3WHPA

Crystal structure of the c-terminal domain of themus thermophilus litr in complex with cobalamin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
192
Chain Sequence
EDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal domain of Themus thermophilus LitR in complex with cobalamin
rcsb
source organism Thermus thermophilus
molecule tags Gene regulation
molecule keywords Probable transcriptional regulator
total genus 61
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
A PF02607 B12-binding_2 B12 binding domain
A PF13411 MerR_1 MerR HTH family regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 3whpA01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 3whpA02
4HEHA 2I2XB 1CCWA 3KP1A 3REQA 3KOWA 4HH1A 3EZXA 6REQB 1REQB 1K98A 4Q37A 7REQA 5C8DA 1E1CB 1B1AA 1ID8A 5REQB 1E1CA 4R3UC 3KOYA 1Y80A 6REQA 1I9CA 2REQA 7REQB 3IVAA 3BULA 1BE1A 2YXBA 2REQB 3KOXA 4HH3C 1CB7A 4REQA 2XIQA 5REQA 2XIJA 1XRSB 4REQB 3REQB 3KOZA 1FMFA 3BICA 1K7YA 3IV9A 3WHPA 4HH0A 1BMTA 4JGIA 1REQA
chains in the Genus database with same CATH superfamily
4NZMA 4PZLA 2VPWA 3D8BA 3HYRA 4EITA 5HOEA 4IRXA 3MBKA 4ZMSA 1XG5A 1IONA 4B2LA 2DFLA 3UK1A 2O59A 1P1JA 5IVPA 3JASB 1M8GA 4KACA 1E2GA 1SXJB 4UMFA 3UZUA 1QF9A 4UUNA 3NXKA 3PF8A 2Z8YM 4QTXA 1KJJA 2X0RA 3ZY2A 1PS0A 4ZAWA 5ERXA 1EXNA 1NBWB 1PG2A 3AR2A 4GDMA 3WLRA 1OX4B 3W8RA 4I2VA 2D3WA 4LE2A 4UAUA 2WIAA 4MDFA 3S2EA 1WABA 3DXFA 3T3IA 2HV9A 2BKAA 2QQEA 5DX1A 5EPOA 5JRJA 1JU4A 4ATNA 4HWOA 4RVFA 2OXRA 5K3OA 5DGDA 3H1BA 4RJIA 3MRVA 4BNTA 2B6HA 3FMFA 3NANA 4R8RA 1EGVB 2WE7A 2VA8A 5LCXA 3V4PB 5G1NA 2G4VA 2PGIA 2GXAA 2ZSIA 4QTUB 1KORA 3RTDA 1FYWA 1HQKA 1KK0A 5B36A 1U7HA 2EC5A 1CHDA 2PSHA 4FYKA 4LBVA 3U4GA 2BBWA 3GELA 4YRSA 4GBJA 2Q29A 1PU2A 1I2ZA 2P62A 2VC2B 1GADO 3L7DA 3ETHA 4KFTA 5A7HA 2VPPA 2Q5IA 2G9VA 2OM6A 2PX4A 3AFMA 4HYEA 4RVDA 4TLEA 4ZKEA 3WLSA 5CDFE 3PR3A 4NNPA 5K9ZA 2DWQA 5CVTA 1A8QA 4O02B 2X0FA 2YFKA 3AM5A 5HDBB 4JELA 3WI7A 3HRHA 1EJBA 1GVHA 4JLBA 4CLEA 3BTUA 2W6ID 4DMFA 2C4VA 2O07A 1VHTA 1S7GA 3A36A 3K1AA 3M1YA 3M4YA 1PFKA 4QDUA 1L7VC 4O4LA 1P29A 4DLNA 3LVFO 4WBNF 2XF2A 1CQPA 2XMGA 4QHSA 2VQDA 1EQ2A 4YCAA 3IE0A 3L0CA 4EO7A 4QGHA 5KDDA 4G0OA 4TMZA 2FX3A 3QQ5A 2H4ZA 2W6IA 3OVMA 2W37A 1KGSA 3Q7PA 1UJ2A 4C22A 4L9RA 5SZKB 2HSDA 2HX1A 4HDKB 3VO1A 2QSZA 4X8MA 4X91A 1ZI6A 4Y2VA 3IUMA 2AQIA 4P58A 1GQYA 2PVCA 5AKLA 3HU1A 4QOFA 4AYWA 3DTVA 2BEKA 1CDDA 3ZGLA 2BBOA 4DILA 5T7BA 4I50B 2CZGA 2WWXA 3ICCA 2VF7A 2YICA 1DGQA 1GKIA 4FCWA 2ZUTA 3ZD9A 1WZUA 1M8FA 4Z9FA 3ND6A 2CLCX 5JHGB 5EFOA 2B21A 1ZITA 2UYOA 3O1IC 4YEDA 3LBHA 3IKLA 1NF2A 2F1RA 2IYAA 3A3NA 3QX8A 4OOEA 5EE5B 2Y0EA 2P5TB 1NLUA 1W0JA 1NVEA 2C96A 2CUTA 2HFJA 1QZUA 2WTAA 5CA0B 2GFQA 4P83A 2J0UA 1H2HA 3K9GA 3NDJA 4WXMA 2V6GA 3RKUA 3EPRA 4UUPA 3OUZA 1M7BA 1AGPA 3O2JA 2C8JA 4KQEA 4R3NA 3WWOA 4AU1A 2WPDD 2VPXA 2ROQA 3HNPA 4ZCQA 4DCPA 4EG8A 1OH8A 1CB7A 1VCMA 1D2HA 4UBOA 3UV3A 3VNAA 4RD6A 5FI0B 5C4GB 4DIOA 2IHZA 2NTVA 2V98A 3HUUA 4PYMA 3IT2A 3CXUA 3OPVA 4XIGS 3OIDA 1JHPA 1MAUA 1Q1EA 2OHIA 2UAGA 2JFFA 5F64A 1NAHA 4TSRA 1KKMA 4CLXA 5BN5B 3USES 4TXNA 2DLCX 1QRDA 1E2KA 4AS3A 1UDBA 1ZNZA 3I2KA 1BRMA 1G59A 2B98A 2YN4A 1OW3B 4PNZA 4AZ3B 2VDUE 1V6CA 3UHOA 1HI9A 1MH1A 2YYAA 1MW9X 5CYFA 5J2TF 1U6KA 3WGGA 2A94A 3STUA 3AL2A 1UJ6A 3OCWA 4QM6A 1Z06A 4V1CA 2GD0A 4ZO8A 2GTPA 3KQUA 1JTEA 4QYWA 1IPEA 1IUNA 3IQIX 4K3UA 3SJ7A 3BXOA 1AVTA 4HQ0A 2IXDA 1D6NA 2ZRFA 4K88A 4B73A 1CJVC 2GILA 5IVDA 2WG1A 4YYEA 4UBMA 3P26A 3RFTA 4WW0A 1X7GA 2H3EA 1PJCA 4EECA 3FYUC 3IUSA 1K6MA 2QRLA 3QLJA 4QQFA 3ZNPA 2EFDB 3K05A 4KKXB 1YKSA 3T7EA 3ZTWA 4ZN6A 4JQZA 4OJKA 1TK9A 1MENA 3D4BA 3VPHA 4B9AA 1QRRA 1AB6A 1YIDA 2DTEA 2A84A 2XGSA 4LOHA 5EJMA 2WOJA 3KV1A 1O58A 3HSYA 3OX4A 1RR6A 1EVIA 1XUOA 4O1IA 5EPEA 1ZX1A 4A8JB 1UL1X 3QKRA 4XWYA 1SHZA 2GN6A 5GTDA 3V1YA 2FGJA 1KY5A 2BFFA 3OT4A 4WD3A 1RADA 3R7WA 4EABA 1SXIA 4YDQA 3IBYA 3LTNC 3PJEA 1GDDA 3CX4A 3RG2A 1LWNA 2ZSFA 1G21B 3HDVA 4G8CA 2EDAA 4L4SA 4EFLA 3L1KA 1Z68A 4P33A 3MHTA 2VEOA 2GHRA 3D02A 3VR6D 5EIXA 4LK2A 5IPFA 1OILA 3Q72A 1W0KA 3U40A 4HWTA 2WM3A 4K9PA 2F67A 2NUPB 1MX1A 3G2IA 3WVNA 3LW8A 5CFPA 1JFTA 2AZ4A 1N2JA 1Q5PA 1QAQA 4LRUA 3MWDA 1J0EA 4NVRA 4F3TA 5FPYA 4PFQA 1AGRA 3V3TA 1JFFA 2HA3A 3VTFA 3L9WA 4UARA 4L9AA 4G4JA 2WZBA 3IIKA 1W4LA 1ZGZA 4D0NA 2NO4A 2LPMA 4YRQA 5AJUA 3QE9Y 1E5TA 1XCJA 1N9GA 2RHGB 1YRWA 3MMPA 3VSBA 3QYPA 3SC4A 4BKRA 3BD9A 4LFAB 1M2GA 2JIBA 1U7DA 4HH1A 5JZVA 2JLYA 1Y82A 4XGQA 3BL8A 2L17A 4JBXA 1KAHA 1M8KA 3KPYA 4X20A 5REQB 4EYGA 3THWA 2ZIVB 3QJGA 3DZIA 3QWHA 5CD1A 3KBOA 1EK6A 1SCUB 3SZOA 2FRDC 2ZYSA 2ZDQA 3N2EA 4M1EA 4PO1A 1N32B 4QYMA 2DF8A 1RJ9A 3EISA 2BGGA 2YFQA 4KLZA 4LJ7A 5A4FS 1MQAA 4C4RA 3THXB 3INGA 2G25A 4NK4A 1NVVR 1WUYA 4BZQA 1I2AA 1XQWA 1J7JA 1PYGA 4DR1B 1HX7A 2A0UA 3I9V6 5KSWB 2FSUA 1WPQA 1XD2A 4BJ3A 5HBRA 3DTTA 2ZYRA 3MD0A 5DIFA 4M86A 1RXCA 4TTVA 1UFKA 1SQFA 1YI8A 2BI8A 3GUHA 1R9NA 5JYCA 3URKA 1A9SA 3S28A 4DPMA 1P2GA 4F46A 2ERYA 1ENOA 3DD1A 5IABA 1T8YA 2B61A 3IUYA 4HGRA 5F52A 2J48A 1FFXB 3F47A 1FFAA 1H0KA 1C0EA 4JFAA 3MTQA 1KR5A 2HJRA 3MPOA 2C5EA 3EUAA 1VJGA 3AKCA 3K5IA 1XO1A 4Z7QB 4F4DA 2WD8A 2P27A 4PQRA 2GZRA 4MCHA 1DXYA 4R0MA 4HWSA 1VP9A 1E4OA 1XN1A 4I1YA 5JI3E 1NE2A 3H7AA 2FB9A 4US1R 3SR0A 1HMYA 2WINI 2DBZA 1LFDB 3NAQA 3WE7A 4AW9A 3HJBA 1EBFA 2IEDA 4IINA 1JUDA 4TKZA 4DLVA 4OXIA 5L9AA 3EZ9A 3HTXA 1SXPA 1N1GA 3QITA 1PWHA 1UBEA 4NOKA 3LT1A 1GNRA 3WYEA 2OENG 3NTRA 3PHBE 1MORA 3SDZA 4CNQA 1A5AB 2BHRA 3RHTA 2NUTB 4RDCA 3R74A 4ZMRA 3TD9A 3BMOB 3QA9A 2XVXA 1WY5A 3INRA 3J80A 4LVOA 2HH9A 2WUVA 1GKYA 4XCXA 3U7QA 2REXB 4TTTS 3A2NA 2CLIB 4TKMA 5CX1B 4Q9HA 2GYUA 1A72A 1HLGA 2HA0A 4H77A 3ORFA 4K2HA 2BN4A 5DYTA 3RSQA 3B52X 4OBWA 4Y2XA 4CIWA 1EP1B 1B0UA 5DN6A 4B4VA 3NHAA 2BF7A 4HLCA 5E7MA 2Q4TA 3MGAA 4NZNA 4GLJA 4U7DA 1N1MA 4K05A 4B3IA 3JATA 4AJKA 1PK8A 1UJ5A 1G8MA 1G66A 5BR1A 4QEDA 3RRBA 3OEHD 3VVBA 1SKUA 2VYNA 3AB7A 4IDBA 1KWKA 3AVQA 4URFA 2V3VA 5HTKA 1VRVA 7GPBA 5D51S 1Y6ZA 2C03A 3A9TA 1JKJB 1WMSA 2EW1A 1OC2A 4HZIA 5DNYB 3VNRA 2C7OA 1QIDA 1D0SA 1A2OA 3UGJA 3R0QA 4PAWA 1FF9A 1WUHS 2W2XA 1SC9A 1VJ0A 2GJ9A 2QTBA 2VN8A 3K5WA 3NKVA 4P82A 3E6AA 5CT9A 4IX1A 1UKVY 3BE8A 5ESWA 3Q8LA 3TAHA 1PYOA 1TVKB 4YMSA 4RAOA 2WHXA 5B57C 4NK5A 1L3CA 2QI9F 4IRMA 1KAOA 3WTBA 1TU3A 1I2DA 1RKXA 3WL7A 2RBEA 4ZQCB 3VSEA 4QG3A 1C7QA 4FW9A 3E18A 2JNWA 4JD5A 5KTNA 2C04A 4LEIA 1F1BA 1DDGA 3TOZA 1HYHA 2Y76A 2CEKA 3TEMA 5JNUA 4UUMA 2Y67A 2IGTA 2GESA 4DDVA 3OQ1A 1ILEA 5DYWA 1N2CA 5C2JB 1YU6A 4YCBA 5AM0A 1KZHA 3RFCA 2Q7DA 2HPZA 3BRWA 1JKIA 3QLUA 4NDAA 3TSOA 1C3OA 4B6QA 1PDWA 3U4HA 1SUBA 2ZPTX 3D7KA 5A3JA 4ZYXA 4UTXA 1M1YA 4BMSA 4G86A 3R41A 2XITA 4MCJA 1IQPA 5A0FA 3WLNA 2CVHA 3NTVA 3P9KA 4QNNA 3M3DA 4JL6A 2ZSHA 1UKYA 1Q19A 2A2ZA 3BYZA 3FDFA 3NHZA 1SXHA 1PNTA 2O1SA 2YV3A 4LYFA 1LS1A 5FJJA 3WMGA 3ZR4B 1C8BA 5AW5A 1PGPA 4ZGGA 3BB3A 2HXYA 1DJOA 4HH0A 4A27A 3A37A 1JR3E 3DAOA 3B3FA 3ZX4A 2ZQ5A 3W5DA 2H31A 2X2OA 1KHHA 1KJIA 1T5BA 4RMGA 2D3TA 4PBSA 2BZ1A 3KKKA 3LLMA 1PX0A 3OZXA 1O57A 3K53A 2H8GA 2Q45A 3WWYA 2DP4E 3FCUB 4PS1A 5K3BA 4BQSA 3OEED 5F7JA 3QU2A 2W2LD 2WHQA 3BOSA 4EG1A 1WXHA 3OX2A 5A2GA 4WL0A 4BU0A 4GM4A 2ZREA 2XMDA 4RKFA 4XTCS 2Q07A 2IE0A 2IPOA 3D3EA 3EFBA 1E2UA 1EVLA 5DI9A 1OI4A 4ZD6A 3NHMA 3ZCQA 1S2GA 4F4JA 5TB5A 3AQ4A 3ZE9A 4W7SA 2CFIA 4KE7A 4INPA 3QV2A 4EMTA 3WFZA 1UPAA 2AJBA 4J29A 3W3AD 3KAJA 3DAGA 4O4IA 1XD2B 1K2VN 3QK7A 3VR5H 4DV3B 2ZI4A 4LHVA 1IDOA 3KWJA 1C1XA 5DJ5A 4C7JA 2ADOA 3WDSA 5ALZA 4I9HA 3OLXA 5IS2A 1RM4A 1KH1A 1ZL0A 3AR5A 1Z2AA 3HABA 1J06A 2BFCB 2JLQA 2KPOA 3KKLA 3L8DA 3KV3O 1YASA 1Z0UA 2MSCB 1FNCA 3EGDB 2V7UA 3GB9A 2HIAA 2VUHB 3BDVA 3HU3A 3O21A 4XM1A 4ZU3A 3RREA 3FUCA 5EIAA 1EFTA 3VRHA 1TEHA 1EFHA 3MSXA 4OAOA 1IZYA 2F1IA 1M34A 2Y27A 4WECA 4DYDA 1XAIA 2W8ZA 3HE3A 3ROXA 1CVRA 1LNQA 2GEUA 2R7AA 3NM6B 3RTAA 3SR3A 5LOVA 1AMUA 1U9YA 1EE1A 3IV9A 3R7DA 4EUNA 1V6SA 3UUGA 3T5AA 2R6AA 1EHYA 4FWTA 1E7SA 3E4DA 4PLFA 1UAYA 4IVQA 1OREA 5D3QA 2JIQA 3G0BA 3WR5A 4CG2A 5ICSA 1KYXA 2D06A 2A9PA 2IJGX 2HJWA 4LXGA 1SUSA 1IOZA 1QRTA 3PWZA 1XNQB 1GPJA 3WA7A 4BJ6A 4MQUA 3O8OA 1YJBA 2XNKA 4OYLA 4S1WA 4W1SA 2YRXA 1V8FA 4XGNA 3UK2A 4DWWA 5BVHB 3GLQA 4HDRB 3VH3A 3H2GA 1V1RB 5AW2A 4TYWA 4KH0A 2DH6A 2E4AA 1SIUA 1DIGA 2I55A 2Q1YA 3OFND 5AHWA 4ANFA 4EKNB 1R8XA 1HEYA 2ON6A 5H4GA 1D0IA 1II8A 5EKDA 3KHUA 3BJMA 3CKMA 4ZVLA 1YR7A 1U90A 3PPXA 2D5LA 3O5AA 4WZAA 5DH9A 5G0WA 3AY6A 4C76A 3PUHA 1KA9H 1ONNA 4IDFA 1FBNA 3FKSD 2WHEA 1KU0A 2HUNA 3LP6A 5C5IA 1L4FA 1L7PA 3KXLA 5A71A 1TFUA 2AG6A 4QOHA 4Y9DA 1XTTA 3ESDA 4EB6B 5LQAA 1DLJA 2L42A 3NRBA 2P5SA 2ZRIA 1CRZA 3FBWA 2Y66A 3NAGA 1QVRA 2QX7A 2FF7A 2GN1A 4ZOLB 1FZTA 3DBOB 1GQOA 1RXIA 4TUYF 1YRQA 3TN7A 5DWDA 1Z7YA 5A62A 1OE0A 2R8PA 4M9ZA 5TF0A 2WYVA 4GZMA 4XW2A 5CCEA 3JWHA 3ADKA 4LDRA 1EHIA 1H23A 4C01A 2PZLA 2YHAA 3E2PA 3WNCA 2VQ3A 2IHNA 2JGIA 1BEEA 4X7PA 3WYAA 3QOYA 4A36A 5JT1A 1MG5A 1IMOA 3LYHA 4ZVVA 4D2IA 2D1YA 4ZDIA 5KYNA 2P7HA 4D02A 1DEAA 3TLMA 4NKRA 1ZESA 2JJ1D 1LBHA 2PX2A 2ZRPA 4WIAA 3SLKA 3WGJA 3IP9A 1DBVO 1XAJA 4Y2GA 5EHZA 2Y9MB 4LQLA 4TZ0A 5EZYA 3FCYA 3HEMA 4PLWA 5KI6A 4QGSA 1L2TA 4Z4FA 1BH6A 3L1UA 4PQYA 1XMJA 1MV8A 3ODPA 5HP4A 3GJRA 4H1UA 4WOPA 4RD2A 3EZFA 2QRHA 4JT8A 1Y34E 1V3VA 3AU8A 1EA5A 1JDNA 1WHTA 3FCSB 4X1YA 1L7RA 5BWLA 3HYCA 3H3JA 4GXTA 3JAKA 1OLSB 3ZH2A 1DOHA 4QPNA 3RC2A 4B6SA 1F20A 1P9RA 2NO5A 3QLTA 5E9AA 4DCOA 4RA9A 4DSNA 3BE6A 3TEJA 3EG9A 3M6WA 2ZVDA 4TTSA 2F48A 5LMZA 2YMLA 3H05A 1BN7A 3EDQA 4OGLA 1PFUA 1U1GA 1MKYA 3U7RA 4IVPA 4GOOD 3NJ8A 1NY5A 4BMNA 3DHNA 1XQ1A 4GLLA 1UUFA 1XKQA 1ZK2A 3AW8A 4M4SA 4MGEA 4QBIA 1UWKA 3ULKA 1EBBA 5DWQA 3D5TA 3FLAA 4IIDA 4PFSA 2IITA 2NQ8A 4A2QA 4D0LB 1HRDA 4ZCLA 4AAYA 1Y1QA 3T3DA 4Z1OA 4ZK2A 3IT3A 4M22A 1T9KA 2I80A 3IPXA 4LJ4A 5DISB 1W88A 1TYDE 2MINA 2WP0A 4JR2A 4UCQA 2V3CC 1DARA 1PT8A 1ZNXA 2P6OA 4RA6B 4C2AA 1G64A 1UPUA 1WHSA 1PAUA 2C54A 2OAEA 3O1HB 4OI2A 4E6EA 2I8AA 2P3SA 2QP4A 3K1YA 1OA1A 4YGYA 3HP1A 5GVRA 1XZMA 3OJLA 3EDMA 4FR2A 1RLOA 1K06A 4C7XA 5J2TA 3ABQB 2I8LA 3N5KA 4UAGA 3BB4A 3RDPA 2A1UB 2ZB2A 3D54D 4EBBA 4WLUA 2J30A 3RU7A 4D56A 4CIBA 5K4HA 2C98A 1QE5A 3TD2A 1R3UA 1W5EA 2JD1A 1J22A 3JZMA 2VK4A 4JMPA 1EUDA 5CM2Z 2WV7A 2Q2VA 4YREA 5A3RA 2DFKB 1KE2A 4P1ZA 3CF0A 5EQJB 5H4HA 1JPVA 3UUFA 2Q28A 3AFIA 2ID4A 1GT6A 3IA7A 3GDWA 2I3ZA 3MS7A 5DM70 3ZEAA 2YWHA 4BC1A 3FD8A 4UCWA 5DMXA 5I9SA 1SLYA 3X1WA 4DZZA 3O8DA 1IBMB 1F3OA 2X9VA 1DAHA 3CUEF 1V4NA 3RIEA 3BAFA 3FNFA 4J9UE 4N7BA 4MVJH 3IE1A 1NL3A 1M8PA 3QW2A 4X00A 3U17A 3ZJ4A 2Q4EA 3LBYA 3COJA 3HPRA 1PEAA 3CRZA 3G5UA 2J9RA 1WB9A 2FEOA 4RNDB 4GYKA 4AO7A 1B41A 1Y1LA 3MAAC 3TGWA 1K0UA 1GNSA 1SUDA 1LLCA 4HZUB 3WKBA 3M4NA 1N7JA 2B0CA 3U4QB 1KMIY 4MB6A 3DMTA 2N42A 4M1MA 3AJRA 4LBWA 5AJWA 3D8RA 1ONOA 5FR2A 1RWNA 5TS3A 3DW3X 1CQJA 4NU8X 1PQPA 5CDTA 1K9VF 3FRJA 3N1UA 3DAHA 2KB0A 1IIRA 1N2OA 3U7JA 1M6NA 4OHFA 1GA4A 4RPJA 1JLLB 2EBUA 3NU1A 2FZEA 4TV9F 5BN4B 2C7RA 1Q11A 2WAAA 1PP4A 2XCOA 4MI9A 4U0KA 2Q49A 2YUTA 1U1EA 4MTLA 4F60A 1SUYA 2IYUA 2ERXA 2ZTVA 2VUUA 2XEXA 3CM0A 3DBHA 2MDTA 4IOLA 4RFLA 3RK0A 4EH1A 3S81A 2K7FA 3O73A 1KEPA 3EYAA 1O94C 1ZD9A 5FI5A 1YFJA 4JJ8A 2XY4A 3HKCA 4A5SA 5FDFA 5FNVB 2P67A 3AINA 6LDHA 3C48A 3WGHA 5JWRA 1A69A 1CE8B 3RGWS 2HAEA 2JIDA 1Q6ZA 1LQ2A 3AERB 2UYQA 3FBTA 2RBKA 2VUTA 1OYVA 2ZJ2A 5JRZA 2GO7A 2X7XA 3HZZA 5J47A 2IZOA 3G8BA 1UM8A 2DUNA 2Y93A 3IP7A 3IUEA 4FD2A 2PA3A 5CM8B 5F12A 2FLVA 3QKUA 2QE6A 3SQDA 2DUJA 4FFBA 4WFIA 4BV9A 4BX9A 1I6MA 2ESRA 3G8YA 4UTRA 1EBUA 1I0IA 3IAFA 4YCJA 1BHQ1 4DSUA 1QZZA 1CZHA 5TMDA 5IAGA 2I3BA 4HPXB 5EY5B 2HIGA 4EAAA 3PJRA 2BM9A 2JFHA 3ANMA 3OD1A 4LJ6A 4IXMA 1QCYA 5HM6A 5L7YA 2G40A 3GAZA 4BN5A 3GCWA 3MCWA 1FDSA 4DLRA 1EG2A 4JH0A 5ARCA 4FFMA 1IH8A 3KYJB 4R1TA 2P30A 4R1LA 4XVHA 5CXSA 4OCZA 4TS1A 3RE1A 3T0GA 2PNFA 4S24A 2Q2WA 5A9RA 5IF9A 1U6JA 5IX8A 1MGPA 3FJYA 4OP1A 4G0WA 2PS1A 1ISSA 4J90A 3W6UA 1RZVA 5FFMA 4BTVA 5HKKD 2BEWA 3NHFA 1YB7A 4QUIA 3UIEA 2BI7A 1T4CB 2Q3CA 2GZHA 3MJTA 3S7TA 2NWQA 2O1EA 1XFDA 2JDIA 3ECCA 1U3FA 4KQ1A 1QQ7A 4ND5A 3WGYA 4ZC1A 5LQJA 1YQWA 1ZFNA 4N41A 1KI4A 3DMPA 2I67A 3LQQA 2LCIA 1FFYA 2X9QA 5AW9A 4WKCA 4A6DA 1KTIA 2EBWA 2J5RA 4L78A 2NZXA 5A9SA 2XV1A 4FMPA 4BKUA 2O8DB 2Y0BA 3U1BA 3Q6IA 2BMDA 3WFJA 2RG1A 5CA0A 1HDOA 4XWWA 1U98A 2RG7A 3FUWA 4OBEA 5FB3A 1D0VA 1VSVA 3C6MA 3ZQJA 4EJSA 4F5DA 1GN8A 3G49A 4YJ3F 5ES4B 5G1PA 2O8EB 4OQXA 3VC2A 1SNYA 1E5VA 4KSYA 1J21A 1Z4JA 5AT1A 1E6LA 2P9QA 1RXYA 4RABA 4F38A 2QU8A 3SKXA 3L6UA 1KAEA 3PI6A 1XDBA 1I13A 2VH5R 5BO5A 4E15A 1YJXA 3K2IA 2O3RA 3OBIA 5CFOA 1NTRA 5M5BA 4MR7B 1ES9A 2UZIR 5JZ9A 4RHYA 5EVJA 3U3DA 2IEBA 4WOCA 3IDQA 4KE9A 3ZC3A 5JXGA 4MRRA 2RD2A 4Y6OA 3ET5A 4US2R 1YD7A 4Q3CA 4UUQA 1ZSVA 1CP2A 2EVWX 2H9YA 2JJQA 2V0CA 3K9BA 3PWKA 4LECA 4R16A 4R98A 2R62A 3RS2A 3NUQA 3OCVA 3WJ7A 1QJCA 5GY7A 5DNDA 4EB0A 1G17A 1F3LA 5GV7A 3TLKA 1L5HB 1D2AA 4URVR 3EWNA 1GPBA 1S9DA 1L4LA 1KIFA 1SH7A 1SM4A 1U2ZA 3GEMA 3I1FA 1D2GA 2XX3A 3L04A 3K9NA 4MUNA 1G21E 2IYWA 1T5DX 2EX1A 3ORSA 4EHKA 1HE1C 5CA1B 3DVQX 2P2DA 3IOMA 3DMFA 4CF3A 1C4WA 1QHFA 4BO4A 2GJKA 1PJBA 2VHEA 3TJRA 3GBSA 1WKCA 2OCBA 3CZMA 2GN0A 4L2IB 3WHIA 1VPTA 2ZJBA 4ZC8A 5T4BA 5KINB 2PXAA 3OTQA 4Z7OB 3F5FA 4UQPA 1R00A 3TXXA 2GBPA 5B4VA 1K97A 4PN7A 4XQ9A 2Q1SA 1N2CB 4DREA 3LZ6A 2VWHA 1XPUA 5B3JA 4GI3A 5FBVB 4FX5A 4QFBA 5E9QA 4YUXA 4DRYA 3R0IA 1JQKA 1KI9A 3WLAA 1A2KC 1J4AA 1PWZA 3NHBA 3ORRA 3QELB 2ODPA 4B7UA 4JVNA 4BP3A 2DB3A 4NABA 2P5YA 2AQ8A 4N3NA 4X54A 4JVSB 4KPEC 3G9QA 3QVLA 4JC5A 4JXJA 4UU8A 2ZCVA 5FO1A 3KK0A 5B12A 2YHIA 4JSTA 1Z36A 3KUKA 1CVLA 5TRTA 3PDWA 1GEGA 1G0OA 1QAOA 2A88A 4CDNA 1AKTA 1YAJA 3VJLA 2VJYA 4ZHSA 2NG1A 1NSYA 3GLFE 3S44A 3GJYA 4KP7A 5FPPA 3UAWA 4YAIA 4YRTA 2LKCA 3R44A 1QSAA 3P9NA 3P94A 4TT8A 2H5EA 5I45A 2O8CA 3PGVA 1K4YA 2NPOA 1Z5NA 4EY8A 2CLFB 4WXEA 4GPTA 2O5CA 2QRKA 3T61A 2FEWB 4H7IA 4L4ZA 4GD3Q 1YOVB 2CXRA 3EOAI 3JATB 1H8EA 2WKPA 3OICA 4YMHA 3TG8A 3LPLA 2DBYA 3NG1A 1T0IA 3UAVA 3B51X 2AYZA 3F6PA 5IUKC 4EP1A 4B31A 1STOA 5K0SA 2W9XA 4CMEC 3DZDA 1P4RA 1YI1A 1YB5A 4NS4A 4UNIA 3GEEA 1Y4AE 2LUOA 4MWGA 4OG2A 1KMHB 1EXVA 4GAEA 3R5JA 1HE2A 5ADVA 1IY2A 1TC2A 3DM5A 4WK2B 3MTGA 5EG5A 1DPFA 1KIAA 2AD1A 3AXSA 3O82A 3RK4A 4N8EA 1IXSB 3LXXA 1I33A 4PSDA 5F2EA 4E33A 4JBYA 3U44B 1Z6AA 1QKIA 1XU9A 2CUNA 3Q0IA 1IZ0A 5B3AA 1LCIA 3DBLB 1FJ2A 4GLBA 4H08A 3MLAA 3OTWA 1J8DA 3BMQA 4GXNA 4XDHA 4AJJA 4DRXB 3UN1A 2FE4A 1LDBA 4QAQA 3FGZA 2FW0A 3LV8A 1GPUA 4PCLA 3KHTA 4DVGA 1K5HA 1YNOA 4RH3A 2E89A 3OLCX 4XA8A 3R9IA 5SY6A 4COKA 1BFUA 3MWEA 4GBMA 1J42A 4NBNA 4D57A 5A0TA 1HNXB 2FPGA 4O33A 5DN9A 1I3CA 2AH5A 2YINC 4NNJA 3V8VA 4YDRA 4RGBA 2PZMA 3UH1A 4DSAA 1FFXA 2RJOA 3JQAB 3PUJA 1WAMA 2P90A 2W0SA 1T0HB 1BO6A 1GNPA 4BHTA 2VYCA 1V4VA 1U28A 3A4IA 1XP8A 1EP3B 5ICMA 2NO1A 5E4FA 4RE6A 4HBZA 3SC6A 2IZ7A 1N6RA 1DEKA 2QGZA 1CC1S 1RJ9B 4XPZA 3SXPA 5IDXA 2PRJA 3L4JA 1DTWA 1B1CA 1IB6A 1V35A 2B25A 5EHIA 1I9GA 1VYHA 3HFSA 3I2GA 4H7JA 4D45A 4CM1A 1KQOA 5BUQA 1QQ5A 4YP7A 2NVOA 2JGNA 2VI5A 3DV9A 3A1CA 3E8SA 3CF4G 3DWGA 1MFPA 1QPBA 2PJDA 4GX1A 4MPPA 4ER7A 2J3LA 5CNIA 3LUCA 1XB2A 5G4KB 5D6NA 2IX9A 3C8DA 1YR8A 2XRYA 3W5UA 1NIJA 1HDGO 1ZUD1 4DTIA 1Z15A 2GJ4A 2N1MA 5DM4A 1KHTA 2O0JA 5FQOA 5DBGA 1UIRA 3MERA 1YMVA 2D0OB 3GN1A 3VVMA 5A6VA 4RULA 2D7JA 1CJBA 1SKMA 3RAEC 1MJ5A 4UEKA 1PUJA 4BV2A 1WDWB 4CCWA 2VTBA 3PD1A 2DQZA 1V43A 3PQ7A 5E4YA 1JQ5A 1TF7A 2W2TA 4DM4A 3AUJB 4WNAA 1JLMA 3W9SA 1THZA 5K8TA 5LMCA 4EA6A 3B3QA 2WPDA 3PVSA 2GWRA 1JHYA 2JI4A 2CWWA 4GHWA 4MULA 1VSQA 3EAFA 1AKUA 4EVRA 3MJFA 3LPCA 1XV5A 5DXJA 2OC4A 2YZMA 3AFHA 4G5OA 3O8QB 5J4HA 3HCNA 4CYMA 5BWNA 1TADA 2IP1A 2R4QA 2IP4A 2YIMA 3NWEA 1W44A 3OQVA 5CAEB 3SEZA 3AEKA 3M6XA 3GAMA 1SG0A 5KU1A 1MQ9A 3OLWA 4D9JA 4F91B 2OLKA 3R20A 1YBMA 3PGMA 4BMOB 4J7XA 1JYEA 3KZXA 4OGGA 4I50F 5IT4A 4D26A 3ZVRA 3PITA 4RWZA 5C9ZA 3NCTA 1E77A 4WDRA 3V48A 2PH7A 3FTPA 3H97A 2RAVA 2KHZA 4NOJA 4O59O 1X92A 4ENRA 3BA6A 1RYMA 2IP2A 1VJ1A 2XNDA 3ZV5A 5C5CA 3AVTA 3TE7A 2VQEB 3IILA 1ISMA 3EGEA 3V4LA 3ZWNA 5BV7A 1UR5A 4LQ4A 2X58A 3EPLA 3EFEA 4KAXA 4B82A 2OCIA 3L7NA 2EQ5A 2EX4A 4QXPA 1NMYA 4XQ0A 5C0OE 4V02A 2G8NA 4OXYA 4UULA 1NURA 2QM0A 2B4RO 4KXLA 4OL9A 2I54A 5WRFA 3TUJC 5HWSA 4AJOA 4X9XA 5TGTA 4NIMA 2ZIXB 3F0TA 1VZ3A 1CUFA 5EWJB 2JH9A 2X15A 1T4GA 4HAWA 4J4HA 4NXMB 2V6BA 3QY9A 4IXNA 3L84A 1KJ9A 5TSDA 1DXHA 1M6WA 2IS6A 4V0NA 3JQ8B 1J9ZA 3N7TA 4OMDA 3OWHA 3HEAA 3OPXA 2GK3A 4UFNA 1ZXLA 3HC7A 2C4UA 2PRSA 4E07A 1V8OA 1DRJA 4MLDA 3LMKA 1TCCA 4C4TA 2YJ6A 1T8WA 3E53A 3I9LA 1AV7A 3U44A 4C0WA 4G01B 2B9EA 1SRRA 2EL7A 2YH2A 3ITNA 5JTUA 3HL4A 3P4XA 4IS2A 1Z2EA 4HAVA 3NP9A 4HDOB 3W05A 3AYZB 5E2BA 2P7IA 1O03A 3IBTA 3ZWMA 4BMZA 2FP3A 4N1AA 3RIYA 4MAMA 3Q98A 5IT9A 2XGOA 4R9VA 4YALA 2VJBA 4ND6A 4MCAA 1DJQA 5JS8A 2A0YA 1YFLA 2FXVA 2AKEA 3ASZA 4I1OA 3EODA 1YRLA 1ZXBA 3PFWO 1PLKA 1K8YB 4PLYA 4U5XA 3TNJA 4ECAA 3KB2A 1JEYA 4PONA 4ZARA 4YUVA 1SBCA 4POAA 3BWDD 3OQIB 1E8DA 3EFHA 4CQMB 1Q17A 4IVNA 4L3VA 1BE0A 4FTWA 2XVYA 2J9GA 1XZFA 5J4VA 1JH8A 3TI9A 2REQA 2GETA 1N5RA 3GWGA 3K8QA 3KM0A 3ZW9A 2CV0A 4R1OA 1M6HA 1DP4A 1I4EB 1NKTA 1R9JA 2QQFA 3WYNA 3WKDA 3KD2A 3AUUA 1SJ9A 4Z7NB 1ULAA 3OBBA 4KXYA 3FH0A 1YZGA 1BMFD 1PT5A 4OSOA 1C9NA 5IZ4A 5E2IA 1NYLA 1WEHA 3GXOA 5KKNB 3QGMA 1E64A 4JDUA 3OZWA 2LWIA 2ZSUA 3UXEA 2A58A 2GR9A 3O8OB 3RVPA 1PZMA 4E0BA 4D97A 4CDGA 4K2AA 2NVUA 4ZO4A 5AK5A 4EPXA 1TYCA 4ZVTA 4F92B 2JPDA 4PN3A 2V0GA 1ZA1A 1FXWA 2AEJA 3D3KA 5CT8A 5I4KA 2IYQA 3NHRA 1FX1A 2R1VB 4YNBA 1QFJA 1XC7A 2R68A 2O06A 2G0AA 3ROFA 4IRUB 5B2ZA 1IJBA 1GPKA 1ZJWA 4QFMA 4OY3A 1OAOA 4G0PA 4JR1A 1LPPA 2NU6A 3BX1A 1ZCFA 4ICIA 3ZIAA 2HO4A 1MA3A 1KAGA 2AOVA 2R4TA 2ASEA 1GJRA 1V7QA 1GZ7A 4UM5A 2QYSA 1QRAA 2QQ0A 2AYXA 3ACBA 3C6KA 3QBTA 5BSMA 1XDWA 4N3AA 3P0RA 4CTJA 3G0DA 1ADCA 2R48A 2ZDGA 3H9JA 4NBTA 3CH7A 5A7GA 4R1PA 1N5OX 3T5GA 1SVLA 5EIBD 5HCUA 3O90A 2XQIA 4GPD1 2GK4A 1FDTA 4RWEA 1S96A 2C5SA 4EHFA 4Z1MD 4R83A 1F2UB 1TAGA 2RJNA 2JATA 3CH5A 4EUFA 4MV0A 2AI2A 2WDPA 1ENPA 4IOMA 3I37X 1D4OA 2CMDA 2XYRA 4L08A 2JJ8A 5EIFA 3UENA 3SK0A 4Y0VA 5A4IS 3UMMA 3TB4A 1C50A 4M9CA 1VL0A 1X0XA 1W0KD 3E7FA 5ELLA 2GAAA 1JG1A 2XLCA 3IOYA 3RUAA 1XVLA 3QBJA 1JLHA 3GP8A 2WWWA 4FZJA 2AEFA 4V2IA 1ECCA 2VHXA 2AFIE 3EK2A 3KPUA 2HCRA 3BERA 1EZ1A 3GVIA 1Z4NA 1JAYA 2JIMA 4HMQA 3D64A 3WWDA 3KYDB 5CB4F 3RYFA 4AF7A 2RH4A 2A14A 3G8CA 4RKYA 4ALIA 1N5IA 1GPAA 4AKSA 2OMKA 4RELA 4JMLA 1ND6A 3ONNA 5COBA 3AIIA 2CL7X 2ZOSA 1QANA 1WWKA 3EPJA 3IAEA 5DP1A 2EQBA 3LIPA 3RUIA 1EJ6A 1IG3A 3VPGA 4RK5A 5FFNA 2IF0A 2PWPA 1SO8A 2Q0SA 4HGNA 1TQ6A 3UA4A 1C29B 4C06A 3L1VA 5FUXA 3VR6H 3Q85A 3T8YA 5DHTA 4CF5A 3KYCA 2O4UX 1N9GB 2FY8A 2P2LA 1FDOA 2TSYB 3ROTA 1W4BA 2C29D 3CTMA 3MCZA 1SOUA 1NJ2A 2JCGA 5F51A 4O4JF 4BO0A 2BHNA 4I36A 1V7PC 5FLXA 3CUWA 1H2XA 3NHUA 1Q20A 1ZM9A 4RH1A 3TSYA 4W5OA 4AI6A 3V7UA 1BHO1 2ACKA 2FFBA 3H6GA 3SOZA 4D4LA 4E09A 1N33B 3WLLA 1A1SA 2GEDA 1XXHA 4ILEA 4UBJA 4MINA 1BGXT 2R4UA 3LYLA 3PUVA 2PMKA 4I8XA 1E5QA 4EY6A 2FUNB 2JAPA 4P3XA 3VPSA 4EG6A 2P77A 4X61A 2IPMA 4B6OA 2NAFA 1V41E 2WUWE 1DG9A 4M55A 3HR4A 1JEEA 2HU7A 2Q2OA 3L0SA 3VMMA 3IEKA 3GH3A 1V11A 5AIAA 3O3MB 1ECLA 1KEVA 5ILGA 4JJ7A 1C4XA 4WJKB 1ONBA 1AKRA 1FDIA 4IG4A 5C8YF 4RMIA 3R5HA 4JI3B 3ZDFA 4DN6A 1C7RA 1OC4A 1XYYA 2ZJ4A 3VZRA 1RWPA 1DOZA 4OB6A 4BECA 4RTPA 2C9DA 4PZYA 2ZPUA 1OI3A 5JO0A 5G53C 1UOEA 3DVLA 3EIEA 4A03A 4M7OA 1L4KA 2RGDA 4DOMA 4ZIRA 4BWYA 3VU0A 5EJGA 2JFYA 3ASVA 2XVMA 3S1LA 1EFAA 3C8HA 3K6RA 5K6TA 4HH3C 4MW7A 2H2GA 3QUQA 4IDEA 1R4AA 4M3NA 4G07A 1JU3A 1G1MA 4G4SO 3T3OA 1WSBA 1X7WA 4V0SA 1YR6A 4G0UA 5H9VA 1L5WA 3IHTA 3V1KA 1G2QA 4N01A 5FYQA 3WADA 4A0FA 2WWRA 5IZCA 3HWSA 1H9BA 4PAMA 2DR3A 5LZ4A 2W0MA 4CKXA 2NUBA 3C4JA 2VZ9A 1TDJA 4G36A 1N2SA 1F0NA 2R66A 4CUJA 3AF5A 5F9FA 1FMCA 1KBQA 1SZDA 3Q12A 3V7FA 2R7KA 3P1JA 5J1SB 3MRXA 1CQJB 1LDMA 4Q4AA 4JI1B 3UVEA 4PSKA 5BSKA 5BSWA 3PE3A 5AVTA 3KEQA 4DCNA 1EFPB 4MYUA 3PX3A 1AN0A 3Q6NA 4UEWA 5K8UA 3BHNA 3FY4A 4ML3A 4NATA 4PW0A 4ZO7A 5NULA 3CG4A 2XWSA 3DCIA 3I5MA 4KDEA 4L8LA 5CH5A 3R8CA 3CLHA 4F9FA 2XJ4A 2ORED 2AVDA 1BQ4A 4WT7A 5IAOA 5LB4A 2QBYA 4UU7A 2C4HA 3Q5GA 4US0R 3EPHA 4M98A 1ZM7A 5T41A 4JCCA 2O2SA 1EFKA 2CXTA 4FEAA 5EWJA 3R8XA 4A10A 3ZJVA 1J8QA 3MUFA 3G2JA 2YMMA 2OCXA 5GONA 2E5LB 4HO1X 4ARZB 1ZD1A 2OUKA 2ZZKA 5AVKA 4CF7A 5IDQA 4LXHA 4BNDA 4O4LF 1R5QA 3DVAA 4MP8A 2D1RA 3JD0A 3TTYA 1TCUA 1VJTA 1XHLA 4X95A 5KX5B 4X3OA 1PV2A 4C4SA 3T5CA 4AJ4A 1CUCA 1B23P 3D6JA 1FTWA 2PRIA 3FCAA 4WRRA 2FW1A 2V7GA 1D5CA 3TCNA 4AWXA 4CV0A 2IXEA 4KOEC 1QIEA 1L7AA 5F5LA 4RHCA 4QECA 2H9AA 3LKBA 4GU5A 1KYZA 2OAQ1 1LX6A 1U7XA 1XTUA 3BN3A 3QZUA 2QK4A 3KYDA 5JHHB 2I2DA 2PX0A 5FPKA 3PRJA 1Z4QA 2W2MA 2B82A 1LU9A 3E1SA 3MW8A 4FNOA 4OHVA 5ENVA 4HT3B 4R5HA 4J7AA 3LSTA 2X0KA 3NC1C 5A0VA 3CO5A 5AVQA 1Z5GA 2GPJA 1IUOA 2YRWA 4MP6A 1M7HA 2NO9A 1MR3F 3D6HA 3SLRA 2VQSA 1JEJA 2H2FA 2BKXA 2IPLA 4QG7A 5JC1A 4Z9BA 1C1YA 4OU5A 4IHJF 4N47A 1VZ2A 3UH0A 2MTBA 2DJ5A 2YZNA 1PG0A 4MGIR 1DTSA 4ZQFA 3GMTA 3I5UA 4M9QA 3OAAA 3MZ0A 2ZI9A 4XWGA 4RTSA 4EUEA 1N7HA 1PD0A 2BBSA 2O2ZA 3BE4A 3CY6A 3NEPX 1A9TA 1PZHA 4NRDA 3ZZNA 4Y2HA 4ZRMA 1XLTA 1KJ8A 3DAPA 2XE7A 3LL4A 3F5MA 4UE3S 3H5NA 3E61A 4HF7A 1T8RA 2I7DA 2QSJA 2R1UA 4XAQA 4PYNA 1M34B 5HK8A 2XJ9A 3IIIA 3MXOA 2O2YA 3LQKA 1RWXA 5F9MA 5JPDA 4M83A 3AONB 2NNLD 1L4BA 1MC8A 1JEDA 2UUAB 1TK2A 3OFKA 2XKJE 5AM5A 3O7MA 2I99A 3FBGA 4GPZA 4HNAB 2MYTA 3PFBA 3TUIC 2ODNA 4IDNA 2DG2A 1CYEA 2D5BA 2QDXA 4ZEWA 3S0JA 1WQ3A 1AGXA 4F8EA 4DDWA 1X1BA 4PHHA 3D5EA 1XF1A 1RQXA 3WMEA 4JGIA 3ZDCA 1BKYA 1H9CA 3P9CA 1RQGA 3AFOA 1FX0B 1VXRA 4LJ8A 4RSGA 5IAAA 3SPXA 3T4UA 5A03A 1P9LA 2IBSA 1Z73A 3KZCA 1LLUA 4HUQB 4Q48A 2WIGA 3TK1A 5BQPA 5AD1A 1N5LA 1XZIA 2Z95A 4IIBA 2HO5A 2HWKA 4CU5A 5I7HA 1Z7WA 4YCCA 3Q7EA 3IALA 3L4KA 1LTQA 3LYAA 4AC9A 4BLOA 3GRUA 2VNAA 1IM8A 1JKFA 5LZ5A 3LUFA 1N2BA 3E8MA 2AV6A 4XE5A 2VHVA 3AVVA 2H2WA 3QUBA 1OT3A 2WWTA 1KRXA 4Z6KA 5JJLA 4Q7LA 5ALYA 5HFAA 2C82A 3SJCA 3FKJA 3RJ9A 3ZE1B 1G19A 5IYZB 5KQMA 3OQIA 1G291 4OHKA 2CW5A 1K75A 3EWIA 2QJTA 4LG1A 2QRJA 4KSCA 3JYHA 1QKKA 3UBTA 4W5JA 3N28A 2GUGA 4HQLA 4JUAA 4IMRA 5ARBA 1NVFA 5DW3A 5JSZB 1E6UA 4MWOA 2PT7A 3CNNA 4K81B 4M99A 2H11A 5CDSA 1QGUA 2CL0X 1MEOA 1J0BA 2DPLA 4N5MA 4UUOA 4WXHA 3S6JA 3S27A 4HDRA 4CEIB 4MZDA 3R3JA 1OOEA 4KMSA 3U7QB 4PC6A 3NOXA 2XBLA 2QPLA 3B6IA 5DTQA 3T1NA 1C2TA 3V8RA 4MA0A 4RLQA 1VCHA 1ZIOA 5FTKA 1EDBA 3Q3EA 1F06A 3E7DA 4GKKB 5C7OO 2FPWA 2IEZA 5K0BA 2CBGA 4MQEB 1IEVA 4U4AA 3H8VA 3M6LA 4JGBA 3V8BA 4BDTA 4EA8A 3TAUA 1GNTA 3G2PA 2QRGA 3HZOA 3AOEA 2Q0HA 1D9XA 2CNNA 4XOUA 1M73E 3IHKA 5EWLA 2YWDA 2BUAA 4Z99A 1NI5A 1BX1A 2P9CA 5D6OA 2M6SA 3O95A 1T4DA 2OHXA 3ONDA 4J3JA 5AI9A 3GFSA 1D2RA 2NU9A 1Y3CE 3B9BA 4RW0A 3HJNA 5LQDA 3TCXB 3AF2A 4WZBB 3CX7A 1EUCA 2A9QA 3M81A 2RC6A 3KSZO 3TLGA 1QHHB 5LYJF 3F78A 5JEDA 4AJNA 2VBIA 3V1NA 5KQGA 4G1FA 2QRVB 3SC2A 3F46A 3HBAA 4RHEA 4G0XA 3BWMA 4TTJA 3HO6A 2ZSDA 4QOGA 5J4YA 5JQWA 3IQHX 3PUWA 3RFVA 5F7OA 1ZH0A 1C1DB 3OF2A 3P2JA 1ZSYA 3IKVA 4RD0A 3EN0A 1YUNA 5EMLA 4MS3A 1QORA 4DG5A 2HV8A 4RK1A 1O94A 3A4MA 3C6XA 1KO1A 4WDQA 3CJRA 5FTLA 2NSJA 2D2EA 1J00A 2CK3D 2ODWA 3PPWA 2WIKA 3G2OA 4OPMA 1FUKA 4TZTA 1UT5A 4MQFA 3MCAA 1T34A 3BDIA 4M9SA 2OHOA 4RHUA 2CJPA 3DTVB 4MVYA 2Y1WA 1RVDA 5JNLA 3K71B 5CXUA 2YIDA 4Q34A 1PL0A 3CZCA 3LUHA 5GOZA 2PZ8A 6ADHA 1OXSC 1JAIA 2Y68A 3IUJA 3KQPA 2R9VA 4FOLA 4HXGA 3B9RA 3GP3A 2EYQA 3ZY6A 4A5OA 1T5LA 4DCGA 3KSMA 4MKHA 4HVLA 1E63A 2VF5X 2JARA 4CIVA 3LT4A 4NAVA 5JNSA 3ROMA 4B8ZA 3EXAA 1J49A 3VKFA 3VR4H 2VPZA 3H8JA 3O75A 3RVOA 3ILHA 1LF0A 1HUQA 2Q3HA 4FW8A 2HSGA 5ESDA 2QTGA 1RKQA 2W43A 2HSJA 1HYEA 3VNBA 3O84A 2OWDA 2QAGB 3R76A 3OI7A 1HT3A 3D4NA 1QFMA 3G68A 4F3YA 4ZWNA 2WJYA 3MINA 4MPTA 4QXOA 2DBVO 2PKQP 4A8PA 4PBTA 1HOXA 1YJ5A 3UAXA 4ON9A 2WSBA 1GGVA 1VHQA 3E3AA 4OATA 4XDZA 1VPWA 3FTNA 1BVRA 1ZYUA 2E1RA 4F97A 3EGWA 3PNMA 1CU1A 1KZ7B 3CBQA 4GZLA 4BCDA 5KVAA 3ZD7A 4ZVKA 1JBKA 2NADA 2YR0A 1LDYA 2Z83A 1S2NA 1UMKA 2WUEA 3PR2B 4I6EA 4V24A 4DXDA 1MRSA 1ULTA 4E1VA 4QOEA 4XSVA 1A4XA 4A26A 4DA4A 4N12A 4Q6WA 5BSUA 2QUJA 4EGCB 2F55A 1O4VA 1F4PA 2EZ8A 2JEOA 3OJFA 4HFMA 4Y30A 4K9MA 1WZCA 2B92A 3O9VA 5EGNA 3RTBA 2CF6A 4FHCA 5FA5A 4AF6A 5C7LO 2JIOA 1W6UA 4BGDA 3EPKA 1PNQA 1VCNA 4JQCA 5D00A 3G82C 3GUZA 1PZGA 4B83A 3E9CA 4MW6A 4CODB 3DLCA 1HOTA 5FWAA 1SXJA 4P0PB 1DKOA 1UPCA 5EWLB 1IPHA 2X7HA 3BTVA 2WHPB 4GSYA 3DEYX 5B4UA 2Z4RA 4B7ZA 3U1TA 4W5NA 4B3DA 5I8ZA 1PGOA 1UJNA 3IVMA 4H15A 3TDMA 1S3SA 1EUCB 4BN0A 1OXBB 4UFPA 1H4VB 3ONFA 4E3WA 2OTCA 3SF8A 4QTYA 1E3WA 2PU7A 4QT4A 1KEWA 5FUQA 4R1NA 3P0FA 1XZJA 1H1LB 1ZGGA 4H1WA 1U8ZA 1L9KA 1YCHA 2V59A 4BB5A 3SOPA 4X1YB 2BMAA 3H9QA 5COQA 3GLKA 5CNKA 3U4MA 2R8ZA 1CUYA 2QVYX 3H2JA 4DMUB 5HCIA 4F4HA 1NI4A 2P2YA 1J33A 3FFAA 2I34A 2A7QA 3ENQA 1E3SA 2V74B 3LUKA 4Q12A 4KMOA 5DGXA 5LQKA 3L7OA 1OSNA 3W5JA 1YVUA 4L76A 2ZRGA 3OQOA 5BP7A 1E4VA 1RHMA 3P9IA 3PICA 3T54A 2LGJA 2QAGC 4DWVA 1U2GA 4JLWA 3ICQB 2AWOA 4V0MA 1TZBA 2ODQA 3UJ7A 3AKEA 1H2RS 3GNLA 3NORA 4WXYB 4XYGA 2ZXUA 1JQBA 1AA9A 1EFDN 1RZUA 2XDQA 3RS5A 3RHFA 4Q9DA 3VX3A 5C5DA 5KWSA 5AWFC 5FKJA 4PIPA 5CR9A 1PR3A 1GRQA 2JI8A 3U7EB 3PI7A 1DKUA 3V3KA 3LHSA 1RM5A 5B3JC 4ITVA 1GAJA 1KJYA 1FFBA 1OAAA 1S01A 4GX0A 5DPMA 2F6RA 5IKMA 2UXBB 2BMFA 3MMXA 2WJZB 5HF9A 5K99A 1SPBS 1SVWA 2UZ1B 2B1JA 4N48A 3P9XA 2E6KA 4XYBA 1T2DA 3A05A 4LA4A 1F7UA 2Z1DA 1T9AA 1W7AA 4ZVSA 3GPDG 5K4AA 4BL5A 4U00A 1BCRA 1CQIA 4URYR 1PLJA 2VBFA 2X4LA 5D5HA 4YGXB 2IWRA 1J1IA 3WNZA 1CR6A 1WVIA 4FMCB 3NCHA 4IFTA 1GFZA 4O0MA 4Z4IA 4ZTZB 3A1VA 1WW2A 5AKYA 4RD1A 5ICFA 5TGZA 3STWA 4H6WA 5A1TA 2VTKA 5ADWA 7ABPA 4NOLA 1WXWA 2FU5C 1ISPA 1EM8A 4J49A 5AKGA 3TD6A 3OZAA 4TYPA 1UDWA 4GE0A 4BLRA 2UVQA 5EP4A 2ZZMA 4XJVA 5ED4A 1X3LA 1SY7A 2EP8A 1JEQA 1QVWA 1MHTA 4CQNA 3BWVA 5CYGA 1GZSA 1L4EA 2CNOA 1DLIA 3K8ZA 4FX2A 4R01A 2WWVD 3GCZA 4CKCB 2JGMA 3N0XA 1T4CA 1K8QA 2C7BA 3PIDA 3K09C 4QBHA 1EX6A 3ZU3A 4PPFA 4KGVA 2CT8A 4GRIA 3JQ6A 4L6CA 5LXTB 3F1LA 5TARA 2PUGA 5FBHA 3D3NA 3N7UA 2WJ6A 3PF9A 1DAGA 2PL9A 3GEHA 4FEEA 4N6OA 1M2HA 4P38A 1GCGA 3LPMA 4UDNA 2BPOA 4RK4A 6YASA 3HUFA 7YASA 3B8HA 1GR1A 2X8JB 3LTEA 1JYFA 4OH1A 4TMKA 5IASA 3FVTA 2X5KO 4M0LA 3WNDA 1EINA 1GZUA 1E6KA 4HPWA 2QE7D 4ALJA 4BO3A 5BNIA 1RRGA 3IPCA 2CXQA 3BS4A 2CFTA 3ESBA 2Y1KA 3PL5A 1WUIS 4L27A 3DE7X 1TUIA 1JX6A 3RSGA 4DFDA 3DHVA 4TL9A 4W8GA 1AF4A 5AP9A 5KTOA 2PR7A 2C9CA 4FNAA 4MH0R 1AE1A 1RJEA 4LZAA 4RL4A 3LNCA 4XI9A 3ZY3A 3IQEA 3ACDA 3B6JA 3KR2A 5LN1A 4IJMA 1XZLA 4EF4A 1ARZA 3B6EA 5EIOA 4EARA 2XKKA 1PYDA 1S0UA 2G1AA 3VU9A 1USUA 3UTDA 3W5SA 2ZR0A 4WFQA 4CMIA 2JGDB 3GHYA 1HDRA 1QIFA 2HLPA 3IAM1 1SN7A 1YA4A 4TXLA 1AS3A 2MYUA 2CB0A 1HZJA 3FPHA 4X6LA 1HWYA 1P0IA 3OF3A 4P4SA 1U2DA 5LBIA 4YCNA 3GBVA 2KLBA 4I19A 1FFEA 3VNVA 4JVLA 1WHSB 3DKPA 4U9HS 2UVPB 3FNEA 3RU3A 2ZM6B 2IH2A 1VIYA 2ATXA 2OKCA 4IIJB 2VOJA 3KL4A 1U28C 4BASA 5LWQA 3U0VA 3LHFA 3TLGB 3X0DA 1P33A 2GN2A 1Y81A 3C3WA 1Z28A 4A3SA 4YAJA 1PS9A 2BGJA 3N7AA 4COOA 5F21A 2AFIB 4AMZA 1L4NA 2GN8A 2BR3A 3KEFA 2W98A 3AKYA 3MWEB 3QI2A 3QWAA 4FE7A 5CCBA 4O63O 3DV0A 1F2VA 1KERA 1OIVA 3CZAA 3T3GA 3TQIA 3T5PA 3QG5A 2WTUA 1KS2A 1IBKB 1WDTA 1YB6A 2YBEA 3E9QA 3N2GB 3WV5A 5DKFA 3LKDA 3U56A 2XUHA 4LXQA 3AXTA 4RHXA 1O96A 3REFA 1R6BX 4PGMA 4BNZA 1X2BA 2JIZA 5ALEA 3HCCA 3BMOA 3HCDA 4WCFA 4MB0A 1HYBA 1NVMB 4IQ4A 3G9ZA 4ARBA 1OVGA 4HRVA 3G7SA 1JNXX 3BSFA 2GNAA 2NO6A 2BEWB 3GGGA 3LECA 2FTKE 3T4PA 1SKBA 1EE9A 3DO6A 3SX0A 1TM4E 1Q0RA 4BVGA 2KX7A 5AICA 1CY8A 2OMEA 2ZWOA 1ZMBA 4ZANA 2FQYA 3JAMA 1DWUA 4K46A 5EQFA 3CH4B 3GVCA 4URHA 1XTZA 2D8MA 1EM8B 4MK4A 3RQIA 5CA0F 2B4QA 5G2OA 5CVUA 1C3OB 2C8VA 1PR5A 2G4CA 4L5AA 4TUYB 5JPIA 2G9RA 2JASA 3BCUA 2F64A 2X7JA 2IDJA 1URPA 1S3IA 2CLLB 1PJ4A 1KSHA 1V2HE 3O2NA 4NFHA 4RQTA 2X0JA 1R37A 3K4QA 4Q9LA 3WOVA 1KY4A 5KMGB 2Q2NA 5ALDA 5FNVA 1DAOA 4JA2A 3VZQA 4RFVA 3KBBA 3HKDB 2YNMC 2IYNA 3M6MD 3N0VA 2REQB 2VNJA 2PIAA 2QX6A 5AM1A 5KYKA 4QNMA 4LRYA 2BFWA 2XXJA 3M0EA 4OXQA 2GPBA 3RVMA 1Z6QA 1A0OA 2PDAA 3BIFA 3C4VA 1AIPA 5DCWA 3RRYA 4Q4CA 4CKWA 2GTHA 3SHOA 3L1HA 4OJTA 4Q7QA 5J2UA 2RGWA 3SVZA 4OHWA 2MJLA 4BIMA 1I4LD 3OEHA 1TTHA 3JQEA 4J1TA 3IAUA 2PM8A 3CUTA 4ZQGA 4I4LA 3DFKA 3KQHA 3B1KA 3L7LA 1BGWA 3NJ4A 3T06B 3R3XA 5KSOA 1Q21A 1ZINA 3JWGA 1C8KA 5KQPA 3UBMA 4YFVA 2W7TA 3NM5A 1ZD2P 3BD8A 3M49A 2C9BA 1Q91A 2K7ZA 4Y3UA 3U6BA 3AGQA 2QZ9A 5MGNA 1YS9A 5EE9A 1U2QA 2GTIA 4K40A 1X7ZA 2SKEA 4L50A 3VHRA 4DQVA 3ZQKA 4I1SA 3PPIA 4BZXA 1AQLA 5BN5A 3LU1A 4BNXA 2PAFA 3I53A 3N8GA 1S1CA 1TF2A 4JI4B 1DG3A 3WMFA 2QVXX 1G6OA 1N8KA 1R4MB 3GFPA 3P32A 2FQXA 5AOCA 5CA1A 5KNBA 3K96A 1EB8A 3AX6A 3WWZA 3MJRA 2PSEA 1XRPA 2D00A 4AG3A 4QOSA 4J2OA 2EFCB 2IYVA 5E9WA 4GZ5A 1TVMA 4M8NE 4Q1BA 1A9XB 3D4IA 2YBDA 3DYVA 4CF6A 4PYJA 4KZKA 1TIBA 3S29A 1K8ZB 2KJQA 1X1CA 4BLQA 5FOSA 3BIOA 1JVSA 4J7CA 3RODA 4F21A 4DKXA 1KARA 3QWFA 5AVJA 1TRKA 4BVKA 5L6LB 2R79A 3QE2A 1L8AA 3K0BA 4CN9A 4ZEMA 2VYVA 3GLIA 2BW0A 2D13A 2Z3VA 1Y9AA 3MRTA 1C9EA 1G8AA 2TRSB 4CU2A 3M6AA 5SZJA 3BIWA 4NMWA 2ZTHA 2FZ4A 5KTYA 2G5TA 1Q92A 3UT5B 5DHPA 4EGQA 2QXYA 421PA 4B3CA 1UMBB 1KEEA 4QE3A 3T9BA 4ARVA 3FXAA 5FRDA 2RDMA 3B1WA 4UM9B 121PA 1JB1A 1UFRA 2NXEA 4CRWB 3OX3A 4EMSA 4KQCA 3CF2A 1VYUA 3F96A 3X43A 2KQUA 3EXIA 1GPNA 2FOXA 4HCJA 1OU4A 1W581 2YY5A 3KKZA 2A8YA 4IILA 3EC2A 4ERXA 3E9EA 4G26A 1F1JA 4J9VA 5JISA 1QU3A 2ZJAA 3FYUA 1Q7BA 3THXA 1WV1A 2F3SA 1XMOB 2ZG6A 3BFKA 5COAA 1HETA 1RP7A 2O9JA 2R60A 2X9LA 3CXRA 3MELA 1QHHA 1YQ9A 1JFVA 4KI0A 5F7ZA 4O2AB 5JAUA 3WRYC 3N59A 1XZNA 2OHJA 2BFBA 2Q6LA 5LP6F 3TSZA 1SELA 4HJRA 1SBTA 3EARA 3RSSA 4GX2A 2A86A 4BV3A 3U7FB 4BQFA 1J2YA 1YU9A 1Z33A 4IFEA 4UTVA 2O23A 3NETA 2XWPA 2ASVA 4BCCA 1ZGJA 2DPXA 4RKWA 3L6DA 2VHCA 5CW2A 3OU7A 2ZJOA 1X77A 3OM8A 2OO7A 3ZEIA 2QP3A 3V4RA 2OV4A 2QL7A 3H2HA 1IVSA 1B8UA 1Y1RA 2MSLA 2IPNA 2FUKA 1P17A 2JHGA 1E89A 3KFVA 3HMQA 5SV2A 4QUHA 4FU0A 4DARA 3WK8A 1JW9B 3R5XA 1KR2A 1UOOA 2ZBEA 1BX0A 1ZA2A 3TNDA 4G9EA 3R09A 5HE9A 5FUBA 3N8IA 1Q83A 4OP3A 3R24A 1F51E 4AJ1A 1QLHA 4XARA 1EFVA 3DNMA 1SCAA 4YUAA 2HDNB 1FFCA 4LMRA 2YHIB 2NU8A 1CTQA 5AFSA 3JQFC 4WN3A 5FV4A 4OHYA 3HL0A 4FR0A 4DUZB 3G6WA 2HEGA 4ZCPA 1G3QA 4FIZA 4G97A 2R5NA 5ALQA 3CJTA 1YR1A 3LBNA 4E12A 1NW5A 4RSMA 5BSFA 1YVRA 5AK0A 1VIMA 1MOPA 4FPXA 3K72B 3ADBA 3SNKA 4D96A 1EM6A 3PG5A 4DT1A 1BA2A 1NFQA 1VBMA 4I1RA 2PRKA 5HFJA 1SHKA 1ZU4A 5FD8A 4AG5A 3TUZC 1VLZA 1WW8A 1U1FA 1CV2A 1UZNA 1QV7A 1QWSA 2RCYA 1V1JA 2JK1A 2VJNA 3RUEA 1VFPA 3ZYZA 3QG1A 1JJIA 4HL6A 4MYSA 4QJ5A 3RSCA 3GROA 3HWX1 3BH0A 1LZKA 1AG9A 1NMQA 2JD0A 2FPSA 3LZCA 4ALNA 4ZT5A 4V0LA 2CFCA 4J76A 1WLSA 4KI7A 4R8KA 3RG8A 3F9RA 2FK7A 3P19A 3CUVA 4PX3A 3BGWA 1U0HC 3RRMA 1KVRA 4ZU1X 5JH7A 1RJDA 3OCZA 5EXXA 1LSOA 1IB0A 4X64B 3DL7A 3DA8A 4QQKA 4DC0A 3Q9NA 1S4MA 4KXFB 1XA3A 1Z6ZA 1R0XA 2PKQO 2QZPA 3BM5A 1RM0A 3ILVA 3QF7A 4HDSB 4F9EA 2H85A 2WWIA 4KUGA 4WASA 3E5HA 1YGPA 5IZCC 1JR3D 1YF3A 1R15A 3B3GA 3AV3A 3CRVA 2WJAA 1ECJA 5L6MB 4Z86A 4WFKA 4FHGA 3GQVA 3UJCA 4QZVA 2G08A 1R8SA 5IHPA 1XQVA 3AHCA 1MO5A 3E15A 2O19A 1NNUA 1OI7A 3LWNA 2BHSA 4MMYB 5IAJA 2OP1A 3BD6A 1LXCA 4R40A 3RWOA 4A82A 3NEYA 8ABPA 3OTOB 3IO5A 3DHYA 5H70A 2Q2QA 2GZ2A 4DLLA 4ZVPA 2Y6UA 3DOFA 1ZAKA 2PD6A 1FP7A 2O2HA 3B6ZA 4LYHA 4MWZA 2HA6A 2OOKA 4WAUA 3KQNA 3I9FA 1T5IA 4YP6A 2VQFB 1DIBA 3OE7A 3PA8A 1JVBA 3RVQA 5BN1A 3D4OA 2XZOA 1EX9A 1E96A 1JDJA 3ANNA 5CJ2A 1XTQA 3I64A 2WKRA 2XH8A 4OHZA 1MU0A 4TXMA 1ZM2A 3EDRA 1F9AA 2CLMB 2GWHA 4PLHA 4RYDA 5DRYA 5FAKA 1I6WA 4HG2A 1IXYA 1WSAA 3OX1A 2C9ZA 2GYVA 3PLRA 2B69A 2VSXA 3B20A 4FS3A 4Q1VA 4O5AA 1TA9A 1NN3A 4XB1A 1XDGA 3KXDA 5DEIA 3FUUA 1NULA 1Q2XA 1IE3A 4FDMA 5BORA 4IUBS 5K6AA 3PUXA 2CB9A 1BH2A 2IK8A 2XUPA 5I4BA 3AVUA 4YXWA 2QAIA 3E9MA 3F4LA 4FFPA 3WZMA 4BLPA 1G3IA 1P7VA 5AUQA 5HKBA 1QGDA 2I4TA 3PUIA 4EW1A 2VYVD 1G9XA 4ABYA 2GZ1A 1U11A 3M6IA 4P7GA 4TYNA 3ZPXA 1W2HA 3G5LA 5C1BA 4I8DA 1MB0A 2BKLA 2NQTA 1ZRHA 1VG9B 5JD5A 3BIJA 4L8WB 2P2CA 1YS6A 4D3SA 4QPPA 1QAMA 4Q7EA 4E5YA 3M6UA 2JLXA 2IHYA 3U5ZB 2I4LA 5D5QA 2VT6A 1I94B 1VKJA 3NXSA 3CLKA 5IN5A 1SGWA 4X7RA 1U4SA 4NC9A 4XTRA 1XMQB 3QVGB 4JN6B 1QHGA 2QJRA 2EW2A 4FSXA 4HKTA 4B6EA 3AJDA 1T24A 4HLDA 1V5WA 1MFZA 3RSHA 1N4AA 4IQ0A 5AVRA 3RADC 3ONWA 4PWZA 3DAFA 2Q5HA 1OGYA 4X8OA 4BV8A 4QPJC 1ZVMA 4LZZA 4Q5IA 2Q62A 3RIXA 3AH8A 5D3ZA 3FWPA 3ZW8A 4MR9B 5BNWA 5ITWA 1C30B 2OG1A 3QKSB 4YCLA 2GJAA 4AWBA 4E11A 5BW4A 1Z4KA 2Q6VA 3U3KA 2EL9A 4IJKA 4JA0A 3VI4B 2O05A 1FNDA 4LJSA 1KSGA 1QV6A 1UZ3A 1N2EA 2INGX 2NP6A 1NXPA 1ORTA 1ORVA 2C2WA 3Q3JB 1LK7A 2YN2A 1ENZA 3VVCA 5HF5A 3QPVA 1VIAA 4QDXA 3LPNA 1KDYA 3LY8A 2QT1A 2DECA 4FGLA 1BHSA 2ZUDA 3JQAA 5HRUA 2ZUFA 3I6QA 1E7WA 2YJ4A 2A1TS 2IYZA 4FJ1A 4HS9A 2FZLA 2Z2XA 3DKRA 4BB9A 2V3WA 3TLAA 4LGCA 3VUEA 1ZGCA 2FGKA 1D09A 3DXZA 1BXRB 1QH8A 4MIOA 1WZ2A 1BE8A 3CJQA 2OE2A 5AXDA 2ZUEA 4NCXA 4J7UA 3QKIA 1ZUIA 3H04A 3H2YA 2XXAB 1WCYA 2I4MA 1JSLA 4K0RA 1OKKA 3VBCA 5KU7A 4A6XA 1DSSG 1NNI1 1XXHB 5HIMA 1V71A 2E49A 2BTOA 2ZBDA 2MSKA 4UVEA 1P7ZA 2FW7A 2QMUA 2VP9A 3PRKE 2E55A 5T6BA 5T64A 3WDLA 4DGQA 4KR7A 1MMFB 1ORRA 2AHRA 2ZWMA 3S99A 4RNCA 3K0SA 1CRWG 4HDSA 4N8SA 5FULA 1UTUA 3WLPA 3E05A 4JHLA 5JAPA 4OL0A 4JEUA 4D80A 2XVAA 3KR9A 1AHPA 4ZYVA 2ST1A 1M34E 2WAYA 3AI1A 3CZRA 4NICA 2JLSA 3PNVA 4N5NA 2W70A 3C41J 3N3AC 5BN3A 4O8ZA 3WO0A 5BSTA 5KQSA 1Q84A 4PEVA 2DX7A 4GKBA 5P21A 1V16A 3WYGA 2FFAA 1Z83A 4RPHA 5BMVF 3FDZB 4DQ0A 3ID6C 1S9HA 2N0SA 4YRJA 3HLYA 5AESA 1QPGA 1IN1A 1RLJA 2I87A 4A9AA 5GADl 2CE2X 4Q4JA 1XTVA 2BFCA 1OQAA 1GUFA 3D0KA 1H9AA 3ETDA 3IDZA 4AZSA 3IL2A 5K0LA 3ZDDA 1YE5A 3FM9A 2J9FA 3R6WA 4IJ5A 5JNWA 2DLDA 4N82A 3V8NA 2JCVA 1L7QA 3FZNA 3EEYA 3OQBA 1TA4A 1NU8A 5CW1A 1L7EA 5EKUA 3T3EA 4DM3A 1GEEA 4QTTB 2EQAA 3FF1A 4GR4A 5EJ5A 4YJ2B 4WK4B 1EJ2A 3ESRA 3WHLA 1Z12A 1Z0IA 3R0ZA 4D9BA 2EWVA 2ZB7A 2IY8A 3SFVA 1KF0A 5JDIA 2HZ7A 1N3LA 3R3VA 1SOWA 3C3PA 4KFCA 1RMYA 2J1LA 4AQ7A 2V55B 3IKJA 4M0DA 4BU1A 2F00A 4DCCA 1TNDA 2CYCA 3H5VA 3KOUA 5IXJA 5K0TA 1KQ3A 4LRTB 5DGIA 3EAGA 4YJGB 1NUQA 4WZBA 1H85A 1U1CA 3WZLA 2DPYA 3TG2A 4NE2A 3RR2A 1JDTA 2OBLA 2BFDA 3ZXYA 4AMYA 4BKMA 3IUPA 1DAPA 1Q12A 1K9SA 3MD9A 1YKFA 1U81A 2IKSA 4JBHA 4M8KA 4UBNA 1FPMA 3DXXA 4GVLA 4EJ0A 1W0CA 3HDYA 4WI1A 2QJFA 4W1QA 4ZT2A 1H65A 5ALXA 4GYJA 2IXFA 1S7CA 3QWIA 1K88A 3F73A 3UC9A 4DLAA 3LP5A 3GJ4A 4KCGA 2BONA 3UYKA 1Q6AA 2XNHA 2VP2A 4NL4H 3SU8A 2QENA 1BZYA 2FP4A 1R6UA 4MUGA 3DB2A 4GMDA 1N3IA 2Y1EA 3PGXA 5BRAA 1PQUA 4ZOEA 1IXKA 5K09A 3GZJA 4BFUA 3KETA 4TSFD 2BFBB 2OR3A 3OLZA 3AJ9A 1BNCA 1C3JA 1CZRA 1CY6A 1MDFA 2YWCA 2JA2A 1ESZA 2QDKA 3B9QA 3KOXA 3OTGA 1XRSB 2XXAA 2OL4A 3GIDA 4HB3A 4G4IA 3L8MA 3UPDA 2EGUA 2JIPA 3G6KA 4FP9A 2DE0X 2YXDA 3G1TA 2RK6A 4J0JA 4LDZA 1QH0A 5JZMA 2YMQA 3IV7A 4KTVE 1E1NA 1GVNB 4BXOB 3OPNA 4X63A 2YIVX 4ESHA 4EY4A 5A2QA 4HLNA 4Q39A 4HXFB 3R40A 4ZYUA 3CLSD 5ADHA 2PQMA 4JLDA 2WAOA 2CL5A 2ZYGA 3FYCA 4MPJA 4F93B 3F6YA 4R9SA 4I9FA 1DJLA 3ASUA 5FYDA 2ZT7A 5HR5A 3VGJA 3Q1KA 4KGDA 3M7IA 1K5GA 1V26A 2KWIA 3D2BA 3NEJA 4IHAA 4QGBA 3ZK9A 1ACMA 2FJ0A 4M8SA 1Z08A 2V7TA 1QOPB 3WL5A 1TIPA 8GPBA 4TVOA 3NMUF 1NP3A 3L02A 2H4FA 2OUIA 2QTAA 3TSWA 4E70A 1H69A 1I4DD 3KOZA 5CK5A 5CVVA 5AXCA 4ENWA 1E79A 1GL9B 1PNRA 3UJNA 5E6UB 3GK3A 3EF0A 4G5RA 2J4CA 3CRW1 3PFFA 2ZRHA 5AI8A 5F2KA 3P2YA 4HEHA 3LKVA 2QW8A 1NZFA 3JD2A 1AKQA 4EPRA 4DLTA 3ZXSA 4J0FA 3GRYA 3C5EA 5DV9A 4LMAA 4ME6A 3UEOA 3LVQE 5HOQA 2E0IA 1Z6PA 4LOJA 4U7TB 2VJPA 2HHAA 2CJWB 4UREA 3RC9A 3WK7A 4YIHA 4CQJA 5JCPA 5J23A 3DTYA 1XZBA 1II9A 3UUWA 2PWZA 4MLCA 1SA0B 1VE6A 3JPWA 1IJEA 2H5LA 4X7BA 1K7EB 4P7JA 3RC1A 4MKIA 4Y9TA 4BKPA 2SNIE 4JT9A 2WG2A 4BPBA 5KJFA 2P6UA 3INNA 4KX5A 2ONCA 2RHBA 1QHXA 1XXLA 1OGIA 2A57A 3DZCA 1P5RA 2JANA 2XQKA 1KK1A 3OZ7A 1GRNA 1EESA 3UJHA 3VKHA 1R6DA 2HXSA 4ZYWA 3PEYA 2CZCA 2Q46A 4P4GA 4RK6A 4F4IA 2D2XA 2ODTX 5C7YA 1RQPA 4OK5A 3THSA 3RW9A 1AKVA 4RC9A 4CL8A 4R2LA 4B3BA 2NX2A 1Y5RA 2ACVA 4YROA 2C7GA 4AROA 2BMEA 4RV9A 5K3DA 3X2EA 1JA0A 4XLTA 1PV4A 1QK5A 3I9OA 2AOXA 1FZQA 2GVDC 1MOQA 2FPIB 1TU0A 1NUSA 5TMBA 4CQLB 2JZOA 5C35A 1M1XB 1P44A 1SQSA 3FNGA 1AHHA 4M0PA 3PC6A 4AMUA 3VHQA 4AJEA 4DIFA 2I9KA 1ULHA 1LQTA 2O5VA 3IO3A 1HQYE 3IVCA 1CCWA 3BWXA 3JD3A 3L6CA 1MO6A 1GNVA 4PBRA 4BQPA 1RJFA 2BTQB 2DHRA 3CRNA 3R5SA 2HHHB 2WW8A 1G5PA 1XRMA 2WUDA 3GLVA 4ZCTA 3HADA 1E8NA 1ZQ1A 2Z8YA 2OKGA 1VPVA 5FOTA 1ZNQO 5FXMA 4F96A 4Y2UA 5TDHA 2XDQB 3VDQA 3WXBA 2L19A 4GOMD 5E4TA 1W73A 3PFIA 4RLHA 4WK0B 2I1LA 3H1GA 2QQ5A 4WUTA 4K9DA 4OLHA 1IVNA 4OX9Y 2UZ3A 1Y37A 4X93A 4RBNA 1X80A 4Z1MA 4J0EA 3I04A 1W59A 1FLAA 2B8JA 3CX6A 4LE1A 3OSUA 4EG5A 4PXYA 5I4IA 4C3UA 1O6CA 3SEAA 3VFDA 4CL2A 5IULC 3BKXA 3DV2A 2ORIA 3AUFA 4HVAA 4FGJA 4KRYA 5E6SA 1IOWA 4N5IX 1Y7IA 4PTZA 3PHIA 4IMJB 2QBYB 1DKNA 1B6SA 1KIMA 1YZKA 4Y6GB 2VRWA 5DSXA 1ID8A 2DU8A 4O4JA 2Y1OA 1AUOA 2C2HA 4QSMA 2LXNA 3UFXB 4B4KA 2WB2A 3Q2KA 3EPPA 2XMPA 1ZP6A 1HLPA 3KJGA 3I6MA 3UK0A 2ZTLA 4DANA 3SZ3A 1D07A 1QM5A 5K8LA 4YONB 3WQSB 1R88A 5K05A 3E0QA 1AQJA 4XLLA 4B6FA 3ZD8A 1EA7A 1PJSA 1UPBA 5DSTA 4BWGA 3QUSA 2YWXA 3QXSA 1MB3A 1YZFA 1TZ2A 5IANA 2I6SA 4LVUA 1YDEA 1OPXA 4MA5A 4V0RA 1OWMA 3WLKX 1M8JA 4MS3B 4KUHA 4K6FA 2H63A 5LR6A 3R7WB 3DKKA 1OTYA 4GSKA 2QVZX 3ZV3A 2H65A 3WMWA 4LSZA 4MQMA 4O0LA 5BQ5A 1K2WA 4B7CA 4QJIA 4C4PA 3M83A 4JODA 1NIPA 1QXSA 2J7KA 1JIJA 1PFYA 5IC4A 1LEHA 2HCBA 3LC0A 1WPGA 2GBFA 3B9PA 5KBYA 1R0LA 2PUWA 2XZLA 1WE2A 1J70A 3A58B 3SM9A 1SVKA 4MUXA 5C34B 1NV9A 2O14A 1H2WA 2G1JA 2QPTA 3DLTA 5IW8A 4DCSA 1ZVKA 1R6TA 2JGAA 1BKDR 3MXTA 1YJQA 4LZNA 4MVXA 4XGKA 5AHRA 3WJAA 3DH0A 4X62B 4D99A 4LGYA 4HGYA 1Z38A 3EEBA 1IY0A 1BGVA 3DWIA 3WMRA 1I3OA 3H2KA 5CUQA 1M2VB 3EFOB 3U3ZA 1RPAA 3IQDB 2YQ4A 3OC0A 2I2BA 1E5XA 1YHYA 1TTPB 1MEJA 5KNBD 2IDMA 3F49S 1UFVA 1ODKA 2PPLA 1CUHA 1ECBA 3MTJA 5KTSA 5EIEA 3SSOA 1SULA 3FTCA 4MJ7A 4GP9A 3TPCA 3OFSA 9ABPA 4EF6A 2LNDA 2NZUG 5A4JA 2ZIZA 3IAS6 1G5FA 1R9GA 4XDYA 2I2AA 3FWHA 4W7HA 3Q9UA 1U2EA 3G0CA 2GM4A 2XZPA 4NG4A 5FV7A 3DMDA 3ZHXA 1UFQA 4E5PA 5I47A 4NU0A 4C0JA 2GAFA 4U8GA 2PRYA 2D54A 1CD5A 2CLEB 3CX3A 4ECEA 4HDMB 1Q7GA 2HCFA 1NQVA 4RK7A 1FJGB 1NN1A 3CX8A 1BDHA 3FPJA 1JFLA 1P73A 1UJBA 2C92A 2OHGA 3BKWA 3MLEA 3TFQA 2AG8A 1M6VB 2OGSA 4BO2A 4UQLA 3SVTA 3TKAA 3K30A 4RMNA 2C83A 2AOUB 4GIBA 2NAPA 1IRIA 3MUNA 1EE2A 1VLJA 5DHSA 5G40A 1EGQA 3ZWYA 2BH9A 9ATCA 5JJBA 4JXXA 1U0EA 3LA8A 2ZRDA 3UCXA 4PG4A 2X6RA 4D5GA 1G16A 2QLLA 4GOJA 1WB4A 1C4KA 3L5KA 4X45A 7REQB 2Q5LA 4Z4GA 1PFVA 1JPJA 4WEQA 4ZALA 3HJUA 1VB3A 3CONA 3PTLA 1XOIA 1UAGA 3RJ5A 621PA 4KXUA 4NPHA 4MUMA 3VM6A 3VPAA 2WG0A 4I3FA 4G89A 2WYIA 3CZ9A 3RSFA 1SURA 3GLGA 4R84A 1T6XA 3GT3A 3HQ4O 1UF9A 1JBEA 1CVIA 1JKJA 1SCIA 3M4XA 1N6NA 4RDIA 1LD3A 4PO8A 2VBCA 1L4YA 5K8VA 4YQZA 1E3QA 1JWAB 4IDQA 2HQBA 2P0YA 5ILQA 2IUUA 2FSHA 3DYBA 3CEMA 4PPQA 1PTJA 5EA2A 3U4DA 3QVOA 4YRMA 1C3VA 3KSBC 2SHKA 4R9RA 3EG5A 3H0EA 3P9QA 4MCIA 4MRMB 1SCUA 3ZHTA 5JLAA 1DDOA 4D6XA 3I04M 2OCKA 3N8HA 3GZ4A 1TLFA 4DCMA 3KRTA 1E2QA 4R2XA 3WGLA 3QW4B 1L4UA 1YMUA 3M3HA 3PD0A 2W8BB 4OHPA 2VDVE 1DAFA 1ZW6A 3NTLA 5LL6P 4KWEA 1SD2A 5E7IA 1GDTA 2VBGA 3GJXC 3ACCA 3IJEB 4YUZA 2CDRA 4HJXA 1EIWA 5BOVA 4DS3A 2VSNA 4BVFA 4FYXA 1UPFA 2QN7A 4V39A 1Z63A 1WPXA 1TM5E 2VDOB 3K4HA 3QXCA 3IKTA 2O5EA 1NXSA 4OVKA 4WKOA 4NBUA 4CMEA 1F8YA 1VTKA 2VHWA 2AFRA 5IBCA 2BSQA 2Z98A 1DRVA 1U0RA 2DC1A 3FSGD 1IMJA 1XCOA 1GG9A 2Z57A 2VT3A 3HBJA 3E1GA 1N5MA 2DY1A 1YVEI 2C2XA 5G3YA 4G0NA 3QEOA 1U63A 1B8VA 2GCEA 5JOQA 2FSIA 4YJHB 5BSVA 3NRCA 3WICA 1HNNA 1Z2OX 4Q3OA 2CVZA 1IAVA 1K4KA 4FDVA 5ALIA 5H59A 1L8XA 1VQ1A 3H5TA 4HYQA 1Z62A 1WUTA 4IDPA 5FPSA 1ISRA 1NDUA 1OH7A 1SPXA 1QUEA 1X86B 2DXIA 3QVUA 1PJRA 4YFYA 4JJGA 2YYSA 5E1MA 2QUIA 1RU3A 1U0GA 3IDFA 5A7FA 2O7NA 1PJTA 3H2ZA 4PGHA 4R4JA 2AKAB 4ZAVA 2OPBA 4N0QA 3SEFA 3KR1A 5MF6A 1KXZA 3PCTA 4Y0NA 4ZVMA 1Y4DE 2HI0A 4KQ9A 4UHHA 1CQXA 3HO1A 1Z0SA 1UWCA 2IXAA 4KXXA 3HVRA 4CCAA 4NX2A 2I03A 3C24A 3L82B 5JD3A 5E1BA 4R1MA 5KTPA 3KIPA 1X8LA 2R00C 4LJ5A 1Z5ZA 3L3BA 1PR0A 3QKSA 4LXXA 4BJ5A 4TYYA 1VCOA 4N7RA 1VRWA 2GRAA 4JBGA 3O2QB 4Y2TA 3RIHA 1TTTA 4D4KA 4YWJA 4CT5A 3PC7A 1Z5WA 4TS4A 5B7GA 1P81A 2WVGA 5DP2A 2XT0A 1MIOA 3BTSA 3NOQA 4DNXA 1G18A 1A50B 1OD6A 2C57A 4L2IA 4UTZA 1V8DA 1O5TA 4TTAA 3K0AB 1SZPA 2FK8A 4XIYA 2RGUA 1KRHA 5L4SA 4TL7A 5K0ZA 4NESA 4XVRA 1V4BA 1P4SA 1WZEA 2MSNA 4EG7A 5A04A 2UUCB 4Q82A 4MYCA 1X6VA 3GGPA 1QO0D 3FUXA 3WGVA 3ZHQA 4UJ5A 2K5UA 5T8KA 1KI3A 3T1HB 3OU6A 1AXEA 1NT4A 4Y2JA 5AOAA 2HK8A 1A1VA 2IZZA 1X0VA 1P1BA 4AUMA 4PRKA 4TLDA 4DUGA 3FYUB 3GJQA 4XFJA 1DAMA 1EK0A 2CJFA 2PZAA 1IFXA 1HDXA 4IF6A 1N7IA 3DEFA 1AMNA 1QLWA 4GS5A 4GP7A 3T1OA 3HI6A 2QTHA 5A6SA 3LK7A 2V96A 1GG5A 4TQGA 2ZT6A 3KYBA 3NO4A 1WB5A 4CLDA 3ZWXA 2CXXA 2PT9A 3SXUA 4LPSA 3HYTA 2XD4A 2KSQA 2IYFA 1AC5A 1FVHA 3ANLA 1CPYA 3GD5A 4EOGA 4ESOA 3KJQA 1GOTA 3QE0A 4KL8S 4M1ZA 3UMRA 1I5OA 3Q7SA 1U04A 2XR1A 3UF0A 6Q21A 1YK0A 2RMKA 5KS2A 4O8CA 2K6GA 3KWMA 2W2LA 4IEEA 3TTVA 3MGGA 2A1IA 1ML3A 2Y1GA 1ZZEA 1TVKA 2VWPA 3PC8C 1C9MA 3LXMA 2JG3A 1AU9A 2JGFA 4H59A 2FAXA 1Q0TA 3GRPA 5I9TA 3K70D 1V16B 2PQ0A 5DF1A 5IBPA 2QZSA 4CDMA 2XAAA 1BXZA 3DBVO 1JE1A 3CKYA 4PZ0A 3HVJA 3SFZA 2DLNA 2WP8J 1K7SN 1VHLA 4EGSA 1CR0A 1E3TA 1HDCA 1I8TA 3I1YA 3S40A