3WHE0

A new conserved neutralizing epitope at the globular head of hemagglutinin in h3n2 influenza viruses
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
212
structure length
212
Chain Sequence
SVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYAVHWYQQLPGTAPKLLISGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved Neutralizing Epitope at Globular Head of Hemagglutinin in H3N2 Influenza Viruses.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 35
structure length 212
sequence length 212
chains with identical sequence 2, 4, 6, 8, N, P, R, T, V, X, Z
ec nomenclature
pdb deposition date 2013-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whe002
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whe001
2EC9U 3WS3B 2YHGA 1DEDA 2D7OA 4O4YL 1JWSA 2PXYB 5BO1L 1U8PB 2WWMD 1MLCB 1N2RA 4C58B 3TP4A 1JCKA 3ARDD 4QXUH 1CLCA 1ORSA 3QSKB 1FBIL 5E2VH 3EYQC 1G9ML 4JJ5A 1F6FB 1U8LA 1MRDL 5D6CA 4OLYL 3TPUB 3D2UB 2NY5H 4UBDD 4QGTA 2Y7QB 5FA3B 3VRIB 4LLMB 5IFJA 5T5FL 5F1NA 4GUPB 1G6RL 3QA3A 3GJFK 5JNYB 4FFZL 3O2WH 1U91B 3V0VA 3RIFK 4JHBA 1FH5H 3BX7C 3T2NH 2ZKHL 3F7YB 5ALCH 3QEQA 1I9JL 3CH8A 4NCC1 2VO5A 1JTOA 2MHAA 3FQXB 5IVXE 5INDA 3OF6A 4NHUA 4RDQF 5HVWA 2R0LH 2JK5B 4WWKB 1MH5B 3QIBC 5GGQL 4D0DA 4H0IA 2QSTA 4U1GB 5IMOA 4XCEB 4RX4D 3RDTC 5E6IA 1D6VL 1WBZB 3WE6B 1WAAF 5CBAB 1QBLL 2O5YL 4MQ7B 1P69B 4R4ND 2CSPA 2NXZC 5HYSA 2LAGB 4MVBC 2CLVA 1CZ8L 1OP3K 4X7DC 5MP6L 1DQDH 5C0BB 3V5DA 5CILH 1G6RH 2G5BA 1G9NH 4QRUB 4YBLB 3T4YA 4DFHA 3MV7B 4AIZA 4MA7H 1G1YA 4KMTH 3ZDXE 4MAUL 4E42A 5T1KB 3MRHA 4M5YL 1OAXL 3T1WA 5DT1H 3V6FA 1D6VH 2J8UB 5AZEH 2E27H 4ZO9A 1MAML 1NMBL 1PYWA 1AR2A 1E4KC 4I0PD 5BW7A 1MUJA 1XGPB 3BT2H 4JY5L 3A6BL 4G42B 3VRLF 1N2RB 2VR4A 1KCVH 4KUCD 3FZUD 4HDIB 1T0MB 4HS3A 3VD9A 4WW1B 4MAYB 3MGAA 3W2DH 5D7LB 3KPSA 4GW1B 1ZLUH 3IXAA 1A1MB 1MCEA 5I8EB 3DETD 5FUOH 5F6IB 5JW4Q 4OD1H 3TT3H 4JM2B 4TRPL 4LCIL 3WUWB 1T2XA 1EGJH 2I07A 4CNIA 3S37L 1KEML 1VFAA 4L8SB 1KBGH 1D5BA 4EDWL 1ZLSH 3U30B 4OTXH 2GT9B 1VADB 3DRTB 5CP3A 2F58H 2ADGA 5HHPA 2AJYH 2AK4E 1DBBL 2HVJB 5TFSL 1BF2A 4Y5VC 5T3XH 4KZDL 3VH8G 1BFSA 4ODXA 4GJTB 4Z9KB 4N8VA 1X6LA 5F7LB 2J8UF 1N3NA 3VXSA 1FFPB 4HSQA 3LIZH 1IC5H 4WI5A 5BS0B 1FH5L 1WC7A 5B38G 3BO8B 5EORH 2CDEA 2VR9A 4LEOA 3O8XD 2O5XL 3EOYG 4OZFB 4NPYB 5HGBA 3LV3B 4JJ5B 4DN4L 2YSSA 4CRPA 2AEQH 2E7LA 1YEHH 4EDWH 5J1TC 4Z5RB 5EIVA 5JXED 3CK0H 1JZ8A 1I75A 3O2DL 1KIRA 4L8BB 2XQYG 5E9DB 3OAUL 2NX5B 3B9KA 2OYPA 3B8SA 5JQHC 4JPKL 1YQVH 1T04B 3PHOB 4QXWA 1AGCB 5BXFB 4HPOH 1HYSC 5FEBA 5IP4A 3VFRA 5D1QC 1JRHH 5JW3H 2B7DT 2G60L 4NJ9L 2XPGB 2R0KL 3CZFB 4GXVH 3DUUB 2FR4A 1F4AA 1C16A 2YA0A 5DDHA 4BM7A 5EBMB 2BNQB 3S3JA 3MUGA 5HI3D 4Q58C 4M7KL 2MCG1 3KPRB 5DSCA 1ODAA 4S1QH 2YD1A 2FH8A 2JB6B 2WBJC 4PJEA 1MCFA 1ZLWH 3BQUB 5E5MA 2EO9A 5CEYA 2VXVH 1II4E 1UM6H 3ARBD 1DP0A 3O9WC 3U36A 5GXBB 4LRNH 3TF7C 5D5MF 1KJVA 1BJ1J 1PG7W 2LE9A 2ARJA 5E1HB 1XH3A 3LKRA 1W0YT 4EN3D 4QRPE 2ADGB 1GGBL 5IUSA 2E7LC 1UA6L 4DGVL 1TQBB 1HK6A 4HUVA 3R0NA 5IFHH 4JLRB 3I75B 3B83A 4XHJC 4PJ5D 5L2KD 1IEAA 2UZIL 1FFPA 5AD0B 1IAIL 5F1KC 1FLRL 4U1NB 3O11A 15C8H 3KYNA 3MLRL 4P2RA 4JHWL 4Z76B 5EO9B 5C7XH 5IV2A 1I7UB 1ZHBB 2XT1B 4MNGA 2NXYC 1X7QB 1JYWA 4JY6B 4UDTB 3KGRA 2OXGA 2JCCB 3T2OA 4LP5A 4QXGH 5IEHA 1MI5D 4BH8A 1F5WA 3HG1B 5DZNA 1YMME 3GNML 2XKUA 1R5VA 1JF6A 3WXWL 4ODVL 5I75C 3CFBB 3OBAA 5KTEH 2F54D 3QUXD 4P5MB 5FHAL 4KGLA 2VL4A 1BQHB 1MF2L 3ZE0E 4KKAC 5DD3H 1T66C 2X44D 2NZ9D 5SWQA 2BJML 2PF6A 2HN7B 2VH5L 2BXZA 5JXAH 4X9IA 4JO2H 5CD5C 4F80A 4NN5B 2BVYA 2ORBH 2CO6B 3MXWH 4FQLH 2EYTA 3QNYB 4PJDE 2QQLL 3LQMA 3DTXA 2MSPA 3DUSB 3PWLB 5F3HB 5I76B 4X4ME 5C0FA 3UTSD 4WO4B 5JPNA 2C26A 3H9SD 3I2CH 5CLWA 1O0VA 2YD9A 1I85C 4U2YA 3CMOL 4V1DA 5HYIA 1P4BL 4MAUH 1SYVB 1SQ2N 1T7YA 2A9ML 1AC6A 1IJ9A 4I5BA 4G6AC 1TMCB 3T65B 3GMNB 2Y25A 5DVOA 5C6TL 4OSUH 1A5FH 3ULUF 5KSAA 3QDMB 2AGJL 2VXUH 5AAMA 4BFBD 1J11A 3BH8B 1FDLL 1TZHB 2CJUH 1GZQB 4J8RB 4HAGA 4XCYA 1D9KC 4JFDA 1E28B 3MLSL 5FM5M 1Q38A 5D2LE 3ZKXC 5DJ2B 4A6YL 5GS0C 4MJ5B 3G9VA 2BY2A 2PO6C 4L8DA 1K4DA 4KDTC 2WAHA 3TVMA 2YD8A 4Q6IB 1P9MA 3ZE2E 4JFQB 1PX4A 3X12B 4GO6B 3R1GL 5I30H 2DQGH 3BZDA 4X80H 5FKPA 5IFAH 3FT4A 5JXEA 2A38A 1BFVH 4QHLB 1A7QH 1RUPH 4HV8B 4NYLB 1A47A 3ILPB 3VFGH 3W81A 4YZFE 3MV8D 3Q1SH 3KJ4B 4HIHB 5BV7C 3T1FB 3IU4L 3LRGA 2EDDA 2FL5B 1OTSC 2X4OA 3QPQC 4OLZH 3S96B 2VN4A 5F7DA 2OJZH 4OQ1A 5TJWK 2W0LA 3B4NA 1G7JA 4IEFB 2OQJB 4Q2ZB 1LP9A 2YUVA 1R24A 1I9IH 4X6FA 1H3PH 4JGMA 1JGEA 4QHKJ 3CLEH 5MENA 4NKMB 1JV5A 3DWTA 5IT2H 4ZXBB 1JIBA 3O2VH 3QQNA 3AM8A 3LS5L 4L3CB 4OCMC 4PLJD 2NY3D 2VDPL 4NJAL 1FVDA 4P2RD 2EE6A 3O3AB 3QCVL 4AMKH 1IVLA 1G0YR 3RVTD 1KIPA 5FO9B 3NCYS 4AEHL 3OJVC 2V5YA 4N90D 4R7DA 3BH8A 1GC1C 2OXHA 5C2UB 3BXNB 2YN3A 2P45B 1T7XA 4JG0H 3ZKMC 2P5EE 1V05A 1U91A 3RWJB 3HB3D 1TETL 5FYKL 2A6JA 2W9DH 1A3LL 4ZMAT 1MFDL 2OR9H 2DM7A 1ACYL 4D9LH 1AI1L 2GK0A 1EEYB 3PDGA 3V4PL 1J8KA 1NCUA 4JAMB 2R29H 3QUZA 5C0DB 3VXNB 1A6UL 3PGFL 2XZAL 1ZS8A 4DW2L 1U58B 4G8IB 4PJHF 4ZFFB 3CGTA 4QHLA 4BUHA 1KSRA 3RWCA 3C5ZB 1I3VA 3NIGE 2P5EB 3BIKB 3O8XA 2LAAA 2IG2H 4G6KH 1G0XA 5DD1L 1S7WB 4N0FA 3T0DA 5I1IL 3MRDA 1JHTA 3KXFD 4LKXA 1B2WH 2W9EL 1FO0H 1LO2H 2YZ1A 1A6TB 4QGYA 3W82A 4H8WC 3MXVH 4H25A 4HZLB 3HZVB 3LPFA 1FZJB 1BHGA 3O3EB 1EH9A 5FYKD 3SY0B 5C0RL 4LCYA 4U1SB 3BKJH 3I6KA 1L6ZA 1VEMA 4S11A 4KTEH 5DVMA 3OAYK 2GEEA 4G43A 1J87A 4RMUA 2ZJSL 3LKQA 2P8LB 3X12A 3BMWA 3QIUD 5D7LA 1QLRB 1EDQA 1HQRA 5IESL 3C6SB 4WHYG 5JR1H 4ZS7H 2VH5H 5GGSA 4RMSA 3OQ3B 2IAMB 3P0VL 3V52L 4FTVB 3QQ3A 1JYNA 2FJFA 2P8PA 2FJGB 2ZP0T 3DV6A 2FLBT 4P4RA 3EAKA 4XP5L 2NY4D 4HK0B 3VE0A 3MUJA 1IKNA 2A6KB 3S5LA 4H26B 1MEXH 4MCZB 4PJXF 5HHOE 4MJIE 4HT1L 1DUYA 3GHBH 5EOCL 2J12B 3BPCB 4NQCD 3VXRB 1UQSB 2Q6WA 1BP3B 5TQ2H 1EEZB 4XCCH 1C5DA 6FABL 3KYOB 1CE1L 3EJYD 4ODXB 2LV4A 2DBJA 3IFPB 1P7HL 4M5YH 1XGTA 3MJ9A 4N8VG 2IFGA 1ZS8B 5CKAA 2P5ED 2H6PB 2R8SH 2WUBL 1EXUA 3Q5OA 4YPGB 3GSQA 4YHYB 2GW5A 1YMMD 2B0SH 1FBIH 1I8KA 4G8FA 3ZYIA 4LOUD 4ONFL 2BHZA 1Q8MA 4K9EC 3WNKA 2NY5L 3HG1D 5GIRB 2AK4A 4LHUD 4M1GH 4R4BB 4OGAD 4AG4L 1HHKB 1RHHA 4LSPH 2G75A 2R39A 4PJ8C 2KH2B 3A67H 1O7SA 2AK1L 1TTUA 2P4AB 3MRCB 1RULL 5JHLH 1OAYH 3HUJF 5BXFA 1A9BB 4PB9L 4OZIF 3KPSE 2V5TA 5DVKA 4KTDL 4TQEL 4M7JH 2CH8A 1CQKA 43CAA 1XAUA 2ZNWA 3LH2H 1FL5B 4JCMA 1S8DB 1RUAL 2B0SL 3L6FB 2MQ0A 3NA9H 4NNPL 4XP1L 3FFCB 3CVHH 1RZFL 1TVBB 2FSEA 5BRZB 5T1KD 1YEGL 1JZ6A 5ELIA 3MRQA 3KDMB 3JTTB 4YGVB 3SN6N 1CLOH 1KACB 2VLKD 3DLQR 1PY9A 3A0OA 5LG1A 1CD0A 3N0PB 1PBYA 1SBBA 2NY2D 1IILE 3T0BA 3TV3H 3WBDA 3CFEA 4X6CB 3H3PH 4JFYA 4MX7A 5E4EC 4DUWA 4FN0A 4E41A 4PJAF 1U8QA 1Q0XH 3D87B 3U7WH 4K23L 2HFEB 4HS8H 5I17B 4OCNC 1UWXK 4LLWA 1T3FB 2CKBH 4PRDA 1CL7L 3NTCL 1SEQL 1PD6A 2BNRB 3BT2L 3CCHA 4QCIA 4MHHI 5D2NE 5A2IH 2LFGA 3OKNA 3C8HA 1CDYA 1L0QA 1P4LB 1F4XH 3QHFH 4C56D 2QR0B 3S5LG 2P1YA 3OG4B 3EJJX 5IKCB 2GTWB 4XAWL 2EDRA 4WDIB 4MDIA 1F4WH 1HHJB 4HUUA 4OZHA 4TVPH 4LLMA 1C8PA 3EGSA 4ISVA 2CUMA 1S7SA 3C8DA 3D2UA 1P7QA 1Y0LB 1HHKA 1BQHA 1ZK9A 3LQAH 4WWKD 1T7WA 5DJ8A 4DK6A 5IR1A 1KBGL 35C8L 5SX4H 3OR7A 4DAGH 4O9HH 3VA2C 4YAQA 3EO0B 3X11A 3IRZA 2Z31C 5IBLC 4ZTPL 5K9KB 4PUBL 2CLRA 3L5HA 1HYRC 3SKMA 5C6PB 4OLVH 4G6FB 3UXFA 3T0EB 3CFCH 3PE9A 4FNLH 4IOIA 2NY6B 5CJOL 3W0WA 3RWGA 1KENH 2QJDA 1W8NA 3HE7B 3W9EB 3JXAA 4AY0A 1UWGL 3L9RA 5IHZB 3GSRA 5I8CA 5IB1B 1CS6A 3ARRA 4XP6L 4OCWL 2KKQA 4PTUB 1BJMA 3WD5H 3P4NB 4LF3A 4JEGB 3GO1H 4RZCB 5DD5H 2VRAA 1WLHA 3P9WB 4NDMA 5CP7A 2V2XA 4KJPC 1KC5H 3O6FC 1CICC 1QRNA 2CPCA 3B5GA 3NZ8B 4RGMB 1AXSA 2BNQE 4LLDA 3RBGA 5L7XH 4PRDB 1IAKA 4OLUH 1MAKA 1S7RA 2X10A 3M17B 1CGTA 5JOPE 2E7CA 1R3JB 3L5IA 1JRHL 5BRZD 5JW3L 3TESA 4Q6IA 2VLRE 3SE3C 3UO1L 4A2MA 4F9PC 5CD3B 4DZ8B 2K9UA 5F7HA 4PRNB 3G5ZB 1N6QL 2FATL 3GJFH 2JE8A 1NMCC 3STBA 4HEPG 4O2CB 5FUOL 4HG4J 3KDMA 4KHXH 3OHXA 4U4BA 4ZPVB 4XWGH 2EIZB 3V6OE 4AH2B 3MBXL 5F93C 1QUNA 5TQ0L 3WN5A 2FCBA 5ID0B 4KKBC 1J1OL 1BEYL 1GGCL 2GFBA 3ME0A 4LDEB 1KXVC 5KVMC 5IQ7L 3BZ4B 4JO4L 4X6FB 3TA3A 3HB3C 1BBJA 2HFFA 4AL8L 1FSKB 4ZSOA 4LMQI 4NZUH 4WI6A 4GAJH 4ZTOH 5JW5A 5IVZB 2EH7L 5CJBA 2A2QT 2N7BA 2XA3A 5I1CL 3OB8A 2YD2A 1CICA 4RWYH 1LE5B 3S35X 5CCKH 1MPAH 3LSOB 3U0WL 3D9AH 4KKAD 5EO0A 1U36A 3WS6C 4A6YH 1FYHB 1QG3A 5HHVL 4PYHA 2HT3D 3AS0A 5IHZA 2B4CH 4U1JB 2B4CC 1BQLH 3IFNL 3MR9A 1ULVA 3WXVL 5JDJA 3R1GH 5DUPL 1BIIA 1RZIB 3PP4L 3VXUA 4WO4D 3C2AL 4RCAA 1QLEH 3HPLB 3IVKB 3ECBA 5FUCE 2BOCB 3OV6A 2NX5A 3ARYA 1RZFH 4NKDA 4HH8A 4GAJL 1KB5A 1WIUA 4B5EA 5IBTH 2ADJB 3WLWC 3GFUA 4Z7OE 2I5YH 4Z77B 4XI5C 4XHJD 4MB3A 5CGYD 1CD9B 1Z3GH 4LVEA 4OM1L 4KJPD 5DA4A 5FYJE 4J3TA 3VDCA 4OKVB 4U6XA 2BY3A 1WZLA 4BZ2H 4PJXB 4OFPA 5SV4A 1K2DA 2XTJC 5FK9A 5C1MB 3QRGL 2W92A 2BHYA 4P5KA 2IC2A 4ODWB 3IFOB 4GMTH 5KJRH 5C0BD 2YPVH 2OZ4A 3PWNA 4Y8AA 1I9RL 1X5KA 4Z7VB 5I74B 3L3HA 1NC2A 2GJZB 3EYUH 2UYLB 4P2QA 3DVNA 1NLDL 1EO8L 5F88B 2LABA 1JPGA 1ZLVK 5DURB 1GZPA 1FO0B 5C0EB 2Z92B 2H2SC 4Q9CA 1FAIH 3QXUA 1PW3A 3I9GL 3EOTL 5HSFA 3J8F7 2WINB 3JTSB 4K9EL 1BVKB 5A3ID 1CXFA 3IAPA 1X9QA 2VSCA 2X05A 3VDAA 3UTZA 2VWEC 2BVEA 4LLDB 3HC0B 4XVTL 2EICA 4PJIF 1RFDL 4KRMB 5T33H 1MLBA 3TBWA 5J7CC 3NAAL 2UZIH 4AM0B 1ZA6B 3UP1A 4KY1L 3OKEB 4OV5A 4HULB 1A1OB 5CD3A 2BSTB 2DYPA 4H0GA 4ODSH 3TBVB 4HC1H 5C7XL 1MNUH 2W59A 3C6SA 3NZHH 4GOSA 3INUH 2FO4A 2J1KA 2I9TB 3ZKQD 4LLYB 1A6ZB 1G7IB 2O61A 5BVJA 4UOW1 4ZNEA 3MV01 3QI9C 1RZJL 1I7RB 5T5FH 32C2B 1DBKL 2MKLC 3I9GH 3O8XC 4KKBD 1LQSR 3JWDH 2CKNA 4S1SH 2J6EA 5GS0L 1LNUB 3S5LB 3FQTA 1KUMA 1KXTB 3QNYA 3U7AA 2D03H 2NY1C 5IG7B 1X5XA 2ITDA 1L9MA 1UACH 4WIQA 3GSXA 1CT8A 3ULVH 1OW0A 3D3VB 5AYQA 5E2UH 4PJCE 1Q9OB 2O5YH 5DMIL 5HVHB 2BX5A 5GQBA 1G7HB 4P2YA 5EO0B 4C56B 3T77A 2W65B 3HR5B 4LQ1A 4NOFA 4K3GA 1CIDA 4NQEE 1FV1A 1K5NA 4NFCA 2NW2B 5TDOB 3LN5A 3STLA 5E2WL 4PJEF 5ICXB 2Y4SA 1NCWH 3GBMH 2EDNA 3ARPA 2GIYA 1A6AA 4E42B 2YWYA 4PJAE 1DBML 1MCHA 3BPOC 1N5YH 4PJFE 3D39A 3A6CL 1T80A 1YEFH 3PP3K 1T21B 1YA5A 2J6EH 5LBSH 1L7TL 3WS6A 4JFHE 1TCMA 2E7MA 4I8DA 2FD6H 2ZSVA 3QXWA 2VLRA 1MCIA 2WW8A 3AVEA 4ELMB 4JPIA 4XMLL 1Q9LA 4AJ0A 3SEPA 5I1AA 4X98A 5I30L 2XFXA 1X4XA 4JM2C 4P3WA 4F33B 2N1KA 3HI5L 2Z0BA 4HJGA 1T7VA 1V7MH 4G6JH 4X7TB 1LDPH 2XN9A 2X4SA 2PTUA 2AEPH 5D1XC 1MOEA 4I0CC 1RK1B 5H94B 2Q7NA 3RDTA 1KIQA 3KR3H 4MA8H 3SE9H 2CIIB 4QRUA 4K94H 1AE6L 4P46D 1BWMA 2XN9D 2NXZD 1UH2A 5K9JL 1A7BA 4RBPK 3B2VH 2B4CL 4PV8B 3M8OH 4HWUA 3OB0H 4Z8FL 3WXVH 4KJYA 5I17A 3KPOA 5JQ6L 1DCLA 3P9LB 3A67L 3QIBD 3QO1B 4OZFH 4ZXBA 3RGHA 3KPPB 2OCFD 2W38A 1RZ7L 3QFDB 4O51B 3JV6A 4RGOL 3MRNB 2QSQA 4WUUD 1J12A 1RJLA 3OMZA 1DUZB 2Q3AA 5EORL 4KHTL 4GW1A 4FA8A 4WFFD 4KQ4H 1MI5B 3QWOB 5DC9B 4R0LA 2AEQL 3NFNA 4CU8A 1UKTA 2NZIA 5HGHB 1LK2A 4CADB 5I1GH 4PJGE 1VACA 2R4SH 3GIZH 4H8WH 2W91A 4PGCA 2Y1VA 2FX8L 4YAQB 4UT6L 1A7RL 3GMQB 3AS1A 3EDDA 3V0AC 3FB7A 2DQGL 2GK0B 1SJEA 3DVFA 1AGCA 2WWMC 3QUZC 1T1YB 2YPVL 3DVGA 1NL0L 5EOQH 3JVGC 4ALAL 5EOTA 2X70B 3V4UH 1JPSL 4M3JA 5D72L 2IANE 4PR5A 4OZGF 5HHXH 4OF6A 5J1SC 1GGTA 2G60H 5DC4B 2OL3H 4JAMA 3SDCD 4HF5L 3RWGB 2MKWA 3GZKA 4OZGB 1S9YA 2C3HA 4FRWA 3NIFF 3VWKC 4IOIB 1HILA 2XRAL 3RWHA 2DLEA 4E0RA 3P30L 1AD0B 2VE6B 2X4RA 4NUGH 4L3ED 5FUZL 4EI5A 1B90A 3NCMA 1U58A 3PG2A 4G8IA 4NPYA 5IW3A 4R96B 3U4BH 4I0PB 4LSTH 1D5MA 5F89B 2FX8H 3C6LB 5D7KE 3WHE1 1BFTA 5DQ9A 2OI9B 3HAEB 3BDBA 4LIQE 3RQ3A 4LSPL 1AQKH 1M05B 4IBLT 4V2CB 4FQCL 4DKFL 3S7GA 4LEXH 3EKCA 1ZXQA 3E2HC 3OKOA 4FQ2H 4G3YL 5HHME 4JZNA 4LOUC 4GW5B 5CEZL 3FQUA 4BJLA 3QUYA 3V5HA 2DQDL 4P99A 2IH3B 2NXYB 3BUTA 3M17A 5C0DA 4HWBL 4LVNC 3P73B 3RL2B 1W72H 1T2QL 3KPMB 4ZTPH 4JG0L 3DUUA 2FR4B 3MREA 1TQCB 1GIGH 3SQOL 4KUZH 3RZCC 4QNPF 1JI1A 5JHDA 3TH4T 3NCCB 1OM3L 3I50H 1TDQA 3QDMD 3P2TA 5GS2H 5BZDA 4FTVE 4NQSB 1IL1B 4YIQB 5KAQG 3WLWD 3VXUE 3KWWB 4I4WB 3QA3B 4GSDL 3QUMA 5FHAH 3DX6B 3TNNB 3VE0B 3VDBA 1P53A 2XWJB 5F7UA 5KS9A 5F7EH 5E08L 4YHZH 4TULL 3DIFA 1B88A 1QD0A 4P9HH 1CLYH 4WO4C 5DK2B 3RVUC 3VFGL 1A6UH 4WWKA 1S9VB 2GY7B 3RBSA 3SY0A 4UIKL 3BI9X 3KLAA 1C5DB 3HMWH 2DBLL 2PR4L 1JPFA 1PZ5B 1UQSA 2Q6WB 3QXVA 4XNZB 1OD7A 4WFFE 3EYQD 1QR4A 4WY7H 5AG8A 3HKFA 1OGTB 1S7TB 1H15A 4YPGA 3LKSA 3SGKC 1ORQB 4LCUA 4J3XA 4KKNA 5BVPL 2FEDD 3DXAB 2VE6A 1QRND 1R3IH 1E4XH 1EV2E 3VH8A 1YEFL 3RGVB 4XVSH 3RU8H 3SCMB 1JNNL 2DMKA 5EBGA 5EZLA 3UPCA 4WHCA 3RWEB 4QY8A 1NFDF 1GZQA 2L0DA 4D0CA 2R1XB 3UBXG 3VFNA 3IETB 4CADA 3D3VE 1WZMA 5ICZA 2FGWL 1FLTX 1U8KB 3MLXH 1CGWA 3IVKA 4JVWA 1CFQB 4CN6A 4UIMB 2NY0D 4KAQL 2PO6D 5I1HH 4PJGA 1MIEL 3QEQD 1RZJC 4GW5A 2ZZUT 3LEVH 3QQ9D 1MUJB 4JCLA 4IRSA 1SM3H 1OCWL 5HHQA 4NWUH 1UXSA 3O4OB 1N0LA 2QQKH 1OOAA 4GAFB 1I1AA 2DRUA 4P2CG 5DJAA 5FK9B 2ZG1A 4P9ML 4MS8C 4OKVA 2QQNH 4NQVB 4HCRA 3OJDA 1NGQL 2N56A 3S35H 4K71C 1CDCA 1BFVL 1TVBA 5HD8C 3V4PH 4OM0H 5SWZE 5D7JC 2Y36H 1D5IL 2A73B 1OB1A 3BVNA 1UYWL 3RNKB 3O2WL 4RGND 4BQ6A 4OCWH 5T3XE 1J8HE 1MSPA 3FB8A 1GOGA 3DX6A 3GSUB 1T1XB 3F58L 3ZTNH 5SX4I 5K9OA 4HGWA 2BVOA 3VFMA 4F15C 4XPGL 3DSFH 3VCLA 4PTTA 4EI6A 1G1CA 1IGJB 4JFYB 1JGUH 1IBGL 5JDSB 4EDXB 1G84A 4K3HA 4ZSOE 3O4LD 1H3TA 3BAEL 4ODTH 5E8EA 3FO0H 4JKPH 1DE4B 2ARWA 1X6NA 3ETBF 3NFSL 4IJ3B 2P24A 3BRFA 3EOBB 4YXKH 5CEXB 2R56L 1DZBA 5LWYH 3RL2A 4CMHB 5I8EA 5INCB 3W39B 2Z91B 4NZDA 5A2JH 3U0PA 1CK0L 4D3CL 1PY4A 2BSTA 1X5LA 3MACH 4DEPC 5IW1A 4R7NB 2Q8AL 2PETA 4Y8DC 3UPRB 2HJLA 1A6WH 1LO3L 3QI9B 4LSQH 5EH1A 5EU5B 2QADB 2HFGH 3MGOB 3H3KA 2DWEB 3OZ9H 4GXUM 5HYJD 3GUTB 1S7SB 4QOKA 3GSNH 4PJAA 2VMFA 4ZDHB 1I9RH 4Y4KD 3BRGC 2A77H 4XPTH 4WWKC 1VADA 3U6RA 1JZ4A 2Z93A 5C70A 1S7VA 2YMXL 3Q5TA 3VGAB 3VXSB 5L6YL 4HKBB 5LWYL 4ZFOL 3KNBB 4Y4KA 4JFPA 3MTRA 4QCIB 4YEEA 5EWIL 3W0WB 3M45A 5EZIL 4W6XB 4QWWD 1M7IB 3L5JA 1K85A 1KPRB 3LCYA 3D3VD 4LSSL 3O9WD 2EDFA 2CRZA 4RRPA 2ZCKL 5DHVH 1OHQA 1FFRA 3FOMB 3MRJB 3S37H 5MHSD 4MD0A 3V4VH 2I9LB 3MA9L 2OTWB 3W0WE 3G04A 5J0BA 5JTWA 2PUQT 2DM2A 1UXWA 3QCUH 4R0LC 2WZPD 4ZO7A 1SVZA 1WZKA 2F5BL 4KUZL 5FAAA 3UDWC 4UIMA 3NPSB 4MDJA 5EBLA 1VPOL 2DTML 3GI8L 2DM4A 4OCYL 4Z78B 4U1LA 2CLRB 4AT6B 3WHXB 5L7XL 1C08A 2YA1A 3OGOE 2WANA 1TTFA 4NUJB 2P43B 1YC8A 3S34L 5DGQA 4O5LL 2XFXB 3MNZB 1MJJB 4K55A 5FGBC 3SDCB 3D5OF 1Q9LB 4JFFA 1IC1A 5C08A 4TULH 3DMMC 4NN7B 4PJBA 1QBMH 2D0FA 3RVWD 2JCCA 5GHWH 5DHVA 2X4SB 2K1MA 5I8CB 3QUZD 3UEZA 5KSAC 3X13A 1QFUL 2AJZA 2GJ6E 1I3RA 4JZJA 1OT1A 2LTQC 1G9MH 2MOVA 2V7HB 4ETYA 2ZG3A 3HMXL 2BOBB 2YZ8A 1QBAA 5J6GB 1P84K 1FG2B 1YEDA 3NPZB 4Y19E 4PREA 2FHBA 4M7LT 3NMEA 3DBXB 4PGBB 3V8CA 1XF4B 2NCMA 5ESVA 1FNHA 1YPZE 1QHPA 4PGDA 1ZVYA 2AQ1A 1XF2A 3BW9B 1IGJA 4Q74A 4Y2OA 4LASH 4O5LH 1V5JA 5D2NA 3CFIC 5DMKA 2NXYD 3KPOB 3OJ2C 1GVIA 3PV7A 4XMPH 3GSNA 1U8IA 3BQUD 5E8NA 2P8LA 5JIPA 2WM0A 2VDRL 1CXLA 4XB7A 5FYJH 3VJ6B 1RUKH 4QHUB 3QHZH 4XNYH 4KAQH 4YLQT 5KVDH 1DJSA 4JDZA 3P4MB 5IW1B 1FNFA 3DETC 1JZ2A 2UWEA 1OGAE 5I1EH 1MI5A 3FT2B 3UAJC 1RU9L 1YQ2A 3U4AA 1RIVL 1DDHB 4NQED 1LDPL 1RZIA 4KMQA 4PRHD 4NC0B 1CDJA 3FB7B 3GK8H 3NBNA 5JPMA 4U1HA 3ARFB 1ZGLP 4FG6D 4PGCB 1Y6KR 1YY9C 1KJ3L 4HJJL 4BZ2L 1GXEA 1TITA 1TLKA 3V6ZB 4N0CC 3UTQB 4Z78A 2GAZB 3RZWA 3WJLA 3PWLA 5F3HA 4GMTL 3HAEG 3PNWA 2YKLL 2NX5E 2OL3B 1OAZL 3FONB 5EUOF 5CZVH 2EYSB 1LHZA 4HKXB 4I48A 4WWID 1XR9A 3NABH 3FAXA 3T3PF 4P49A 4Y4HD 3VXME 4PUBH 4R6UA 1HILB 4YEFA 2ADIA 1NDMA 1HYSD 2CLVB 1R5WA 3FO9B 3GHEL 3LZFH 3PWNB 4OLVL 1U2HA 4YHML 5E8OB 3T1FA 3MV7A 1H5BA 4YHPA 2BVTA 2BJMH 5F96H 4JREB 4TRPH 3C09B 5C0EA 1FNLA 3MRKA 5DRWB 1KTLB 3RAJH 4KWUA 3DX7A 4FQ1L 5ESVB 4WUUA 5LXGL 3GMPB 1LP9B 3RDTD 4JFDB 2QHRH 3UTZB 5K59E 1RSFA 4YR6A 5CSZB 2BRQA 3FQRA 5DMKB 2HT2C 4PIRF 5HGDB 2E5EA 1C08B 1LGVA 2CK0L 1R3HB 3Q3GB 4O58L 3H9SB 1XIWA 3K8KA 4WI7A 2GJ6D 2R0ZL 5T5NF 5CAYB 1PG7X 4RMVA 3BWAA 5CWSA 5KSVB 1KPVB 5HHMB 3FFCA 5JOFB 1JPSH 4OLUL 2PNDA 1ZAGA 3BPLB 3S8WA 3JV4B 1U6AH 5JHDB 3N85L 2NY1D 4R3SA 4UT7L 1QSFD 4LFHD 4LSVL 3QUMB 3IJSA 4NM4H 5E1AA 4ZD3H 5D7LE 5CUSL 1T5XA 4J1UB 1KT2A 2EKJA 2FL5A 2X4OB 5FUZH 1XFPA 2AJSH 2F74B 1AJ7L 3QFJE 5FDWB 4BQ8A 1JV5B 1SYSA 1I3GL 2VL5B 5TH2B 4X5WA 2K3TA 2RIKA 4M4PA 3MNVA 5DHYB 1QQDB 4X80L 4PJ9B 2B8OT 3TZVC 3CFCL 3BD5A 1JPST 5I9QC 4F7TA 3IDGB 5MENE 5DJXA 4LNRA 3L9RB 5CIPA 4CVWA 4YDJA 1EFXD 2E8YA 2AW2A 4KI5D 4OZIB 2E3VA 3E3QC 3RP1A 1L9NA 3GRWL 3PWJA 4K9EH 5HGBB 5ICXA 1MPAL 1XZ0B 1KJ2L 4JGUA 2X1XR 2D7QA 1DBJH 1CDGA 2MQCA 3GO1L 1U8KA 1M7DB 4RAUA 5DD5L 1QFOA 3GBML 3LQZB 3OAZH 3UYOD 1CN4A 2DQIL 5GRWA 1N7MH 1IGIL 4PS4L 1XF5B 5C6TH 1B0RB 1V7ML 3O0RL 3UTQA 5FO8B 4PRID 3F7PC 3JWOC 3JWOH 5ANME 5FF6A 2ZPKL 3MOAL 2EYRB 1XIWB 2IBZX 2BRRH 3P4OB 4C54A 1BZ9A 1HSAA 3FONA 2APVA 4NRXB 4ZFZB 4UIKH 5DSCB 3VXQA 5DRXB 1RMFL 4C56A 3QG7H 4HFWA 3MUGB 2X4UA 4YNYA 4HKZB 2ED8A 5C07E 5F9JA 3CD4A 5CZKA 3DI3B 5HGAB 4OAWA 1CWVA 1MCBA 1QLFB 5KN5B 4L4VA 2CIIA 1IAOA 5E5UB 1BLNA 2V7NB 4NZJA 4HGWB 4EUPH 4X9FA 3ROOA 1CXHA 4RSVA 4BFIB 4ODHH 1DLFH 1INDH 5H37G 4OI8A 1YNKL 1M71B 4IRJC 3PGFH 3BP4B 2CD0A 5T3ZL 1NEZA 3WDIA 2HH0L 2B39A 1F3DJ 4ZUWB 1ZHKB 4LQFH 2ENSA 1WWCA 5IB3A 1CQYA 4S10A 4I2XE 5DJYA 2ID5A 2KQNA 2VXTL 4G6MH 1GH7A 4YE4L 1INQB 3MGOA 1T7ZA 1OGAB 1IGCH 4CDHA 4LCWB 4JPWL 4MJ4A 1NFIB 2Y36L 1MCWM 3TGXA 1MHPH 4PPTA 2UWEF 3F65A 3VFTA 3GB7A 4PJ9D 5HDQL 2QBWA 4PV8A 4WENB 3TNMB 5EA0L 2C3GA 2VNCA 4WU7B 3WFHA 2ZWLT 4KJQC 5EB9A 4KI5E 4MQXD 5D72H 1QQDA 3HTLX 2CXKA 3MFFA 1S9YB 3K1DA 1IBGH 1R3KA 3S97C 5I74C 4TUKL 1A2YB 2VDML 4X6BB 1FYTE 4P2OB 1ZT1A 2OR9L 4HBQA 4XVUD 3K4ZA 2YEZB 4JY4B 3ULUL 1MAMH 5F9WB 4XVSL 5EPMA 3HNVL 2R29L 3S88H 1A7QL 1A64A 1RUPL 4R4BA 4PJ7B 3UX9B 2PO6A 4V1DE 1TTGA 2HMIC 1LO4L 2HTLD 2V5SA 3WUZA 5CKGA 2Q3ZA 3IU4H 2RJMA 2ZUXA 3ZL4L 3VGEA 1M05A 2ZUQB 4HK3J 3HR6A 5T1DH 4MB5A 3MOBL 1PEZA 2IGFL 3HMXA 3PL6C 4FFWD 1Q1JL 4XVJH 1RFDH 2RBLA 3I3DA 1XF3B 4MAYD 4NWUL 1HE7A 3OKEA 2ATPB 3AXLA 3IT8D 1TIUA 1EPFA 1VFOA 2VR5A 4PP1C 3RI5K 2W9EH 1DLHA 4GRLC 4XWOC 3T04D 4QKXB 3GMRB 4NN7C 4W70A 4YGVA 4Y5YA 5C0RH 3LRSB 2JELH 3VI3E 1IE5A 3MRQB 2GTZB 4KH2A 1DFBL 4XNQA 2XWTB 1UYWH 4W4OA 3LB6C 4IHOA 2AP2A 4YK4C 4OFKA 4ZOBA 2H32B 3LKOA 1ZVSA 3HI5H 1FFQA 4R4FH 1NFIA 4U7MA 2DMCA 2QKIB 3V6BR 5D6DA 5GGRA 2EDEA 1IAII 4YHIA 4KK5C 3O9WA 3MV8E 3MLTB 1A1NB 3ROOB 4H88H 3DIFB 3UZEA 2E27L 3MO1A 3MBEC 2FEEI 3FQUB 3QG6B 3Q48A 2GCYA 2I25N 2VYRE 5KVGH 2PR4H 1DBJL 4HUXB 3VXSE 4NO0A 4P23C 3VJ6A 1FRGH 1ZGLB 5I73C 3GSWB 4KK9D 2BNUB 1AGFA 3VMPA 1A02N 1DQJB 3BZEA 3C08L 4P59H 3FQNA 4LEOB 4OZFA 4HG4K 1H3XA 2C1PA 4NKQB 4PJDF 3GSVB 4R4FL 1H8OA 4QRTB 4LBEA 3U9UB 1I4FB 5IQ9A 2SEBA 3FT2A 3KWWA 4MD5A 4P46B 1KJ2B 3OZ9L 4O2FA 1XGYH 5J89A 5JW4M 3MRIB 3W0WD 4G6KL 3O3UN 3V6ZA 2GSGA 4L9LA 1T2QH 5KSBB 3VFWA 1Q94B 5DK0A 5DK2A 3HZYA 4NNXA 3PL6D 5HHPB 3SOBH 2HLFD 1U93A 4X99A 5HY9B 2DQCL 3BP6A 2QLVB 1HZHL 1FZKA 3SDDB 1P9MC 1FNGB 3PJSB 4IDJL 1MWAH 5DQJB 1MFEL 2GUOB 2FHCA 2VDOH 4MCYA 4RISH 1U8HB 2MCPL 3PDDA 3IU3B 4HCRL 3G5ZA 3BYTA 3B2UD 3FZUC 2APXA 3QWRA 3ESUF 2HVKA 1OB1B 4JFEB 5EDXA 2X9WA 4Y2DA 5C08D 4S0SD 4Y2DC 2OZ4H 3LEXA 3RWCB 4IHOB 1D5IH 3CFDB 3OL2A 5C6WH 3BHBA 3QAZB 4O9HL 5KSBF 1KGCD 1WJ3A 1LP9E 4PJ8A 4L8BA 5E9DA 3QZWA 4NUGL 3NZ8A 2BFVL 1C5BL 3CVHL 3MLTA 4HPYL 4PJDB 3EO1A 2GYSA 1SEBB 3PGCB 1MIMH 1AKJD 1J10A 2X09A 4PLNC 1CBVL 2VDOL 4FNLL 1QHOA 3I75A 5DMGC 3AY4C 1RZ7H 4YHKL 5E94A 2AABL 2DKUA 1NLBH 3W39A 4MMZC 4MNGB 2AJVH 4HBCH 1VEPA 4X6DE 3SDYH 2QADD 2RCSH 4OZFG 1RZKC 2ESVD 1YNLH 5GRUH 5IVXA 5JOFA 2JCCE 2VLRD 5E00A 5IQ9B 1FNSL 4HIEB 2FEDC 4AEEA 4WV1B 4GKSB 5C9JA 1HDMA 5JORA 4OCLC 4ZPTB 2AK4D 3IFLL 2P48B 1DQMH 2ZCLL 1SY6H 1WFUA 1FJ1B 3CSPA 4G7VH 1WK0A 4YGAB 2X1QA 1F4WL 4JVUA 2COQA 2HN7A 2P7TA 3DSNA 2X6MA 4EI5D 5C3LD 4ELME 2VL5A 3EYFB 5I1KH 4M8VA 4OD2B 3K8MA 3VXRA 3DX9A 1CFNB 1CXKA 4IIQB 4LIQL 1NCAH 3BGMA 1MLCA 4GS7B 3DI2B 4Z7WF 2YC1B 2H6PA 3ARDC 3K4AA 1F45A 3HE7C 3RPKA 4DKEL 5ISZE 4CW1B 3QCTH 4UDTA 3HRPA 3UTPD 3AFLA 3ZSSA 4UUJA 1U95A 4JQXC 1JF5A 4QXGL 1IT9L 4TN9A 3BEVB 1RIVH 2I9LA 4UNTA 4GH7B 3QXDB 1DEEA 4P46A 1PSKL 4XPBL 2HJFA 4FQXB 3OKMA 2CLZA 4DGYL 2EH7H 5F1OB 1FQ9C 4ENEC 5FCUH 5HYQA 2FNBA 3CFKB 2A6IA 3BN3B 5ANMA 1TCRB 5I76A 3JV5A 1CL7H 1XGQB 1RVFL 2V9QA 3ELAT 3ZMRA 5I1HL 5DRXA 1F42A 3SBWA 4U6VH 1KFAL 3MCG1 4WFHE 2VXSH 5GGQH 4NRXA 4ZFZA 1KPRA 1OL0A 2YPKA 3DMMB 3LKPB 5IB4B 4PJHB 4OT1L 4UINL 3ISWA 1AFVL 5I19H 5C0BA 1GJIA 3WO3B 1U0QA 3EYOA 4CU7A 1QSEA 2LU7A 3G6JA 5LAXA 5F7MC 4NT6B 4EVNB 3VXPB 1BFOB 3ULVC 1GYAA 3QUXB 3VWKD 5KVFL 2R2CA 2WINA 1OF2A 1QSFA 3KPLA 3BW9A 3OXSB 5DJ0B 1N6QH 4EIGB 2XQYK 5EBLB 1S3KL 5C8JA 4PRAB 4OLEA 1ZEAL 1NH6A 3PGCA 3HLAA 2HLFC 3DX9B 2GK2A 1NGPH 1P2CB 3OKNB 4P3CL 4KTDH 5TDNB 2WP3T 3X3GL 1E0OB 4YDKH 3PQYA 4LCUB 3EHBC 5AZEL 3RPIB 3V7AE 3D1MC 1J7VR 4Z0BH 2VDQH 3HC3L 3FRPG 3F62A 5MEND 1KCVL 8FABB 2XI9A 3MA7A 4CKVX 1EMTH 3H42H 4L1HA 2Q76A 3WYRA 3ZT6A 4TVPE 1MI5E 4G9FD 4M7KH 4XB8A 5ADOH 12E8H 2A6JB 4NZRL 1YEDB 5IR1B 4KV5F 3QEGH 2C3WA 1DN0B 4JFOB 1AXIB 1B4JL 2X9XA 4L4TA 1BQUA 4XNXL 3ZE2F 4J4PC 1URLA 4WU5A 3IS1X 4K71B 1JWUA 2NY0B 5C0GB 4KU1A 5ID1A 5EZOL 2UVFA 1OLZA 4KROC 1DLFL 5B3JE 4AZ8A 1YPZA 5LXGH 5CEYB 3K7UA 3SJVA 2G9HA 3OX8A 4F15B 1CTOA 4S2SB 3WLBB 1N5AA 3MV8B 4ZYKA 3RWEA 1BFOA 4LQFL 2MFNA 1TQBC 1A6AB 4TVPL 3QRGH 4NRYB 5FGCE 5SV3A 1KN2H 3PGDB 1UH3A 1W8OA 3MLZL 3L7EA 3G6DH 1A6TA 1JGUL 4EDXA 2VDRH 4QXUL 1UB5A 2A9NL 4N0CD 4AL8H 4GAGH 3JWOL 1YY9D 3C5JB 1HNGA 1TCRA 4NCDA 5D5MA 4JPIB 1G7LB 1DUZA 2R0ZH 3JBG7 3MRPA 4FFVC 4HPOL 3E6HB 3R8BB 3F8UB 4LLVA 5GS1A 5DHXB 4NQDD 5JHDE 4OKDA 3U46A 3RY6C 5C0CB 1AY1H 1KEMH 3BKYH 4M6OH 1WT5C 5ALBL 3FB8B 1U41A 4ZDHA 4PFEA 3VXUD 1FO0L 1QBML 4S1QL 4GQ9H 5GRZA 2NY6C 4F58L 3NZHL 3RA7H 1FZJA 4DK3A 3PWPD 5E8PB 4IOSD 1DQLL 1XMWA 4YXLH 1N26A 1K4CB 3WL9B 1L7IL 4J3OC 1LE5A 4FOMA 5ISZB 3OXRA 1CR9H 3E6FB 3MNVB 3QWQB 5DHYA 3W5MA 5GGRY 4X6DF 3RVXD 5HHNA 1UA6H 2PKDA 1R5IB 2IGFH 4MA3B 1CGUA 5E70A 5ITFB 5CS7A 5IVNA 4PB9H 3KXFB 4XGZA 3MRJA 1IGIH 2VXTH 4G6ML 4YE4H 1I4FA 5C2BH 4FFVD 4AENB 1TZHA 5H2BB 4GUPA 2C1PB 3SGJA 3G5XA 4N90E 4LDOB 2Y7QA 5FA3A 5IFJB 1XGUA 4PRIE 1BD2B 2A6KA 5C0ND 3VFWB 1B0GA 2VXSL 2M8XA 1J88A 1I7TB 5E03A 1BGXH 3QIUB 3ARBC 3FQXA 1NBZA 5DUBA 4JZOA 1SYSB 3T0EE 5EA0H 1CR9L 1FFOA 4QRSA 3QEQE 5CBAA 3TYGH 3MPCA 3CDGB 1HOCA 5DQJA 3RUGB 1OLLA 1XR8B 3SGKA 3OTTA 1T1ZB 5BRZA 4RWHA 4TNVK 4ZD3L 3VGFA 5D1QA 4HWZB 4OTXL 1Z9LA 2YRPA 1FGNH 4PG2C 4XAKE 2J4WL 4X7SL 1FIEA 4FFWC 4G80A 3OX8B 3KS0J 3C2SA 1FL6B 3LQAC 4YNYB 5FO7A 2VDNH 1A7PH 4MNQD 4B7IA 1HN1A 3MRMB 4MD4B 5F88A 4KK8C 3MUZ1 3TIDB 1KB5L 1K6QH 3FB6B 3SKUD 3TH3T 3ZE1E 1E6OL 3TT1L 5D9SA 3FCTB 4QYOA 4XCFL 4AQOA 2R69L 1QR1A 1BQSA 4AT6A 1VESA 2BNRE 1G9MC 4I3SH 1QFWH 3OXRB 3VD5A 2VZ3A 2QQQA 2GI7A 3HCVB 3RVXC 1E4KA 4JQIL 4DJMA 3LKSB 5AYUL 1E4XI 4NRZA 1QYGH 1T5WB 4M6NH 4X6CE 5FO9A 1FIGH 4HXAL 4MGXA 2VLJE 5J11B 5EZLB 4PRPE 4KJQD 2ESVB 2CIKA 1T4KA 5EZOH 2HT3C 4R2GC 1T22A 1CFBA 3HA0A 4OF8A 4ONGH 5I0ZA 5CJOH 4W6YB 2D7TH 4U1IA 3FFCE 1X5IA 2R69H 5D2LB 3TZVD 5ICYB 1R24B 2JB5H 4N8VB 3UZQA 1OAKL 3FFCD 3NCJH 1MJUL 4MMXC 4IIQC 3ULSB 2YXMA 4Y1AB 2R4SL 4HKXA 1AJ7H 3TA3C 1ZA3B 3MMEA 3QZWG 1B0WA 3G5VA 1P4BH 4LGPB 1QEWB 3GI9H 1ZHKA 4LRIC 3PQYD 4X5XA 1G7HA 4I0PC 3S4SG 1OARH 3TBYA 5EBWA 5D93B 2HG5A 2IANB 1BZ7A 4EXKA 1JN6A 4QT5B 3HNVH 1I8IB 1CG9A 3UTTB 4PJ7A 4RMRA 3HG1E 4FQXC 3L3JB 1J0ZA 1MHHB 2C1OB 4HQQH 5T1LB 1Z5LB 3VCLB 1ZV5A 4M5ZH 1X5AA 4XBEL 1I1RA 5L2KA 2VLJB 3NCJL 2QSCH 4JHWH 3KYMB 3QYCA 2A6IB 2DQCH 5D5ME 3D0LA 1U9KA 1MCCA 1MEXL 3UBXB 2NMSA 4X98B 4K2UH 3P11L 1GGIH 1JNLL 3UC0L 3T0EA 1X5YA 1IGFH 4ZFOB 5IEKB 4FQ2L 1UCBL 4ZNEE 3QUMH 4BQCA 4EIZC 5T1MA 5JA8B 4JPWH 5EBMA 1RJZB 5LQBH 3CXHK 4JRXE 2DYPD 4U0QB 1BD2E 2M26A 3WJLC 1MHPL 4DOHE 3O3DB 1BBDL 1H3GA 3VFPA 2FGWH 4UMGA 3CU7A 2DQHL 5MI0C 2CDGB 1NGZA 4X0KB 5ACZB 4LRIA 1JJUA 5I16B 5IMLB 1KIQB 2QKIA 3DYMA 4JZJC 2Q86B 1CLZH 5IK3B 3QQ4A 3DX7B 4LGRB 5DJ0A 3VG0L 5JDSA 4FQJL 2BMKB 4YC2B 4P57A 4UV7L 3MO1B 3WNMA 5IVZA 3Q6FB 4ZO6A 3WS3A 5ENWB 2X4TB 3ULSA 2ZOKB 1PSKH 4XC1H 3DGCR 3IFPA 3KYNB 2EEBA 5IBLD 3UTTD 5DZLA 3TN0D 4E41D 2PYFA 5DI8A 3X14A 5CIPB 4NO2A 3RWFB 2RAMA 4YHZL 4XC3H 3SGEH 2W60B 3ARSA 4ZUTB 4HMDA 3NFNB 3CDFA 2P5WB 5GRUL 1GC1L 3GRWH 4DZBB 2W0FA 3FQWA 4ZUVA 4F3FB 1M1SA 3U2SA 3GBLA 3LEYH 3WUWG 5KSUB 3MC0A 4DN3H 3FMGH 3GMQA 1ZHLA 2VB5A 2VKWA 4TNVF 3ROLA 4PRPA 3ZLQC 3V52H 2FX7H 2GFBB 2X5PA 3IAGC 1A3RL 1WBYA 3EYSL 4HJ0D 5FV1L 3ULUE 4XP5H 4YXKL 3KJ4C 5HYJE 1FZKB 2IEPA 2EYTB 2VZ1A 1ADQA 4XCEA 4NQEB 1R0AL 1DR9A 5LCVL 5ID1B 5FV2A 1XCTA 4M61B 3BP7A 5LGJB 3RWHB 1M4KA 1ZLUK 4N9GA 2R0WL 3FT4B 3QDGE 3GHBL 4NBZB 5CJXA 3IDJB 3IDNB 3RY5A 3JTTA 4X5XB 1NCCH 3G08B 4Z7WE 1AR1C 1MCNA 3GM0A 2VLME 3X13B 4JDVB 1VHPA 2ERJB 3EFFA 2BVUA 2G5BB 2ZCHL 2QQNL 1FZOB 3HC3H 1U3HB 1VKXA 1KLGA 4GSDH 1QFWI 3SDDD 5HYSG 4I18B 1WWAX 2G5RA 3Q6FA 2YK1L 3LQAL 1TVDA 4IRSC 4JFQA 1A7NL 4Z7VE 2GITB 5GJSL 1SMAA 2C7UB 5E94B 5F9OH 1ZA6A 4HS3B 1JBJA 3MYJA 4YDVA 3REWB 1MLBB 1NEZB 5C08B 3OKKA 1FGVL 5F9DC 5IROA 5FKPB 5C07B 5D1ZA 5E24E 5KJRL 3WHE0 3TC9A 4CVZA 1WV7T 4LLUB 2R9HD 4HIHA 4Z7UB 3EYUL 3H0TB 4K7PL 1RY7B 1I1AD 5E00B 1X4ZA 4TSCH 4PJFA 3OR7B 1B6DA 5I16A 2Z4QB 5IMLA 2BVQA 5EC2B 4FTVD 3MBED 3WFBL 4JM4L 3TYFB 3ILQD 3WFHB 1NAMH 4U1KB 2ITDB 5KVEL 1W0WB 5F9OL 5J6HA 2NY1B 4WFGE 5IHUL 2LVCA 3DHJA 5EOCH 5ISZA 4LLWB 2DLIA 4GFTB 1H0DA 2Z8SA 5D7IE 3MBEA 4HHAB 2YC1A 4N0UB 3VXRE 4HIJA 5JO5A 4QRQA 4OV5B 1FORL 3HAEH 2YUWA 1TZGH 4P2OA 2GQHA 2D9CA 5HVHC 1SBSL 2JIXB 1NANI 3W9EA 5EULV 1UEMA 3LB6D 1N8ZB 4OIIL 5IVXB 4X4YB 2CO7B 3H8NA 3VH8B 1Z9SA 1TVHB 2VDKL 3MV9A 4PTUA 3G6JE 4FQQA 5KZCD 2ZUQC 3O3BB 1IT9H 3AY4A 3QXDA 4P2OD 2DJSA 4PP1D 4NC2B 3RY6A 5D8JH 2YPLE 5EWIH 3LIZL 3MX0A 1KF9B 1S5HA 3U0TA 1S9XA 1OAYL 3ROLB 4JPVL 3QIUC 3N1GC 2H45A 3HNTL 4M03A 2O5XH 2C3VB 4U6VL 5IOPA 1AY1L 3BKYL 4M6OL 4OLWL 3H2WA 3NGBC 4M7JL 2RHEA 2Q1EA 1HKLH 1EA9C 4NN6C 2UZXB 5I66A 5I8OL 4M1CC 4FZEL 2F5BH 4NZUL 1RAMA 3BE1L 2FWOA 1I7ZA 3G6AB 1YEEL 3V0WL 4NNYA 1OTUD 2HRPL 5JUEL 5B4MD 1JWMB 4J7RA 5J13C 2D7MA 3HE6B 3K80A 1IKNC 5DRWA 1XGRB 5HD8D 3WN5B 1OP5K 3UZVB 5JA9A 3ZTJG 2Y07L 4LMQE 4H26A 3WFCL 1TPXB 2FH6A 4POZC 3GSNL 2HYMA 4U6YA 5DJZB 4X5WB 2AJ3B 3VXMB 5F6HJ 3SPVA 3WKMH 3SO3B 1P2CA 4OZ4B 4HUNB 1QO3A 1W0VB 3DO7B 1E4WL 2HLAA 1X5GA 3QO1A 3BWAB 3LVEA 3ALXA 5IBTL 4UT6H 3H9SA 2IALA 1J0KA 2IADA 5ADOL 4TVPD 4I9WD 5B39A 4AG4H 3GMRA 1G9NL 2XN9B 2F54E 4TVSa 2W9LA 3T3PE 3PL6A 5FGBA 1DVFA 5FYLE 1VCAA 4OCRH 3EYOB 4XRCB 3ZZ1A 1EMTL 8FABA 4PP2B 3PP3H 4O2FB 4N5EC 3RVTC 3B9KD 2BOCA 4MCZA 2WNGA 4U1IB 4LNVA 3JUZA 2H2PC 3MLVL 1RUAH 3P30H 5FA4B 2APTA 3PIQA 3SE4C 2Q87A 3CDCA 3TYFA 3I85A 3VFSB 1T1YA 2EE3A 1YEGH 2JK5A 3OPZL 4FQHB 3TBTB 1FN4A 4ZNCD 5HDBF 1A9EA 5ILTH 4XNMB 4HKBA 3RKDD 1DTUA 3DXAE 1QKZL 4MNQB 4OGXH 1J0IA 5FGSA 1AGEB 4O02H 3WNPA 4RMWA 3G5VB 4DGIL 4WI2A 3IKCB 5EFIA 5KVFH 2ERJC 5E9DE 3V5DB 1A6PA 1AGDB 2EZ0C 2AVGA 3MR9B 3KAAA 1JI2A 3X3FL 4JDTL 1V3KA 1K8DA 4Y5XB 3HAEA 1DBAL 3I84A 1N5AB 2HRLA 3MV8A 2JF1A 4OQTA 2HTKC 4JE4B 2HMID 3S3PA 3CX5K 3HMXH 1JFQH 2IPUG 3UDWA 3V0WH 3RIAF 4L3EA 1PAMA 5CJQH 3P0YL 4RGNC 1MH5A 1T89C 3EW3B 3FN0H 4FMFA 5HHOA 2VDQL 3GSOB 4UNUA 4O2EB 4UOJA 1QZ1A 3QO0A 4Q97A 4OGYH 2BSRA 1YECL 2X89A 4LVNB 1JGVH 3KPSD 5JOPD 1T6VN 4OCSH 4WW2A 1WUNT 2Y6SD 1MY7A 5HYSB 2YS4A 4MAYA 4HX1A 5KVEH 3U4BL 1KCSL 4YDLB 4I0PA 4Q9RL 1PG7L 3LDBC 32C2A 1HWHB 1DQLH 3S9DB 2FZ3A 2A6DA 5DEGB 3DBXA 4PGBA 3L5WB 5ECJE 3TCXA 3DPBA 1G7JB 3B6SB 1AQDB 5D1XA 4FXLA 3TFKD 3PWVB 3FO1B 1BJ1H 1RJYA 4GQ9L 4HKJB 4JFEE 1I1CA 5E8DH 3FL7A 2ZPKH 3MOAH 4F7CA 1NANH 3TWCH 4WI9A 3FFDB 5L2JB 1WFOA 3MXWL 4FQLL 4LIQH 3TZVA 2ITCA 5EC1A 3X14B 1N5YL 2VSDA 3QULB 4HWBH 4JRYE 3B9EA 5CUSH 1IKFH 5FYLD 3RI5F 3L3DB 4GAYB 1JGDB 4WCYL 2J6EL 5LBSL 1NFDB 4NQXB 4Q9BA 4G8EB 1EUTA 4IRJD 5EFIB 1FV1B 1K5NB 1VGKA 1YJDH 3O4LB 1JHKH 4L8CB 3G6DL 5GZND 3UJTL 2ICWA 4NIKB 1EAPB 4HC1L 1MCJA 1J0JA 1YDPA 1H3UA 3PUCA 2ZOLA 1N0XL 2J7LA 4M1DH 1DSFH 3C60A 3NA4A 4QRRA 3FRUB 3HMWL 3C60C 3OAYH 2ATKB 5FKAB 1KN4L 1NDGB 4UT9L 5ERWB 4OFDA 1MCOH 4LASL 4XNMA 4HIXL 2AV1A 1QFWM 5J3HD 2KZWA 3FTGB 4XZUA 4U6HB 3VW3H 4HWZA 1HHIA 4NSKB 3MNWB 1BEYH 1RZ8A 4CAGA 1U8JB 3ULVE 4OD3H 1NUNB 4F58H 3G08A 1FPTH 1CGSL 3STZA 3F12A 3HFML 5FO7B 2R1XA 1TPXC 3VFNB 5DUMH 4I3SL 5E4EB 2VKXA 2ORBL 1N6UA 1WGOA 4Y89A 4NDMB 5CP7B 4ZSOB 1I7TA 2B20A 5I8KH 3HC4H 5D1QD 1NFKA 4H25B 4HZLA 3PABA 3BPNC 1KJ3H 1AD9A 1QA9A 1R3HA 4GXVL 2R0LL 1FZMB 2VDMH 3LPGA 3X3GH 1DBMH 3NVQA 2IPTH 5IV2B 1NFDA 1U42A 3ARFC 3C2AH 5D1QB 2C9AA 1QBLH 2AJYL 1YNTB 3QJFB 3BP5B 5L0QC 1GAFH 4M43L 4N0RA 2YPLB 2H32A 3BZFB 5E1AB 2HWZL 4OBSA 1NCDL 1YY8B 5MP6H 3I3EA 2MWCA 1T22B 4PJAB 3CDYA 3GHEH 3LZFL 4X6EB 2YD3A 4DGVH 2DF3A 3VG9C 5F96L 5GGRB 4OZHF 3QH3B 2H26A 1UVQA 5BQ7B 2DM3A 4UV7H 5D2LA 2ATKA 2GHWB 4RDQG 5GZNC 2R15A 4JLRA 1KCRL 1KCUH 4N0UE 4WO4A 2P5WE 4EXPX 1AH1A 4OFIA 2PXYA 4U6XB 5D7SH 3SKNA 4BKLB 1NAKH 2IQAB 2M1KA 3L3DA 4GAYA 4PJCB 4I5BB 5JIKA 2CK0H 4ZQKA 3U7YL 5CEZH 4QOKD 1FG9C 3C6LC 4JPKH 1N0XH 2HT2D 3MCLH 3JSSA 4GBXC 4JFEA 4YXLL 4AIXA 3TO4A 2Y5TB 1BZ7B 1NUFA 3WXWH 3SCMD 3SKJH 1BOGA 4L8CA 5EBWB 2EIEA 3E2HB 4LL9A 2DQTH 5E2WH 3IGAA 5C0CE 3ECBB 2JLLA 1JPGB 5BW7C 1T4KB 2AXHA 4MJIA 1YYML 3VXUB 3QFJA 4TUJB 4X7FC 1JUFB 1EGJL 2FECI 1CGXA 4Z77A 4JHZA 4U1MB 3DGGA 5AYUH 4E5XB 5E95B 2A1WH 1Q94A 2AI0L 5DK0B 4GG6A 5IF0B 1P5UA 1Q9KA 4GRLA 2J8HA 1P4IL 1YN7B 4ZFGL 3RL1B 4Q9RH 2A0LC 1U92B 1CVRA 4Y4HC 4OFYD 3DTXB 1VA9A 3NACH 4PRBA 5A3IC 3P73A 5CZXD 5DWUH 1T0MA 4PJ8D 5ABDE 2MJWA 1I3UA 5F1IA 1Q9WA 4LPCA 3Q2CA 3GGWA 1BZ9B 1HSAB 1JHLL 4L5FL 3L6FA 1NMCB 1IQDB 1RULH 5HDOA 5JHLL 1CLZL 1NEUA 5JMOC 3AM8C 5MEPB 1SJHB 1NBVH 1C5CH 2YD5A 3U30C 2YD7A 1VEOA 2BOBA 3KLDA 4FG6C 4LCWD 5EUOB 2W9DL 3ZT7A 3EDFA 2XRAH 1HDMB 1IAIM 3NN8B 4OZIE 4S1RH 2VQ1A 2VUYA 4L4VB 3EJYC 4S0TD 3UTTE 3HI1B 2HFEA 5IMKA 3IYLW 5IK3A 5BQ7A 3VXMA 4E41B 4LGSB 4Q2ZA 2E9IA 2J88H 4DVBB 2YK1H 1H8SA 3H7LA 4P4KB 4W6WB 4X9GA 2BSSA 3EOAA 2YOCA 3C9NB 4NUJA 3CSGA 2F53E 4WEMB 1AXTH 3ZKXB 4PJFF 2DYPB 3F7QA 4F7PB 3QUYC 1GCFA 1G6VK 2NY4C 5KOMC 5I18L 5GSRB 3UYRL 4F2MB 2HFTA 4PB0L 4P9HC 1OCWH 5FYJU 1UCTA 1MCKA 4HFUL 5ADPL 4R7DB 2VLLB 4JGJA 5DVNA 4ORZC 4KQ4L 1Y0LA 8CGTA 4XP4L 5J1AA 4K7PH 4S1RL 4GG6E 1XGUB 5FYKU 3EGSB 4ISVB 1V7NH 1L4IA 3ZKSD 4LVOB 1J86A 2CLZB 3VFTB 4E9LA 1R0AH 2A9MH 3RFZC 3PV6B 1WEJL 3AROA 3MUHL 2AV7A 2IF7A 1QVOA 3TN0B 5I1JH 4WEBH 5IWLC 4YQXH 4F8QA 1YN7A 3TBTA 5MENB 3H9SE 4KK6D 1B6UA 1U8MB 3QEHB 4YDIL 1CGSH 1ONQB 5GZOC 2VDLL 3ARWA 5D7JB 3NOIA 1Q9WB 4ORGA 5K9QG 3HPJA 1Z0NA 4YBQC 3EYVA 2YPKB 2QHRL 2XICA 4JDZB 3SGDH 5E8OA 1IGTA 3K2UH 3TO4B 3B2VL 2HA1A 1BM3H 2JCCF 2BNQD 5CHNB 4C83A 2IMNA 3GIVB 4OUOA 4FZ8H 2EIBA 4WUUB 3BKMH 2EKSB 1K8IA 1HINL 1D9KA 1UZ8B 3WNNA 4HUVB 1TJIL 3CVIL 2ZUUA 3QQ9C 3OKLB 4JN2B 1RPQA 4PJGF 3OF6D 1FL3B 4YR6B 4IRSB 1LVEA 1CDHA 3HHRB 5I1AB 5HHOB 5ITBH 43C9B 5IB2A 4F7EB 4BA8A 5KS9F 3NTCH 3MRNA 2VZTA 1TFHA 2KDGA 5AUMB 3TVMD 2F8XC 3GIZL 4EUPB 4FXKA 5M95B 4JFDE 3OHXB 1A3RH 5IM7B 5DD1H 1AHWA 1R5WB 3MRBA 5GS1C 4NT6A 2P5EA 3O8XB 4P9MH 3SDAC 4HK0A 1AIFB 2C4FU 3UJJH 4Y4KC 4NKIL 2P46B 4OZHE 3MJ8A 2NY3C 3BZ4A 4QHNB 4I2XA 4ZG1A 1DVFD 4PB0H 4OUUB 4PRIB 4HIIA 4MSWA 2AV7B 5F72S 3O6LL 1TZGL 2ICCA 2EEAA 4OJFH 1C12A 2L7UA 2CR6A 4PJ9A 5IHUH 1QR1B 1Z9MA 2X1PA 3L3OB 2Z31D 1F97A 4G43B 1DQQB 3PXJA 3TZVB 1LE9A 2FIRT 4Q9QH 3QFDA 1AGFB 4O51A 2ADFH 4P2RB 3T4AA 2BHUA 1KTDB 5J06A 2PYEB 5GGSB 4GMSL 3BAEH 4R0LB 2B1AH 3BN9D 1MJ7L 4JPVH 4Y19A 4DVRL 3SQBA 4OGYL 4QRTA 2R1YA 3RTQD 3BEWA 5F1NB 4K7PY 1KG0B 1M6OA 3IJHB 4WNQA 4GQPH 4NM4L 4P4RB 3D48R 2WUCL 2G75B 2DL9A 1KJMA 4HQQL 2GSGB 3MLUL 3MLXL 4L9LB 4WHTB 1MHEB 3M1BA 1JHLH 1IGML 3F7YA 4MNGE 1SEQH 5TQ2L 3MRLA 3OKLA 1UJ3A 5D7JD 1A9BA 1WBZA 3WE6A 5TE6L 5I66B 5KG9A 4H88L 1MCWW 2FX7L 4WW2C 2WUBH 2ZUVA 4OI9A 5D7JA 3ES6B 4RQQB 4KVCH 5CZXC 4XPBH 1MJ8L 2LTQB 5B8CC 4XAKD 2WBJA 3VXTB 4DGIH 5JZ7D 1TJIH 1V3MA 3CVIH 5BS0E 4G7YH 2OSLB 5FCUL 4ODHL 4AIOA 1CCZA 4D8PA 3FOMA 5LGHL 4I4WA 1EBPA 1F3DH 5EN2B 2Q86A 3PGDA 2AK4B 4M6AA 3O2DH 3UTTA 2Z8WC 1QLFA 5KN5A 4M1CD 2NR6C 5HJ3A 3RGVC 3V4VL 2FYYB 1OAXH 3JTSA 1JMXA 1SBSH 3KYMA 1GPOH 4BFIA 3KYKL 2MMXA 3SO3C 1AI1H 2NZ9C 2A74A 4ODTL 1CGVA 1A14L 1UB6B 3QDAA 1IGYA 2BRRL 5E6YA 2HLAB 1WC7B 4Y5YC 3EFDL 1NCAL 5FECB 1J0YA 4MA1B 4N9OB 1BJ8A 1JRHI 4QEGA 1X5HA 4K23H 1I8MA 4X5LA 1AO7D 4JO3H 4RMTA 3ZT5A 3CPLA 1Y18A 4XNUH 3LV3A 1S3KH 1P7KA 4BSJA 5I6XC 4R26L 3HNTH 5C0AE 1BIHA 3IFNH 2HFGL 1LO0H 5EZJA 2ZG2A 1WWBX 1VFUA 1EZVX 1Q0XL 2I24N 1D5BB 1UVQB 3MLWH 4GMSH 3GEWB 4Z0BL 3KLAB 3PXHA 5GJTL 1FJ1A 2MTPA 1HWGB 3CU1A 5D1ZD 4XHQA 1C12B 3VWJB 3K46A 1FVEB 3ILQC 1OGTA 1S7TA 4KROB 1LP9F 1WF5A 4QRRD 2I26N 3U1SH 3T77B 1G7QA 3OKDA 1B4JH 2UVEA 3QEGL 1KTDA 3WFZA 4GG8A 2D03L 3B8YA 5D71L 5CJ5A 3D6GA 4XPGH 5E2JA 4L29A 2ZCKH 3WJJA 3RNKA 3QWRD 4YBLC 3U36B 5T3ZE 3WIFA 3LN5B 3STLB 5ICZB 3B3IA 2YR3A 4TUJA 1DDHA 4XMKL 1DBAH 3CJJA 1LMKA 1DEEB 4I18A 2VLMD 3EZ8A 3PHQA 3OB0K 2EDYA 4RIRA 4UB0L 4CL7A 1RU9H 1HHHA 1PKQB 4JFXA 4KGJA 4IRSD 1SY6A 3W9DA 5DS8B 2JTDA 5CMAB 1NCWL 4NQVA 2G2RA 2CKBB 5HBBA 2V2WB 3WEXA 4YDKL 3QP3A 5SWSD 3S98A 4N1CA 1YMMB 4M48H 2OR7A 3O6LH 1HCVA 2EE9A 4XP6H 3MZTA 1LEKA 3DV6B 1Z6JT 1OAUH 3G6JB 5LAXB 5EU5A 4I3RL 4K3EL 4BFGA 2NYYC 1NAMB 3P4NA 4LF3B 4X9BA 2UWEE 4TSBH 1LO4H 3EZJB 5GGUA 3MRKB 3PWVA 3QHFL 1S78C 3NN8A 5GSVA 4OGAC 1UJTA 4KRNA 1CD1B 3SHSA 3QJHA 2YWZA 2D31A 3SKOA 5IB5A 4KZEL 1EFXA 2O5ZH 4U1NA 3P77B 5C0FB 1TXKA 1RV6X 1XF3A 2BY0A 5E8EB 4Y16A 3DHMA 4N0UA 5EU3A 5GRYA 1YEIL 1IEAB 1ZTXL 4F2MA 3X3FH 1IQWL 1T5WA 4JO4H 4KJWC 2B5IC 4Y0GA 2FATH 1P1ZA 2J2ZA 5DF0A 3QI9D 3K3QA 5INCA 3FQNB 4K7FA 3ZKMD 3GMLA 3NACL 3SOBL 3TPUA 1F90L 3LRSA 1EVUA 3OG6B 3LMJL 1EAJA 2HG5B 2IANA 5I2IB 2VDKH 1Y18B 4LSDA 3CFBA 4ZAKB 3O45B 3HNSL 3QI9A 4M7ZC 1ITCA 4H5SB 3CXDH 4KKLC 1ZVSB 4N8CL 4P46C 2DQFB 2N7AA 3N9GL 1CLOL 5ID0A 1UM5H 4DQOL 2VLJA 3TN0C 2L4OA 3PV6A 4R97C 3WDHA 5DJ2A 2O5ZL 1A1NA 4PV9A 4JFFE 2VOTA 4G9FB 4HGKC 1SJEB 4UTAL 2CDFA 4WHDA 4JANA 5E7FA 1IQWH 1EEZA 4Y5VB 4KXZH 3D9AL 4GT7A 2C4XA 5CZVL 2AS5M 4YHLH 4WJ5B 4M6NL 3I6GA 4OQTL 2F58L 3BD3A 5FIEA 4U0RB 3ESVF 1T1WA 4L4VD 5E7BA 3TBYB 4MQ7A 4UB0H 4JRYA 4ODBD 1DQDL 4C59B 2VITB 3FO2A 4AEHH 3GMNA 2Q7YB 4LLQB 1RZ8B 2UYLA 4P2QB 4NO5B 5CHNA 4Y2DB 4C83B 2DJUA 5JIHA 3SDXB 2XTJD 4X7EC 4F7MA 5DRNB 4Z7WB 4ELMF 2K7QA 1C1EL 3QZWB 3KVQA 1U8OB 3FAWA 3MRHB 3MRIA 4JN1H 4HBCL 5SWZA 1A3LH 3N1MC 4JKWA 5CGYC 2NLJB 1UKQA 4ZUUA 4XP4H 4WUKH 1UZ8A 1NMAL 5BRZE 1A4JB 4IJ3C 1U93B 4X99B 5HY9A 4JY5H 4LDLB 1EGJA 3AGVA 1PKQA 4JFXB 1MREL 3BSZL 3D0LB 1MFEH 4QNPE 5HPOA 4Y1AD 1V8HA 2DQJL 3MREB 2AV1B 1FVDB 4UTBL 5DGRA 4MCYB 3D0VB 1MJJA 2CRMA 3W2DL 2IADB 3KPMA 5F44A 2FWOB 5I6XB 4M62H 3K0WA 3TCLA 4ODWA 1WCBA 4W4OC 5DJYB 4R8WL 3V2AR 4EUPA 1EO5A 3EBAA 1D5XA 5GS1B 1C5CL 4UT7H 3CFDA 4H5SA 4R2GB 4NQSA 3KLHD 2FLRT 1BOYA 5CCKL 4ZUSB 1NGZB 4QLRA 4X0KA 3U82B 4JRXD 1T20A 2VQTA 2F19L 4X6EA 3PIQB 4A6YA 4NP4L 4LRNL 3RX5A 3U7YH 5D71H 1MREH 3BSZH 4XMLH 5DD0L 2F53B 5E8PA 4JREC 5EG6C 3MRGB 4MNQA 4D9RD 4PD4K 1KCUL 4Y4FC 1UG9A 5J12B 3MFFB 3P77A 5CD5D 3TFKC 1HH6A 1NCBL 2FX9H 5AEAA 3T4AB 4M61A 3T3MF 3QDGA 4QTHB 1FCCA 3ZTJH 4AQ1B 3MV7E 1MVUA 3HI6H 3ZKNC 2FHFA 1BREA 2AXGB 3HN3A 5E08H 4XVJL 4QF1B 4NQDA 3IXAB 1CLYL 4PJCA 4EZMA 3FO2B 2R1YB 3VFUA 4F3FA 5B39G 4M7LH 3BKCH 1HHGB 5D96B 1NC4A 3BH9B 3V79C 2UWEB 2F5AL 1J8HA 2KQMA 2YPLD 2DWDA 4IRZH 2YBRB 2R1WA 2Y6SC 4XRCA 5HHOD 1KIRB 2H2SD 2DQTL 4WHTA 4J3WA 5E2TH 4L9LC 4WHYH 3GJFA 5DFTA 4PJEE 4PY7B 5JPMB 4J6RL 1PQZB 1ERNA 5MEQB 3CXHJ 4JFZL 1BVZA 4NKIH 4YQXL 1OTUC 4Z0XB 4V1DD 1ZT4B 4WU7A 3MJGX 4NC1E 3O6FD 2EC9T 5DJAB 4Y4HB 1CFNA 4I0KA 1FHGA 1UXSB 3D3VA 5JMRA 1QFWL 4B41A 4DKEH 4EN3C 3BDXA 3RHWK 5B8CB 4ZQKB 3C5ZA 3EO9H 5C0IB 1XCQB 4K8RC 4LSRH 5KVGL 1L7TH 1W2KT 2NY5C 3E8UL 1CGYA 5MI0B 3EFFB 2NW2A 5TDOA 2JJWA 1UEYA 1MCLA 1P5VA 2AKRA 2UUDK 4D8PB 1JHTB 3DYPA 1RK0A 1WISA 3C87A 4TNWF 3RJDA 1HXYB 5B38B 2IPKB 1WFTA 5HI3C 5EUOA 5I1IH 3VXPA 1PFCA 3BGAA 3QDJE 3GSUA 4P4KD 2Q20A 3ULUH 1S7QB 1E27A 1QPPA 1U3HA 2V17L 5GISL 3B5TA 4FQIH 3D25A 3GMPA 1SJXA 2AJXH 3D18A 1QRNB 3CH1A 4ONGL 3DGGB 1F90H 1FDLH 5L2JA 1A4JA 4U3CA 3NCBB 2DQUL 5HGDA 1OAKH 4RAVA 5BV7L 1NQBA 1XGQA 4N5ED 5F7FA 3S36H 3VG0H 1C16B 3JVGA 5AZ2H 1ES0A 4XT1C 3NH7L 1RJLB 4PRNA 2AEPL 2EDTA 4N0YL 5DQDL 1FP5A 5IB4A 5IHLB 2VAAA 1Q0YL 1MFDH 3FN9A 3QQ3B 1H3VA 1LK2B 2YA2A 1F11B 1R5VB 2D9QB 3FO0L 2WK2A 4DKFH 4H1LA 2CIKB 3TBSB 3REVA 3B6SA 5D1XB 4O00A 2XACC 4K3JH 4K07A 5C0AD 2IFFL 5TH2A 3OGCB 1RZKL 1N59A 3S36X 5IMMA 3ZHKA 1PX3A 1V3JA 3GMMB 4WTXA 4L5FH 3ZDZF 4F7CB 3QG7L 3ARVA 1S7VB 2O93L 4DN3L 4UT9H 4P3CH 2ED7A 1H0DB 4KC3B 4NJ9H 3WIHL 3DROB 4KHTH 4TUKH 4F7PA 1IM9A 3EYSH 1YPZB 1LWRA 2FDBP 4FZ8L 1MVUB 1SYVA 4G8EA 4F8TA 1UGNA 4LAQH 4KTYA 3SJVE 2WWKT 1UC6A 3V4UL 1NMAH 1NEZG 3IF1B 5HYFA 4BH7A 1YPZF 3STZB 3TO4C 3K2UL 3VRLE 5E99H 3WO4B 2CJUL 4J8RA 4LLAA 5F89A 3T0VA 5AWNL 4JVPA 35C8H 5EU6B 4XH2B 2EIDA 4G6JL 4N1HB 3ULVD 1AXTL 4LSRL 3RUGE 1AR1D 3L5XH 4RIRB 4GKNB 4PGJA 5IOPB 4Q6YA 2XXCB 2ICEB 4C4KO 3P9MA 5TE6H 3O41B 1CDBA 4W81A 3VD7A 2WBJD 3MJ9L 4Z95H 4RAVB 2VISA 3LN9A 1CFSA 2NY7H 4NC1C 2BVPB 4Y4HA 2F8OA 5I75B 3NFSH 5T1MB 5C71A 4PJBB 2EDHA 1A4KA 1JYVA 3VRJA 4HV8A 2DD8H 4D0BA 4WFHD 1G7PA 4WI8A 1FE8H 3BESR 5D8JL 4HH9A 1L7IH 4QHMB 5LGHH 1OAQH 3MJ6A 3GKWL 1AQKL 2AJZB 5CBEA 3T0WA 5ACMA 3VFVB 3AREC 4XX1E 1JNJA 1X5ZA 2IQ9L 1F02I 5F7WC 1LNUA 4LKCB 3CFJB 3WFDH 3FHQA 3O2VL 4Y4FB 1NSNL 3SKOB 3ARDA 3AB0B 3KYKH 5IIEA 1DQQA 3CLFH 1UM4L 1LD9A 4TSCL 3I2CL 4NHCL 3C5JA 3QIWD 2FD6L 2XZQL 3T08A 4K3JL 4JM4H 2J88L 4ZUTA 1H15B 1HHJA 2Y06L 4HUUB 3WFBH 4LLVB 4UBDC 5K93A 2DKSA 5TE7H 1NAML 2IAMC 1MRFH 3SKJL 4MA7L 1IEBA 5BVJB 3S3SA 5IESH 2PO6B 4JB9H 3H9HB 1CFVH 1U2CA 2WLZA 3G5YA 1TETH 3WIIH 3QFJB 2XZCL 2P5WD 5DT1L 4LCCB 1YNLL 3NCEB 2XY1A 4ODUA 4ZPTA 5B3NA 4V2BA 5KS9B 3TNMA 4LHUA 4D9RE 3RU8L 5MERB 4RAHA 1KIUA 1JGEB 1AHWC 4X6CF 1ADQL 2GAZA 1J1PH 3GSOA 5GGVL 1CF8L 1FN4B 5GJSH 2LU4A 2WBWB 4IMLA 4TTGA 3RVVD 3WSQH 1HOCB 3EDKA 2E8ZA 4MZ3A 2YEZA 3VFOA 1RIUH 2JB6A 4PJEB 4JM2F 1IC4L 3OJDB 5L8JB 1QNZH 6FABH 3Q6GL 1BECA 4FABH 4HWEL 5C2BL 5IB1A 2HT4D 2CGRH 2CXGA 1AGBB 5DEGA 4PY8J 1FZOA 1C7SA 1G7MA 1LILA 5H8DA 4HD9A 5EIIA 3TIDA 1WAAE 3VFMB 5C8JB 2H8PA 4DCQB 3PWPB 2H32H 3IDUA 4YXHL 1D6EB 3RL1A 5IJVA 3LKQB 4HUKB 3CFKA 4L1DA 3FT3A 2BP3A 4Q0XH 4HUWB 4QO1A 3UCRA 5C09E 4Y16D 5F7EL 4DZ8A 3DX8B 3IXTA 4RFNC 2XV6B 5DK3A 4XCNA 3VRJB 2GTZA 2HJLB 4NKOB 3IRPX 3ZSTA 5DO2D 3TO4D 3H0TA 4R7NA 2IBGA 4J4PA 2ZSWB 5KZCB 3BIAX 3CPLB 3CLFL 4M93C 4HK3N 4G80B 3VRIA 4I3RH 1V3LA 3V9FA 1FNSH 2EXWC 4XP1H 4C4KT 5JHDD 3GUTA 4EVNA 1YDPB 4ETQA 5L2KE 2ARJB 2HFFB 4PJFB 3BGFB 3FB6A 5INDB 2PW1B 2MPAH 2VUOA 4MWFB 1ACYH 4XBGA 3BPCA 4D9LL 3AAZB 4KVCL 3OXSA 3FFDA 4QRRB 3MCKA 5KAQF 3U6RB 4HCRH 5I1KL 4WGVB 1YECH 4EI5C 1FVEA 4NBYB 3O81A 4OLYH 4Q0XL 4KI1A 2CK2A 3EOAB 1KTKE 4QTHA 4UOW0 4XZUB 2WMPA 3LN4B 3KNBA 5L88H 3GSWA 2Z8VC 3QPQD 5KW9H 4HS8L 1JE6A 3QIWA 5DVLA 1NGWA 1XT5A 2AAVA 2VZVA 2HVKB 2R2EB 3UROR 5TE4L 1QEWA 2WLYA 4KKCD 3NFPA 5CEZD 1VGKB 1I8LC 3ZDXF 4PG9A 1IZJA 4P2QE 4AIZB 1MCPH 1MHHA 4RA0C 3TJHD 5C0JB 4R8WH 1EAPA 4MZ2A 3UTSE 2H3NB 4M8QB 1NGQH 2IWGA 2BERA 2ADJA 2QSVA 3MRRB 4LHUB 3PHQB 3VI4F 1D6EA 5DTFB 3SDYL 3U48A 1K4DB 5C0AA 2RCSL 5EOTB 1ZT4A 2XTLA 4YFDB 4B0MM 1YEHL 3T0ED 1YZZA 2ENYA 4KRPC 3BP6B 4DAGL 4APQD 4FQXD 1BQHG 1A1OA 2J5LB 4GRLD 4NSKA 3IDXH 2WP3O 2PYED 1MCQA 1ZSDA 5JOEA 4KVNL 1IARB 2UZYB 4MYWB 1EX0A 2ZSWA 1LK3L 2NW3B 5KSAB 1L0XA 3DOSA 5SWZD 5FGCB 4OIAA 2NPLX 2V2TB 4M02A 5JW4N 1IAOB 4GRWH 4OCRL 1KOAA 1UWGH 5EU6D 4LPXA 4MNQE 4OCSL 4MWFA 4NQDE 4PBXA 3V6FB 4XNZC 4BUGA 3HC0A 5KANI 3AB0C 1EFXB 2OLDA 3WD5L 2ZOKA 2MNUA 4Y19D 1OQXA 3E1F1 3IDXL 1LEIB 4IMKA 3NAAH 5BS0A 4UTBH 1IGFL 2MPAL 1ZLSL 3KPQB 4N8CH 1KB9J 4F9LA 3KXFA 1ES0B 1JTTA 5DLML 3RGVA 4JM2A 5I2IA 3FQWB 1A0QL 1F00I 2XN9E 4PG9B 2ZNXA 2FB4L 4WNQB 1SVCP 4F57L 1F2XK 4DN4H 2GT9A 1LDSA 2CRYA 2HJFB 4KK9C 4L8SA 4JO3L 1CIUA 5GGVY 3QIUA 4PRIA 1T03L 1RVFH 3MRRA 2H9GA 4KMLB 4MXQD 5DFWH 5C9KA 2WIIA 1OTTD 3LOWA 4UTAH 3QDGD 4O58H 3VFRB 2YN5A 5ETUA 4MLSA 1K6QL 2OL3A 4G9DB 5F97E 1NMBH 4BKLA 4ODVH 5I1LB 3TIEB 3PNWB 4LU5H 3ZYZA 4K94C 2BNQA 3AU1A 4GRMB 3U4EA 4PBVC 3BO8A 3GSRB 4K8RL 4N9GB 1S9KC 1SJHA 1OSZA 5I1EL 4M9OA 3ALPA 2W07A 3HE7A 4CN1A 4LHUG 3QAZC 1X4YA 2QQLH 2PXYC 3SCMA 2YSSB 4LLQA 2WV3A 4JDVA 1EEUA 1P7QB 3NH7H 2OR8A 1GGYA 2DICA 5K9OB 4HXAH 1PG7H 5HVGB 5BMFH 2A83B 2K7PA 3H3PL 5DURD 3W5NA 1YEIH 4KY1H 4NM8H 2PXYD 1F6AB 3WMSA 1O5DT 4U1MA 3GKZA 1NBZB 1HI6A 4HWBA 1R3LB 1MNUL 3PP4H 4P4KA 4PJIE 1OAZH 4GKNA 4JANB 5HYQB 3C5ZD 1T0NB 5C0NC 4RNRA 3QCVH 4AMKL 5J11C 3CDGA 4HF5H 5SX5H 3EFDH 3OR6B 3RPIA 5F1IB 1WCBB 2W0PA 3SGDI 4FMKA 5BOZG 4LLUA 5B22A 3IDNA 4JQVC 5T1DL 3CZJA 5IFHL 2A6DB 1HH9B 4WV1C 5H94A 5B3JF 2EDKA 4ZO8A 1UZ6F 1W72A 4LKXB 5BZWB 3W11C 4XXCC 3VWJC 2E6QA 2R2BA 1OT2A 1TZIA 3N06B 3FO1A 4M43H 4I77H 2V6HA 3JUYA 2AJUL 3QPXH 3RRQA 2XQBL 4U1KA 3BKCL 3ARDB 2BXYA 4PJ9C 4OCYH 5TF0A 3PDOA 4LP4A 5A40E 3KPPA 3CSYB 4P3DB 3U4EB 2FEEL 5HGGS 4OD1L 1BAFH 2DDQL 3EDEA 3I50L 2DI9A 4WI3A 3MV9D 3WIFB 4LSUL 4YFLI 1HEZA 2Q76B 4LVHC 3T8XB 3BPLC 1UKSA 3U0TB 5F6HI 3S88L 4ZUSA 1NGYB 1QFUH 4NKDB 3HFMH 4JRXB 1KC5L 2ICWI 4MNHB 1MQKL 4P59L 1F4YL 1QPXA 2JIXD 5E6IB 1TJHH 3RKPA 1S8DA 1GRWA 2HJKA 4CVXB 1UM5L 2CMRL 4HLJA 5DD6A 5D5MB 3P0VH 5JPNB 3EDJA 5F70A 2OL3L 5ERWA