2E5N A;  4BJT A;  3OS2 A;  3O8H A;  2D45 A;  3N97 A;  4DVY P;  3KP2 A;  3HOV J;  3F9K A;  4JX5 A;  2K7L A;  4UXN A;  1OMI A;  1MMG A;  1J59 A;  1WKM A;  2NNN A;  3ZQC A;  2HQN A;  4D9J A;  2EB7 A;  4AD9 A;  3H3Z A;  2CV1 A;  1ZLK A;  2PJR A;  4AYB A;  4RAF A;  4UVB A;  3T8T A;  4P9F A;  4XL9 A;  1X3U A;  3B6A A;  1U8B A;  3OR1 C;  1SFX A;  4EAT A;  2Y0M A;  3AKZ A;  1Q1V A;  1WHU A;  2VQH A;  2JRM A;  2RAE A;  1T8I A;  2OD5 A;  3ISP A;  1LE8 A;  3E6M A;  4TV7 A;  1SFO J;  2X6Y A;  2PBI A;  3PUB A;  2GOX B;  2KJB A;  3RPU A;  2ESN A;  5LFA A;  4X6A J;  2LOO A;  4UB6 C;  3ABK H;  3C2B A;  2DA1 A;  2B7E A;  2BYV E;  4IJA A;  1BBY A;  4QIW N;  1TL8 A;  3S16 J;  2Z99 A;  1J9I A;  2XGE A;  4N4N B;  5AON A;  4ETS A;  2P81 A;  1UHS A;  4Q4Z F;  1HOM A;  1IV6 A;  2F5C A;  4MO7 A;  3HOS A;  5EDN A;  3HRS A;  1JJ8 C;  3BCG A;  1IUF A;  2NX4 A;  2V26 A;  4BXX J;  3TL4 X;  3WE3 A;  1WJF A;  2A2F X;  2XAQ A;  2QWT A;  1YE9 A;  3V42 A;  4EJV A;  1OPC A;  1TTY A;  4WXD A;  4F7Z A;  3HL2 A;  1UST A;  3HTI A;  3DBH B;  5JHF A;  4CCO A;  2WB1 A;  2R7Q A;  1FT9 A;  5ILV A;  3SXY A;  3F8N A;  4CUG A;  1LQ1 A;  1WVR A;  4OMY A;  4E7I A;  2LTP A;  2QSF X;  4IO9 F;  3I0T A;  3SZG A;  1WI9 A;  1X58 A;  3BJB A;  3K4L A;  2FQ3 A;  4EQQ A;  4BKX A;  3BTI A;  2ZME C;  4NNJ A;  2DW4 A;  1XX5 A;  1NHA A;  2VC0 A;  1R49 A;  3CMM A;  1MZB A;  2ZNY A;  1ZHF A;  3CUQ B;  4HNU A;  2HZT A;  3RI4 A;  4UY8 I;  1G4D A;  5FLV A;  3VDX A;  3K4J A;  1ZGJ A;  1S6L A;  2CQX A;  4JNN A;  1R00 A;  4IHV A;  4L9J A;  5B66 C;  4CYC B;  4IRG A;  3BG9 A;  4LIV A;  1BR4 A;  4XID A;  2DQL A;  4BQA A;  3DPU A;  4IHY A;  5DM7 F;  2LBF A;  4I09 A;  1UHW A;  3K7A J;  3KE2 A;  3BR1 A;  4M74 A;  2BE5 F;  2I8D A;  5D5U B;  1TQM A;  2EZK A;  4HX8 A;  1U5T A;  4RB0 A;  2LY1 A;  4IQ4 A;  3G73 A;  2PJP A;  1MKM A;  2K86 A;  2ZJP F;  2GXG A;  2VIX A;  2E19 A;  3B02 A;  3TP3 A;  4OD4 A;  1BJA A;  4M3F A;  2UZK A;  3Q0V A;  1Y0U A;  3V8J A;  3F0C A;  2VJ5 A;  4RLQ A;  3CC4 I;  2B1E A;  1QHG A;  3HOZ J;  2O03 A;  2IGN A;  1IG7 A;  3U1D A;  3QP5 A;  3GTQ J;  2HR3 A;  1SFK A;  4P9U A;  2PI0 A;  3GTG J;  3DTK A;  4DW6 A;  3BTJ A;  1WRJ A;  2KLO A;  4CCN A;  3G2B A;  4E7L A;  5D1R A;  1LDK B;  3C2H A;  4BXF A;  4CXF A;  1BA5 A;  2PJR B;  1T0F A;  3VYS B;  2OC6 A;  5IYC J;  2RQP A;  1W7P A;  1WI3 A;  4JBA A;  1UB9 A;  2ELH A;  3SEZ A;  3UR3 C;  1QA6 A;  4NC7 A;  3NQO A;  3IKT A;  3H3U A;  4BHC A;  2A07 F;  4A12 A;  5K1Y A;  5LD2 C;  2ZC2 A;  4AF5 A;  1ZAR A;  2YU3 A;  1R1U A;  3HG9 A;  4LGW A;  5FD6 A;  1Z0X A;  1ENH A;  4I76 A;  3REO A;  3V7C A;  1KZH A;  1EH8 A;  2GM4 A;  4QTR A;  4L5I A;  2W00 A;  3GFL A;  3ZR8 X;  3W3C A;  1MBK A;  3OYF A;  4XR6 A;  4ZYE A;  2LVS A;  1S72 I;  1MDM A;  1MH4 A;  2ZOY A;  4M9X A;  1Z3Y A;  2HDD A;  1QVU A;  5TJJ A;  3GYH X;  2DOF A;  5BQT A;  2DTR A;  2L2O A;  3BR5 A;  2VKH A;  5F1R A;  2QKL B;  5GAD J;  3U9G A;  5J8C A;  1D8J A;  3LFK A;  1Z6T A;  4BHB A;  1IAW A;  2LF7 A;  3BRO A;  1VTN C;  5HDN A;  1N77 A;  1QZZ A;  3EET A;  2X0L A;  2LSO A;  2HS5 A;  3HJE A;  2KKO A;  2GA2 A;  4A3F J;  1J09 A;  4A0Y A;  2MC4 A;  4L0Z B;  1FOX A;  2VJJ A;  2UXP A;  3KNW A;  2DMT A;  2I10 A;  2MBF A;  1PUF B;  1QO0 D;  2G7U A;  2BBY A;  1R7J A;  1X4O A;  3CRJ A;  3ABM H;  4IHW A;  1QU3 A;  3F3X A;  1CF7 B;  4LFU A;  1ULY A;  2L7Z A;  4P96 A;  1ONV A;  3ZP5 A;  2MAB A;  4BDZ A;  4DIQ A;  3DV8 A;  3LWJ A;  1LKX A;  1USS A;  5JI6 A;  5M5Y J;  3LA7 A;  4LOC A;  5C3E J;  2VL8 A;  4PJM A;  3SQN A;  5BS6 A;  3VEP A;  2C6Y A;  2NS7 A;  1LDJ A;  2PMZ A;  4CCK A;  3J7A O;  2E1C A;  5AIP A;  4NBQ A;  1TWA J;  3PPB A;  3VOX A;  3FM3 A;  3ZMS A;  5KAI C;  2EFN A;  3WGG A;  3PM1 A;  5DCM A;  3VW1 A;  2F2E A;  2QLZ A;  2JSP A;  3ZCO A;  1IO2 A;  3OYB A;  3RYR A;  3VIB A;  3CDL A;  1BOB A;  2OCE A;  3RPQ A;  2FBI A;  2LBF B;  3ELK A;  3FKJ A;  3LQR A;  4ANJ A;  5GAE J;  4RGS A;  1D8K A;  3WTZ A;  2LMD A;  1X1D A;  4BY1 J;  1U5T B;  2F4M B;  4DYQ A;  1TLH B;  1KGS A;  4Y7N J;  3UNG C;  5E8I A;  3OOP A;  3NI7 A;  5FO5 A;  3JCU C;  5H6R A;  4KIT B;  2Z9O A;  4G7H F;  1MJB A;  1GHC A;  2R7T A;  5EF6 A;  3IH2 A;  1SC7 A;  4DNC A;  2WUI A;  3DPJ A;  1ETO A;  1D1C A;  4XLE A;  4RMN A;  1S29 A;  4Y13 A;  1IGN A;  4X0G A;  2H8R A;  1EV7 A;  4IHX A;  3S14 J;  2ZY9 A;  1POG A;  3KP5 A;  1WWX A;  4MQ9 F;  5JR3 A;  2DN0 A;  4XRM A;  2Y9Z A;  3WTW C;  1DP7 P;  3GF2 A;  4IX7 A;  1FOK A;  1KQ9 A;  2K02 A;  1GXQ A;  5J40 A;  1P4X A;  3IH3 A;  4IRH A;  4G7Z F;  1SGM A;  5JHU A;  3RJP A;  4QSH A;  3DTE A;  2X6O A;  1SD5 A;  2KHM A;  4UVC A;  1PYV A;  4F55 A;  2W48 A;  2VON A;  3S1Q J;  4WIB A;  3T5X A;  1W7P B;  1N78 A;  3JRD A;  1E3P A;  2A05 A;  3A0B C;  3PQK A;  4U0Y A;  1JKP C;  2XAJ A;  2K40 A;  3MWM A;  2R7U A;  4RAZ A;  2BXY A;  3IHU A;  5C44 J;  2YS9 A;  3WTV C;  3VW0 A;  2DMU A;  1I1S A;  1YRN B;  2E1N A;  2R3S A;  3PSF A;  5J6X A;  1HF0 A;  2VT2 A;  2QQ8 A;  3E5U A;  1IXS B;  1W0T A;  4LLL A;  3G6E I;  4D1Q A;  1KYW A;  5DYM A;  5TRD A;  3QPS A;  3QPT A;  3BY6 A;  3HB9 A;  4AWX B;  2A6H F;  4UV8 A;  3OYG A;  1P9Q C;  3VYR B;  2HGC A;  4S0H B;  2NNY A;  1JGS A;  1TP4 A;  3CF5 F;  2RAS A;  5B1A H;  3OYE A;  5L3B A;  3WTY C;  3W2V A;  1DUX C;  2EIM H;  1MIJ A;  2V57 A;  3M8F A;  5HLG A;  3G1M A;  1GXP A;  3F8C A;  4RGX A;  2E2I J;  1QRY A;  5D6F A;  3GWZ A;  2IS2 A;  4MIM A;  4HOB A;  4HV5 A;  2L7K A;  6PAX A;  2CMP A;  2DMQ A;  2IU5 A;  2CQK A;  2KIM A;  4A0X A;  2CV0 A;  1ZGW A;  3KIO A;  3CO7 C;  1MBG A;  5IYD J;  3TDZ C;  1ZRF A;  3BPV A;  2K9Q A;  2CGP A;  3BWG A;  2AXL A;  5F27 A;  4BHP A;  2HYF A;  2LKP A;  4FET A;  5GTI C;  3QAH A;  4WXH A;  4BAY A;  2HOT A;  2BY0 A;  3BZ6 A;  4I98 B;  4YEJ A;  4C3H J;  4AIJ A;  4ITV A;  2XUB A;  1MBH A;  1F43 A;  4PSX A;  4BNC A;  1P7I A;  3QWL A;  1T33 A;  1IRX A;  1E17 A;  1X1A A;  1ODD A;  3K1M A;  2K9N A;  3QOP A;  4F3Q A;  2EA4 A;  5DCM B;  3OS1 A;  2VUM J;  2CFX A;  2KRC A;  2W57 A;  2I5U A;  3E5X A;  3QYF A;  4BS9 A;  3HRM A;  2IS4 A;  5M3F J;  1BL0 A;  4J01 A;  3SFI A;  2OV7 A;  2ZSI B;  4IHT A;  4B1R A;  3A2K A;  2MA3 A;  3SJM A;  1ZEL A;  4PGH A;  2ME0 A;  4XLA A;  3QOD A;  5LEK A;  4E70 A;  3M8J A;  1FYL A;  5J47 A;  4RLF A;  4KDP A;  1JT0 A;  2FJ1 A;  4S04 A;  1O3T A;  5IY5 H;  2LYC A;  5CVJ A;  1HC8 A;  1VQ8 I;  2OAZ A;  1YIJ I;  4XSZ F;  5CW8 A;  4D7M A;  2JZY A;  2HYG D;  4V2F A;  3CJQ B;  1X2N A;  2XB5 A;  2XAG A;  2DPU A;  3GTO J;  1TC3 C;  4NUB A;  2KIS A;  1A31 A;  3LA3 A;  5LGN A;  2CO5 A;  2LG4 A;  1U0J A;  3RZD J;  3OYN A;  2NVU B;  3RTR A;  1WJE A;  1P4A A;  2CUF A;  2XF7 A;  1O7L A;  2JUG A;  2XV4 S;  5E1Z B;  4E6K G;  5K5R A;  2RKH A;  1PUE E;  2VBY A;  3S2W A;  1U9O A;  2BZT A;  4CA0 A;  4Y17 A;  4L9T A;  2BVL A;  3TGN A;  1BI3 A;  3KP7 A;  2YR2 A;  3VYU B;  1SD7 A;  1VI0 A;  2F07 A;  5FHP A;  2L9N A;  1IZ1 A;  4OIN F;  3VVX A;  3CCM I;  2NS0 A;  1LJ9 A;  1E0E A;  2L3D A;  1U3E M;  2ISZ A;  2IS6 A;  2A3S A;  1A04 A;  3HXL A;  3RKY A;  2A5Y B;  3KKD A;  3GTK J;  5L3C A;  3K10 A;  3M1E A;  3G4S I;  2ETH A;  3FXK A;  2Z2S B;  3VUQ A;  1IN6 A;  4NDL A;  5F0F A;  3FMQ A;  4FHT A;  2EH3 A;  2OUM A;  4E7H A;  2XAF A;  5HVQ C;  1Z21 A;  4C3J J;  2JWT A;  1FOY A;  3GZI A;  5F0C A;  3GBG A;  3BC8 A;  2EFO A;  5H2F C;  2IAI A;  1ETY A;  2BGC A;  1ZRC A;  3LJL A;  3QYB A;  3PIP F;  3FZV A;  2O0Y A;  3R61 A;  4F52 A;  3LAP A;  1AOY A;  3IV5 A;  2BV6 A;  4JX4 A;  1NH3 A;  3PSI A;  2ZKZ A;  3HIF A;  2JPC A;  4B3X A;  2M3A A;  3AL0 C;  2R7X A;  2HEO A;  2IS1 A;  3F6O A;  4M6Y A;  3FXJ A;  2FXA A;  1OR7 C;  3PQJ A;  2KRH A;  1R22 A;  5L3F A;  3CCU I;  2FMY A;  2LH9 A;  3GW2 A;  3S8P A;  4CIC A;  3ZXS A;  5HLT A;  4MEX F;  3GLL A;  4UHT A;  1B72 A;  4YFN F;  2VE8 A;  2AS5 F;  2M0C A;  3VYT B;  3H35 A;  3VOD A;  3H0G J;  4CCM A;  3BTC A;  4XBF A;  2UWM A;  2CQQ A;  1P7J A;  1UMQ A;  1WJA A;  2JVH A;  2DA6 A;  2GIZ A;  3KP4 A;  3GTJ J;  3K69 A;  4HDV A;  5C4Y A;  3A03 A;  1R23 A;  1Z3X A;  4ZTF A;  1Z9C A;  2PQ8 A;  2EV0 A;  3I53 A;  1OCT C;  4OIP F;  1AWC A;  1FZP B;  2NYX A;  2QSG X;  2VBX A;  1UG2 A;  4FCY A;  1TWH J;  4ZJZ A;  4N9I A;  1H88 C;  2VOD A;  1QGP A;  5IP7 J;  4KNY A;  2FML A;  1MH3 A;  1QHH D;  3CO6 C;  3DFG A;  5FKL A;  1OCP A;  3OV8 A;  1Z67 A;  3ONQ A;  5D5W B;  1GVD A;  4A3I J;  3E6C C;  2MSY A;  3CP2 A;  4LK1 F;  1QZY A;  1ETQ A;  1YHQ I;  2IPQ X;  2IGM A;  2MLG A;  3PNY A;  2KRF A;  2P6S A;  3TBI A;  4LLN A;  2JA7 J;  1G3W A;  3CLO A;  3FIW A;  4ZDP A;  2OZU A;  5HDK A;  1QBJ A;  4HX7 A;  1ZG5 A;  4BAC A;  2A5W A;  3I4N J;  4PCQ A;  3CJT B;  2MFZ A;  3BG5 A;  3S15 J;  2B0L A;  2Z16 A;  3BLY A;  1YI2 I;  4KMF A;  2F5E A;  1JXS A;  1F1Z A;  4GYG A;  2E7X A;  4PJ0 C;  2EFQ A;  1W36 C;  4YG2 F;  3BRU A;  4OAZ A;  3BT9 A;  3JRA A;  1QPI A;  4LB6 B;  2FD5 A;  2BHY A;  1FP2 A;  4EGZ A;  1YG2 A;  5E1X A;  1H9G A;  3S3N A;  3SZT A;  3FXM A;  2JVG A;  3GFI A;  2KZG A;  1J75 A;  1Y8Q B;  1Y6I A;  5E20 A;  4C9Y A;  2JUC A;  2HPI A;  4F92 B;  4HLX A;  3C7J A;  1V4R A;  3TKY A;  2R7V A;  4BQO A;  3RQI A;  1IDY A;  2P6T A;  2XIG A;  1HSJ A;  1X19 A;  2G7G A;  2NVT J;  3GEU A;  2FBQ A;  1A6I A;  1XN7 A;  3CJR B;  3I58 A;  5HS9 A;  1KYZ A;  4MEY F;  2DA4 A;  2Y0S A;  3CP8 A;  4XM3 A;  2PX9 A;  4KUM A;  5FLX Z;  4IZZ A;  3NNR A;  3BR6 A;  5KCM A;  2HZD A;  2JA8 J;  2OER A;  1ZK8 A;  3NWS A;  4PGG A;  4XOT A;  3P5J A;  3VWB A;  3G71 I;  2JQ7 A;  2GBY A;  2DLL A;  5EFY A;  5JLW A;  5FFX A;  1JHF A;  2EV6 A;  4KIS A;  3MQ0 A;  3JRH A;  2FU4 A;  3K9T A;  2IXS A;  1XB4 A;  5E3O A;  2WV0 A;  1OYW A;  3SHF A;  3IWF A;  4LK0 F;  2P8T A;  3LSI A;  4PDK A;  4X1E A;  3HSE A;  3HUG B;  1FIP A;  1P2F A;  1ITY A;  2CH0 A;  1FMW A;  2R7O A;  4OWR B;  3RD3 A;  4JX6 A;  3DQV C;  3B81 A;  4HG2 A;  2UXX A;  3C18 A;  3I59 A;  3E6D A;  4NHJ A;  2X1E A;  2XF6 A;  2ZB9 A;  5DD4 A;  4ZC3 A;  4ICH A;  3LAJ A;  3HPG A;  3TP0 A;  1B72 B;  3OIQ A;  2NVY J;  4AM3 A;  3WGH A;  3HOU J;  2KL4 A;  3AL0 B;  3LSJ A;  2ZCX A;  3T6N A;  4B8X A;  3DPT A;  2UXN A;  5F64 A;  4HX4 A;  5BOX A;  3JSO A;  3R0A A;  4MTE A;  2K4J A;  2JK3 A;  5IT9 K;  2PFB A;  3PJR A;  2E5Z A;  4LB5 A;  2OF7 A;  2KP6 A; 
#chains in the Genus database with same CATH homology
 4AF5 A;  3FIS A;  2FQ4 A;  1Z0X A;  1ENH A;  3KKC A;  4I76 A;  2KDZ A;  1ETK A;  3S1R J;  2X9D A;  2GM4 A;  1BW5 A;  3ZQI A;  4QTR A;  4DZJ A;  2R92 J;  3GTM J;  3HE0 A;  3QQA A;  5GPA A;  4KWA A;  4A3D J;  4FE7 A;  1MBK A;  1HLV A;  3OOU A;  2AHQ A;  2LVS A;  2MG4 A;  1MH4 A;  2XGC A;  3WHC A;  5EGO A;  2R93 J;  2L7M P;  2XPV A;  2HDD A;  2ZOY A;  3HIM A;  3NAR A;  2O8K A;  2EZL A;  2ECC A;  1QVU A;  5IP9 J;  3HGY A;  3CMY A;  3BR5 A;  2N8G A;  5F0H A;  2LP0 A;  2VKV A;  2LKX A;  1MBF A;  4Y52 J;  4A3K J;  3G1O A;  5DTD A;  5K7Z A;  2YUS A;  3CJD A;  2Y9Y A;  4I6Z A;  3HEF A;  4DYC A;  2XSD C;  2HOS A;  5IPA A;  4A3F J;  2Y0S N;  9ANT A;  3A01 A;  5K58 A;  2IEK A;  2UXP A;  2LR8 A;  3KNW A;  2DMT A;  2I10 A;  2LY9 A;  1PUF B;  3CRJ A;  1APL C;  1XS9 A;  3B6C A;  3LNQ A;  2E2H J;  3UKG A;  1VND A;  2E2J J;  4IHW A;  3PO3 J;  2NP3 A;  1TWC J;  2L7Z A;  4UUT A;  5IP6 A;  3LWJ A;  1TWF J;  5M5Y J;  5C3E J;  4LOC A;  1NTC A;  3TED A;  5FLM J;  3JRB A;  2FX0 A;  4B4C A;  3JRE A;  5FMP A;  2CUE A;  2NS7 A;  2R5Y B;  3MVP A;  3HOW J;  3I4M J;  5CXG A;  1MBE A;  4GFK A;  4MLO A;  3VVY A;  2WV1 A;  1BJZ A;  1TWA J;  3PPB A;  3VOX A;  3ZOB A;  2GUH A;  3PM1 A;  5EZH A;  5K7F A;  3S5R A;  3VW1 A;  1RKT A;  3VIB A;  3CDL A;  1FTZ A;  2DJN A;  1ZTR A;  2EBI A;  3WHB A;  2ZCN A;  4UDS A;  3VVZ A;  2NVQ J;  2D6Y A;  4RBO A;  1Y1W J;  1LFU P;  2M9H A;  4BY1 J;  4DYQ A;  4Y7N J;  3JR9 A;  2GEN A;  2R5Z A;  3MKL A;  3NI7 A;  3BR0 A;  2UXU A;  2M2E A;  1ORK A;  4BBR J;  4XK4 A;  5EF6 A;  3IH2 A;  1AKH B;  1WCM J;  2WUI A;  3DPJ A;  1ETO A;  5D18 A;  2MW8 A;  2DMN A;  1IGN A;  2H8R A;  1ETV A;  2HXI A;  5F1J A;  4IHX A;  3S14 J;  3S2D J;  4FIS A;  1POG A;  5M3M J;  1JGG A;  5DS9 A;  2Y9Z A;  3W6V A;  4XRM A;  2DN0 A;  2XPW A;  3VOK A;  5FKN A;  4D5F A;  3HM5 A;  3IH3 A;  1SGM A;  4QSH A;  2GFN A;  1WH7 A;  2DA7 A;  4DZP A;  3CWR A;  3JRG A;  2QCO A;  2X6O A;  3S1Q J;  2W48 A;  2QKO A;  1H8A C;  4CYC A;  3BTL A;  4MXM A;  3JRD A;  4IEJ A;  5FKM A;  1JKP C;  1B8I B;  2R7Z J;  2K40 A;  1AU7 A;  2G0E A;  5C44 J;  2YS9 A;  1I6H J;  4YZE A;  3VW0 A;  3VP5 A;  2DMU A;  1DU6 A;  3CQZ J;  1YRN B;  1HF0 A;  1D5Y A;  2HKU A;  1VFC A;  3Q3S A;  1JKQ C;  3BR3 A;  1W0T A;  4FTH A;  2HYJ A;  2WB1 N;  1NK2 P;  3QPS A;  5EGO B;  1W0U A;  4ME9 A;  3HB9 A;  5GPC A;  1LE8 B;  2PMZ N;  1HCR A;  3PAS A;  2COB A;  3RZO J;  4S0H B;  4XRS G;  1MBJ A;  4D5C A;  3QPL A;  2X48 A;  1LFB A;  2RAS A;  1I50 J;  4GCL A;  1IRZ A;  5E3M A;  4W1U A;  2V57 A;  3LOC A;  3C07 A;  3G1M A;  3F1B A;  3IUV A;  1ETW A;  2WAQ N;  2E2I J;  4JKZ A;  1QRY A;  1QVT A;  3HTH A;  1HDP A;  3A01 B;  1ZKG A;  3HKZ N;  2CU7 A;  4MIM A;  2EQR A;  2ELK A;  4GCT A;  4M3E A;  5M5W J;  2Y30 A;  1RPW A;  1OJL A;  5D19 A;  2YVE A;  2DMQ A;  3ZQL A;  2IU5 A;  2H1K A;  2CRG A;  1I3Q J;  4JP0 A;  1ZGW A;  4NEL A;  1MBG A;  5IYD J;  2K9Q A;  1RES A;  2TCT A;  3LSP A;  3ANG A;  3FRQ A;  5F27 A;  4FE4 A;  1DU0 A;  5C4J J;  2QOP A;  5FGL A;  4CGR A;  2DA2 A;  5EYR A;  3HTJ A;  2HOT A;  4HKU A;  5J1R A;  5J3L A;  1CQT A;  1IJW C;  4C3H J;  3BR2 A;  3CCY A;  1MBH A;  3HOX J;  2G7S A;  2XDN A;  4V2G A;  1F43 A;  4BY7 J;  2UXH A;  3JRC A;  1P7I A;  3OIO A;  2HOA A;  1MSE C;  1T33 A;  3NPI A;  1XC5 A;  3HOY J;  3Q0W A;  2K9N A;  3JSJ A;  4HNV A;  3GTL J;  3DCF A;  1K83 J;  1Z77 A;  3M4O J;  4EEF G;  2VUM J;  3OSF A;  4MK6 A;  1IDZ A;  2XGD A;  1WPK A;  2ID3 A;  5M3F J;  3L1P A;  2Y31 A;  1BL0 A;  5IOZ A;  2DG7 A;  3SFI A;  3VW2 A;  3LSG A;  4B1R A;  3SJM A;  2JA5 J;  3E7Q A;  2NVX J;  2ME0 A;  3S1M J;  3DEW A;  1S7E A;  4A3E J;  2R5Z B;  5EZG A;  2REK A;  4GFL A;  1U78 A;  1PUF A;  2WGB A;  3IH4 A;  1JT0 A;  2JJ7 A;  1A5J A;  2MGQ A;  2FJ1 A;  2HQ5 A;  3TW7 A;  1K61 A;  3VPR A;  3MNL A;  3K2A A;  4A3L J;  1EF4 A;  5CW8 A;  4D7M A;  3ON2 A;  4V2F A;  1X2N A;  2XB5 A;  3GTO J;  3EGQ A;  3AQT A;  1TC3 C;  2ECB A;  2KT0 A;  3AQS A;  5IYB J;  3RZD J;  2XRL A;  1JUP A;  5BNG A;  1JTY A;  1IC8 A;  4JL3 A;  1GV5 A;  2L0K A;  2CUF A;  2ZCM A;  2LFB A;  1ZQ3 P;  4M3D A;  1MSF C;  2JA6 J;  3LHQ A;  1RKW A;  4B3A A;  3KZ9 A;  4A3M J;  1U9O A;  3A02 A;  2O7T A;  4JYK A;  3GTP J;  1JT6 A;  4DYR A;  1GV2 A;  3HGG A;  2UXO A;  4AC0 A;  1VI0 A;  2F07 A;  2W53 A;  1H89 C;  5F04 A;  1JKR C;  5FHP A;  5J1U A;  2VI6 A;  3E7L A;  3VVX A;  5HAW A;  2VKE A;  4AUX A;  2D5V A;  4G12 A;  4PXI A;  3KKD A;  3GTK J;  2ID6 A;  2B63 J;  3VUQ A;  2M34 A;  3ZQF A;  1JJ6 C;  2JMW A;  4NDL A;  2DG8 A;  2G7L A;  5F0F A;  3ANP A;  2EH3 A;  1ZR2 A;  4AC6 A;  1FIA A;  2YU9 J;  4A3C J;  4ACI A;  1U9N A;  4C3J J;  2JWT A;  1AKH A;  5AQC A;  1ZR4 A;  2UXI A;  3EUP A;  2HYT A;  4ABZ A;  1NK3 P;  3GZI A;  5HSZ A;  3BHQ A;  2R0Q C;  5F0C A;  3GBG A;  1AHD P;  2Y2Z A;  2IAI A;  1ETY A;  2DA5 A;  2Q24 A;  3LJL A;  1RR7 A;  1Y1V J;  2QF7 A;  1GUU A;  2GLO A;  2RHA A;  5J1Y A;  3IV5 A;  4JX4 A;  2LK2 A;  3JRF A;  1WH5 A;  3M3Y J;  2QIB A;  2TRT A;  3O8H A;  3S1N J;  2K9S A;  2NOG A;  4UUS A;  3HOV J;  4JX5 A;  3QBM A;  5M5X J;  3OSG A;  3ZQC A;  1OFC X;  1B72 A;  2M0C A;  3RH2 A;  1YRN A;  3H0G J;  3ZQG A;  3BTC A;  3D1N I;  2CQQ A;  2M8G X;  3B6A A;  1P7J A;  2AO9 A;  1U8B A;  1UMQ A;  2DA6 A;  1F36 A;  1SAN A;  1Q1V A;  3GTJ J;  2G3B A;  5C4Y A;  2RAE A;  3A03 A;  1WGX A;  5EG0 A;  2HXO A;  1OCT C;  1LE8 A;  2EZH A;  2L7F P;  3O60 A;  5CXI A;  1HDD C;  1SFO J;  3P9T A;  5FJ8 J;  1UG2 A;  2OPT A;  3O8G A;  1TWH J;  2ME6 A;  4FCY A;  1H88 C;  3HDD A;  2ZOZ A;  5IP7 J;  4A69 C;  4X6A J;  1MH3 A;  3HTA A;  5FKL A;  3C2B A;  2DA1 A;  3FKI J;  1OCP A;  4QIW N;  4A93 J;  5C4X J;  1ITY A;  4A3I J;  1GVD A;  3S16 J;  3BQY A;  4A3G J;  2XGE A;  2MSY A;  1GDT A;  1UI6 A;  1ETQ A;  2P81 A;  1UHS A;  1JUM A;  4D7N A;  1IV6 A;  4MO7 A;  4MFD A;  3MN2 A;  2JA7 J;  1HOM A;  3BNI A;  5EDN A;  3FIW A;  1JJ8 C;  3BCG A;  1IUF A;  2XB0 X;  3ZQH A;  3I4N J;  3G56 A;  2NX4 A;  1GT0 C;  4BXX J;  3BG5 A;  4W97 A;  3S15 J;  5E3L A;  2QWT A;  4M6V A;  3H3V K;  2CJJ A;  3ON4 A;  2NS8 A;  4GFB A;  3HTI A;  4M3B A;  1O4X A;  4GCK A;  1ETX A;  3RKQ A;  3BRU A;  3BT9 A;  3JRA A;  1QPI A;  3G1L A;  4RDU A;  3BQZ A;  1FTT A;  2LTP A;  2LD5 A;  1G2H A;  5IOY A;  2FD5 A;  4A3J J;  1X58 A;  3BJB A;  4BKX A;  2IBD A;  3BTI A;  5HBU A;  2O9L A;  4C2M J;  2R5Y A;  5FKK A;  4M3G A;  5FLV A;  1T56 A;  1X2M A;  2CQX A;  4MFE A;  3SDG A;  4JNN A;  3RQI A;  5E3N A;  4IHV A;  1IDY A;  2HI3 A;  5GP9 A;  4CYC B;  3S2H J;  3BG9 A;  4NN1 A;  3NAU A;  2L9R A;  2NVT J;  2G7G A;  2FBQ A;  3GEU A;  2VPR A;  1A6I A;  4XID A;  4AYB N;  4IHY A;  3V6G A;  2DMP A;  3QKX A;  2DA4 A;  3K7A J;  5HOD A;  1XG1 A;  4A3B J;  1JTX A;  3BR1 A;  2DTZ A;  3NNR A;  1UI5 A;  3BR6 A;  2PBX A;  5K7H A;  2JA8 J;  2OER A;  1ZK8 A;  2EZK A;  3V78 A;  2JN6 A;  1MNM C;  5JLX A;  2XPU A;  2GBY A;  4XRS A;  3LSR A;  5EFY A;  2PZ9 A;  1BW6 A;  5JLW A;  1R9T J;  4L5E A;  2LLK A;  4BBS J;  3NRG A;  2E19 A;  3FK6 A;  3JRH A;  3TP3 A;  5DAJ A;  1VF9 A;  2EZI A;  4M3F A;  2OI8 A;  5E3O A;  3Q0V A;  5F08 A;  3G7R A;  3F0C A;  2NP5 A;  2O7O A;  4X1E A;  3HOZ J;  1FIP A;  1IG7 A;  4UUS B;  3TW6 A;  4J19 A;  1TWG J;  4XIC A;  3GTQ J;  3PO2 J;  2QTQ A;  3RD3 A;  4JX6 A;  3GTG J;  1JUS A;  2E1O A;  3BG3 A;  3B81 A;  4DW6 A;  2YVH A;  2ZB9 A;  3BTJ A;  3FK7 A;  5EEA A;  1E3O C;  4ICH A;  4L62 A;  3TP0 A;  5D1R A;  5FKO A;  1B72 B;  3NXC A;  1RET A;  1BA5 A;  2NVY J;  3S17 J;  5H9T A;  3HOU J;  1FJL A;  3LSJ A;  2ZCX A;  3Q0U A;  2DA3 A;  5IYC J;  3T6N A;  1WI3 A;  3JRI A;  1JKO C;  2JK3 A;  1B8I A;  4C3I J;  1FEX A;  3HBL A;  2OF7 A;  5EG0 B;  3COL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...