3WHBA

Crystal structure of fadr from bacillus subtilis, a transcriptional regulator involved in the regulation of fatty acid degradation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
189
structure length
189
Chain Sequence
RPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Fatty acid metabolism regulator protein
total genus 76
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whbA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whbA02
2GLOA 4I6ZA 5EZGA 2O9LA 1FTTA 3HE0A 1UG2A 3COLA 1X2MA 3I4NJ 1ITYA 4D5FA 1NK2P 3ANGA 2FJ1A 2NVXJ 1TWCJ 3CCYA 4HNVA 5EDNA 5E3LA 2XPWA 2LFBA 3JRIA 2D6YA 2Q24A 1YRNA 3JRHA 3DCFA 5EEAA 1Z77A 4ICHA 1IDYA 3TEDA 2WV1A 3GTPJ 3LHQA 4BBRJ 3LNQA 1GV5A 1ETYA 3B81A 3ZQIA 3CQZJ 3C2BA 1ETKA 3JRBA 4JX4A 3HKZN 4A3GJ 2ZOZA 3HGYA 2JWTA 1E3OC 5F08A 2R7ZJ 2GFNA 2X48A 4MO7A 2Y0SN 2NS7A 2ZCNA 1I6HJ 2JN6A 5F0FA 2CUEA 3BTLA 3PO3J 4Y52J 1LFBA 4DZJA 2JA6J 1WI3A 2VKEA 1F43A 3FISA 3GTMJ 5EZHA 2ID6A 3M4OJ 3JR9A 1FJLA 2CUFA 2WAQN 3MN2A 2M34A 4ACIA 3QBMA 2K9SA 3VOXA 3HTJA 2R0QC 5CW8A 2GBYA 2B63J 3IUVA 2TCTA 2CRGA 2H1KA 2HXIA 3A03A 1APLC 4DYCA 1GUUA 1ZGWA 1S7EA 4A3MJ 3BTIA 2M2EA 3GEUA 1P7IA 2FX0A 3BG9A 5F04A 1IG7A 4UDSA 2CU7A 1Y1WJ 4XIDA 3TP0A 2E2HJ 3ZQGA 1RESA 2NS8A 5DS9A 2E2IJ 3HOVJ 1WCMJ 3IH4A 3S1RJ 5FMPA 4BBSJ 2E1OA 2Y9YA 3HTHA 4A93J 1BW5A 2HI3A 4AYBN 3Q0WA 2HKUA 3HTAA 3RH2A 3V78A 4X1EA 2XDNA 2IAIA 3RZOJ 5EG0A 1D5YA 2KDZA 2JA5J 4DYRA 2ID3A 3Q0VA 2XSDC 1Y1VJ 2LP0A 4AC0A 1JKQC 2LKXA 4A3CJ 2EZLA 1EF4A 2DA3A 3F0CA 5FKMA 5EGOA 1SFOJ 1GT0C 1YRNB 3S17J 5AQCA 2DMQA 4XICA 2R5YB 2ECCA 2YU9J 3BQYA 5F0HA 1IC8A 2VUMJ 3VIBA 4HKUA 4BXXJ 1MH4A 5K7FA 1ZR2A 2QKOA 5C44J 3D1NI 2MG4A 4XRSG 3G1LA 4C3JJ 2XPUA 1H88C 3VVZA 4GCKA 3PPBA 2NVQJ 4IHWA 4JNNA 3DEWA 2V57A 4CGRA 5E3OA 1RETA 2Y31A 4A3BJ 4DYQA 2R5ZB 3H0GJ 4GFKA 4A3LJ 1JT0A 3OOUA 4C3IJ 5K58A 2OF7A 1I3QJ 2QIBA 1ZKGA 3JRGA 2YUSA 3S15J 1ZTRA 3LSJA 2R93J 4XRSA 1BW6A 2EQRA 3HM5A 4DZPA 4M3EA 1RR7A 4JL3A 2DTZA 1NK3P 1R9TJ 4L5EA 2DA1A 2NOGA 1A6IA 3BJBA 3E7LA 3JRCA 2ZCXA 2OERA 3VW0A 4A69C 1DU6A 2LLKA 2L7FP 4IEJA 5IYCJ 3Q0UA 2NX4A 1HDPA 3NI7A 1AHDP 1MNMC 2XB5A 1U9NA 5GPCA 4M3GA 3LWJA 3FK7A 4D7MA 4B1RA 1TWFJ 4JX5A 1SANA 1X58A 3V6GA 1O4XA 2G7LA 1WGXA 5IPAA 3LJLA 4QSHA 3BR1A 2JA8J 1B72B 3W6VA 2RASA 2AHQA 3JSJA 1JUMA 3E7QA 3VOKA 2IU5A 1B8IB 1TWAJ 3NPIA 5D1RA 5C3EJ 3KZ9A 3BR3A 2JA7J 5E3MA 4M3FA 2COBA 3TW6A 2M9HA 1W0UA 2G3BA 1TWGJ 2QF7A 2HXOA 5FLVA 5IOZA 4V2FA 1ZK8A 3HOXJ 2W53A 4UUSB 2LTPA 3NAUA 3BQZA 1UI5A 2I10A 5D18A 2AO9A 3G1MA 4D7NA 2O8KA 2DG7A 1OFCX 2M0CA 4MXMA 3BR2A 1OCTC 4UUSA 3GTQJ 1MBHA 1TWHJ 3S2DJ 2HYTA 2CQQA 5FLMJ 3O8HA 4M6VA 4ME9A 3AQTA 1HDDC 1QRYA 2DMUA 1NTCA 4MFDA 1FEXA 2G7GA 1JJ6C 4GCTA 2Y30A 5HBUA 2HOSA 2O7TA 2Y2ZA 4CYCA 2KT0A 4B3AA 4L62A 3SDGA 1MH3A 5J1YA 1B72A 3CRJA 5DAJA 5HAWA 2E19A 4XK4A 1JJ8C 4B4CA 1K61A 1W0TA 3B6CA 1HOMA 2EZHA 4NDLA 5C4JJ 4A3IJ 2VPRA 5E3NA 2D5VA 2OPTA 2K9QA 1IUFA 5F27A 3KKDA 1T56A 3A01A 2E2JJ 5FGLA 1JUPA 5IYDJ 3C07A 4M3DA 2XGEA 2ZB9A 3JRFA 4I76A 1MBKA 1IDZA 4A3DJ 1JTXA 2MSYA 2L7MP 1IRZA 3CWRA 3WHCA 5K7HA 2LY9A 3A02A 4A3EJ 3FK6A 4LOCA 3JREA 5FJ8J 5DTDA 1FTZA 3BRUA 2W48A 3S1MJ 3Q3SA 3G1OA 2P81A 2K40A 2R5YA 4W97A 3LSRA 2XB0X 4MFEA 3HDDA 2QOPA 3GTGJ 4QIWN 4MIMA 5IOYA 3M3YJ 3HIMA 2DMTA 5FKOA 3ON2A 1QVUA 3S1NJ 1ETVA 3PASA 3OSGA 5M3MJ 3GTLJ 2WUIA 1Z0XA 5J1RA 2L7ZA 3NXCA 1BJZA 5HSZA 3NARA 3SJMA 1Q1VA 3HB9A 2YS9A 2UXUA 4YZEA 5CXGA 2EH3A 3BR5A 4FE7A 2XGCA 2UXPA 2CQXA 2HYJA 1U9OA 3KNWA 4BKXA 3BTCA 1HLVA 3VW2A 3VVXA 2X9DA 3QKXA 3FIWA 5CXIA 1ENHA 5J1UA 1AU7A 3BG5A 3G56A 3OIOA 4JKZA 4A3KJ 3ON4A 1MBFA 5FKKA 1HF0A 1F36A 3VPRA 3NNRA 5M5XJ 2O7OA 3GTKJ 3GBGA 3HEFA 4BY7J 5EGOB 2NVYJ 1MBEA 5IYBJ 3PO2J 2LD5A 3MVPA 3UKGA 1I50J 1XG1A 4RBOA 4NN1A 3F1BA 9ANTA 1FIPA 5J3LA 3ZQFA 4AUXA 1DU0A 5K7ZA 2DA7A 1JKRC 4MLOA 5EF6A 4DW6A 5M5YJ 3S14J 3LOCA 2H8RA 1XS9A 1VI0A 2M8GX 3BT9A 1QVTA 4KWAA 2RAEA 2MGQA 4JP0A 4Y7NJ 1OJLA 5IP7J 4X6AJ 3CMYA 1SGMA 3IH3A 3VP5A 1LE8A 2DMPA 3ANPA 1G2HA 1JT6A 2XRLA 5FHPA 1BL0A 5M5WJ 4M3BA 3BTJA 1ZR4A 1MSEC 3L1PA 3BNIA 3RD3A 5GPAA 2QWTA 3A01B 2VKVA 2DA4A 2PMZN 3HBLA 1CQTA 2QCOA 3O60A 5M3FJ 2WGBA 2PBXA 4FCYA 2HOAA 4S0HB 1VFCA 1ETXA 3ZQHA 2GM4A 5F0CA 1RKWA 1ETWA 4RDUA 2ME0A 1AKHB 1MBGA 1IGNA 4CYCB 1OCPA 1U78A 3QPLA 1RKTA 5EYRA 3QPSA 3TP3A 3T6NA 2JMWA 3MKLA 4JYKA 3HOYJ 3P9TA 1LFUP 1ORKA 3HGGA 3K2AA 3S16J 3HOWJ 2DN0A 4W1UA 2ECBA 2FD5A 1JGGA 2F07A 3ZOBA 5IP9J 2QTQA 4FE4A 2FBQA 1IJWC 3PM1A 2PZ9A 2UXIA 2ME6A 1XC5A 2N8GA 3B6AA 5JLXA 1UI6A 1LE8B 3OSFA 3JRDA 5F1JA 2DA5A 3IH2A 4AF5A 4D5CA 2CJJA 4G12A 1BA5A 2RHAA 2DG8A 1H8AC 4IHYA 3BHQA 1A5JA 2DA6A 3HOZJ 2ZCMA 3EUPA 4FTHA 4J19A 1GV2A 4A3FJ 5C4YA 1WH5A 1MBJA 4A3JJ 1B8IA 3CJDA 2L0KA 2EZIA 5GP9A 2HDDA 3S5RA 2HQ5A 4C2MJ 3H3VK 2R92J 2DA2A 1GVDA 1POGA 2ELKA 3BG3A 4IHVA 3HTIA 3RKQA 2LR8A 4GCLA 4FISA 2REKA 3GTOJ 5IP6A 1ETQA 3RQIA 1HCRA 2G0EA 1P7JA 4JX6A 2VI6A 2ZOYA 3BR0A 1IV6A 3ZQCA 2WB1N 4V2GA 3CDLA 1UHSA 3K7AJ 3DPJA 1JUSA 2XGDA 1FIAA 2L9RA 1H89C 2HOTA 2DMNA 1PUFB 2NP3A 3VVYA 5FKLA 3MNLA 3FRQA 1WPKA 2LVSA 4MK6A 5HODA 5EFYA 4XRMA 3KKCA 2G7SA 2FQ4A 3TW7A 1UMQA 2NVTJ 3QQAA 2EZKA 1MSFC 4C3HJ 2IEKA 3S2HJ 2EBIA 2TRTA 2MW8A 2Y9ZA 1RPWA 1VF9A 3O8GA 3LSPA 3ZQLA 2DJNA 2IBDA 4IHXA 1JTYA 2YVEA 5C4XJ 1VNDA 2JJ7A 2X6OA 2LK2A 4BY1J 1K83J 1PUFA 3IV5A 1GDTA 2NP5A 3FKIJ 5EG0B 5BNGA 3I4MJ 2OI8A 1WH7A 2JK3A 4UUTA 2UXOA 3JRAA 2GENA 1X2NA 1ETOA 2R5ZA 3LSGA 3RZDJ 3VW1A 5JLWA 2YVHA 4GFBA 3HOUJ 4EEFG 1QPIA 2UXHA 1JKOC 4NELA 3VUQA 4PXIA 2GUHA 4ABZA 3SFIA 5FKNA 1ZQ3P 3AQSA 3NRGA 3WHBA 3S1QJ 1JKPC 3EGQA 5D19A 3BR6A 4GFLA 1T33A 2XPVA 1U8BA 4QTRA 3G7RA 1AKHA 1TC3C 4AC6A 3BCGA 5H9TA 3GZIA 2K9NA 3GTJJ
chains in the Genus database with same CATH superfamily
1Y39A 4KN4X 5EZGA 2O9LA 3MZYA 1FTTA 3BPVA 3H1CA 1X2MA 3NEUA 4MQVA 1ITYA 3COLA 2FJ1A 4AIKA 2M8EA 1IAWA 2NVXJ 2IA1A 3CCYA 4LJZF 1FBQA 1O3TA 1IZ1A 5EDNA 3I59B 2E7XA 1NH3A 2O6GE 2XPWA 3E5QA 2UV1A 2DI3A 1FZPB 1K78A 2DQRA 1FYKA 3ECOA 3OS2A 1IXCA 1EV7A 2L4MA 3DQVC 3H36A 2QBYB 4UUVA 2HS5A 4WIBA 3VODA 1Q1HA 1D0ZA 1LDKB 1GV5A 4KYWA 3B81A 3JRBA 3MMYB 3C2BA 4A3GJ 3OIQA 3HKZN 2JWTA 3W6JB 4F52A 2KLOA 3GF2A 2XV4S 4MQ9F 3MWMA 1HXDA 4ZYAA 2DFIA 1FBUA 2CUEA 5HS8A 1LFBA 3EDPA 1B4AA 1O7FA 2XF5A 1R49A 3LA3A 3FISA 5JVGF 3GTMJ 5EZHA 5EEHA 1FJLA 4KUMA 4KJZA 3QBMA 1LB2A 1BR1A 4KDPA 1ZREA 2QKMB 3H5NA 5CW8A 4LG0B 2GBYA 2FMLA 3IUVA 2CRGA 1MMGA 4B44A 5HNFA 3I58A 3A03A 4RGRA 1ULYA 5B1BH 4ZH4F 1R22A 2LDUA 4CZCA 3NS4A 3E3VA 1FSEA 2MLKA 2CU7A 2LNBA 3KIOA 3ERMA 1R58A 2WTEA 5KK1A 3KZIC 2E2IJ 3LFUA 3S1RJ 5DYMA 4BBSJ 4XN3A 2OAZA 2K02A 1MMAA 3HG9A 1DUXC 4AYBN 3KP3A 3Q0WA 3HTAA 3KYDB 2XDNA 4N9IA 1ONVA 3L09A 4KISA 4A12A 1WJCA 2JA5J 4L9JA 4PJLA 1Y8QB 2ID3A 1KQ8A 3Q0VA 1JKQC 2R7XA 4OD5A 3BZKA 2XVCA 2FBIA 1EF4A 5FKMA 2PMHA 5ICEA 1Y0UA 1DPUA 2DMQA 4U9LA 3NWSA 2K4JA 1EH7A 1F4KA 2MH9A 2JVGA 2QSFX 3BQYA 5F0HA 2H6CA 3VIBA 1ZG1A 4BXXJ 1QZZA 3DTEA 1H0MA 2DPDA 2Q0OA 1ZGJA 1V5GA 2L3DA 1G4DA 3Q9VA 5E8GA 2K3FA 2XPUA 5LD2C 1AWCA 1WJBA 4GCKA 3N4MA 3K4KA 3DEWA 2LKSA 1DP7P 1FOKA 4PSXA 4CGRA 5D5VB 2KIUA 2O0YA 3UNGC 2VE9A 4DYQA 3V8LA 1X1BA 3H0GJ 4GFKA 1D8JA 4II2A 2ZMEC 1JT0A 1BI1A 3OOUA 1D1BA 4HNTA 1P2FA 4ZDOA 2I5UA 4Z6YA 1OR7A 3S15J 3CCSI 2GXGA 3BY6A 4XKCA 4XRSA 4PGHA 4X0GA 5L3GA 1AA7A 3HM5A 3PNTA 4DZPA 1X3UA 1R9TJ 2LY2A 2NOGA 2KDOA 2L2OA 5DV5A 4OD4A 5DCMB 3E6BA 3V4GA 4M9XA 1S9HA 2L7FP 1FLIA 1LJ9A 4L18B 4F92B 3Q0UA 4HV5A 3WE2A 1EKEA 4XLEA 2V1UA 3KP6A 1W1WE 3LL7A 2RQQA 1K4SA 3HRSA 2CMPA 4F7ZA 1IW7F 2IRFG 2VQHA 4HZFA 5HLGA 3LWJA 2OUMA 4IRGA 3CZ6A 2EA2A 4B1RA 1SANA 1X58A 2QWWA 1O4XA 3V6GA 3RPQA 3LJLA 1XSXA 1ODDA 3L9FA 3DKWA 1JGSA 1B72B 3W6VA 2V9KA 3CCJI 1TZLA 2IU5A 1XGNA 3LA2A 1SVOA 1TWAJ 3KZ9A 4QPQA 1R1UA 2EV5A 2BVMA 2NOJB 2D45A 1UZCA 5E3MA 3TW6A 5GTIC 2XIGA 3FMSA 2M9HA 3TDUC 2KP6A 1Z6RA 2HXOA 3RPUD 5E18F 2A07F 3I5UA 4LITA 2I10A 4D7NA 2O8KA 3NWTA 2DG7A 1Y0NA 2M0CA 3DLLF 2WC2A 3DTIA 2QGUA 3MZHA 1XX5A 1UB9A 4PSWA 5DM6F 3S2DJ 4M6VA 3I56I 3VYRB 3AQTA 3ASNH 2DMUA 2CQNA 3BPXA 1Y6IA 4MTDA 2Y30A 5HBUA 2HOSA 3U21A 2O7TA 5FLXZ 3H35A 2R7RA 4A5MA 2B9SA 3E5XA 1FMVA 3GO5A 3BZ6A 1B9MA 1XMKA 3ZMSA 2F5CA 2QUFA 3S32A 5J1YA 1TW2A 3V8JA 2UXXA 4B4CA 4AVZA 1DPRA 1P9QC 1S8NA 3B6CA 3G3ZA 3IHUA 2WBMA 1OCRH 4NDLA 4HQMA 3GZ5A 1I3AA 5LGNA 1QQIA 4DBQA 5E3NA 4ZYHA 3S3OA 1BM9A 3A0BC 3HJEA 3J81K 3CDHA 3WTZA 5BPIA 2O03A 2D2WA 4BQOA 2IA2A 1IXSB 2Q1ZB 2XGEA 2ZB9A 1FOXA 3EETA 4G7ZF 3P7NA 3NRVA 2UXNA 2V1DA 4LIVA 1LQ1A 4ESFA 4RLQA 3B02A 2Q8KA 1VQNI 2VB6A 3UR3C 4IXAA 5LHIA 3LSRA 4JQFA 4DQ2A 3GTGJ 4CA0A 1MKMA 2W7NA 1GHCA 3M3YJ 3R61A 2FSWA 3SYTA 2X4HA 3KFWX 4LMYA 4EM0B 3DEEA 1QVUA 3PASA 4O3MA 2FMYA 4B8XA 5DM7F 4LK1F 2WUIA 2EIMH 2VOOA 2HFHA 1X1DA 1BJZA 3MEXA 4GYIA 2YS9A 2UXUA 3J80K 4FE7A 2XGCA 3ABUA 1HKQA 2AQFA 2CWEA 5E8IA 1HLVA 3BTCA 2VXZA 5CXIA 1ENHA 4RAFA 5BOXA 5J1UA 1AU7A 4EJWA 3OIOA 4ETSA 3OR1C 1E0EA 3K69A 1RR8C 4A3KJ 2DOAA 3ON4A 1HF0A 3IC7A 3ZP5A 1HBXG 2R7TA 1ZYRF 2EJRA 1ZG3A 3C2GA 3FM5A 2O7OA 5LHHA 2VQLA 3CTAA 3DPTA 3I9V2 3HEFA 5J6XA 3IL2A 4E70A 2X85A 2NVYJ 2M7BA 2BXZA 3ECHA 3PO2J 3OYHA 5LEKA 3UKGA 2OTJI 1XG1A 3CP2A 4Y17A 2QSHX 3H9JA 1TQPA 3CLOA 3F1BA 1QHHD 2AXLA 2IS1A 1QO0D 5K7ZA 4LGWA 3EUHA 3JCUC 3QU6A 5LHGA 2R7QA 3OMYA 5JFRA 2XAJA 1R1VA 2M5WA 3G73A 4LG3A 4CGZA 5LLQA 4G6TB 2H27A 2AXTC 4P9FA 3BCAA 3ABTA 2ETHA 4LLLA 4ZTJA 4M3BA 1BC8C 2VLAA 1MSEC 2YPRA 2RREA 1YW9A 3H92A 3BNIA 3RD3A 2B1EA 4HLXA 3A01B 2PMZN 2GAUA 3K4BA 5BPDA 4YIFA 3EUHC 3CJTB 2M3AA 2HOAA 4JK1X 3FXKA 3GVAA 5B5EC 2Y0MA 2H1LA 2GM4A 1RKWA 2ME0A 1AKHB 1MBGA 1X4OA 4CYCB 3QPLA 5KHDA 3QPSA 3TP3A 2E60A 1R00A 2JMWA 2HVRA 2PX9A 3WU1B 1MNDA 3OYLA 3P9TA 3K2AA 3ZXSA 3HOWJ 3CMAI 4W1UA 2Q2EA 1QA6A 2IGNA 3DPUA 1RRJA 1MDMB 5HDNA 1WI9A 3L2CA 1IXRC 4IF4A 4RGUA 1ZRDA 5FRMA 2PZ9A 2UXIA 1KYWA 3RTRA 5D4SA 2R7OA 3JRDA 1GXQA 4ZYDA 2DA5A 1SMTA 2Z1DA 4XKWA 2CJJA 3WTTC 3FXMA 2ZFWA 4G12A 2DG8A 1H8AC 4IHYA 2ZCMA 1IN4A 2K5CA 4UV8A 4OOIA 4J19A 1GV2A 4A3FJ 1BIBA 3F21A 1MBJA 2NXNB 4A3JJ 1IRXA 3K1MA 1R4NB 5GTHC 3S5RA 3A1YA 5J4VA 3H3VK 2VE8A 3SFZA 4CCNA 2DA2A 4UV9A 4IHVA 3HTIA 1MW7A 3RKQA 4P55A 3PJRA 1Z21A 3VOEA 2I8DA 3RPUA 3GTOJ 2V6CA 2EFQA 2IGKA 4HG2A 1HCRA 3ZR8X 2X1EA 2EWNA 1S3JA 1YW8A 4D9JA 2K3PA 3TL4X 1JUSA 3PUBA 2L9RA 2HOTA 2NP3A 5FKLA 3MNLA 2XAUA 3FRQA 1RNLA 2HR3A 4IRVA 4XRMA 3OY9A 4BQQA 4IJAA 2WY7Q 4KFCA 5HVQC 2NVTJ 2RC4A 1LVKA 2IEKA 2JUGA 3S2HJ 3ZMTA 3VYUB 3LQQA 3RKXA 2MW8A 2KHMA 3KE2A 1O3RA 4CCLA 3LSPA 2F2EA 5CJ9A 4E7SA 2V26A 2DJNA 4B43A 1UAAA 3O2PE 1IRFA 2E36A 4L9VA 1YJ9I 2Z99A 1UFMA 1XCVA 5ILVA 1W7PD 3G2BA 5BNGA 4G7HF 1DGWY 3GW2A 3HIFA 3P9CA 1FYLA 2HWVA 1LFPA 2VODA 2HPMA 3TO6A 1EH6A 4NELA 1NG7A 1OYWA 4DBRA 1GVJA 2Z16A 4NUBA 5ICGA 5D19A 1O7LA 3MAJA 1OMIA 4PGGA 4UVAA 1X3ZB 3G7RA 4P9UA 1HW1A 1D3YA 4U88A 2BYVE 4BNCA 3GZIA 3GTJJ 2HTSA 4YFXF 1Z91A 2K27A 4ESJA 3OIPA 3PNYA 1S7OA 3HE0A 1XTAA 1U3EM 2JT1A 3I4NJ 1ZN2A 5JR3A 3ANGA 1VQ6I 1TWCJ 3N05A 2VXDA 2IA0A 3SDBA 4HNVA 5E3LA 1U5TC 2IS2A 4CICA 1KGSA 3L2QA 2VL8A 2E5NA 3DCFA 1Z77A 4ICHA 1I6XA 2WV1A 2GQQA 2M7AA 5BMZA 3GTPJ 3MFKA 3VSKA 3E6CC 2R7SA 2P5KA 4BBRJ 1VQPI 1ETYA 2G9WA 4RB0A 2ZOZA 4JX4A 3PIOF 3HGYA 4PJNA 1JHFA 5F08A 3SEQA 4MEXF 2R7ZJ 2GFNA 2H94A 2Y0SN 3GFIA 3HHHA 2JTVA 2NS7A 5J8FA 1ZLKA 4L9NA 5TISC 2JN6A 1G3WA 5F0FA 1CF7A 3I71A 2RVCA 3BTLA 4FASD 4DZJA 3WU2C 1XMAA 2JSPA 1FNNA 1WI3A 2FU4A 4Y15A 1MGTA 4XOPA 1F43A 1BR4A 1XCBA 2ID6A 3M4OJ 3P5JA 2CUFA 2M34A 4KT6A 4ACIA 1BI0A 3FWEA 2VONA 1D8KA 2GA1A 3O6BB 1BOAA 5KAFC 3VOXA 4BGDA 1DQUA 4PDKA 2B63J 1N78A 1P4XA 2H1KA 1D0XA 1APLC 1GUUA 4A3MJ 2XASA 3BTIA 3MQ0A 2FX0A 1E3PA 4L9TA 3BG9A 3HL2A 5F04A 1IG7A 2NVUB 1Y1WJ 1R6RA 2A68F 1LPQA 2E2HJ 1XN7A 1RESA 3ZRGA 1VQ8I 5FMPA 3IH4A 2FJI1 2LREA 1SFXA 1WJDA 3DLAA 2HU9A 1D1AA 2OU2A 2Y9YA 3OYNA 5KNLA 4R79A 4AYBA 1Z05A 2DT6A 1X1AA 3VTIA 2KJCA 4A6EA 2IAIA 4XBFA 1J09A 5LRRA 2XSDC 1Y1VJ 3WTSC 4NB5A 3VVZA 1SFOJ 1GT0C 4YFNF 2FUG2 2ZNYA 4KICA 2KMUA 2VIXA 1MZBA 4XICA 2JA2A 3QAHA 2P5LC 2FXAA 2FA5A 3I55I 4BE1A 4HKUA 3WTUC 2LF7A 3ESWB 1MH4A 3KYLA 4ZYGA 2DDBA 2EFPA 3DWLE 3M1CA 5K7FA 3RKYA 3D1NI 4XRSG 4ANJA 3BJOA 4JNNA 1NG6A 2VKHA 3W2VA 1RETA 3IWZA 1TQMA 4CXFA 5E3OA 3N97A 2QLZA 2XAHA 4A3BJ 2P6SA 3SZPA 3FDYA 1OYIA 3HSEA 1R36A 5ILSA 4IPAA 1SD5A 2OZUA 1MJ9A 1ZKGA 1ZTRA 2R93J 2VQCA 2FOWA 3HPGA 3TKYA 3HYIA 1U5TB 4N0BA 4CDGA 5D8LB 4HDVA 4IOAF 1JXSA 2DYRH 4XNFA 5CVVA 2RNJA 4WCGA 1YJWI 2ZMEB 4L5EA 3V7RA 1ON1A 3CUOA 2DA1A 1A6IA 1T2KA 2OBPA 3BJBA 3E7LA 3P9KA 4ON0A 4A69C 2HQAA 2LLKA 2WWYA 1R4MB 3CJRB 1UHMA 4FT8A 2NX4A 3CCEI 1J0RA 4E7ZA 3CC2I 2BHYA 1HA8A 2DOEA 1XSDA 3L00A 5L3EA 2VPLA 4PJJA 3F9KA 3SZTA 1FWZA 1MDMA 4HAMA 4HPQA 4M3GA 4RGSA 2WY8Q 2MFZA 1TWFJ 1BI2A 2E1MB 5BS6A 1VQKI 2KRHA 3VB2A 1TTYA 1TL8A 2B0LA 1JUMA 5ED4A 1Z1DA 3TMOA 2GA2A 2OC6A 4Q47A 4EATA 3C18A 4CZZA 3NPIA 2O3FA 5C3EJ 4MNUA 1UG0A 1ZGAA 1CGPA 4M3FA 4UXNA 2LC2A 3WGHA 1W0UA 5FO5A 2G3BA 1TWGJ 3CESA 4LLNA 5IOZA 3PUFA 3DXJF 2GOMA 4UUSB 2LTPA 1F1ZA 4XONA 1UI5A 4U9NA 5D18A 2AO9A 1KU2A 2VN2A 1OYYA 1OFCX 3D5LA 2WA0A 1FP1D 1MBHA 2HYTA 5FLMJ 3IAS2 4ME9A 2ADUA 5EJCA 2BE5F 4MFDA 5HLTA 1FEXA 4NC8A 4GCTA 2WV0A 2ISZA 2E5ZA 1KQ0A 1G3YA 3WTVC 2KT0A 3D5SC 1ZH5A 2K85A 1BI3A 1MH3A 4I01A 2VJJA 3RJPA 4EJUA 4ENNA 5KAIC 1S72I 1YX5A 2KIMA 2IW5A 3GEZA 1LVAA 2Z3YA 5C4JJ 5CVIA 2R7UA 2VPRA 4C2TA 1IUFA 5F27A 3KKDA 4IQ4A 4NBQA 4XR6A 4BHBA 1STZA 1JUPA 4MGRA 5D6FA 2XUBA 4M3DA 3HTUA 4XLHA 2Y69H 4CCMA 1MBKA 2MSYA 2R7DA 4GCVA 3WHCA 4HQEA 3V8KA 4A3EJ 3GCMA 3GFJA 3FK6A 4LOCA 4DJAA 5DTDA 2W57A 1SEUA 1QNTA 1FTZA 2X1DA 1IRGA 4L0YB 3G1OA 3SZGA 2K40A 4W97A 1A36A 4BUPA 2B3WA 4NC7A 4QIWN 4HBLA 1ZELA 4A0ZA 3VFZA 3HIMA 3BP8A 2P6TA 5FKOA 5D8KB 3ON2A 1XDUA 4C9YA 2M4KA 4V19K 4ZYEA 2DOFA 2RN7A 4GRIA 3S1NJ 3JSOA 2R7FA 1G8XA 3OSGA 3GTLJ 2XGXA 1EJ9A 1Z7LA 1U6GA 2DXIA 3KP4A 1W36D 2F5VA 2MYSA 4FETA 5J1RA 2LY1A 3HRTA 3HB9A 4PFPA 3F8BA 3SJMA 3KLOA 4YZEA 3FMQA 2NAZA 2MABA 3BR5A 2ISYA 3IUOA 5A2QZ 4OMYA 1W36C 3G6EI 4C2UA 3JAMK 4EQQA 4IHSA 3GZ6A 1U9OA 3LSIA 5H20A 2PMUA 4BKXA 3VVXA 3K4MA 4XRFA 3QKXA 5CVUA 2ZFUA 2E1MC 2HQRA 4C30A 3G56A 3PFYA 2PN6A 4EJVA 2DFFA 2IPQX 3ZQQA 5CYVA 2OD5A 4OIOF 4HSRA 5FKKA 1F36A 3EYYA 3M8JA 5E1ZB 3NNRA 5M5XJ 3FXRA 3GTKJ 4M71A 4BY7J 5EGOB 5IYBJ 4KIFA 3CCRI 2HDWA 1I50J 2BXYA 1A04A 2JRMA 4NN1A 4RAYA 3ZQFA 2MH2A 3WTXC 3JAMZ 3QODA 2DA7A 1JKRC 2F4IA 4MLOA 3WGGA 3ZN1A 5EF6A 4CHUA 3LOCA 2NS0A 2V1XA 1N75A 1T0FC 1VI0A 1T8IA 3BT9A 3E6DA 4KWAA 4F93B 2RAEA 2MGQA 1X3WB 3BDDA 4JP0A 3WODF 4Y7NJ 1MJAA 3CMYA 3GZNB 2DU9A 5JVTA 3IH3A 3KZZA 1LE8A 3GUDA 3ANPA 1FOYA 2FBHA 2XRLA 5FHPA 3ABMH 2XAGA 3I3LA 2M30A 4I0BA 5GPAA 3QRFF 3L7WA 2HEOA 3CUQB 2DA4A 4XL9A 2F5FA 3HBLA 2CH0A 3OYKA 4A5NA 5H2FC 3TO9A 1YQAA 1CQTA 3CC7I 5TGTA 2WGBA 2PBXA 1J2XA 4AIHA 2KPMA 4HEA2 3BLYA 2BV6A 4S0HB 3C3WA 1VFCA 2ZO4A 4I0AA 3AAFA 1DDNA 3F8MA 2KKOA 2P7VB 2IS4A 1ETWA 4I7HA 3T0YA 2Z9OA 1LEAA 3L2RA 3JTGA 4RA2A 3M8FA 4BYYA 3C2HA 2BOLA 5K5QA 4XLFA 5D5WB 4JYKA 4B48A 3IRQA 4GDFA 3S16J 2KQRA 3LWFA 4BACA 3M07A 2F07A 4K2EA 4FE4A 1HKTA 4J01A 3B6AA 4EGYA 4AF5A 1TLHB 3I59A 3L2VA 2LF8A 3RYPA 3BJAA 2ZJRF 4XMYA 5J40A 2DA6A 2RDPA 3CJQB 2CUZA 1K6YA 3E6MA 3U9GA 1WH5A 2HQNA 4G9YA 2A5YB 1N25A 2HQ5A 4RAGA 2A5WA 2R92J 1GVDA 1POGA 2FEZA 2KRFA 2STTA 3RI4A 3OYAA 2PJPA 2REKA 5LGUA 2XKPA 3W3CA 3IKVA 1I27A 1P7JA 4JX6A 4RB2C 3AFHA 3BR0A 1IV6A 4WF2A 4P96A 2WB1N 5FRNA 1SD4A 4V2GA 3CDLA 4DNCA 1KZHA 3DPJA 2WAEA 1BOBA 2EV0A 2DMNA 1PUFB 4HF0A 1V3FA 3WG7H 4CSWA 3M8EA 1WPKA 4YG2F 2LVSA 4N9HA 5EFYA 3HRMA 2VT2A 4U0WA 4BJ5C 2M0MA 2LH9A 1YIOA 2W82A 3F8CA 2G7SA 2X51A 4DVYP 2ZMEA 1LDDA 3OYIA 3CCUI 3HOSA 2DT5A 2PG4A 3KLNA 1JI8A 1U2WA 5B66C 2EBIA 5H6QA 4QWQA 4BXFA 1EA3A 5CLSA 4U0VA 5LFAA 3F6OA 1RPWA 3ROUA 1KU9A 3MCZA 3ZQLA 2CV0A 4UVCA 3ZMDA 3CCMI 2VC0A 3OYFA 3LA7A 5C4XJ 1YG2A 1IUYA 4B47A 3AG1H 2JJ7A 2X6OA 2LK2A 4BY1J 1PUFA 4NQWA 5EG0B 2DJIA 3KP7A 1WH7A 2JK3A 4UUTA 3JRAA 2GENA 3HPHA 2R5ZA 1ETOA 3HHGA 1KQ9A 1GXPA 3VW1A 5CQGA 4ZC3A 4HV6A 4GFBA 1JKOC 4LFUA 2F4OB 3VUQA 1WJ5A 2DCEA 3CO6C 2WAQA 3NRGA 4IZZA 3S1QJ 5DUIA 3BR6A 2V1NA 1U8BA 1WHUA 5H9TA 4AC6A 2BZTA 3BCGA 2A6EF 5J4YA 2XDVA 4I6ZA 1G6NA 1UG2A 4KITB 1HQCA 2QQ9A 3LSMA 2F5DA 4LG0A 1ON2A 2CFXA 3WTWC 2EV6A 3H9QA 4U0YA 5E20A 2D6YA 2R4GA 3PQJA 4B3XA 1YRNA 3JRHA 3AL0B 1ACIA 5EEAA 3R0JA 3M7GA 1IDYA 5FB2A 1XPXA 2XAQA 4FHTA 2HOEA 5B3SH 5LRSA 3WTYC 3TEDA 3LHQA 3P9IA 1KA8A 3LNQA 3B73A 3K1NA 3LFKA 2HKOA 3HXLA 2YX4A 2ZSIB 1SVMA 3S3NA 3NXCA 2ZC2A 4ENJA 4MO7A 2ZCNA 3KZYA 1FP2A 1WWXA 4RLFA 2K9LA 3PO3J 3DU5A 4BJ6C 1TBXA 2Y75A 4WXCA 4U7DA 2VKEA 2XAFA 4II3A 4WXDA 4KA4A 1B6AA 2CV1A 5ERIA 3OYGA 3K9TA 1S6LA 3JR9A 3LSHA 3VDXA 1D0YA 3MN2A 5DEQA 4UB6C 1YJNI 4EJTA 2G7HA 1YHQI 4O6JA 2ZJPF 1SC7A 1D5VA 2R0QC 2MC4A 2LRDA 3CF2A 2TCTA 2A6HF 4DYCA 1T98A 1S7EA 2E34A 2MLGA 3FXLA 3T8RA 1P7IA 2RNGA 4QPOA 2O8XA 2ZXIA 3LMMA 4Y33A 4XIDA 2IP2A 3TP0A 2VBYA 1SFUA 2MD0A 2TDXA 2NS8A 1J59A 4UVBA 1S7AA 1WCMJ 3OR2C 2E1OA 1QZEA 1WVRA 4N4NB 5IT3A 3HTHA 1USSA 4PCQA 3RH2A 4X1EA 1T08B 5FD6A 3K4NA 2CG4A 3RZOJ 1MMNA 1RUNA 4DYRA 3QOEA 3CMMA 3OYMA 1YIJI 1FPQA 3S93A 4AC0A 4F55A 4R1HA 1F5TA 5GAHJ 2EZLA 2DA3A 4NNJA 5EGOA 1V5FA 3K70C 3S17J 5AQCA 3KEOA 1M1EB 2ECCA 1FBSA 2XSJC 1IC8A 3F3XA 1AOYA 4I02A 2X6WA 5FGMA 3R0AA 5HS7A 2LOOA 3AKZA 2MG4A 1KYZA 1XDSA 3G1LA 1YE9A 4RB1A 1H88C 3KCCA 2NVQJ 4IHWA 5DCFA 3BWGA 1UELB 5IT9Z 2CQKA 2A2FX 1F9NA 4AWXB 2GOXB 2HYGD 2R5ZB 2OQRA 3CDIA 4XM3A 3J7ZI 2F5EA 4F91B 3OOPA 4BE2A 2V6EA 4PJ0C 1ZG5A 3H5AA 5JI6A 2GXAA 1WFXA 2YUSA 3ABKH 2HVSA 2K86A 3E97A 3BC8A 1LDJA 3JSPA 1OPCA 1BW6A 2ELHA 3L2UA 4YRVA 3RKWA 5AIQA 4IO9F 2PMZA 4GYGA 3QU3A 3AL0C 2M4GA 3KETA 4M3EA 2DTZA 4O5VA 6PAXA 3LQRA 3DV8A 3V7CA 3RYRA 1A31A 2ZCXA 1WJEA 3VW0A 4UY8I 4IEJA 5IYCJ 1V4RA 2OCEA 3ISPA 4S05A 3HTSB 2ICWG 5DUKA 3VYTB 3PSIA 2OCCH 1AHDP 1UCRA 1HSTA 2XC7A 4LIUA 3F22A 5GPCA 2JPBA 1ZAOA 2LG4A 4UHTA 5HS9A 3IAM2 4A2UA 4D7MA 2KJBA 1WGXA 5IPAA 4WK8F 1JE8A 1BBYA 4QSHA 5TRDA 5ICCA 2WB1A 2AHQA 3W2AA 3JSJA 4KIGA 3EUAA 2LBFB 3HZJA 4AIJA 2VT3A 1P6RA 2QEXI 5GAGJ 3FHNA 3ONQA 4IRHA 1K7AA 1USTA 3A2KA 2CFOA 2M87A 2QF7A 3PSFA 2NRAC 5FLVA 3GX4X 2VKDA 1VQ9I 3J7AY 2W53A 1FX7A 3NAUA 4CH7A 1OISA 1ZARA 4YELA 3KP5A 1XB4A 3G1MA 3MKYB 4CCKA 3BR2A 1OCTC 2GIZA 1B1BA 3O8HA 3BZCA 3O3KA 3PFIA 1HDDC 1QRYA 2ESHA 2OZ6A 4L5IA 1NTCA 2G7GA 3TDZC 1JJ6C 3LSTA 1LKXA 3DKYA 4XSXF 1WQ2A 4B3AA 2OQGA 2VJIA 3REOA 1HW5A 3KPHA 4L62A 3SDGA 1D1CA 3CP8A 2JSCA 4ENKA 1B72A 5DAJA 5HAWA 2E19A 2EFOA 1JJ8C 3QP5A 3DBRB 1W0TA 3HRUA 3K70D 1REPC 2EZHA 2CO5A 1WRJA 1Z67A 2BVLA 4A3IJ 2ELJA 2V9PA 3U1DA 2HGCA 3IKTA 2K9QA 3HUGB 2L54A 2E2JJ 1WKMA 5IYDJ 3C07A 4I76A 2PBIA 1RC9A 4RB3C 4A3DJ 1JTXA 3OS1A 5D6EA 1IRZA 3CWRA 5K7HA 2LY9A 3J80Z 2IVMA 1HC8A 3A02A 2O61A 5FLXK 5FJ8J 3BRUA 1BR2A 2W48A 4YFKF 3Q3SA 3S1MJ 4JBAA 5JHFA 2R5YA 2OA4A 2X1CA 3CF5F 4BE0A 1QBJA 3HDDA 2DBBA 3MKZA 2F4MB 4CYDA 5K5OA 1SVLA 3T1BA 1MNEA 4YIRX 4HF2A 1SMYF 1SFEA 5CVRA 1ETVA 2QQAA 3CO7C 2JUCA 4HRIA 3X2QH 4IHTA 1J7KA 5HSZA 3NARA 3H3ZA 3SHFA 3DBHB 3EQLF 1YOVB 1HKSA 5L3DA 4BDYA 2RV8A 2E35A 3FXUA 2UXPA 2CQXA 4BH9A 3GWZA 3DFGA 3FXQA 3RCOA 2MA3A 3BG5A 4JOMA 1FYMA 3V42A 4HNUA 4QLCU 5E79C 3CMEI 4G94A 2Y0SA 4JKZA 3Q9SA 4OWRB 3C7JA 1KONA 1L0OC 4EVIA 3VPRA 2EFWA 4HOBA 3BROA 2OJED 1YS6A 4HLYA 4KT5C 4IQJA 1OCZH 1H9GA 1IO2A 3MVPA 5L3CA 2LD5A 1P92A 5E17F 2YR2A 1DGRM 4M74A 1B9NA 2L5QA 1FIPA 5J3LA 4AUXA 1T6SA 2BW3B 4WWCA 4J00A 1PP7U 5AIPA 2NNYA 3S14J 4Y13A 5BQTA 3ML6A 3KX2A 3OS0A 2BY3A 5KVRA 1YTYA 2L02A 2P8TA 1OJLA 2QBYA 1YO5C 2YSRA 2CQ7A 1JT6A 2DK8A 4M72A 1XGMA 5D5XB 4H4KC 5M5WJ 3BTJA 2FNPA 1KU3A 3L1PA 4PUSA 1K79A 2QWTA 2IJLA 2X6YA 2VKVA 4BQNA 2JPCA 3L2WA 5LGTA 2PJRB 3A4CA 1G3TA 4XLAA 5GADJ 1SFKA 3WG9A 5EEGA 1ETXA 1R5HA 3ZMZA 1R5GA 2B7EA 2EFNA 3ZQHA 5F0CA 4HX7A 1YLFA 4EGZA 4RDUA 1PDNC 2MBFA 4BXUA 1P4WA 4M73A 1IGNA 1OCPA 1YITI 1Z3YA 5EYRA 3EPZA 2HDCA 4G8XA 1BJAA 2QQBA 3T6NA 4EM1A 4Y4RA 3ULQB 1CF7B 4I99C 1PUEE 2H8WA 3HOYJ 3T5XA 2W24A 3PIPF 2CUJA 4C2MA 2DN0A 2P4WA 4FQGA 4ZZDA 3CCVI 1L3LA 2ECBA 2FD5A 4BHPA 1JGGA 1O57A 1W5CC 1TNSA 2Z2SB 4XQFA 4GGGA 5IP9J 3CD6I 3A0HC 3NQOA 4DGWB 4M9SA 2QSGX 4BHCA 2N8GA 3K4LA 3CLQA 1UI6A 2BEOA 5F1JA 2HKXA 3SQNA 3ZPLA 2DAOA 4OU0A 1MD0A 1QHGA 4D5CA 1IV8A 2D1VA 1BA5A 2RHAA 3BHQA 2A61A 4KN7X 4U7BA 4HA8A 4M6YA 1K4TA 1B8IA 1LUJB 1U5TA 2L0KA 3MZ8A 2EZIA 3GLLA 5GP9A 2HDDA 1FC3A 4ZJZA 2LBFA 2ELKA 4ESBA 2YVXA 5FD5A 5HLIA 4GCLA 2KZGA 4FISA 4E4HA 4OIPF 4HF1A 2BY0A 1ETQA 2G0EA 2ZOYA 3ZQCA 1YW7A 3OYDA 4LLGF 3SEZA 3K7AJ 1W4MA 2XGDA 3JW4A 1H89C 1J75A 3H5RA 2ZNZA 4GO1A 4HYEA 4Q5SF 2STWA 3VVYA 3GXOA 3TOBA 1VQOI 3TQNA 3EUKL 4E7KA 4MK6A 5HODA 1I1GA 5HOOA 2R7WA 5DCMA 2AQEA 3KKCA 3C1DA 3ZGKA 3F8NA 2FQ4A 4ZDLA 3TW7A 3OYCA 2CSOA 2VQGA 3HC7A 2EZKA 3QQAA 1G59A 2YX7A 1I5ZA 1PJRA 2TRTA 1VQ7I 1W5TA 2AS5F 2Y9ZA 2NNNA 1IN8A 3WGIA 1VF9A 3O8GA 4IHXA 2Y48A 4AM3A 1VNDA 2W25A 2ACJA 1RIOH 2L01A 3IP4B 1EH8A 1K83J 3K6GA 3IV5A 1GDTA 3ZMVA 3FKIJ 2NP5A 1HW2A 2QM3A 4Q4ZF 2OI8A 4BDZA 4OIQF 1E3HA 2EK5A 2BBYA 1TP4A 3RZDJ 3HOUJ 4EEFG 3DP7A 2CW7A 2GUHA 3SFIA 5FKNA 1IN6A 1I39A 1JKPC 4L5JA 2BGCA 3QYBA 4GFLA 1T39A 3DPLC 1UHWA 2K9NA 3PNVA 3J7AO 3VP5A 2OTLI 3V7SA 2RKHA 1RZ4A 2GLOA 2O5RA 4FX4A 2FQ3A 5LEJA 4KIBA 1ZRFA 1LNWA 4D5FA 1PP8F 1NK2P 2PJRA 1IN7A 2JRTA 2LSOA 2K4BA 3CUQA 4IKFA 1UJ8A 3W2WA 1QU3A 3QPHA 2LFBA 1MMDA 3JRIA 2HNHA 4XOTA 2Q24A 2ESNA 4HSTA 2LMDA 4ENMA 2ZJQF 3I0TA 4WX9A 3R60A 4BEHA 1PYVA 4IL6C 5E1XA 5AONA 2DPUA 3ZQIA 3CQZJ 1C0WA 1ETKA 1WJFA 4NC6A 1E3OC 4L0ZB 2PLYA 2X48A 4R8HA 2FE3A 3HSRA 3F6VA 3PL8A 3R4KA 3VSLA 5A2QK 1XGSA 1I6HJ 3FF5A 4ZTFA 3OWTA 3COAC 2ZJ2A 4Y52J 1XSVA 2JA6J 4DOZA 3E1SA 2FBKA 4AU7A 2YU3A 2GIVA 3ASOH 1V55H 5L3FA 1K78B 4UNOA 2WAQN 2XKOA 3KEYA 1VQ4I 1WZ2A 1VZ0A 2K9SA 2R3SA 4EV0A 2IS6A 1JHHA 3ZN0A 4BJTA 3HTJA 5J47A 4HDUA 1R1TA 2CS3A 1A35A 1FMWA 2HXIA 2A3SA 1ZGWA 3DU6A 2HYFA 1OQYA 5HNHA 2M2EA 2C6YA 3GEUA 3KEQA 4UDSA 3ZQGA 5FFZA 4KMFA 5DS9A 3HOVJ 3K1PA 2IT0A 1ERDA 3IWFA 2XHKA 1FSHA 5LBQA 3AG2H 3D5RC 3QYEA 4A93J 1YYVA 3F72A 4BEHB 2HI3A 1BW5A 4ITVA 1V5EA 2HZTA 5D4RA 2HKUA 3V78A 4XKVA 3RDIA 3K2ZA 1J5YA 4NQWB 5EG0A 1D5YA 2KDZA 3CCQI 2LP0A 2LKXA 4A3CJ 1TW3A 1BIAA 3F0CA 1YRNB 4XORA 3GLXA 4TV7A 2K9MA 2R5YB 2E71A 3G71I 2YU9J 3K4CA 1SAUA 2VUMJ 4FX0A 4WXHA 3LSKA 2V7FA 3F8FA 1Z9CA 5IT9K 1QZYA 1ZR2A 2QKOA 5C44J 1K6OA 4C3JJ 3S2WA 5J8CA 4P1WA 3ERED 3PPBA 4AD9A 5F64A 3E5UA 2V57A 3TGNA 2Y31A 3QWLA 3GFLA 3K4JA 4A0XA 1YS7A 2EIKH 2UZKA 1TNTA 5FROA 2DO7A 4A3LJ 1VQ5I 3VEPA 3EYIA 2KIFA 4C3IJ 5F1RA 3FHZA 2OF7A 5K58A 1I3QJ 2QIBA 2IGOA 3JRGA 2J5OA 4KNYA 2VBZA 2V9VA 3LSJA 1WSUA 3J7YJ 1T38A 5L3BA 2CYYA 2EILH 2EQRA 3TOAA 3CC4I 2FOKA 4E7HA 4MHGA 4E7JA 3S3MA 2DQLA 1RR7A 4JL3A 4N4OB 4BS9A 1NK3P 1GLNA 4KMUX 2P0WA 2L9SA 3CJNA 1SD6A 1Y8RB 3H9GA 5KCMA 2E7WA 1KU7A 1U8RA 2MC3A 3R6SA 4XLPF 3JRCA 1J9IA 3BG6A 2OERA 2QA4I 1DU6A 5CKTA 4XLCA 2P7CB 3VWBA 1VTNC 3NI7A 1HDPA 4I98B 4YEJA 1I1SA 1MNMC 2H09A 3BOQA 5F6FA 3VYSB 4RGXA 1LEBA 3K8PC 2XF7A 2VBWA 2XB5A 5HLHA 1U9NA 4RMNA 1IF1A 2COMA 2W85A 1G3SA 2HVQA 3FK7A 5JHUA 2X6XA 4JX5A 4E7IA 2G7LA 1YI2I 4H0EA 3F23A 3BR1A 1PVEA 3K10A 2JA8J 4D0PA 2RASA 1Z3XA 3I54A 3TBIA 3FX3A 3E7QA 3VOKA 1B8IB 3RQ4A 5D1RA 3FXJA 2VOPA 2ZCWA 3BR3A 3LAPA 2JA7J 4Y3OA 4AIDA 2CV2A 2COBA 2A6TA 1FY7A 4V2FA 1ZK8A 3HOXJ 3BQZA 4EJOA 1T95A 2L7KA 1DP3A 3TO7A 4MXMA 1TT5B 1XD7A 4UUSA 3GTQJ 1X1CA 1TWHJ 1A6QA 3HKZA 2CQQA 2G7UA 3KYCB 4LB6B 5B1AH 2Q2EB 5DD4A 5D5UB 2EIJH 3SXYA 3U2RA 3JTHA 4HX8A 4OAYA 2QKLB 2DYSH 1ZHFA 2GXBA 5IY5H 4UB8C 2Y2ZA 4CYCA 4OAZA 2DLLA 2PFVA 3CRJA 3FMRA 3HSFA 4EM2A 4GXOA 2LKPA 4XK4A 4Z2YA 2WAFA 1K61A 3GYHX 1HOMA 2XRNA 2DDAA 1R71A 3AG3H 3I64A 4RM3A 5DDGA 1VQMI 3E0JB 5E1WA 1T0FA 3BJ6A 2D5VA 2OPTA 2VASA 1T56A 2FF4A 3A01A 5FGLA 4LB5A 4AVPA 4PJMA 3JRFA 1IDZA 1MMSA 3LAJA 2KIQA 2L7MP 2CGPA 4ZZLA 3AG4H 3GMEA 3FXOA 1XMXA 3DF8A 2V79A 3JREA 5DD8A 3GFMA 4A6DA 4G6QA 2RQPA 2P81A 2XB0X 4MFEA 2BW3A 1OCOH 3WE3A 4F3QA 2QOPA 2PEXA 4MIMA 2UUZA 5IOYA 1O3QA 1RI7A 2QVOA 2DMTA 1Z7UA 1E2XA 1U0JA 1N77A 1Y56A 2WADA 5M3MJ 2GWRA 1Z0XA 4DIQA 2L7ZA 3ZCOA 2DW4A 2VJ4A 1Q1VA 3T8TA 4XN0A 5CXGA 2EH3A 3OV8A 3BG7A 2QYOA 4P5OA 1MIJA 1IN5A 2LYCA 2HYJA 3H0DA 3KNWA 3PQKA 4BQAA 3VW2A 2FNAA 2EB7A 2X9DA 3FIWA 3OYJA 4XKBA 2V4JC 1OCCH 1OKRA 2ZXJA 2ZBKA 3FZVA 2DODA 2KRCA 2F6CA 3I4PA 1MBFA 3DTKA 2DTRA 4LK0F 2VJ5A 1V54H 4Q48A 3GBGA 2M1BA 1MBEA 2IXSA 4RBOA 4PK4A 2JZYA 9ANTA 5FFXA 1X4PA 1DU0A 4ZDPA 2KL4A 5CVJA 2HTJA 4G6DA 4DW6A 5M5YJ 2XF6A 1Z6TA 2H8RA 3U1KA 1WJAA 1XS9A 4IVNA 5HDGA 2M8GX 2X0LA 4I09A 2W84A 2MD5A 1QVTA 3K0LA 2JVHA 3RSNA 5IP7J 1SAXA 4X6AJ 1W5SA 2L9NA 1SGMA 3OYBA 2DMPA 1O3SA 1RUOA 1G2HA 4NHJA 1BL0A 4HW0A 2W00A 1ZR4A 1H9TA 1X1PA 4CCOA 1YFHA 2UWMA 3D0SA 1BN5A 3HUGA 3HOTA 2PQ8A 3MD2A 2QCOA 5K5RA 3M1EA 3O60A 5M3FJ 4FCYA 1OR7C 1VQLI 4CCJA 2CW0F 4M9ZA 1R5ID 2H6BA 3QPTA 2DFEA 3I53A 4PFOA 4CO8A 3FKJA 1U78A 4BAYA 5GAEJ 1RKTA 2E1NA 2KFDA 4LD5A 1BC7C 2IGMA 2GZWA 5ICFA 3MKLA 4CUGA 2ZY9A 1X19A 4HX4A 1ORKA 3HGGA 5HDKA 1LFUP 2D1HA 3BCBA 3FM3A 1ZRCA 4RAZA 4OMZA 5CQEA 3MKWB 3FBIB 3ZOBA 2QTQA 2Z33A 3DKXA 1S29A 3W6KB 2DFHA 4I2OA 3FBNB 4IOCF 2DT7B 2Z5UA 2NYXA 2FBQA 1IJWC 3PM1A 2ME6A 1XC5A 3S8PA 5JLXA 1LE8B 2JQ7A 4BL0B 3OSFA 3ZQ7A 1W7PB 3IH2A 1S5LC 2F48A 4XSZF 2KISA 1A5JA 3HOZJ 1R23A 2E1CA 3EUPA 4S04A 2HPIA 4FTHA 5C4YA 1B59A 4D1QA 4OIRF 3G4SI 2PFBA 2VC1A 3CJDA 1FOWA 2OV7A 1NHAA 5TJJA 4U87A 2EPFA 4C2MJ 1QGPA 3DBLB 2DK5A 3BG3A 3CCLI 2ZXHA 2LR8A 4RM2A 2R7VA 2PI0A 5IP6A 1P4AA 3QYFA 3DEUA 3RQIA 4BU2A 2VI6A 2CW8A 4MEYF 3RIRA 3Q5FA 1UHSA 3ABLH 1FIAA 3WU0A 4E7LA 1OLTA 4XLNF 3SWHA 1R7JA 1TT0A 3H3UA 2ZXWH 4MTEA 1TQIA 5H6RA 4A0YA 4IX7A 2KZVA 3KP2A 3OL4A 2W4SA 1QPMA 4OINF 4G7OF 4B09A 1UMQA 2EINH 2J5PA 5ILUA 1MSFC 4C3HJ 3CUQC 2BY1A 2QQ8A 1FT9A 4RS8A 3J81Z 3M9AA 1MJBA 1W7PA 2EA4A 2L9VA 1E17A 2ZSHB 2IBDA 2BY2A 5CPRB 1JTYA 2YVEA 2VBXA 1XGOA 4E6KG 2HZDA 3QP6A 1HSJA 3ZMUA 2L4AA 3I4MJ 2UXOA 1SD7A 4ASNA 1X2NA 3OYEA 4EMSA 4IRIA 2QENA 3LSGA 2YVHA 5JLWA 2P5VA 3OL3A 4YIIA 2QZ8A 3ELKA 1QPIA 3QOPA 2A05A 2UXHA 1YX3A 4PZJA 2RGVA 4PXIA 2XROA 2A69F 4ABZA 1ZQ3P 3IRRA 3AQSA 3WHBA 2M45A 4M6XA 3EGQA 2K7LA 2BHZA 1T33A 2XPVA 4QTRA 2W1OA 1ZLJA 2FRHA 1AKHA 2ZKZA 1TC3C 5K1YA
chains in the Genus database with same CATH topology
2GLOA 4I6ZA 5EZGA 2O9LA 1FTTA 3HE0A 1UG2A 3COLA 1X2MA 3I4NJ 1ITYA 4D5FA 1NK2P 3ANGA 2FJ1A 2NVXJ 1TWCJ 3CCYA 4HNVA 5EDNA 5E3LA 2XPWA 2LFBA 3JRIA 2D6YA 2Q24A 1YRNA 3JRHA 3DCFA 5EEAA 1Z77A 4ICHA 1IDYA 3TEDA 2WV1A 3GTPJ 3LHQA 4BBRJ 3LNQA 1GV5A 1ETYA 3B81A 3ZQIA 3CQZJ 3C2BA 1ETKA 3JRBA 4JX4A 3HKZN 4A3GJ 2ZOZA 3HGYA 2JWTA 1E3OC 5F08A 2R7ZJ 2GFNA 2X48A 4MO7A 2Y0SN 2NS7A 2ZCNA 1I6HJ 2JN6A 5F0FA 2CUEA 3BTLA 3PO3J 4Y52J 1LFBA 4DZJA 2JA6J 1WI3A 2VKEA 1F43A 3FISA 3GTMJ 5EZHA 2ID6A 3M4OJ 3JR9A 1FJLA 2CUFA 2WAQN 3MN2A 2M34A 4ACIA 3QBMA 2K9SA 3VOXA 3HTJA 2R0QC 5CW8A 2GBYA 2B63J 3IUVA 2TCTA 2CRGA 2H1KA 2HXIA 3A03A 1APLC 4DYCA 1GUUA 1ZGWA 1S7EA 4A3MJ 3BTIA 2M2EA 3GEUA 1P7IA 2FX0A 3BG9A 5F04A 1IG7A 4UDSA 2CU7A 1Y1WJ 4XIDA 3TP0A 2E2HJ 3ZQGA 1RESA 2NS8A 5DS9A 2E2IJ 3HOVJ 1WCMJ 3IH4A 3S1RJ 5FMPA 4BBSJ 2E1OA 2Y9YA 3HTHA 4A93J 1BW5A 2HI3A 4AYBN 3Q0WA 2HKUA 3HTAA 3RH2A 3V78A 4X1EA 2XDNA 2IAIA 3RZOJ 5EG0A 1D5YA 2KDZA 2JA5J 4DYRA 2ID3A 3Q0VA 2XSDC 1Y1VJ 2LP0A 4AC0A 1JKQC 2LKXA 4A3CJ 2EZLA 1EF4A 2DA3A 3F0CA 5FKMA 5EGOA 1SFOJ 1GT0C 1YRNB 3S17J 5AQCA 2DMQA 4XICA 2R5YB 2ECCA 2YU9J 3BQYA 5F0HA 1IC8A 2VUMJ 3VIBA 4HKUA 4BXXJ 1MH4A 5K7FA 1ZR2A 2QKOA 5C44J 3D1NI 2MG4A 4XRSG 3G1LA 4C3JJ 2XPUA 1H88C 3VVZA 4GCKA 3PPBA 2NVQJ 4IHWA 4JNNA 3DEWA 2V57A 4CGRA 5E3OA 1RETA 2Y31A 4A3BJ 4DYQA 2R5ZB 3H0GJ 4GFKA 4A3LJ 1JT0A 3OOUA 4C3IJ 5K58A 2OF7A 1I3QJ 2QIBA 1ZKGA 3JRGA 2YUSA 3S15J 1ZTRA 3LSJA 2R93J 4XRSA 1BW6A 2EQRA 3HM5A 4DZPA 4M3EA 1RR7A 4JL3A 2DTZA 1NK3P 1R9TJ 4L5EA 2DA1A 2NOGA 1A6IA 3BJBA 3E7LA 3JRCA 2ZCXA 2OERA 3VW0A 4A69C 1DU6A 2LLKA 2L7FP 4IEJA 5IYCJ 3Q0UA 2NX4A 1HDPA 3NI7A 1AHDP 1MNMC 2XB5A 1U9NA 5GPCA 4M3GA 3LWJA 3FK7A 4D7MA 4B1RA 1TWFJ 4JX5A 1SANA 1X58A 3V6GA 1O4XA 2G7LA 1WGXA 5IPAA 3LJLA 4QSHA 3BR1A 2JA8J 1B72B 3W6VA 2RASA 2AHQA 3JSJA 1JUMA 3E7QA 3VOKA 2IU5A 1B8IB 1TWAJ 3NPIA 5D1RA 5C3EJ 3KZ9A 3BR3A 2JA7J 5E3MA 4M3FA 2COBA 3TW6A 2M9HA 1W0UA 2G3BA 1TWGJ 2QF7A 2HXOA 5FLVA 5IOZA 4V2FA 1ZK8A 3HOXJ 2W53A 4UUSB 2LTPA 3NAUA 3BQZA 1UI5A 2I10A 5D18A 2AO9A 3G1MA 4D7NA 2O8KA 2DG7A 1OFCX 2M0CA 4MXMA 3BR2A 1OCTC 4UUSA 3GTQJ 1MBHA 1TWHJ 3S2DJ 2HYTA 2CQQA 5FLMJ 3O8HA 4M6VA 4ME9A 3AQTA 1HDDC 1QRYA 2DMUA 1NTCA 4MFDA 1FEXA 2G7GA 1JJ6C 4GCTA 2Y30A 5HBUA 2HOSA 2O7TA 2Y2ZA 4CYCA 2KT0A 4B3AA 4L62A 3SDGA 1MH3A 5J1YA 1B72A 3CRJA 5DAJA 5HAWA 2E19A 4XK4A 1JJ8C 4B4CA 1K61A 1W0TA 3B6CA 1HOMA 2EZHA 4NDLA 5C4JJ 4A3IJ 2VPRA 5E3NA 2D5VA 2OPTA 2K9QA 1IUFA 5F27A 3KKDA 1T56A 3A01A 2E2JJ 5FGLA 1JUPA 5IYDJ 3C07A 4M3DA 2XGEA 2ZB9A 3JRFA 4I76A 1MBKA 1IDZA 4A3DJ 1JTXA 2MSYA 2L7MP 1IRZA 3CWRA 3WHCA 5K7HA 2LY9A 3A02A 4A3EJ 3FK6A 4LOCA 3JREA 5FJ8J 5DTDA 1FTZA 3BRUA 2W48A 3S1MJ 3Q3SA 3G1OA 2P81A 2K40A 2R5YA 4W97A 3LSRA 2XB0X 4MFEA 3HDDA 2QOPA 3GTGJ 4QIWN 4MIMA 5IOYA 3M3YJ 3HIMA 2DMTA 5FKOA 3ON2A 1QVUA 3S1NJ 1ETVA 3PASA 3OSGA 5M3MJ 3GTLJ 2WUIA 1Z0XA 5J1RA 2L7ZA 3NXCA 1BJZA 5HSZA 3NARA 3SJMA 1Q1VA 3HB9A 2YS9A 2UXUA 4YZEA 5CXGA 2EH3A 3BR5A 4FE7A 2XGCA 2UXPA 2CQXA 2HYJA 1U9OA 3KNWA 4BKXA 3BTCA 1HLVA 3VW2A 3VVXA 2X9DA 3QKXA 3FIWA 5CXIA 1ENHA 5J1UA 1AU7A 3BG5A 3G56A 3OIOA 4JKZA 4A3KJ 3ON4A 1MBFA 5FKKA 1HF0A 1F36A 3VPRA 3NNRA 5M5XJ 2O7OA 3GTKJ 3GBGA 3HEFA 4BY7J 5EGOB 2NVYJ 1MBEA 5IYBJ 3PO2J 2LD5A 3MVPA 3UKGA 1I50J 1XG1A 4RBOA 4NN1A 3F1BA 9ANTA 1FIPA 5J3LA 3ZQFA 4AUXA 1DU0A 5K7ZA 2DA7A 1JKRC 4MLOA 5EF6A 4DW6A 5M5YJ 3S14J 3LOCA 2H8RA 1XS9A 1VI0A 2M8GX 3BT9A 1QVTA 4KWAA 2RAEA 2MGQA 4JP0A 4Y7NJ 1OJLA 5IP7J 4X6AJ 3CMYA 1SGMA 3IH3A 3VP5A 1LE8A 2DMPA 3ANPA 1G2HA 1JT6A 2XRLA 5FHPA 1BL0A 5M5WJ 4M3BA 3BTJA 1ZR4A 1MSEC 3L1PA 3BNIA 3RD3A 5GPAA 2QWTA 3A01B 2VKVA 2DA4A 2PMZN 3HBLA 1CQTA 2QCOA 3O60A 5M3FJ 2WGBA 2PBXA 4FCYA 2HOAA 4S0HB 1VFCA 1ETXA 3ZQHA 2GM4A 5F0CA 1RKWA 1ETWA 4RDUA 2ME0A 1AKHB 1MBGA 1IGNA 4CYCB 1OCPA 1U78A 3QPLA 1RKTA 5EYRA 3QPSA 3TP3A 3T6NA 2JMWA 3MKLA 4JYKA 3HOYJ 3P9TA 1LFUP 1ORKA 3HGGA 3K2AA 3S16J 3HOWJ 2DN0A 4W1UA 2ECBA 2FD5A 1JGGA 2F07A 3ZOBA 5IP9J 2QTQA 4FE4A 2FBQA 1IJWC 3PM1A 2PZ9A 2UXIA 2ME6A 1XC5A 2N8GA 3B6AA 5JLXA 1UI6A 1LE8B 3OSFA 3JRDA 5F1JA 2DA5A 3IH2A 4AF5A 4D5CA 2CJJA 4G12A 1BA5A 2RHAA 2DG8A 1H8AC 4IHYA 3BHQA 1A5JA 2DA6A 3HOZJ 2ZCMA 3EUPA 4FTHA 4J19A 1GV2A 4A3FJ 5C4YA 1WH5A 1MBJA 4A3JJ 1B8IA 3CJDA 2L0KA 2EZIA 5GP9A 2HDDA 3S5RA 2HQ5A 4C2MJ 3H3VK 2R92J 2DA2A 1GVDA 1POGA 2ELKA 3BG3A 4IHVA 3HTIA 3RKQA 2LR8A 4GCLA 4FISA 2REKA 3GTOJ 5IP6A 1ETQA 3RQIA 1HCRA 2G0EA 1P7JA 4JX6A 2VI6A 2ZOYA 3BR0A 1IV6A 3ZQCA 2WB1N 4V2GA 3CDLA 1UHSA 3K7AJ 3DPJA 1JUSA 2XGDA 1FIAA 2L9RA 1H89C 2HOTA 2DMNA 1PUFB 2NP3A 3VVYA 5FKLA 3MNLA 3FRQA 1WPKA 2LVSA 4MK6A 5HODA 5EFYA 4XRMA 3KKCA 2G7SA 2FQ4A 3TW7A 1UMQA 2NVTJ 3QQAA 2EZKA 1MSFC 4C3HJ 2IEKA 3S2HJ 2EBIA 2TRTA 2MW8A 2Y9ZA 1RPWA 1VF9A 3O8GA 3LSPA 3ZQLA 2DJNA 2IBDA 4IHXA 1JTYA 2YVEA 5C4XJ 1VNDA 2JJ7A 2X6OA 2LK2A 4BY1J 1K83J 1PUFA 3IV5A 1GDTA 2NP5A 3FKIJ 5EG0B 5BNGA 3I4MJ 2OI8A 1WH7A 2JK3A 4UUTA 2UXOA 3JRAA 2GENA 1X2NA 1ETOA 2R5ZA 3LSGA 3RZDJ 3VW1A 5JLWA 2YVHA 4GFBA 3HOUJ 4EEFG 1QPIA 2UXHA 1JKOC 4NELA 3VUQA 4PXIA 2GUHA 4ABZA 3SFIA 5FKNA 1ZQ3P 3AQSA 3NRGA 3WHBA 3S1QJ 1JKPC 3EGQA 5D19A 3BR6A 4GFLA 1T33A 2XPVA 1U8BA 4QTRA 3G7RA 1AKHA 1TC3C 4AC6A 3BCGA 5H9TA 3GZIA 2K9NA 3GTJJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLO A;  4I6Z A;  5EZG A;  2O9L A;  1FTT A;  3HE0 A;  1UG2 A;  3COL A;  1X2M A;  3I4N J;  1ITY A;  4D5F A;  1NK2 P;  3ANG A;  2FJ1 A;  2NVX J;  1TWC J;  3CCY A;  4HNV A;  5EDN A;  5E3L A;  2XPW A;  2LFB A;  3JRI A;  2D6Y A;  2Q24 A;  1YRN A;  3JRH A;  3DCF A;  5EEA A;  1Z77 A;  4ICH A;  1IDY A;  3TED A;  2WV1 A;  3GTP J;  3LHQ A;  4BBR J;  3LNQ A;  1GV5 A;  1ETY A;  3B81 A;  3ZQI A;  3CQZ J;  3C2B A;  1ETK A;  3JRB A;  4JX4 A;  3HKZ N;  4A3G J;  2ZOZ A;  3HGY A;  2JWT A;  1E3O C;  5F08 A;  2R7Z J;  2GFN A;  2X48 A;  4MO7 A;  2Y0S N;  2NS7 A;  2ZCN A;  1I6H J;  2JN6 A;  5F0F A;  2CUE A;  3BTL A;  3PO3 J;  4Y52 J;  1LFB A;  4DZJ A;  2JA6 J;  1WI3 A;  2VKE A;  1F43 A;  3FIS A;  3GTM J;  5EZH A;  2ID6 A;  3M4O J;  3JR9 A;  1FJL A;  2CUF A;  2WAQ N;  3MN2 A;  2M34 A;  4ACI A;  3QBM A;  2K9S A;  3VOX A;  3HTJ A;  2R0Q C;  5CW8 A;  2GBY A;  2B63 J;  3IUV A;  2TCT A;  2CRG A;  2H1K A;  2HXI A;  3A03 A;  1APL C;  4DYC A;  1GUU A;  1ZGW A;  1S7E A;  4A3M J;  3BTI A;  2M2E A;  3GEU A;  1P7I A;  2FX0 A;  3BG9 A;  5F04 A;  1IG7 A;  4UDS A;  2CU7 A;  1Y1W J;  4XID A;  3TP0 A;  2E2H J;  3ZQG A;  1RES A;  2NS8 A;  5DS9 A;  2E2I J;  3HOV J;  1WCM J;  3IH4 A;  3S1R J;  5FMP A;  4BBS J;  2E1O A;  2Y9Y A;  3HTH A;  4A93 J;  1BW5 A;  2HI3 A;  4AYB N;  3Q0W A;  2HKU A;  3HTA A;  3RH2 A;  3V78 A;  4X1E A;  2XDN A;  2IAI A;  3RZO J;  5EG0 A;  1D5Y A;  2KDZ A;  2JA5 J;  4DYR A;  2ID3 A;  3Q0V A;  2XSD C;  1Y1V J;  2LP0 A;  4AC0 A;  1JKQ C;  2LKX A;  4A3C J;  2EZL A;  1EF4 A;  2DA3 A;  3F0C A;  5FKM A;  5EGO A;  1SFO J;  1GT0 C;  1YRN B;  3S17 J;  5AQC A;  2DMQ A;  4XIC A;  2R5Y B;  2ECC A;  2YU9 J;  3BQY A;  5F0H A;  1IC8 A;  2VUM J;  3VIB A;  4HKU A;  4BXX J;  1MH4 A;  5K7F A;  1ZR2 A;  2QKO A;  5C44 J;  3D1N I;  2MG4 A;  4XRS G;  3G1L A;  4C3J J;  2XPU A;  1H88 C;  3VVZ A;  4GCK A;  3PPB A;  2NVQ J;  4IHW A;  4JNN A;  3DEW A;  2V57 A;  4CGR A;  5E3O A;  1RET A;  2Y31 A;  4A3B J;  4DYQ A;  2R5Z B;  3H0G J;  4GFK A;  4A3L J;  1JT0 A;  3OOU A;  4C3I J;  5K58 A;  2OF7 A;  1I3Q J;  2QIB A;  1ZKG A;  3JRG A;  2YUS A;  3S15 J;  1ZTR A;  3LSJ A;  2R93 J;  4XRS A;  1BW6 A;  2EQR A;  3HM5 A;  4DZP A;  4M3E A;  1RR7 A;  4JL3 A;  2DTZ A;  1NK3 P;  1R9T J;  4L5E A;  2DA1 A;  2NOG A;  1A6I A;  3BJB A;  3E7L A;  3JRC A;  2ZCX A;  2OER A;  3VW0 A;  4A69 C;  1DU6 A;  2LLK A;  2L7F P;  4IEJ A;  5IYC J;  3Q0U A;  2NX4 A;  1HDP A;  3NI7 A;  1AHD P;  1MNM C;  2XB5 A;  1U9N A;  5GPC A;  4M3G A;  3LWJ A;  3FK7 A;  4D7M A;  4B1R A;  1TWF J;  4JX5 A;  1SAN A;  1X58 A;  3V6G A;  1O4X A;  2G7L A;  1WGX A;  5IPA A;  3LJL A;  4QSH A;  3BR1 A;  2JA8 J;  1B72 B;  3W6V A;  2RAS A;  2AHQ A;  3JSJ A;  1JUM A;  3E7Q A;  3VOK A;  2IU5 A;  1B8I B;  1TWA J;  3NPI A;  5D1R A;  5C3E J;  3KZ9 A;  3BR3 A;  2JA7 J;  5E3M A;  4M3F A;  2COB A;  3TW6 A;  2M9H A;  1W0U A;  2G3B A;  1TWG J;  2QF7 A;  2HXO A;  5FLV A;  5IOZ A;  4V2F A;  1ZK8 A;  3HOX J;  2W53 A;  4UUS B;  2LTP A;  3NAU A;  3BQZ A;  1UI5 A;  2I10 A;  5D18 A;  2AO9 A;  3G1M A;  4D7N A;  2O8K A;  2DG7 A;  1OFC X;  2M0C A;  4MXM A;  3BR2 A;  1OCT C;  4UUS A;  3GTQ J;  1MBH A;  1TWH J;  3S2D J;  2HYT A;  2CQQ A;  5FLM J;  3O8H A;  4M6V A;  4ME9 A;  3AQT A;  1HDD C;  1QRY A;  2DMU A;  1NTC A;  4MFD A;  1FEX A;  2G7G A;  1JJ6 C;  4GCT A;  2Y30 A;  5HBU A;  2HOS A;  2O7T A;  2Y2Z A;  4CYC A;  2KT0 A;  4B3A A;  4L62 A;  3SDG A;  1MH3 A;  5J1Y A;  1B72 A;  3CRJ A;  5DAJ A;  5HAW A;  2E19 A;  4XK4 A;  1JJ8 C;  4B4C A;  1K61 A;  1W0T A;  3B6C A;  1HOM A;  2EZH A;  4NDL A;  5C4J J;  4A3I J;  2VPR A;  5E3N A;  2D5V A;  2OPT A;  2K9Q A;  1IUF A;  5F27 A;  3KKD A;  1T56 A;  3A01 A;  2E2J J;  5FGL A;  1JUP A;  5IYD J;  3C07 A;  4M3D A;  2XGE A;  2ZB9 A;  3JRF A;  4I76 A;  1MBK A;  1IDZ A;  4A3D J;  1JTX A;  2MSY A;  2L7M P;  1IRZ A;  3CWR A;  3WHC A;  5K7H A;  2LY9 A;  3A02 A;  4A3E J;  3FK6 A;  4LOC A;  3JRE A;  5FJ8 J;  5DTD A;  1FTZ A;  3BRU A;  2W48 A;  3S1M J;  3Q3S A;  3G1O A;  2P81 A;  2K40 A;  2R5Y A;  4W97 A;  3LSR A;  2XB0 X;  4MFE A;  3HDD A;  2QOP A;  3GTG J;  4QIW N;  4MIM A;  5IOY A;  3M3Y J;  3HIM A;  2DMT A;  5FKO A;  3ON2 A;  1QVU A;  3S1N J;  1ETV A;  3PAS A;  3OSG A;  5M3M J;  3GTL J;  2WUI A;  1Z0X A;  5J1R A;  2L7Z A;  3NXC A;  1BJZ A;  5HSZ A;  3NAR A;  3SJM A;  1Q1V A;  3HB9 A;  2YS9 A;  2UXU A;  4YZE A;  5CXG A;  2EH3 A;  3BR5 A;  4FE7 A;  2XGC A;  2UXP A;  2CQX A;  2HYJ A;  1U9O A;  3KNW A;  4BKX A;  3BTC A;  1HLV A;  3VW2 A;  3VVX A;  2X9D A;  3QKX A;  3FIW A;  5CXI A;  1ENH A;  5J1U A;  1AU7 A;  3BG5 A;  3G56 A;  3OIO A;  4JKZ A;  4A3K J;  3ON4 A;  1MBF A;  5FKK A;  1HF0 A;  1F36 A;  3VPR A;  3NNR A;  5M5X J;  2O7O A;  3GTK J;  3GBG A;  3HEF A;  4BY7 J;  5EGO B;  2NVY J;  1MBE A;  5IYB J;  3PO2 J;  2LD5 A;  3MVP A;  3UKG A;  1I50 J;  1XG1 A;  4RBO A;  4NN1 A;  3F1B A;  9ANT A;  1FIP A;  5J3L A;  3ZQF A;  4AUX A;  1DU0 A;  5K7Z A;  2DA7 A;  1JKR C;  4MLO A;  5EF6 A;  4DW6 A;  5M5Y J;  3S14 J;  3LOC A;  2H8R A;  1XS9 A;  1VI0 A;  2M8G X;  3BT9 A;  1QVT A;  4KWA A;  2RAE A;  2MGQ A;  4JP0 A;  4Y7N J;  1OJL A;  5IP7 J;  4X6A J;  3CMY A;  1SGM A;  3IH3 A;  3VP5 A;  1LE8 A;  2DMP A;  3ANP A;  1G2H A;  1JT6 A;  2XRL A;  5FHP A;  1BL0 A;  5M5W J;  4M3B A;  3BTJ A;  1ZR4 A;  1MSE C;  3L1P A;  3BNI A;  3RD3 A;  5GPA A;  2QWT A;  3A01 B;  2VKV A;  2DA4 A;  2PMZ N;  3HBL A;  1CQT A;  2QCO A;  3O60 A;  5M3F J;  2WGB A;  2PBX A;  4FCY A;  2HOA A;  4S0H B;  1VFC A;  1ETX A;  3ZQH A;  2GM4 A;  5F0C A;  1RKW A;  1ETW A;  4RDU A;  2ME0 A;  1AKH B;  1MBG A;  1IGN A;  4CYC B;  1OCP A;  1U78 A;  3QPL A;  1RKT A;  5EYR A;  3QPS A;  3TP3 A;  3T6N A;  2JMW A;  3MKL A;  4JYK A;  3HOY J;  3P9T A;  1LFU P;  1ORK A;  3HGG A;  3K2A A;  3S16 J;  3HOW J;  2DN0 A;  4W1U A;  2ECB A;  2FD5 A;  1JGG A;  2F07 A;  3ZOB A;  5IP9 J;  2QTQ A;  4FE4 A;  2FBQ A;  1IJW C;  3PM1 A;  2PZ9 A;  2UXI A;  2ME6 A;  1XC5 A;  2N8G A;  3B6A A;  5JLX A;  1UI6 A;  1LE8 B;  3OSF A;  3JRD A;  5F1J A;  2DA5 A;  3IH2 A;  4AF5 A;  4D5C A;  2CJJ A;  4G12 A;  1BA5 A;  2RHA A;  2DG8 A;  1H8A C;  4IHY A;  3BHQ A;  1A5J A;  2DA6 A;  3HOZ J;  2ZCM A;  3EUP A;  4FTH A;  4J19 A;  1GV2 A;  4A3F J;  5C4Y A;  1WH5 A;  1MBJ A;  4A3J J;  1B8I A;  3CJD A;  2L0K A;  2EZI A;  5GP9 A;  2HDD A;  3S5R A;  2HQ5 A;  4C2M J;  3H3V K;  2R92 J;  2DA2 A;  1GVD A;  1POG A;  2ELK A;  3BG3 A;  4IHV A;  3HTI A;  3RKQ A;  2LR8 A;  4GCL A;  4FIS A;  2REK A;  3GTO J;  5IP6 A;  1ETQ A;  3RQI A;  1HCR A;  2G0E A;  1P7J A;  4JX6 A;  2VI6 A;  2ZOY A;  3BR0 A;  1IV6 A;  3ZQC A;  2WB1 N;  4V2G A;  3CDL A;  1UHS A;  3K7A J;  3DPJ A;  1JUS A;  2XGD A;  1FIA A;  2L9R A;  1H89 C;  2HOT A;  2DMN A;  1PUF B;  2NP3 A;  3VVY A;  5FKL A;  3MNL A;  3FRQ A;  1WPK A;  2LVS A;  4MK6 A;  5HOD A;  5EFY A;  4XRM A;  3KKC A;  2G7S A;  2FQ4 A;  3TW7 A;  1UMQ A;  2NVT J;  3QQA A;  2EZK A;  1MSF C;  4C3H J;  2IEK A;  3S2H J;  2EBI A;  2TRT A;  2MW8 A;  2Y9Z A;  1RPW A;  1VF9 A;  3O8G A;  3LSP A;  3ZQL A;  2DJN A;  2IBD A;  4IHX A;  1JTY A;  2YVE A;  5C4X J;  1VND A;  2JJ7 A;  2X6O A;  2LK2 A;  4BY1 J;  1K83 J;  1PUF A;  3IV5 A;  1GDT A;  2NP5 A;  3FKI J;  5EG0 B;  5BNG A;  3I4M J;  2OI8 A;  1WH7 A;  2JK3 A;  4UUT A;  2UXO A;  3JRA A;  2GEN A;  1X2N A;  1ETO A;  2R5Z A;  3LSG A;  3RZD J;  3VW1 A;  5JLW A;  2YVH A;  4GFB A;  3HOU J;  4EEF G;  1QPI A;  2UXH A;  1JKO C;  4NEL A;  3VUQ A;  4PXI A;  2GUH A;  4ABZ A;  3SFI A;  5FKN A;  1ZQ3 P;  3AQS A;  3NRG A;  3WHB A;  3S1Q J;  1JKP C;  3EGQ A;  5D19 A;  3BR6 A;  4GFL A;  1T33 A;  2XPV A;  1U8B A;  4QTR A;  3G7R A;  1AKH A;  1TC3 C;  4AC6 A;  3BCG A;  5H9T A;  3GZI A;  2K9N A;  3GTJ J; 
#chains in the Genus database with same CATH topology
 1Y39 A;  4KN4 X;  5EZG A;  2O9L A;  3MZY A;  1FTT A;  3BPV A;  3H1C A;  1X2M A;  3NEU A;  4MQV A;  1ITY A;  3COL A;  2FJ1 A;  4AIK A;  2M8E A;  1IAW A;  2NVX J;  2IA1 A;  3CCY A;  4LJZ F;  1FBQ A;  1O3T A;  1IZ1 A;  5EDN A;  3I59 B;  2E7X A;  1NH3 A;  2O6G E;  2XPW A;  3E5Q A;  2UV1 A;  2DI3 A;  1FZP B;  1K78 A;  2DQR A;  1FYK A;  3ECO A;  3OS2 A;  1IXC A;  1EV7 A;  2L4M A;  3DQV C;  3H36 A;  2QBY B;  4UUV A;  2HS5 A;  4WIB A;  3VOD A;  1Q1H A;  1D0Z A;  1LDK B;  1GV5 A;  4KYW A;  3B81 A;  3JRB A;  3MMY B;  3C2B A;  4A3G J;  3OIQ A;  3HKZ N;  2JWT A;  3W6J B;  4F52 A;  2KLO A;  3GF2 A;  2XV4 S;  4MQ9 F;  3MWM A;  1HXD A;  4ZYA A;  2DFI A;  1FBU A;  2CUE A;  5HS8 A;  1LFB A;  3EDP A;  1B4A A;  1O7F A;  2XF5 A;  1R49 A;  3LA3 A;  3FIS A;  5JVG F;  3GTM J;  5EZH A;  5EEH A;  1FJL A;  4KUM A;  4KJZ A;  3QBM A;  1LB2 A;  1BR1 A;  4KDP A;  1ZRE A;  2QKM B;  3H5N A;  5CW8 A;  4LG0 B;  2GBY A;  2FML A;  3IUV A;  2CRG A;  1MMG A;  4B44 A;  5HNF A;  3I58 A;  3A03 A;  4RGR A;  1ULY A;  5B1B H;  4ZH4 F;  1R22 A;  2LDU A;  4CZC A;  3NS4 A;  3E3V A;  1FSE A;  2MLK A;  2CU7 A;  2LNB A;  3KIO A;  3ERM A;  1R58 A;  2WTE A;  5KK1 A;  3KZI C;  2E2I J;  3LFU A;  3S1R J;  5DYM A;  4BBS J;  4XN3 A;  2OAZ A;  2K02 A;  1MMA A;  3HG9 A;  1DUX C;  4AYB N;  3KP3 A;  3Q0W A;  3HTA A;  3KYD B;  2XDN A;  4N9I A;  1ONV A;  3L09 A;  4KIS A;  4A12 A;  1WJC A;  2JA5 J;  4L9J A;  4PJL A;  1Y8Q B;  2ID3 A;  1KQ8 A;  3Q0V A;  1JKQ C;  2R7X A;  4OD5 A;  3BZK A;  2XVC A;  2FBI A;  1EF4 A;  5FKM A;  2PMH A;  5ICE A;  1Y0U A;  1DPU A;  2DMQ A;  4U9L A;  3NWS A;  2K4J A;  1EH7 A;  1F4K A;  2MH9 A;  2JVG A;  2QSF X;  3BQY A;  5F0H A;  2H6C A;  3VIB A;  1ZG1 A;  4BXX J;  1QZZ A;  3DTE A;  1H0M A;  2DPD A;  2Q0O A;  1ZGJ A;  1V5G A;  2L3D A;  1G4D A;  3Q9V A;  5E8G A;  2K3F A;  2XPU A;  5LD2 C;  1AWC A;  1WJB A;  4GCK A;  3N4M A;  3K4K A;  3DEW A;  2LKS A;  1DP7 P;  1FOK A;  4PSX A;  4CGR A;  5D5V B;  2KIU A;  2O0Y A;  3UNG C;  2VE9 A;  4DYQ A;  3V8L A;  1X1B A;  3H0G J;  4GFK A;  1D8J A;  4II2 A;  2ZME C;  1JT0 A;  1BI1 A;  3OOU A;  1D1B A;  4HNT A;  1P2F A;  4ZDO A;  2I5U A;  4Z6Y A;  1OR7 A;  3S15 J;  3CCS I;  2GXG A;  3BY6 A;  4XKC A;  4XRS A;  4PGH A;  4X0G A;  5L3G A;  1AA7 A;  3HM5 A;  3PNT A;  4DZP A;  1X3U A;  1R9T J;  2LY2 A;  2NOG A;  2KDO A;  2L2O A;  5DV5 A;  4OD4 A;  5DCM B;  3E6B A;  3V4G A;  4M9X A;  1S9H A;  2L7F P;  1FLI A;  1LJ9 A;  4L18 B;  4F92 B;  3Q0U A;  4HV5 A;  3WE2 A;  1EKE A;  4XLE A;  2V1U A;  3KP6 A;  1W1W E;  3LL7 A;  2RQQ A;  1K4S A;  3HRS A;  2CMP A;  4F7Z A;  1IW7 F;  2IRF G;  2VQH A;  4HZF A;  5HLG A;  3LWJ A;  2OUM A;  4IRG A;  3CZ6 A;  2EA2 A;  4B1R A;  1SAN A;  1X58 A;  2QWW A;  1O4X A;  3V6G A;  3RPQ A;  3LJL A;  1XSX A;  1ODD A;  3L9F A;  3DKW A;  1JGS A;  1B72 B;  3W6V A;  2V9K A;  3CCJ I;  1TZL A;  2IU5 A;  1XGN A;  3LA2 A;  1SVO A;  1TWA J;  3KZ9 A;  4QPQ A;  1R1U A;  2EV5 A;  2BVM A;  2NOJ B;  2D45 A;  1UZC A;  5E3M A;  3TW6 A;  5GTI C;  2XIG A;  3FMS A;  2M9H A;  3TDU C;  2KP6 A;  1Z6R A;  2HXO A;  3RPU D;  5E18 F;  2A07 F;  3I5U A;  4LIT A;  2I10 A;  4D7N A;  2O8K A;  3NWT A;  2DG7 A;  1Y0N A;  2M0C A;  3DLL F;  2WC2 A;  3DTI A;  2QGU A;  3MZH A;  1XX5 A;  1UB9 A;  4PSW A;  5DM6 F;  3S2D J;  4M6V A;  3I56 I;  3VYR B;  3AQT A;  3ASN H;  2DMU A;  2CQN A;  3BPX A;  1Y6I A;  4MTD A;  2Y30 A;  5HBU A;  2HOS A;  3U21 A;  2O7T A;  5FLX Z;  3H35 A;  2R7R A;  4A5M A;  2B9S A;  3E5X A;  1FMV A;  3GO5 A;  3BZ6 A;  1B9M A;  1XMK A;  3ZMS A;  2F5C A;  2QUF A;  3S32 A;  5J1Y A;  1TW2 A;  3V8J A;  2UXX A;  4B4C A;  4AVZ A;  1DPR A;  1P9Q C;  1S8N A;  3B6C A;  3G3Z A;  3IHU A;  2WBM A;  1OCR H;  4NDL A;  4HQM A;  3GZ5 A;  1I3A A;  5LGN A;  1QQI A;  4DBQ A;  5E3N A;  4ZYH A;  3S3O A;  1BM9 A;  3A0B C;  3HJE A;  3J81 K;  3CDH A;  3WTZ A;  5BPI A;  2O03 A;  2D2W A;  4BQO A;  2IA2 A;  1IXS B;  2Q1Z B;  2XGE A;  2ZB9 A;  1FOX A;  3EET A;  4G7Z F;  3P7N A;  3NRV A;  2UXN A;  2V1D A;  4LIV A;  1LQ1 A;  4ESF A;  4RLQ A;  3B02 A;  2Q8K A;  1VQN I;  2VB6 A;  3UR3 C;  4IXA A;  5LHI A;  3LSR A;  4JQF A;  4DQ2 A;  3GTG J;  4CA0 A;  1MKM A;  2W7N A;  1GHC A;  3M3Y J;  3R61 A;  2FSW A;  3SYT A;  2X4H A;  3KFW X;  4LMY A;  4EM0 B;  3DEE A;  1QVU A;  3PAS A;  4O3M A;  2FMY A;  4B8X A;  5DM7 F;  4LK1 F;  2WUI A;  2EIM H;  2VOO A;  2HFH A;  1X1D A;  1BJZ A;  3MEX A;  4GYI A;  2YS9 A;  2UXU A;  3J80 K;  4FE7 A;  2XGC A;  3ABU A;  1HKQ A;  2AQF A;  2CWE A;  5E8I A;  1HLV A;  3BTC A;  2VXZ A;  5CXI A;  1ENH A;  4RAF A;  5BOX A;  5J1U A;  1AU7 A;  4EJW A;  3OIO A;  4ETS A;  3OR1 C;  1E0E A;  3K69 A;  1RR8 C;  4A3K J;  2DOA A;  3ON4 A;  1HF0 A;  3IC7 A;  3ZP5 A;  1HBX G;  2R7T A;  1ZYR F;  2EJR A;  1ZG3 A;  3C2G A;  3FM5 A;  2O7O A;  5LHH A;  2VQL A;  3CTA A;  3DPT A;  3I9V 2;  3HEF A;  5J6X A;  3IL2 A;  4E70 A;  2X85 A;  2NVY J;  2M7B A;  2BXZ A;  3ECH A;  3PO2 J;  3OYH A;  5LEK A;  3UKG A;  2OTJ I;  1XG1 A;  3CP2 A;  4Y17 A;  2QSH X;  3H9J A;  1TQP A;  3CLO A;  3F1B A;  1QHH D;  2AXL A;  2IS1 A;  1QO0 D;  5K7Z A;  4LGW A;  3EUH A;  3JCU C;  3QU6 A;  5LHG A;  2R7Q A;  3OMY A;  5JFR A;  2XAJ A;  1R1V A;  2M5W A;  3G73 A;  4LG3 A;  4CGZ A;  5LLQ A;  4G6T B;  2H27 A;  2AXT C;  4P9F A;  3BCA A;  3ABT A;  2ETH A;  4LLL A;  4ZTJ A;  4M3B A;  1BC8 C;  2VLA A;  1MSE C;  2YPR A;  2RRE A;  1YW9 A;  3H92 A;  3BNI A;  3RD3 A;  2B1E A;  4HLX A;  3A01 B;  2PMZ N;  2GAU A;  3K4B A;  5BPD A;  4YIF A;  3EUH C;  3CJT B;  2M3A A;  2HOA A;  4JK1 X;  3FXK A;  3GVA A;  5B5E C;  2Y0M A;  2H1L A;  2GM4 A;  1RKW A;  2ME0 A;  1AKH B;  1MBG A;  1X4O A;  4CYC B;  3QPL A;  5KHD A;  3QPS A;  3TP3 A;  2E60 A;  1R00 A;  2JMW A;  2HVR A;  2PX9 A;  3WU1 B;  1MND A;  3OYL A;  3P9T A;  3K2A A;  3ZXS A;  3HOW J;  3CMA I;  4W1U A;  2Q2E A;  1QA6 A;  2IGN A;  3DPU A;  1RRJ A;  1MDM B;  5HDN A;  1WI9 A;  3L2C A;  1IXR C;  4IF4 A;  4RGU A;  1ZRD A;  5FRM A;  2PZ9 A;  2UXI A;  1KYW A;  3RTR A;  5D4S A;  2R7O A;  3JRD A;  1GXQ A;  4ZYD A;  2DA5 A;  1SMT A;  2Z1D A;  4XKW A;  2CJJ A;  3WTT C;  3FXM A;  2ZFW A;  4G12 A;  2DG8 A;  1H8A C;  4IHY A;  2ZCM A;  1IN4 A;  2K5C A;  4UV8 A;  4OOI A;  4J19 A;  1GV2 A;  4A3F J;  1BIB A;  3F21 A;  1MBJ A;  2NXN B;  4A3J J;  1IRX A;  3K1M A;  1R4N B;  5GTH C;  3S5R A;  3A1Y A;  5J4V A;  3H3V K;  2VE8 A;  3SFZ A;  4CCN A;  2DA2 A;  4UV9 A;  4IHV A;  3HTI A;  1MW7 A;  3RKQ A;  4P55 A;  3PJR A;  1Z21 A;  3VOE A;  2I8D A;  3RPU A;  3GTO J;  2V6C A;  2EFQ A;  2IGK A;  4HG2 A;  1HCR A;  3ZR8 X;  2X1E A;  2EWN A;  1S3J A;  1YW8 A;  4D9J A;  2K3P A;  3TL4 X;  1JUS A;  3PUB A;  2L9R A;  2HOT A;  2NP3 A;  5FKL A;  3MNL A;  2XAU A;  3FRQ A;  1RNL A;  2HR3 A;  4IRV A;  4XRM A;  3OY9 A;  4BQQ A;  4IJA A;  2WY7 Q;  4KFC A;  5HVQ C;  2NVT J;  2RC4 A;  1LVK A;  2IEK A;  2JUG A;  3S2H J;  3ZMT A;  3VYU B;  3LQQ A;  3RKX A;  2MW8 A;  2KHM A;  3KE2 A;  1O3R A;  4CCL A;  3LSP A;  2F2E A;  5CJ9 A;  4E7S A;  2V26 A;  2DJN A;  4B43 A;  1UAA A;  3O2P E;  1IRF A;  2E36 A;  4L9V A;  1YJ9 I;  2Z99 A;  1UFM A;  1XCV A;  5ILV A;  1W7P D;  3G2B A;  5BNG A;  4G7H F;  1DGW Y;  3GW2 A;  3HIF A;  3P9C A;  1FYL A;  2HWV A;  1LFP A;  2VOD A;  2HPM A;  3TO6 A;  1EH6 A;  4NEL A;  1NG7 A;  1OYW A;  4DBR A;  1GVJ A;  2Z16 A;  4NUB A;  5ICG A;  5D19 A;  1O7L A;  3MAJ A;  1OMI A;  4PGG A;  4UVA A;  1X3Z B;  3G7R A;  4P9U A;  1HW1 A;  1D3Y A;  4U88 A;  2BYV E;  4BNC A;  3GZI A;  3GTJ J;  2HTS A;  4YFX F;  1Z91 A;  2K27 A;  4ESJ A;  3OIP A;  3PNY A;  1S7O A;  3HE0 A;  1XTA A;  1U3E M;  2JT1 A;  3I4N J;  1ZN2 A;  5JR3 A;  3ANG A;  1VQ6 I;  1TWC J;  3N05 A;  2VXD A;  2IA0 A;  3SDB A;  4HNV A;  5E3L A;  1U5T C;  2IS2 A;  4CIC A;  1KGS A;  3L2Q A;  2VL8 A;  2E5N A;  3DCF A;  1Z77 A;  4ICH A;  1I6X A;  2WV1 A;  2GQQ A;  2M7A A;  5BMZ A;  3GTP J;  3MFK A;  3VSK A;  3E6C C;  2R7S A;  2P5K A;  4BBR J;  1VQP I;  1ETY A;  2G9W A;  4RB0 A;  2ZOZ A;  4JX4 A;  3PIO F;  3HGY A;  4PJN A;  1JHF A;  5F08 A;  3SEQ A;  4MEX F;  2R7Z J;  2GFN A;  2H94 A;  2Y0S N;  3GFI A;  3HHH A;  2JTV A;  2NS7 A;  5J8F A;  1ZLK A;  4L9N A;  5TIS C;  2JN6 A;  1G3W A;  5F0F A;  1CF7 A;  3I71 A;  2RVC A;  3BTL A;  4FAS D;  4DZJ A;  3WU2 C;  1XMA A;  2JSP A;  1FNN A;  1WI3 A;  2FU4 A;  4Y15 A;  1MGT A;  4XOP A;  1F43 A;  1BR4 A;  1XCB A;  2ID6 A;  3M4O J;  3P5J A;  2CUF A;  2M34 A;  4KT6 A;  4ACI A;  1BI0 A;  3FWE A;  2VON A;  1D8K A;  2GA1 A;  3O6B B;  1BOA A;  5KAF C;  3VOX A;  4BGD A;  1DQU A;  4PDK A;  2B63 J;  1N78 A;  1P4X A;  2H1K A;  1D0X A;  1APL C;  1GUU A;  4A3M J;  2XAS A;  3BTI A;  3MQ0 A;  2FX0 A;  1E3P A;  4L9T A;  3BG9 A;  3HL2 A;  5F04 A;  1IG7 A;  2NVU B;  1Y1W J;  1R6R A;  2A68 F;  1LPQ A;  2E2H J;  1XN7 A;  1RES A;  3ZRG A;  1VQ8 I;  5FMP A;  3IH4 A;  2FJI 1;  2LRE A;  1SFX A;  1WJD A;  3DLA A;  2HU9 A;  1D1A A;  2OU2 A;  2Y9Y A;  3OYN A;  5KNL A;  4R79 A;  4AYB A;  1Z05 A;  2DT6 A;  1X1A A;  3VTI A;  2KJC A;  4A6E A;  2IAI A;  4XBF A;  1J09 A;  5LRR A;  2XSD C;  1Y1V J;  3WTS C;  4NB5 A;  3VVZ A;  1SFO J;  1GT0 C;  4YFN F;  2FUG 2;  2ZNY A;  4KIC A;  2KMU A;  2VIX A;  1MZB A;  4XIC A;  2JA2 A;  3QAH A;  2P5L C;  2FXA A;  2FA5 A;  3I55 I;  4BE1 A;  4HKU A;  3WTU C;  2LF7 A;  3ESW B;  1MH4 A;  3KYL A;  4ZYG A;  2DDB A;  2EFP A;  3DWL E;  3M1C A;  5K7F A;  3RKY A;  3D1N I;  4XRS G;  4ANJ A;  3BJO A;  4JNN A;  1NG6 A;  2VKH A;  3W2V A;  1RET A;  3IWZ A;  1TQM A;  4CXF A;  5E3O A;  3N97 A;  2QLZ A;  2XAH A;  4A3B J;  2P6S A;  3SZP A;  3FDY A;  1OYI A;  3HSE A;  1R36 A;  5ILS A;  4IPA A;  1SD5 A;  2OZU A;  1MJ9 A;  1ZKG A;  1ZTR A;  2R93 J;  2VQC A;  2FOW A;  3HPG A;  3TKY A;  3HYI A;  1U5T B;  4N0B A;  4CDG A;  5D8L B;  4HDV A;  4IOA F;  1JXS A;  2DYR H;  4XNF A;  5CVV A;  2RNJ A;  4WCG A;  1YJW I;  2ZME B;  4L5E A;  3V7R A;  1ON1 A;  3CUO A;  2DA1 A;  1A6I A;  1T2K A;  2OBP A;  3BJB A;  3E7L A;  3P9K A;  4ON0 A;  4A69 C;  2HQA A;  2LLK A;  2WWY A;  1R4M B;  3CJR B;  1UHM A;  4FT8 A;  2NX4 A;  3CCE I;  1J0R A;  4E7Z A;  3CC2 I;  2BHY A;  1HA8 A;  2DOE A;  1XSD A;  3L00 A;  5L3E A;  2VPL A;  4PJJ A;  3F9K A;  3SZT A;  1FWZ A;  1MDM A;  4HAM A;  4HPQ A;  4M3G A;  4RGS A;  2WY8 Q;  2MFZ A;  1TWF J;  1BI2 A;  2E1M B;  5BS6 A;  1VQK I;  2KRH A;  3VB2 A;  1TTY A;  1TL8 A;  2B0L A;  1JUM A;  5ED4 A;  1Z1D A;  3TMO A;  2GA2 A;  2OC6 A;  4Q47 A;  4EAT A;  3C18 A;  4CZZ A;  3NPI A;  2O3F A;  5C3E J;  4MNU A;  1UG0 A;  1ZGA A;  1CGP A;  4M3F A;  4UXN A;  2LC2 A;  3WGH A;  1W0U A;  5FO5 A;  2G3B A;  1TWG J;  3CES A;  4LLN A;  5IOZ A;  3PUF A;  3DXJ F;  2GOM A;  4UUS B;  2LTP A;  1F1Z A;  4XON A;  1UI5 A;  4U9N A;  5D18 A;  2AO9 A;  1KU2 A;  2VN2 A;  1OYY A;  1OFC X;  3D5L A;  2WA0 A;  1FP1 D;  1MBH A;  2HYT A;  5FLM J;  3IAS 2;  4ME9 A;  2ADU A;  5EJC A;  2BE5 F;  4MFD A;  5HLT A;  1FEX A;  4NC8 A;  4GCT A;  2WV0 A;  2ISZ A;  2E5Z A;  1KQ0 A;  1G3Y A;  3WTV C;  2KT0 A;  3D5S C;  1ZH5 A;  2K85 A;  1BI3 A;  1MH3 A;  4I01 A;  2VJJ A;  3RJP A;  4EJU A;  4ENN A;  5KAI C;  1S72 I;  1YX5 A;  2KIM A;  2IW5 A;  3GEZ A;  1LVA A;  2Z3Y A;  5C4J J;  5CVI A;  2R7U A;  2VPR A;  4C2T A;  1IUF A;  5F27 A;  3KKD A;  4IQ4 A;  4NBQ A;  4XR6 A;  4BHB A;  1STZ A;  1JUP A;  4MGR A;  5D6F A;  2XUB A;  4M3D A;  3HTU A;  4XLH A;  2Y69 H;  4CCM A;  1MBK A;  2MSY A;  2R7D A;  4GCV A;  3WHC A;  4HQE A;  3V8K A;  4A3E J;  3GCM A;  3GFJ A;  3FK6 A;  4LOC A;  4DJA A;  5DTD A;  2W57 A;  1SEU A;  1QNT A;  1FTZ A;  2X1D A;  1IRG A;  4L0Y B;  3G1O A;  3SZG A;  2K40 A;  4W97 A;  1A36 A;  4BUP A;  2B3W A;  4NC7 A;  4QIW N;  4HBL A;  1ZEL A;  4A0Z A;  3VFZ A;  3HIM A;  3BP8 A;  2P6T A;  5FKO A;  5D8K B;  3ON2 A;  1XDU A;  4C9Y A;  2M4K A;  4V19 K;  4ZYE A;  2DOF A;  2RN7 A;  4GRI A;  3S1N J;  3JSO A;  2R7F A;  1G8X A;  3OSG A;  3GTL J;  2XGX A;  1EJ9 A;  1Z7L A;  1U6G A;  2DXI A;  3KP4 A;  1W36 D;  2F5V A;  2MYS A;  4FET A;  5J1R A;  2LY1 A;  3HRT A;  3HB9 A;  4PFP A;  3F8B A;  3SJM A;  3KLO A;  4YZE A;  3FMQ A;  2NAZ A;  2MAB A;  3BR5 A;  2ISY A;  3IUO A;  5A2Q Z;  4OMY A;  1W36 C;  3G6E I;  4C2U A;  3JAM K;  4EQQ A;  4IHS A;  3GZ6 A;  1U9O A;  3LSI A;  5H20 A;  2PMU A;  4BKX A;  3VVX A;  3K4M A;  4XRF A;  3QKX A;  5CVU A;  2ZFU A;  2E1M C;  2HQR A;  4C30 A;  3G56 A;  3PFY A;  2PN6 A;  4EJV A;  2DFF A;  2IPQ X;  3ZQQ A;  5CYV A;  2OD5 A;  4OIO F;  4HSR A;  5FKK A;  1F36 A;  3EYY A;  3M8J A;  5E1Z B;  3NNR A;  5M5X J;  3FXR A;  3GTK J;  4M71 A;  4BY7 J;  5EGO B;  5IYB J;  4KIF A;  3CCR I;  2HDW A;  1I50 J;  2BXY A;  1A04 A;  2JRM A;  4NN1 A;  4RAY A;  3ZQF A;  2MH2 A;  3WTX C;  3JAM Z;  3QOD A;  2DA7 A;  1JKR C;  2F4I A;  4MLO A;  3WGG A;  3ZN1 A;  5EF6 A;  4CHU A;  3LOC A;  2NS0 A;  2V1X A;  1N75 A;  1T0F C;  1VI0 A;  1T8I A;  3BT9 A;  3E6D A;  4KWA A;  4F93 B;  2RAE A;  2MGQ A;  1X3W B;  3BDD A;  4JP0 A;  3WOD F;  4Y7N J;  1MJA A;  3CMY A;  3GZN B;  2DU9 A;  5JVT A;  3IH3 A;  3KZZ A;  1LE8 A;  3GUD A;  3ANP A;  1FOY A;  2FBH A;  2XRL A;  5FHP A;  3ABM H;  2XAG A;  3I3L A;  2M30 A;  4I0B A;  5GPA A;  3QRF F;  3L7W A;  2HEO A;  3CUQ B;  2DA4 A;  4XL9 A;  2F5F A;  3HBL A;  2CH0 A;  3OYK A;  4A5N A;  5H2F C;  3TO9 A;  1YQA A;  1CQT A;  3CC7 I;  5TGT A;  2WGB A;  2PBX A;  1J2X A;  4AIH A;  2KPM A;  4HEA 2;  3BLY A;  2BV6 A;  4S0H B;  3C3W A;  1VFC A;  2ZO4 A;  4I0A A;  3AAF A;  1DDN A;  3F8M A;  2KKO A;  2P7V B;  2IS4 A;  1ETW A;  4I7H A;  3T0Y A;  2Z9O A;  1LEA A;  3L2R A;  3JTG A;  4RA2 A;  3M8F A;  4BYY A;  3C2H A;  2BOL A;  5K5Q A;  4XLF A;  5D5W B;  4JYK A;  4B48 A;  3IRQ A;  4GDF A;  3S16 J;  2KQR A;  3LWF A;  4BAC A;  3M07 A;  2F07 A;  4K2E A;  4FE4 A;  1HKT A;  4J01 A;  3B6A A;  4EGY A;  4AF5 A;  1TLH B;  3I59 A;  3L2V A;  2LF8 A;  3RYP A;  3BJA A;  2ZJR F;  4XMY A;  5J40 A;  2DA6 A;  2RDP A;  3CJQ B;  2CUZ A;  1K6Y A;  3E6M A;  3U9G A;  1WH5 A;  2HQN A;  4G9Y A;  2A5Y B;  1N25 A;  2HQ5 A;  4RAG A;  2A5W A;  2R92 J;  1GVD A;  1POG A;  2FEZ A;  2KRF A;  2STT A;  3RI4 A;  3OYA A;  2PJP A;  2REK A;  5LGU A;  2XKP A;  3W3C A;  3IKV A;  1I27 A;  1P7J A;  4JX6 A;  4RB2 C;  3AFH A;  3BR0 A;  1IV6 A;  4WF2 A;  4P96 A;  2WB1 N;  5FRN A;  1SD4 A;  4V2G A;  3CDL A;  4DNC A;  1KZH A;  3DPJ A;  2WAE A;  1BOB A;  2EV0 A;  2DMN A;  1PUF B;  4HF0 A;  1V3F A;  3WG7 H;  4CSW A;  3M8E A;  1WPK A;  4YG2 F;  2LVS A;  4N9H A;  5EFY A;  3HRM A;  2VT2 A;  4U0W A;  4BJ5 C;  2M0M A;  2LH9 A;  1YIO A;  2W82 A;  3F8C A;  2G7S A;  2X51 A;  4DVY P;  2ZME A;  1LDD A;  3OYI A;  3CCU I;  3HOS A;  2DT5 A;  2PG4 A;  3KLN A;  1JI8 A;  1U2W A;  5B66 C;  2EBI A;  5H6Q A;  4QWQ A;  4BXF A;  1EA3 A;  5CLS A;  4U0V A;  5LFA A;  3F6O A;  1RPW A;  3ROU A;  1KU9 A;  3MCZ A;  3ZQL A;  2CV0 A;  4UVC A;  3ZMD A;  3CCM I;  2VC0 A;  3OYF A;  3LA7 A;  5C4X J;  1YG2 A;  1IUY A;  4B47 A;  3AG1 H;  2JJ7 A;  2X6O A;  2LK2 A;  4BY1 J;  1PUF A;  4NQW A;  5EG0 B;  2DJI A;  3KP7 A;  1WH7 A;  2JK3 A;  4UUT A;  3JRA A;  2GEN A;  3HPH A;  2R5Z A;  1ETO A;  3HHG A;  1KQ9 A;  1GXP A;  3VW1 A;  5CQG A;  4ZC3 A;  4HV6 A;  4GFB A;  1JKO C;  4LFU A;  2F4O B;  3VUQ A;  1WJ5 A;  2DCE A;  3CO6 C;  2WAQ A;  3NRG A;  4IZZ A;  3S1Q J;  5DUI A;  3BR6 A;  2V1N A;  1U8B A;  1WHU A;  5H9T A;  4AC6 A;  2BZT A;  3BCG A;  2A6E F;  5J4Y A;  2XDV A;  4I6Z A;  1G6N A;  1UG2 A;  4KIT B;  1HQC A;  2QQ9 A;  3LSM A;  2F5D A;  4LG0 A;  1ON2 A;  2CFX A;  3WTW C;  2EV6 A;  3H9Q A;  4U0Y A;  5E20 A;  2D6Y A;  2R4G A;  3PQJ A;  4B3X A;  1YRN A;  3JRH A;  3AL0 B;  1ACI A;  5EEA A;  3R0J A;  3M7G A;  1IDY A;  5FB2 A;  1XPX A;  2XAQ A;  4FHT A;  2HOE A;  5B3S H;  5LRS A;  3WTY C;  3TED A;  3LHQ A;  3P9I A;  1KA8 A;  3LNQ A;  3B73 A;  3K1N A;  3LFK A;  2HKO A;  3HXL A;  2YX4 A;  2ZSI B;  1SVM A;  3S3N A;  3NXC A;  2ZC2 A;  4ENJ A;  4MO7 A;  2ZCN A;  3KZY A;  1FP2 A;  1WWX A;  4RLF A;  2K9L A;  3PO3 J;  3DU5 A;  4BJ6 C;  1TBX A;  2Y75 A;  4WXC A;  4U7D A;  2VKE A;  2XAF A;  4II3 A;  4WXD A;  4KA4 A;  1B6A A;  2CV1 A;  5ERI A;  3OYG A;  3K9T A;  1S6L A;  3JR9 A;  3LSH A;  3VDX A;  1D0Y A;  3MN2 A;  5DEQ A;  4UB6 C;  1YJN I;  4EJT A;  2G7H A;  1YHQ I;  4O6J A;  2ZJP F;  1SC7 A;  1D5V A;  2R0Q C;  2MC4 A;  2LRD A;  3CF2 A;  2TCT A;  2A6H F;  4DYC A;  1T98 A;  1S7E A;  2E34 A;  2MLG A;  3FXL A;  3T8R A;  1P7I A;  2RNG A;  4QPO A;  2O8X A;  2ZXI A;  3LMM A;  4Y33 A;  4XID A;  2IP2 A;  3TP0 A;  2VBY A;  1SFU A;  2MD0 A;  2TDX A;  2NS8 A;  1J59 A;  4UVB A;  1S7A A;  1WCM J;  3OR2 C;  2E1O A;  1QZE A;  1WVR A;  4N4N B;  5IT3 A;  3HTH A;  1USS A;  4PCQ A;  3RH2 A;  4X1E A;  1T08 B;  5FD6 A;  3K4N A;  2CG4 A;  3RZO J;  1MMN A;  1RUN A;  4DYR A;  3QOE A;  3CMM A;  3OYM A;  1YIJ I;  1FPQ A;  3S93 A;  4AC0 A;  4F55 A;  4R1H A;  1F5T A;  5GAH J;  2EZL A;  2DA3 A;  4NNJ A;  5EGO A;  1V5F A;  3K70 C;  3S17 J;  5AQC A;  3KEO A;  1M1E B;  2ECC A;  1FBS A;  2XSJ C;  1IC8 A;  3F3X A;  1AOY A;  4I02 A;  2X6W A;  5FGM A;  3R0A A;  5HS7 A;  2LOO A;  3AKZ A;  2MG4 A;  1KYZ A;  1XDS A;  3G1L A;  1YE9 A;  4RB1 A;  1H88 C;  3KCC A;  2NVQ J;  4IHW A;  5DCF A;  3BWG A;  1UEL B;  5IT9 Z;  2CQK A;  2A2F X;  1F9N A;  4AWX B;  2GOX B;  2HYG D;  2R5Z B;  2OQR A;  3CDI A;  4XM3 A;  3J7Z I;  2F5E A;  4F91 B;  3OOP A;  4BE2 A;  2V6E A;  4PJ0 C;  1ZG5 A;  3H5A A;  5JI6 A;  2GXA A;  1WFX A;  2YUS A;  3ABK H;  2HVS A;  2K86 A;  3E97 A;  3BC8 A;  1LDJ A;  3JSP A;  1OPC A;  1BW6 A;  2ELH A;  3L2U A;  4YRV A;  3RKW A;  5AIQ A;  4IO9 F;  2PMZ A;  4GYG A;  3QU3 A;  3AL0 C;  2M4G A;  3KET A;  4M3E A;  2DTZ A;  4O5V A;  6PAX A;  3LQR A;  3DV8 A;  3V7C A;  3RYR A;  1A31 A;  2ZCX A;  1WJE A;  3VW0 A;  4UY8 I;  4IEJ A;  5IYC J;  1V4R A;  2OCE A;  3ISP A;  4S05 A;  3HTS B;  2ICW G;  5DUK A;  3VYT B;  3PSI A;  2OCC H;  1AHD P;  1UCR A;  1HST A;  2XC7 A;  4LIU A;  3F22 A;  5GPC A;  2JPB A;  1ZAO A;  2LG4 A;  4UHT A;  5HS9 A;  3IAM 2;  4A2U A;  4D7M A;  2KJB A;  1WGX A;  5IPA A;  4WK8 F;  1JE8 A;  1BBY A;  4QSH A;  5TRD A;  5ICC A;  2WB1 A;  2AHQ A;  3W2A A;  3JSJ A;  4KIG A;  3EUA A;  2LBF B;  3HZJ A;  4AIJ A;  2VT3 A;  1P6R A;  2QEX I;  5GAG J;  3FHN A;  3ONQ A;  4IRH A;  1K7A A;  1UST A;  3A2K A;  2CFO A;  2M87 A;  2QF7 A;  3PSF A;  2NRA C;  5FLV A;  3GX4 X;  2VKD A;  1VQ9 I;  3J7A Y;  2W53 A;  1FX7 A;  3NAU A;  4CH7 A;  1OIS A;  1ZAR A;  4YEL A;  3KP5 A;  1XB4 A;  3G1M A;  3MKY B;  4CCK A;  3BR2 A;  1OCT C;  2GIZ A;  1B1B A;  3O8H A;  3BZC A;  3O3K A;  3PFI A;  1HDD C;  1QRY A;  2ESH A;  2OZ6 A;  4L5I A;  1NTC A;  2G7G A;  3TDZ C;  1JJ6 C;  3LST A;  1LKX A;  3DKY A;  4XSX F;  1WQ2 A;  4B3A A;  2OQG A;  2VJI A;  3REO A;  1HW5 A;  3KPH A;  4L62 A;  3SDG A;  1D1C A;  3CP8 A;  2JSC A;  4ENK A;  1B72 A;  5DAJ A;  5HAW A;  2E19 A;  2EFO A;  1JJ8 C;  3QP5 A;  3DBR B;  1W0T A;  3HRU A;  3K70 D;  1REP C;  2EZH A;  2CO5 A;  1WRJ A;  1Z67 A;  2BVL A;  4A3I J;  2ELJ A;  2V9P A;  3U1D A;  2HGC A;  3IKT A;  2K9Q A;  3HUG B;  2L54 A;  2E2J J;  1WKM A;  5IYD J;  3C07 A;  4I76 A;  2PBI A;  1RC9 A;  4RB3 C;  4A3D J;  1JTX A;  3OS1 A;  5D6E A;  1IRZ A;  3CWR A;  5K7H A;  2LY9 A;  3J80 Z;  2IVM A;  1HC8 A;  3A02 A;  2O61 A;  5FLX K;  5FJ8 J;  3BRU A;  1BR2 A;  2W48 A;  4YFK F;  3Q3S A;  3S1M J;  4JBA A;  5JHF A;  2R5Y A;  2OA4 A;  2X1C A;  3CF5 F;  4BE0 A;  1QBJ A;  3HDD A;  2DBB A;  3MKZ A;  2F4M B;  4CYD A;  5K5O A;  1SVL A;  3T1B A;  1MNE A;  4YIR X;  4HF2 A;  1SMY F;  1SFE A;  5CVR A;  1ETV A;  2QQA A;  3CO7 C;  2JUC A;  4HRI A;  3X2Q H;  4IHT A;  1J7K A;  5HSZ A;  3NAR A;  3H3Z A;  3SHF A;  3DBH B;  3EQL F;  1YOV B;  1HKS A;  5L3D A;  4BDY A;  2RV8 A;  2E35 A;  3FXU A;  2UXP A;  2CQX A;  4BH9 A;  3GWZ A;  3DFG A;  3FXQ A;  3RCO A;  2MA3 A;  3BG5 A;  4JOM A;  1FYM A;  3V42 A;  4HNU A;  4QLC U;  5E79 C;  3CME I;  4G94 A;  2Y0S A;  4JKZ A;  3Q9S A;  4OWR B;  3C7J A;  1KON A;  1L0O C;  4EVI A;  3VPR A;  2EFW A;  4HOB A;  3BRO A;  2OJE D;  1YS6 A;  4HLY A;  4KT5 C;  4IQJ A;  1OCZ H;  1H9G A;  1IO2 A;  3MVP A;  5L3C A;  2LD5 A;  1P92 A;  5E17 F;  2YR2 A;  1DGR M;  4M74 A;  1B9N A;  2L5Q A;  1FIP A;  5J3L A;  4AUX A;  1T6S A;  2BW3 B;  4WWC A;  4J00 A;  1PP7 U;  5AIP A;  2NNY A;  3S14 J;  4Y13 A;  5BQT A;  3ML6 A;  3KX2 A;  3OS0 A;  2BY3 A;  5KVR A;  1YTY A;  2L02 A;  2P8T A;  1OJL A;  2QBY A;  1YO5 C;  2YSR A;  2CQ7 A;  1JT6 A;  2DK8 A;  4M72 A;  1XGM A;  5D5X B;  4H4K C;  5M5W J;  3BTJ A;  2FNP A;  1KU3 A;  3L1P A;  4PUS A;  1K79 A;  2QWT A;  2IJL A;  2X6Y A;  2VKV A;  4BQN A;  2JPC A;  3L2W A;  5LGT A;  2PJR B;  3A4C A;  1G3T A;  4XLA A;  5GAD J;  1SFK A;  3WG9 A;  5EEG A;  1ETX A;  1R5H A;  3ZMZ A;  1R5G A;  2B7E A;  2EFN A;  3ZQH A;  5F0C A;  4HX7 A;  1YLF A;  4EGZ A;  4RDU A;  1PDN C;  2MBF A;  4BXU A;  1P4W A;  4M73 A;  1IGN A;  1OCP A;  1YIT I;  1Z3Y A;  5EYR A;  3EPZ A;  2HDC A;  4G8X A;  1BJA A;  2QQB A;  3T6N A;  4EM1 A;  4Y4R A;  3ULQ B;  1CF7 B;  4I99 C;  1PUE E;  2H8W A;  3HOY J;  3T5X A;  2W24 A;  3PIP F;  2CUJ A;  4C2M A;  2DN0 A;  2P4W A;  4FQG A;  4ZZD A;  3CCV I;  1L3L A;  2ECB A;  2FD5 A;  4BHP A;  1JGG A;  1O57 A;  1W5C C;  1TNS A;  2Z2S B;  4XQF A;  4GGG A;  5IP9 J;  3CD6 I;  3A0H C;  3NQO A;  4DGW B;  4M9S A;  2QSG X;  4BHC A;  2N8G A;  3K4L A;  3CLQ A;  1UI6 A;  2BEO A;  5F1J A;  2HKX A;  3SQN A;  3ZPL A;  2DAO A;  4OU0 A;  1MD0 A;  1QHG A;  4D5C A;  1IV8 A;  2D1V A;  1BA5 A;  2RHA A;  3BHQ A;  2A61 A;  4KN7 X;  4U7B A;  4HA8 A;  4M6Y A;  1K4T A;  1B8I A;  1LUJ B;  1U5T A;  2L0K A;  3MZ8 A;  2EZI A;  3GLL A;  5GP9 A;  2HDD A;  1FC3 A;  4ZJZ A;  2LBF A;  2ELK A;  4ESB A;  2YVX A;  5FD5 A;  5HLI A;  4GCL A;  2KZG A;  4FIS A;  4E4H A;  4OIP F;  4HF1 A;  2BY0 A;  1ETQ A;  2G0E A;  2ZOY A;  3ZQC A;  1YW7 A;  3OYD A;  4LLG F;  3SEZ A;  3K7A J;  1W4M A;  2XGD A;  3JW4 A;  1H89 C;  1J75 A;  3H5R A;  2ZNZ A;  4GO1 A;  4HYE A;  4Q5S F;  2STW A;  3VVY A;  3GXO A;  3TOB A;  1VQO I;  3TQN A;  3EUK L;  4E7K A;  4MK6 A;  5HOD A;  1I1G A;  5HOO A;  2R7W A;  5DCM A;  2AQE A;  3KKC A;  3C1D A;  3ZGK A;  3F8N A;  2FQ4 A;  4ZDL A;  3TW7 A;  3OYC A;  2CSO A;  2VQG A;  3HC7 A;  2EZK A;  3QQA A;  1G59 A;  2YX7 A;  1I5Z A;  1PJR A;  2TRT A;  1VQ7 I;  1W5T A;  2AS5 F;  2Y9Z A;  2NNN A;  1IN8 A;  3WGI A;  1VF9 A;  3O8G A;  4IHX A;  2Y48 A;  4AM3 A;  1VND A;  2W25 A;  2ACJ A;  1RIO H;  2L01 A;  3IP4 B;  1EH8 A;  1K83 J;  3K6G A;  3IV5 A;  1GDT A;  3ZMV A;  3FKI J;  2NP5 A;  1HW2 A;  2QM3 A;  4Q4Z F;  2OI8 A;  4BDZ A;  4OIQ F;  1E3H A;  2EK5 A;  2BBY A;  1TP4 A;  3RZD J;  3HOU J;  4EEF G;  3DP7 A;  2CW7 A;  2GUH A;  3SFI A;  5FKN A;  1IN6 A;  1I39 A;  1JKP C;  4L5J A;  2BGC A;  3QYB A;  4GFL A;  1T39 A;  3DPL C;  1UHW A;  2K9N A;  3PNV A;  3J7A O;  3VP5 A;  2OTL I;  3V7S A;  2RKH A;  1RZ4 A;  2GLO A;  2O5R A;  4FX4 A;  2FQ3 A;  5LEJ A;  4KIB A;  1ZRF A;  1LNW A;  4D5F A;  1PP8 F;  1NK2 P;  2PJR A;  1IN7 A;  2JRT A;  2LSO A;  2K4B A;  3CUQ A;  4IKF A;  1UJ8 A;  3W2W A;  1QU3 A;  3QPH A;  2LFB A;  1MMD A;  3JRI A;  2HNH A;  4XOT A;  2Q24 A;  2ESN A;  4HST A;  2LMD A;  4ENM A;  2ZJQ F;  3I0T A;  4WX9 A;  3R60 A;  4BEH A;  1PYV A;  4IL6 C;  5E1X A;  5AON A;  2DPU A;  3ZQI A;  3CQZ J;  1C0W A;  1ETK A;  1WJF A;  4NC6 A;  1E3O C;  4L0Z B;  2PLY A;  2X48 A;  4R8H A;  2FE3 A;  3HSR A;  3F6V A;  3PL8 A;  3R4K A;  3VSL A;  5A2Q K;  1XGS A;  1I6H J;  3FF5 A;  4ZTF A;  3OWT A;  3COA C;  2ZJ2 A;  4Y52 J;  1XSV A;  2JA6 J;  4DOZ A;  3E1S A;  2FBK A;  4AU7 A;  2YU3 A;  2GIV A;  3ASO H;  1V55 H;  5L3F A;  1K78 B;  4UNO A;  2WAQ N;  2XKO A;  3KEY A;  1VQ4 I;  1WZ2 A;  1VZ0 A;  2K9S A;  2R3S A;  4EV0 A;  2IS6 A;  1JHH A;  3ZN0 A;  4BJT A;  3HTJ A;  5J47 A;  4HDU A;  1R1T A;  2CS3 A;  1A35 A;  1FMW A;  2HXI A;  2A3S A;  1ZGW A;  3DU6 A;  2HYF A;  1OQY A;  5HNH A;  2M2E A;  2C6Y A;  3GEU A;  3KEQ A;  4UDS A;  3ZQG A;  5FFZ A;  4KMF A;  5DS9 A;  3HOV J;  3K1P A;  2IT0 A;  1ERD A;  3IWF A;  2XHK A;  1FSH A;  5LBQ A;  3AG2 H;  3D5R C;  3QYE A;  4A93 J;  1YYV A;  3F72 A;  4BEH B;  2HI3 A;  1BW5 A;  4ITV A;  1V5E A;  2HZT A;  5D4R A;  2HKU A;  3V78 A;  4XKV A;  3RDI A;  3K2Z A;  1J5Y A;  4NQW B;  5EG0 A;  1D5Y A;  2KDZ A;  3CCQ I;  2LP0 A;  2LKX A;  4A3C J;  1TW3 A;  1BIA A;  3F0C A;  1YRN B;  4XOR A;  3GLX A;  4TV7 A;  2K9M A;  2R5Y B;  2E71 A;  3G71 I;  2YU9 J;  3K4C A;  1SAU A;  2VUM J;  4FX0 A;  4WXH A;  3LSK A;  2V7F A;  3F8F A;  1Z9C A;  5IT9 K;  1QZY A;  1ZR2 A;  2QKO A;  5C44 J;  1K6O A;  4C3J J;  3S2W A;  5J8C A;  4P1W A;  3ERE D;  3PPB A;  4AD9 A;  5F64 A;  3E5U A;  2V57 A;  3TGN A;  2Y31 A;  3QWL A;  3GFL A;  3K4J A;  4A0X A;  1YS7 A;  2EIK H;  2UZK A;  1TNT A;  5FRO A;  2DO7 A;  4A3L J;  1VQ5 I;  3VEP A;  3EYI A;  2KIF A;  4C3I J;  5F1R A;  3FHZ A;  2OF7 A;  5K58 A;  1I3Q J;  2QIB A;  2IGO A;  3JRG A;  2J5O A;  4KNY A;  2VBZ A;  2V9V A;  3LSJ A;  1WSU A;  3J7Y J;  1T38 A;  5L3B A;  2CYY A;  2EIL H;  2EQR A;  3TOA A;  3CC4 I;  2FOK A;  4E7H A;  4MHG A;  4E7J A;  3S3M A;  2DQL A;  1RR7 A;  4JL3 A;  4N4O B;  4BS9 A;  1NK3 P;  1GLN A;  4KMU X;  2P0W A;  2L9S A;  3CJN A;  1SD6 A;  1Y8R B;  3H9G A;  5KCM A;  2E7W A;  1KU7 A;  1U8R A;  2MC3 A;  3R6S A;  4XLP F;  3JRC A;  1J9I A;  3BG6 A;  2OER A;  2QA4 I;  1DU6 A;  5CKT A;  4XLC A;  2P7C B;  3VWB A;  1VTN C;  3NI7 A;  1HDP A;  4I98 B;  4YEJ A;  1I1S A;  1MNM C;  2H09 A;  3BOQ A;  5F6F A;  3VYS B;  4RGX A;  1LEB A;  3K8P C;  2XF7 A;  2VBW A;  2XB5 A;  5HLH A;  1U9N A;  4RMN A;  1IF1 A;  2COM A;  2W85 A;  1G3S A;  2HVQ A;  3FK7 A;  5JHU A;  2X6X A;  4JX5 A;  4E7I A;  2G7L A;  1YI2 I;  4H0E A;  3F23 A;  3BR1 A;  1PVE A;  3K10 A;  2JA8 J;  4D0P A;  2RAS A;  1Z3X A;  3I54 A;  3TBI A;  3FX3 A;  3E7Q A;  3VOK A;  1B8I B;  3RQ4 A;  5D1R A;  3FXJ A;  2VOP A;  2ZCW A;  3BR3 A;  3LAP A;  2JA7 J;  4Y3O A;  4AID A;  2CV2 A;  2COB A;  2A6T A;  1FY7 A;  4V2F A;  1ZK8 A;  3HOX J;  3BQZ A;  4EJO A;  1T95 A;  2L7K A;  1DP3 A;  3TO7 A;  4MXM A;  1TT5 B;  1XD7 A;  4UUS A;  3GTQ J;  1X1C A;  1TWH J;  1A6Q A;  3HKZ A;  2CQQ A;  2G7U A;  3KYC B;  4LB6 B;  5B1A H;  2Q2E B;  5DD4 A;  5D5U B;  2EIJ H;  3SXY A;  3U2R A;  3JTH A;  4HX8 A;  4OAY A;  2QKL B;  2DYS H;  1ZHF A;  2GXB A;  5IY5 H;  4UB8 C;  2Y2Z A;  4CYC A;  4OAZ A;  2DLL A;  2PFV A;  3CRJ A;  3FMR A;  3HSF A;  4EM2 A;  4GXO A;  2LKP A;  4XK4 A;  4Z2Y A;  2WAF A;  1K61 A;  3GYH X;  1HOM A;  2XRN A;  2DDA A;  1R71 A;  3AG3 H;  3I64 A;  4RM3 A;  5DDG A;  1VQM I;  3E0J B;  5E1W A;  1T0F A;  3BJ6 A;  2D5V A;  2OPT A;  2VAS A;  1T56 A;  2FF4 A;  3A01 A;  5FGL A;  4LB5 A;  4AVP A;  4PJM A;  3JRF A;  1IDZ A;  1MMS A;  3LAJ A;  2KIQ A;  2L7M P;  2CGP A;  4ZZL A;  3AG4 H;  3GME A;  3FXO A;  1XMX A;  3DF8 A;  2V79 A;  3JRE A;  5DD8 A;  3GFM A;  4A6D A;  4G6Q A;  2RQP A;  2P81 A;  2XB0 X;  4MFE A;  2BW3 A;  1OCO H;  3WE3 A;  4F3Q A;  2QOP A;  2PEX A;  4MIM A;  2UUZ A;  5IOY A;  1O3Q A;  1RI7 A;  2QVO A;  2DMT A;  1Z7U A;  1E2X A;  1U0J A;  1N77 A;  1Y56 A;  2WAD A;  5M3M J;  2GWR A;  1Z0X A;  4DIQ A;  2L7Z A;  3ZCO A;  2DW4 A;  2VJ4 A;  1Q1V A;  3T8T A;  4XN0 A;  5CXG A;  2EH3 A;  3OV8 A;  3BG7 A;  2QYO A;  4P5O A;  1MIJ A;  1IN5 A;  2LYC A;  2HYJ A;  3H0D A;  3KNW A;  3PQK A;  4BQA A;  3VW2 A;  2FNA A;  2EB7 A;  2X9D A;  3FIW A;  3OYJ A;  4XKB A;  2V4J C;  1OCC H;  1OKR A;  2ZXJ A;  2ZBK A;  3FZV A;  2DOD A;  2KRC A;  2F6C A;  3I4P A;  1MBF A;  3DTK A;  2DTR A;  4LK0 F;  2VJ5 A;  1V54 H;  4Q48 A;  3GBG A;  2M1B A;  1MBE A;  2IXS A;  4RBO A;  4PK4 A;  2JZY A;  9ANT A;  5FFX A;  1X4P A;  1DU0 A;  4ZDP A;  2KL4 A;  5CVJ A;  2HTJ A;  4G6D A;  4DW6 A;  5M5Y J;  2XF6 A;  1Z6T A;  2H8R A;  3U1K A;  1WJA A;  1XS9 A;  4IVN A;  5HDG A;  2M8G X;  2X0L A;  4I09 A;  2W84 A;  2MD5 A;  1QVT A;  3K0L A;  2JVH A;  3RSN A;  5IP7 J;  1SAX A;  4X6A J;  1W5S A;  2L9N A;  1SGM A;  3OYB A;  2DMP A;  1O3S A;  1RUO A;  1G2H A;  4NHJ A;  1BL0 A;  4HW0 A;  2W00 A;  1ZR4 A;  1H9T A;  1X1P A;  4CCO A;  1YFH A;  2UWM A;  3D0S A;  1BN5 A;  3HUG A;  3HOT A;  2PQ8 A;  3MD2 A;  2QCO A;  5K5R A;  3M1E A;  3O60 A;  5M3F J;  4FCY A;  1OR7 C;  1VQL I;  4CCJ A;  2CW0 F;  4M9Z A;  1R5I D;  2H6B A;  3QPT A;  2DFE A;  3I53 A;  4PFO A;  4CO8 A;  3FKJ A;  1U78 A;  4BAY A;  5GAE J;  1RKT A;  2E1N A;  2KFD A;  4LD5 A;  1BC7 C;  2IGM A;  2GZW A;  5ICF A;  3MKL A;  4CUG A;  2ZY9 A;  1X19 A;  4HX4 A;  1ORK A;  3HGG A;  5HDK A;  1LFU P;  2D1H A;  3BCB A;  3FM3 A;  1ZRC A;  4RAZ A;  4OMZ A;  5CQE A;  3MKW B;  3FBI B;  3ZOB A;  2QTQ A;  2Z33 A;  3DKX A;  1S29 A;  3W6K B;  2DFH A;  4I2O A;  3FBN B;  4IOC F;  2DT7 B;  2Z5U A;  2NYX A;  2FBQ A;  1IJW C;  3PM1 A;  2ME6 A;  1XC5 A;  3S8P A;  5JLX A;  1LE8 B;  2JQ7 A;  4BL0 B;  3OSF A;  3ZQ7 A;  1W7P B;  3IH2 A;  1S5L C;  2F48 A;  4XSZ F;  2KIS A;  1A5J A;  3HOZ J;  1R23 A;  2E1C A;  3EUP A;  4S04 A;  2HPI A;  4FTH A;  5C4Y A;  1B59 A;  4D1Q A;  4OIR F;  3G4S I;  2PFB A;  2VC1 A;  3CJD A;  1FOW A;  2OV7 A;  1NHA A;  5TJJ A;  4U87 A;  2EPF A;  4C2M J;  1QGP A;  3DBL B;  2DK5 A;  3BG3 A;  3CCL I;  2ZXH A;  2LR8 A;  4RM2 A;  2R7V A;  2PI0 A;  5IP6 A;  1P4A A;  3QYF A;  3DEU A;  3RQI A;  4BU2 A;  2VI6 A;  2CW8 A;  4MEY F;  3RIR A;  3Q5F A;  1UHS A;  3ABL H;  1FIA A;  3WU0 A;  4E7L A;  1OLT A;  4XLN F;  3SWH A;  1R7J A;  1TT0 A;  3H3U A;  2ZXW H;  4MTE A;  1TQI A;  5H6R A;  4A0Y A;  4IX7 A;  2KZV A;  3KP2 A;  3OL4 A;  2W4S A;  1QPM A;  4OIN F;  4G7O F;  4B09 A;  1UMQ A;  2EIN H;  2J5P A;  5ILU A;  1MSF C;  4C3H J;  3CUQ C;  2BY1 A;  2QQ8 A;  1FT9 A;  4RS8 A;  3J81 Z;  3M9A A;  1MJB A;  1W7P A;  2EA4 A;  2L9V A;  1E17 A;  2ZSH B;  2IBD A;  2BY2 A;  5CPR B;  1JTY A;  2YVE A;  2VBX A;  1XGO A;  4E6K G;  2HZD A;  3QP6 A;  1HSJ A;  3ZMU A;  2L4A A;  3I4M J;  2UXO A;  1SD7 A;  4ASN A;  1X2N A;  3OYE A;  4EMS A;  4IRI A;  2QEN A;  3LSG A;  2YVH A;  5JLW A;  2P5V A;  3OL3 A;  4YII A;  2QZ8 A;  3ELK A;  1QPI A;  3QOP A;  2A05 A;  2UXH A;  1YX3 A;  4PZJ A;  2RGV A;  4PXI A;  2XRO A;  2A69 F;  4ABZ A;  1ZQ3 P;  3IRR A;  3AQS A;  3WHB A;  2M45 A;  4M6X A;  3EGQ A;  2K7L A;  2BHZ A;  1T33 A;  2XPV A;  4QTR A;  2W1O A;  1ZLJ A;  2FRH A;  1AKH A;  2ZKZ A;  1TC3 C;  5K1Y A; 
#chains in the Genus database with same CATH homology
 2GLO A;  4I6Z A;  5EZG A;  2O9L A;  1FTT A;  3HE0 A;  1UG2 A;  3COL A;  1X2M A;  3I4N J;  1ITY A;  4D5F A;  1NK2 P;  3ANG A;  2FJ1 A;  2NVX J;  1TWC J;  3CCY A;  4HNV A;  5EDN A;  5E3L A;  2XPW A;  2LFB A;  3JRI A;  2D6Y A;  2Q24 A;  1YRN A;  3JRH A;  3DCF A;  5EEA A;  1Z77 A;  4ICH A;  1IDY A;  3TED A;  2WV1 A;  3GTP J;  3LHQ A;  4BBR J;  3LNQ A;  1GV5 A;  1ETY A;  3B81 A;  3ZQI A;  3CQZ J;  3C2B A;  1ETK A;  3JRB A;  4JX4 A;  3HKZ N;  4A3G J;  2ZOZ A;  3HGY A;  2JWT A;  1E3O C;  5F08 A;  2R7Z J;  2GFN A;  2X48 A;  4MO7 A;  2Y0S N;  2NS7 A;  2ZCN A;  1I6H J;  2JN6 A;  5F0F A;  2CUE A;  3BTL A;  3PO3 J;  4Y52 J;  1LFB A;  4DZJ A;  2JA6 J;  1WI3 A;  2VKE A;  1F43 A;  3FIS A;  3GTM J;  5EZH A;  2ID6 A;  3M4O J;  3JR9 A;  1FJL A;  2CUF A;  2WAQ N;  3MN2 A;  2M34 A;  4ACI A;  3QBM A;  2K9S A;  3VOX A;  3HTJ A;  2R0Q C;  5CW8 A;  2GBY A;  2B63 J;  3IUV A;  2TCT A;  2CRG A;  2H1K A;  2HXI A;  3A03 A;  1APL C;  4DYC A;  1GUU A;  1ZGW A;  1S7E A;  4A3M J;  3BTI A;  2M2E A;  3GEU A;  1P7I A;  2FX0 A;  3BG9 A;  5F04 A;  1IG7 A;  4UDS A;  2CU7 A;  1Y1W J;  4XID A;  3TP0 A;  2E2H J;  3ZQG A;  1RES A;  2NS8 A;  5DS9 A;  2E2I J;  3HOV J;  1WCM J;  3IH4 A;  3S1R J;  5FMP A;  4BBS J;  2E1O A;  2Y9Y A;  3HTH A;  4A93 J;  1BW5 A;  2HI3 A;  4AYB N;  3Q0W A;  2HKU A;  3HTA A;  3RH2 A;  3V78 A;  4X1E A;  2XDN A;  2IAI A;  3RZO J;  5EG0 A;  1D5Y A;  2KDZ A;  2JA5 J;  4DYR A;  2ID3 A;  3Q0V A;  2XSD C;  1Y1V J;  2LP0 A;  4AC0 A;  1JKQ C;  2LKX A;  4A3C J;  2EZL A;  1EF4 A;  2DA3 A;  3F0C A;  5FKM A;  5EGO A;  1SFO J;  1GT0 C;  1YRN B;  3S17 J;  5AQC A;  2DMQ A;  4XIC A;  2R5Y B;  2ECC A;  2YU9 J;  3BQY A;  5F0H A;  1IC8 A;  2VUM J;  3VIB A;  4HKU A;  4BXX J;  1MH4 A;  5K7F A;  1ZR2 A;  2QKO A;  5C44 J;  3D1N I;  2MG4 A;  4XRS G;  3G1L A;  4C3J J;  2XPU A;  1H88 C;  3VVZ A;  4GCK A;  3PPB A;  2NVQ J;  4IHW A;  4JNN A;  3DEW A;  2V57 A;  4CGR A;  5E3O A;  1RET A;  2Y31 A;  4A3B J;  4DYQ A;  2R5Z B;  3H0G J;  4GFK A;  4A3L J;  1JT0 A;  3OOU A;  4C3I J;  5K58 A;  2OF7 A;  1I3Q J;  2QIB A;  1ZKG A;  3JRG A;  2YUS A;  3S15 J;  1ZTR A;  3LSJ A;  2R93 J;  4XRS A;  1BW6 A;  2EQR A;  3HM5 A;  4DZP A;  4M3E A;  1RR7 A;  4JL3 A;  2DTZ A;  1NK3 P;  1R9T J;  4L5E A;  2DA1 A;  2NOG A;  1A6I A;  3BJB A;  3E7L A;  3JRC A;  2ZCX A;  2OER A;  3VW0 A;  4A69 C;  1DU6 A;  2LLK A;  2L7F P;  4IEJ A;  5IYC J;  3Q0U A;  2NX4 A;  1HDP A;  3NI7 A;  1AHD P;  1MNM C;  2XB5 A;  1U9N A;  5GPC A;  4M3G A;  3LWJ A;  3FK7 A;  4D7M A;  4B1R A;  1TWF J;  4JX5 A;  1SAN A;  1X58 A;  3V6G A;  1O4X A;  2G7L A;  1WGX A;  5IPA A;  3LJL A;  4QSH A;  3BR1 A;  2JA8 J;  1B72 B;  3W6V A;  2RAS A;  2AHQ A;  3JSJ A;  1JUM A;  3E7Q A;  3VOK A;  2IU5 A;  1B8I B;  1TWA J;  3NPI A;  5D1R A;  5C3E J;  3KZ9 A;  3BR3 A;  2JA7 J;  5E3M A;  4M3F A;  2COB A;  3TW6 A;  2M9H A;  1W0U A;  2G3B A;  1TWG J;  2QF7 A;  2HXO A;  5FLV A;  5IOZ A;  4V2F A;  1ZK8 A;  3HOX J;  2W53 A;  4UUS B;  2LTP A;  3NAU A;  3BQZ A;  1UI5 A;  2I10 A;  5D18 A;  2AO9 A;  3G1M A;  4D7N A;  2O8K A;  2DG7 A;  1OFC X;  2M0C A;  4MXM A;  3BR2 A;  1OCT C;  4UUS A;  3GTQ J;  1MBH A;  1TWH J;  3S2D J;  2HYT A;  2CQQ A;  5FLM J;  3O8H A;  4M6V A;  4ME9 A;  3AQT A;  1HDD C;  1QRY A;  2DMU A;  1NTC A;  4MFD A;  1FEX A;  2G7G A;  1JJ6 C;  4GCT A;  2Y30 A;  5HBU A;  2HOS A;  2O7T A;  2Y2Z A;  4CYC A;  2KT0 A;  4B3A A;  4L62 A;  3SDG A;  1MH3 A;  5J1Y A;  1B72 A;  3CRJ A;  5DAJ A;  5HAW A;  2E19 A;  4XK4 A;  1JJ8 C;  4B4C A;  1K61 A;  1W0T A;  3B6C A;  1HOM A;  2EZH A;  4NDL A;  5C4J J;  4A3I J;  2VPR A;  5E3N A;  2D5V A;  2OPT A;  2K9Q A;  1IUF A;  5F27 A;  3KKD A;  1T56 A;  3A01 A;  2E2J J;  5FGL A;  1JUP A;  5IYD J;  3C07 A;  4M3D A;  2XGE A;  2ZB9 A;  3JRF A;  4I76 A;  1MBK A;  1IDZ A;  4A3D J;  1JTX A;  2MSY A;  2L7M P;  1IRZ A;  3CWR A;  3WHC A;  5K7H A;  2LY9 A;  3A02 A;  4A3E J;  3FK6 A;  4LOC A;  3JRE A;  5FJ8 J;  5DTD A;  1FTZ A;  3BRU A;  2W48 A;  3S1M J;  3Q3S A;  3G1O A;  2P81 A;  2K40 A;  2R5Y A;  4W97 A;  3LSR A;  2XB0 X;  4MFE A;  3HDD A;  2QOP A;  3GTG J;  4QIW N;  4MIM A;  5IOY A;  3M3Y J;  3HIM A;  2DMT A;  5FKO A;  3ON2 A;  1QVU A;  3S1N J;  1ETV A;  3PAS A;  3OSG A;  5M3M J;  3GTL J;  2WUI A;  1Z0X A;  5J1R A;  2L7Z A;  3NXC A;  1BJZ A;  5HSZ A;  3NAR A;  3SJM A;  1Q1V A;  3HB9 A;  2YS9 A;  2UXU A;  4YZE A;  5CXG A;  2EH3 A;  3BR5 A;  4FE7 A;  2XGC A;  2UXP A;  2CQX A;  2HYJ A;  1U9O A;  3KNW A;  4BKX A;  3BTC A;  1HLV A;  3VW2 A;  3VVX A;  2X9D A;  3QKX A;  3FIW A;  5CXI A;  1ENH A;  5J1U A;  1AU7 A;  3BG5 A;  3G56 A;  3OIO A;  4JKZ A;  4A3K J;  3ON4 A;  1MBF A;  5FKK A;  1HF0 A;  1F36 A;  3VPR A;  3NNR A;  5M5X J;  2O7O A;  3GTK J;  3GBG A;  3HEF A;  4BY7 J;  5EGO B;  2NVY J;  1MBE A;  5IYB J;  3PO2 J;  2LD5 A;  3MVP A;  3UKG A;  1I50 J;  1XG1 A;  4RBO A;  4NN1 A;  3F1B A;  9ANT A;  1FIP A;  5J3L A;  3ZQF A;  4AUX A;  1DU0 A;  5K7Z A;  2DA7 A;  1JKR C;  4MLO A;  5EF6 A;  4DW6 A;  5M5Y J;  3S14 J;  3LOC A;  2H8R A;  1XS9 A;  1VI0 A;  2M8G X;  3BT9 A;  1QVT A;  4KWA A;  2RAE A;  2MGQ A;  4JP0 A;  4Y7N J;  1OJL A;  5IP7 J;  4X6A J;  3CMY A;  1SGM A;  3IH3 A;  3VP5 A;  1LE8 A;  2DMP A;  3ANP A;  1G2H A;  1JT6 A;  2XRL A;  5FHP A;  1BL0 A;  5M5W J;  4M3B A;  3BTJ A;  1ZR4 A;  1MSE C;  3L1P A;  3BNI A;  3RD3 A;  5GPA A;  2QWT A;  3A01 B;  2VKV A;  2DA4 A;  2PMZ N;  3HBL A;  1CQT A;  2QCO A;  3O60 A;  5M3F J;  2WGB A;  2PBX A;  4FCY A;  2HOA A;  4S0H B;  1VFC A;  1ETX A;  3ZQH A;  2GM4 A;  5F0C A;  1RKW A;  1ETW A;  4RDU A;  2ME0 A;  1AKH B;  1MBG A;  1IGN A;  4CYC B;  1OCP A;  1U78 A;  3QPL A;  1RKT A;  5EYR A;  3QPS A;  3TP3 A;  3T6N A;  2JMW A;  3MKL A;  4JYK A;  3HOY J;  3P9T A;  1LFU P;  1ORK A;  3HGG A;  3K2A A;  3S16 J;  3HOW J;  2DN0 A;  4W1U A;  2ECB A;  2FD5 A;  1JGG A;  2F07 A;  3ZOB A;  5IP9 J;  2QTQ A;  4FE4 A;  2FBQ A;  1IJW C;  3PM1 A;  2PZ9 A;  2UXI A;  2ME6 A;  1XC5 A;  2N8G A;  3B6A A;  5JLX A;  1UI6 A;  1LE8 B;  3OSF A;  3JRD A;  5F1J A;  2DA5 A;  3IH2 A;  4AF5 A;  4D5C A;  2CJJ A;  4G12 A;  1BA5 A;  2RHA A;  2DG8 A;  1H8A C;  4IHY A;  3BHQ A;  1A5J A;  2DA6 A;  3HOZ J;  2ZCM A;  3EUP A;  4FTH A;  4J19 A;  1GV2 A;  4A3F J;  5C4Y A;  1WH5 A;  1MBJ A;  4A3J J;  1B8I A;  3CJD A;  2L0K A;  2EZI A;  5GP9 A;  2HDD A;  3S5R A;  2HQ5 A;  4C2M J;  3H3V K;  2R92 J;  2DA2 A;  1GVD A;  1POG A;  2ELK A;  3BG3 A;  4IHV A;  3HTI A;  3RKQ A;  2LR8 A;  4GCL A;  4FIS A;  2REK A;  3GTO J;  5IP6 A;  1ETQ A;  3RQI A;  1HCR A;  2G0E A;  1P7J A;  4JX6 A;  2VI6 A;  2ZOY A;  3BR0 A;  1IV6 A;  3ZQC A;  2WB1 N;  4V2G A;  3CDL A;  1UHS A;  3K7A J;  3DPJ A;  1JUS A;  2XGD A;  1FIA A;  2L9R A;  1H89 C;  2HOT A;  2DMN A;  1PUF B;  2NP3 A;  3VVY A;  5FKL A;  3MNL A;  3FRQ A;  1WPK A;  2LVS A;  4MK6 A;  5HOD A;  5EFY A;  4XRM A;  3KKC A;  2G7S A;  2FQ4 A;  3TW7 A;  1UMQ A;  2NVT J;  3QQA A;  2EZK A;  1MSF C;  4C3H J;  2IEK A;  3S2H J;  2EBI A;  2TRT A;  2MW8 A;  2Y9Z A;  1RPW A;  1VF9 A;  3O8G A;  3LSP A;  3ZQL A;  2DJN A;  2IBD A;  4IHX A;  1JTY A;  2YVE A;  5C4X J;  1VND A;  2JJ7 A;  2X6O A;  2LK2 A;  4BY1 J;  1K83 J;  1PUF A;  3IV5 A;  1GDT A;  2NP5 A;  3FKI J;  5EG0 B;  5BNG A;  3I4M J;  2OI8 A;  1WH7 A;  2JK3 A;  4UUT A;  2UXO A;  3JRA A;  2GEN A;  1X2N A;  1ETO A;  2R5Z A;  3LSG A;  3RZD J;  3VW1 A;  5JLW A;  2YVH A;  4GFB A;  3HOU J;  4EEF G;  1QPI A;  2UXH A;  1JKO C;  4NEL A;  3VUQ A;  4PXI A;  2GUH A;  4ABZ A;  3SFI A;  5FKN A;  1ZQ3 P;  3AQS A;  3NRG A;  3WHB A;  3S1Q J;  1JKP C;  3EGQ A;  5D19 A;  3BR6 A;  4GFL A;  1T33 A;  2XPV A;  1U8B A;  4QTR A;  3G7R A;  1AKH A;  1TC3 C;  4AC6 A;  3BCG A;  5H9T A;  3GZI A;  2K9N A;  3GTJ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...