3WHPA

Crystal structure of the c-terminal domain of themus thermophilus litr in complex with cobalamin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
192
Chain Sequence
EDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal domain of Themus thermophilus LitR in complex with cobalamin
rcsb
source organism Thermus thermophilus
molecule tags Gene regulation
molecule keywords Probable transcriptional regulator
total genus 61
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
A PF02607 B12-binding_2 B12 binding domain
A PF13411 MerR_1 MerR HTH family regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 3whpA01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 3whpA02
1ID8A 7REQB 3IVAA 1BMTA 4HH0A 1REQB 3KP1A 1CB7A 2I2XB 3KOZA 2YXBA 3KOYA 5REQB 3BULA 3EZXA 1E1CB 4HH1A 3REQB 3IV9A 1FMFA 4HH3C 6REQA 7REQA 1K7YA 1K98A 2XIJA 6REQB 4REQB 3BICA 1E1CA 1XRSB 4HEHA 3KOXA 2REQA 2XIQA 4REQA 1B1AA 3REQA 5C8DA 3WHPA 3KOWA 4JGIA 1REQA 4Q37A 4R3UC 1I9CA 2REQB 5REQA 1BE1A 1Y80A 1CCWA
chains in the Genus database with same CATH superfamily
5B7NA 3LHSA 1TD1A 2XUPA 4AG6A 3DLBA 2G67A 3F9IA 3D54D 1M1NB 2VK1A 4OF4A 5B6IA 5TPZD 5JDIA 4DKXA 3LH5A 3IDSA 1E32A 4KXVA 3TMKA 3BN3A 2IUFA 1XWWA 1YGYA 3OE1A 1FDTA 2WWFA 3D6JA 4FZRA 5JZOA 4XGQA 1IMOA 2I22A 4K9NA 4G86A 1E2UA 4ZVMA 4WNIA 4K26A 1TI7A 3IVXA 1L5YA 1MD9A 2OXCA 1ESMA 3KNZA 3O73A 4YO7A 1CSEE 3FLEA 4TS9A 5BW6B 1QMPA 3BGDA 1KJZA 3DL2A 1QIIA 5DASA 5ALJA 4JQYA 3KALA 5CDTA 1ST2A 3OPYB 3W3ZB 4K8RB 4OLFA 4V3CA 3UANA 2EWVA 5G1NA 1YBVA 3IKLA 1IHYA 2UXCB 1YT5A 3D4BA 3W79A 5JLAA 1YHYA 4PIMA 1E9EA 1EDDA 1XFDA 1W4AA 3OFKA 3DV0A 4JC0A 4JI6B 3IUSA 3U3ZA 3U44A 1M1ZA 1KO8A 3N2ZB 2HNAA 5CVUA 4DA9A 1ZGHA 2R00C 4JS0A 5JY6A 1Z4LA 2R4QA 4JLDA 1V5GA 5AHOA 2XSZD 1BMDA 4GLLA 1UJMA 4CGZA 1YTLA 1MTOA 3M4JA 2BKEA 2JFNA 3GAMA 2CNWD 3HBJA 4IX9A 2ZWAA 3A9TA 4MO2A 1RRPA 3HVKA 3DE7X 3RSCA 2OV2A 2XMBA 4BJ3A 1ODCA 3DZHA 4MWDA 4R51A 2YS7A 4M1OA 5C8YA 5EWJA 2TYSB 2A3RA 5FA6A 2GD0A 3IJEB 3DKIA 1EM8A 2GUWA 2GO1A 3R0IA 4L07A 4L4YA 5E9JA 3KC2A 3DE3X 4CMCA 2ETXA 1YQ9A 4ZC8A 2P77A 1EGQA 2WICA 3WYCA 3AJAA 1JFVA 1GU0A 3HUUA 3WHKA 3ZWPA 5DP2A 1E4YA 1FMCA 2WHPB 4WZBA 5ESRA 2L82A 1WTCA 4ENRA 4ZGWA 1BWPA 2WD7A 1HE5A 4GWLA 4HADA 5CXXA 2G1AA 1OLUA 1TCAA 2WY2D 5K3OA 2XE7A 2JD2A 1VGVA 4R83A 4W9NC 3HN2A 1G60A 3EXIA 3SBXA 4AMBA 1RXWA 5BN5A 1MO5A 2Z0MA 2WMYA 4B31A 1NQOA 1Z83A 1UEIA 2W98A 3T5AA 1BXZA 4D9KA 4L4ZA 5FUWA 1YNOA 1LGYA 2GJ9A 4NXNB 1AH2A 1T2FA 2IYSA 3COZA 1W5AA 3HCPA 3P96A 1IOVA 4AIRA 1ULZA 2PS3A 4KE9A 5K3EA 5GGYA 1JU9A 4BN5A 4F21A 3R9XB 4MUKA 2C7RA 3ZDAA 1JFRA 2RGNC 4WT7A 3WTBA 5C8YB 5FWXB 5K4HA 2BGWA 1WHTA 3ETLA 5FP0A 4LZNA 1UT8A 5KYWB 2BFCA 1AQ6A 4M0PA 5DHQA 5DCYA 4ZZ2A 3RWMB 3W8RA 2FPMA 4DLUA 2ZZNA 2OGTA 1C9NA 4DWWA 3V1LA 4YJ3A 1DGQA 4Q3OA 1U31A 4HUJA 2JW5A 3USZA 2AX3A 2IIQA 2Q62A 4CJXA 2GZ1A 1OLUB 3MB8A 4UMVA 5EC8A 2JRLA 4IHKA 5ADHA 1CDEA 1ZD4A 3HCOA 3AK4A 3ZWOA 2OWEA 2H00A 5DEIA 4L9AA 2Y8EA 4N3AA 5EE0A 3WLMA 1TKBA 1UQUA 1Z07A 5LZ2A 3S8EA 1U3WA 1Y9ZA 1XNJA 4N3NA 5FHRA 1YZ3A 3HY3A 4CVNA 2O8FB 4PQEA 1UKYA 3TZLA 3AEQB 3DOEA 1X7XA 5FL7D 4IUYA 2G88A 1SD5A 4C1NA 2G07A 2OCDA 3VR3D 5CW1A 5GY7A 1T1GA 3UJ7A 1GTJ1 5IW8A 2HHLA 3PNBA 1KA9H 4IVNA 5H81A 5HCNA 4DUYB 3AVWA 5B1IA 1UMKA 1PTKA 3ZG6A 3EGVA 3ICQB 1UDWA 3H1GA 1QHGA 3N28A 1WHTB 5JZ9A 1H3NA 4RORA 2YV2A 4PGHA 4RQUA 4B34A 4I7EA 2QMOA 3FZNA 1FNSA 1YQEA 1JEYB 5BWMA 1IJKA 3OTHA 3CUUA 4Y6QA 4Q9HA 1IG0A 3THOA 3T4UA 4UFPA 2VP4A 1AOXA 1ZIPA 3FPLA 1WDWB 1X1RA 2LV8A 3E8MA 4BQQA 1M8JA 4OXYA 3GZJA 3PA8A 1N5IA 3PXDA 5M3BA 4RD4A 2GFIA 3R3JA 3V8PA 1NDUA 2CLCX 4H16A 4DDVA 1JJFA 4A36A 3PIRA 3PZBA 4FI3C 2JDIA 3RG2A 2YW9A 1M5RA 2IHZA 1YR3A 3T1OA 1NR5A 2B2CA 3OMXA 1SXGA 4JZYA 1SUCA 1XNGA 2JAQA 1KZGB 1YRAA 3FZQA 1BXKA 2HW8A 3R3WA 1L4FA 1ZG3A 4M1KA 2HCBA 1PJAA 4KEAA 3SICE 3DSRA 1H6AA 1KYYA 2BE7A 5JZVA 1JKJB 2IBMA 5LU8A 1CUWA 4QJ4A 2EG9A 2ZJ4A 1NJFA 2Q3JA 1NIJA 3EA0A 1EZ1A 3D0RA 4TTJA 2OY0A 2ZJAA 3FSRA 5I8WA 3IQIX 4ZCQA 3IUEA 1QDEA 3ECSA 5E1OA 3RANA 4R2XA 4QG3A 1DC6A 1H66A 1U0EA 2FR0A 2C07A 1H94A 3AJ9A 1HE4A 4XTCS 3UK0A 3JQ9A 1SIOA 2JLQA 2OGUA 1KZHA 4UXHA 3QEJA 2WPDD 3UCXA 5LQNA 4B75A 4J6EA 3HKDA 2JFOA 4FNGA 3F7TA 5KVAA 1VB3A 2BTOA 3C1TA 4LRWA 5K6AC 3O82A 5I7FA 2QMZA 4CM3A 1ZH0A 4PIPA 4BUZA 5ADVA 4X1YA 2VHXA 4LHYA 1A72A 4R3NA 3ADPA 3ODPA 1T5DX 3OIDA 3QU4A 3JYHA 2ISQA 3L0CA 4FKZA 4BVJA 5T4FA 2C7QA 4XD2A 3L8MA 4BGEA 2VFAA 1C7QA 1FNNA 4EKDA 1DDOA 1C2TA 3TZCA 3DBVO 1O94C 1T0JB 5DDIP 1UR5A 3ISVA 4L72A 1TA4A 3B9RA 2LGJA 1NOIA 3KLBA 1SRQA 5ESDA 1YCGA 4LDRA 4IHQA 4B76A 3JWPA 4YHHB 2A0KA 3HVRA 3B38A 4WGFA 4MRVA 2F1HA 1H2HA 3W5DA 2FPPA 4IZ6A 3NWJA 4RK6A 1ZVMA 2JIZD 2Y1XA 3BMQA 1GNQA 1W34A 1WW2A 4DQXA 4DV1B 4M0LA 2BL4A 2NXNA 5EJIA 3HKBB 1XU7A 2WNHA 4MNTA 3FI0A 2ATIA 1Y5LA 3TR0A 2GXQA 3QA3E 3PI6A 1BFDA 3KJNA 3UY4A 1R6TA 2EGUA 4GKVA 1U9IC 4UM7A 2ZSJA 4GOLD 4DREA 1TQHA 1XRPA 3DDNA 4QGAA 2HF2A 4PYNA 3JASA 1GZ6A 2JA2A 1NF9A 5TMPA 1YVEI 2WHRA 4DM3A 3TW8A 1KSHA 3R5TA 3M0EA 1FRVA 2E4ZA 3MAAC 3AM3A 2RD2A 1KJYA 4IDBA 4BLRA 1HMPA 2J0SA 2O3SA 1RKBA 4HB2A 4JLBA 4DSOA 2R8ZA 2GKGA 1DQSA 4E6PA 1NKTA 1K86A 4XQGA 1O94D 4Y7CA 3MXTA 3WGUA 3JVUA 3WAGA 1E2HA 2F4VB 5ENVA 4OREX 3SS7X 4MR8A 4KSCA 4BX9A 4R7ZA 4F56A 2QLLA 1PNQA 3TLCA 3FTCA 4JR2A 3L6CA 3Q5DA 4MLPA 4R1NA 4AN1A 5KNCH 1FFWA 3IPRA 3KVYA 3L7AA 3NIBA 4KRXA 4DY4A 3WO0A 1KNXA 1V8FA 2QVCA 1E5XA 1SHTX 2AX4A 4LN1A 5EPEA 2CFCA 3MA0A 1SUWA 2EJBA 4NONA 3L92A 1TJ4A 2BIFA 2IEAA 1IWPB 2VATA 2Y0CA 1JAHA 3PQ7A 4GQAA 3JYLA 4PHFA 5ALTA 4JKIA 2R8XA 2HIAA 2IV3A 5LWHA 3ZH9B 1GCIA 1DVRA 3EAGA 1NJGA 3I1IA 1IUOA 3P9CA 3HDQA 4UE3S 2G1UA 3VISA 3ZWVA 2HJVA 2JIOA 3WK7A 4CI0B 4W5QA 2A92A 2ENWA 3LUFA 2XE6A 3TL2A 2X42A 2XMDA 2X0EA 3GDGA 4E4RA 1XU4A 1MQ8B 3C6MA 2FZLA 2FQYA 3PGKA 2YMLA 4KTVE 5FNVA 1F8UA 3IKVA 1QLJA 1ZNYA 4FOPA 3E4CA 5ANRB 4HF7A 3LY8A 3I32A 1JJVA 1II9A 2NVUA 3PEEA 1AGNA 4NS1A 3AFGA 4OJMX 5A5GA 5DK4A 1CHNA 1KIMA 3UUWA 4B0PA 2V9PA 4XLZA 2XCSB 4D25A 4NOMA 4QYIB 3QPCA 5EY5B 5I9BA 5TGTA 3S2YA 4H60A 3K72B 3O8RA 4TS4A 2G09A 2IPXA 3HR8A 4JJGA 4HAXA 1LBSA 3IR7A 4HBGA 3GLIA 4ZVOA 3LS2A 2QS9A 3CLHA 2VA8A 3K1JA 3RU3A 1IHUA 2JVKA 4L8WB 4KPFC 3A7DA 2ZATA 1PG5A 1IXKA 2OV8A 2NOAA 4MW9A 4ZQFA 1E9VA 5DBOA 2YV4A 2NTYC 4LJ5A 3LHDA 4NK5A 4CKYA 4LXHA 4ESEA 2Q1WA 1FRFS 2OZEA 4K6GA 4LIPD 4MYRA 5FWYB 2WOJA 3FTQA 3S5UA 5I8PA 3GU3A 4OX9B 1DZIA 4UCFA 3GX1A 4R3WA 3AHJA 4OGKA 5KPDA 1UJNA 1Y5NA 5BSRA 3L6DA 5CFOA 2IP4A 4HMOA 4EIWA 1F9EA 3DCJA 1DXOA 2EKBA 3KCNA 4HPXB 1VG1A 2XNJA 3W3AH 3LY9A 4NC9A 1KVUA 3H7IA 9ABPA 4PW0A 2WOOA 1EK5A 1JHXA 1P9RA 3SE7A 5KNDD 2AN9A 4GC9A 4S2EA 4E07A 4E15A 1MQSA 4A8JC 4O5OA 5A6VA 2A5LA 4ALNA 4A91A 2TMGA 4GPBA 5KTMA 5AJUA 1HFJA 4AJIA 1MO4A 1EX7A 4UHBA 1ZLXA 2GFHA 1FP4B 2YIVX 1ISSA 3A3YA 1FL9A 3E9DA 4A1OA 4AN4A 1MB4A 1RXSA 2R8OA 4AMGA 4WN9A 1CJKC 3FNGA 2WSSD 1BQEA 4B6JA 5TT0A 1MV5A 1QYRA 1STOA 1VYHA 3MWDB 3CVYA 2BP7B 2PNJA 1TTTA 4PO3X 1IBRA 4KR6A 1ICIA 3SHVA 1GL9B 1ISGA 3GAAA 1WY5A 3I9KA 2BWJA 4JSTA 3UMSA 4IHAA 5LIPA 1ADJA 2IXDA 1I0LA 3HR4A 4YXWA 4DCJA 2I62A 3CLTC 3QVSA 2V8BA 1Z4MA 4MS4B 2WSBA 4EFKA 2FSVA 2C0QA 2ZYAA 3F49S 4YRZA 1O58A 3EDMA 4DLZA 3QFRA 3L0BA 4B46A 4KQ2A 1P91A 2OQRA 1U28C 1J8VA 1VLQA 3IP7A 2VUIB 4HGZA 1EVLA 1HYGA 2NTEA 1AHIA 5FR2A 1Y8ZA 4WK0B 4EPWA 4YMVA 3K9WA 1W25A 4BO0A 1DDGA 3A4YA 3OJWA 4CMEC 2RMKA 4GR5A 1AK2A 3I3OA 1SULA 1ZM9A 2ZJ0A 3LE8A 1GPJA 1N6IA 1C8BA 5HBGA 3R2JA 2VAXA 2WMDA 1IQ0A 1K4MA 4RDIA 1VG9B 2NN3C 1VE3A 2J9RA 3GW8A 1IZ7A 3BDAA 3PC2A 3A25A 4H6WA 1GRVA 2G5CA 1KERA 4J9VA 2CEAA 3DQZA 4TL9A 5FNVF 1IEXA 2JCYA 2Q0XA 4JZKA 4AF6A 2O8DA 2GK4A 1EIWA 3WI7A 1NRJB 5J4KA 5SYNA 3EUWA 5BNZA 1U1FA 5I5GA 4XSGA 2J4FA 1RJDA 5LYJA 1UXKA 3I28A 3CB4A 3ZZ1A 3I2IA 4CLXA 3I92A 3FNRA 3ZYZA 1PT5A 2BGIA 1VDZA 3QYPA 4O29A 5CGZA 2JPDA 4MWEA 2D00A 3TW4A 4QUJA 5T7BA 1SUDA 4GYYA 1E0KA 3GDOA 2DWQA 1H42A 3C6KA 3CX4A 2JJQA 1E66A 4RULA 4DCGA 2PZFA 3HCDA 2IUSA 4CL0A 5HS4A 4ZRNA 3VU1A 1FYFA 1L4UA 1SBHA 3ETEA 4HY3A 4OHPA 5DWDA 3RSFA 1KO1A 2HA0A 4IM7A 1YJ8A 1N92A 1P75A 3JQPA 1ZD1A 3HSSA 2PTGA 3UGQA 4IFEA 5J2TF 2CXPA 2GEUA 2JDID 1MT0A 3C43A 4WDRA 5EIHA 3IAS1 1FZTA 2ILVA 3C7TA 5DWVA 3UAWA 1SXHA 5AKXA 3FCOA 2FEPA 4IIEA 4YRBA 1SZJG 1SHKA 4IXDA 1YFLA 1A1VA 2JGAA 3LK6A 1FFAA 2QBYB 2VJMA 3OPXA 2QP4A 1KY5A 1V9LA 3A14A 4AS3A 4L27A 3KUKA 3T5MA 1Y8RA 4OTZA 5EJMA 2R7MA 1ZM3A 5FUBA 2V4UA 3K20A 2OO3A 1CV2A 5EZ6B 3S6JA 4ASUA 2NSDA 4AURA 1Z5VA 4L8GA 2H5EA 3C3XA 3JZDA 1DC8A 3QE0A 4BO1A 4M49A 4RTPA 5DP1A 4FEGA 1R5JA 3IT3A 1C30B 3GAZA 4F91B 1X7HA 4B3FX 4EJ6A 3CURA 2A1UA 1N5MA 2AKAB 2BMWA 1B0AA 1G55A 1DTSA 1RLOA 4RZQA 5GZ6A 1Q7EA 4AUKA 4Y2SA 3PXUA 1QV9A 1EI9A 3BB4A 1JA0A 2HUNA 3EG9B 4ZCLA 4Z4FA 4CETA 3KTFA 4RSGA 4U02A 4BLTA 4K9MA 1FUIA 1T4MA 4G8DA 5DXJA 4ZV4A 3RBZA 3SI7A 1F38A 2Y0PA 2VEDA 2OUKA 4G0OA 2OD7A 8MHTA 2YMQA 1IJBA 5AUPB 4B6SA 1O8BA 2FGJA 3EXG1 2AL7A 1ORRA 2ZRLA 3B89A 1KDRA 4MWZA 4EVQA 4X0EA 3HN7A 3SQXA 1ZBDA 2IDJA 4PLHA 1UBOS 4AY2A 5B1YA 5TX7A 1OZGA 5LNK1 1MOPA 4IWNA 4PZAA 3WYEA 3OZEA 3ABZA 2YHSA 2PR2A 1CJSA 1PBNA 2VZ0A 3KOYA 3M9WA 4HDRB 3VJKA 4ABYA 2V6FA 4F2HA 2O23A 3PICA 4ZGGA 5J4YA 3IQXA 3W0LB 2QL7A 1I3KA 4AKEA 2AN4A 4BO6A 2DBQA 4A6DA 4F6CA 2VUTA 4NZYA 4UU8A 5AW3A 2XB8A 4J0IA 5E95A 4KNVA 5CM2Z 1J2UA 1KI4A 1C7FA 1V41E 2X22A 1O6GA 1SG0A 3B9BA 3HB0A 1F8XA 3AP2A 4YCAA 3C4VA 5BN3B 1Y7IA 3AFMA 1DJOA 3O83A 4LWZA 3DOUA 4NV0A 3T15A 3AILA 4WLFA 1EZ4A 3BSFA 1EB8A 4MMXB 4B3BA 1N2SA 4LISA 3SHQA 3HXQA 1WSWA 1VJTA 1GPKA 3ZGOA 4B73A 2NUTB 3KPUA 3DEFA 4L1KA 2D62A 1NBHA 2HRQA 2XWQA 3KPVA 4HQFA 2WMOB 4QPJC 5FB3A 5C34B 4CIXA 2YXDA 1DBPA 1X77A 1FDIA 1GFZA 4Z9YA 5FBHA 1N2CE 3P9QA 2IYZA 3A3PA 3Q5EA 5CJPA 4MDYA 5MGBA 5A2QA 2BJWA 2V59A 3KFLA 4IPTA 1EX9A 2DR3A 1A9SA 1ZKMA 1S2OA 2HF7A 5E0KB 3GGPA 3C3KA 4FOLA 4V0LA 5EGSA 3HL4A 5KZMB 3I0ZA 3T9DA 2JFFA 2VNAA 3L4KA 3PHIA 4ZYXA 1QVZA 4M1SA 1BDJA 3ML1A 2HYIC 5KVSA 2I3DA 3D3JA 3GRPA 1AZSC 3NHAA 4G5RA 4GLFA 1YQUA 2VH5R 4J7XA 3RF6A 4ALLA 2WTEA 1VYTA 1OIWA 1R8SA 4IGKA 2OENG 1FFHA 1PS0A 2QRMA 4DC9A 3E4DA 4LJAA 3PQ2A 1KAGA 4I9UA 3M5WA 5C7YA 3AB8A 4XIYA 2ESRA 2I33A 3MJTA 4ZQIA 3SYKA 4ID9A 3OC0A 5TQVA 3PDHA 4DPKA 2C2KA 3HUDA 3OQHA 5DYNA 3DBIA 1BKDR 5KVCA 5FFNA 3VJRA 4H3SA 3JW8A 4UEQA 2A4MA 5FPTA 4C2BA 3QUBA 1D03A 2R79A 1K6MA 4ND1A 2E4UA 4R7TA 4KPGA 3Q0TA 4WEOA 3CWQA 4F6LA 1ZVVA 4F84A 1VIDA 2O8CB 2JAWA 3BDVA 5TT1A 1NXQA 1W35A 2JLVA 1QIEA 5B2EA 4B79A 4YJHB 3B12A 1CVRA 1FVFA 1ZOOA 1ZQ1A 2JGNA 1YB4A 4B40A 3GVIA 5FLYA 5LXTA 1A2OA 5H9WA 5J3JA 3GLUA 1D07A 4R8RA 3ED1A 1W76A 1OB2A 3S2SA 5B7PA 3BEOA 4LGCA 2WI8A 3EGIA 2HZ7A 4C29A 4F86A 2DLDA 3BUSA 3NRBA 3V33A 3JQ7B 1E2QA 4E14A 1RPTA 3GPCA 3HADA 3ZZ0A 3QX8A 3HBNA 4EPXA 3OUTA 5CB0A 1HOTA 5LD2B 4HNAA 1NRIA 3SNKA 5IWAB 2VJKA 3TLZA 3QXGA 1GGFA 4MUFA 3SMVA 3FTPA 3NYQA 4UQPA 5AOCA 2WJPA 1Q2UA 2C3YA 1JAXA 4LC0A 3TW6A 1CF4A 3QIVA 1FC0A 1IYZA 3AUSA 2F8LA 1M2GA 3MWGA 1KEZA 2WKSA 4DAOA 2BT4A 4Q1FA 1MZPA 2PQ6A 1PNTA 3BWDD 3FDFA 1SCQA 1Z4JA 4UUOA 2IW3A 5GOZA 3U80A 2G5TA 5LDHA 2RGXA 5CTJA 4UNQA 621PA 1N6NA 3RC3A 1W36D 4B3GA 1P5FA 2PEZA 1V39A 3C15C 4YASA 1ESZA 3SBDA 2J0VA 4FEYA 3OTOB 3SLRA 1GNTA 3KOOA 1MG0A 1RAFA 1I01A 2Y9PB 4PWZA 5F12A 2JFYA 3ZZNA 1PDVA 1JAZA 1J33A 2Q4EA 1FFBA 3I6IA 4JT9A 4K0RA 2HA2A 5CPBA 3UVEA 4BWVA 5KMGA 5AXBA 2ZT7A 3MS2A 4JI4B 1QXSA 5DEOA 3FOAA 4H0FA 3I72A 3OIFA 4UHJA 1OF1A 4XYMA 1FXUA 5EUQB 3UAGA 4IG4A 5TARA 1EFUA 5CIYA 1SFRA 5I7AA 1SGWA 1H8EA 1L4EA 3GEEA 3RYHA 2QR2A 4Q05A 2ZUTA 1C3VA 1LLUA 1NW3A 1QGUB 2AQHA 4RQAA 4XWGA 3GT7A 5JXGA 4H7JA 4G37A 2O1SA 1RI3A 2R6DA 4P36A 1RJ9B 1HH4A 1U6KA 2EP8A 3Q15C 5CH3A 4QGHA 3PEWA 3DXZA 1QGED 1Y8QB 4YCSA 4HB3A 1UOOA 1CY7A 4YMWA 3UJ9A 1G4AE 2IY8A 3UMGA 3THXB 4YP5A 1NSFA 1OQAA 3K9HA 2X2EA 3WG9A 2DHDA 2W43A 3IERA 3T5GA 1WM1A 3PNYA 3COVA 4N0DA 4JX9A 5DBEX 4TVBA 4DEVA 1C7EA 3IQEA 1BU5A 3NPAA 4AP9A 1PGQA 2CWWA 1UZ3A 2QNBA 2WE7A 2ZYSA 3JZAA 4F3RA 2EATA 3NW9A 3GRAA 4MZXA 2AOUA 1DLIA 5KMGB 3VO1A 4KQHA 5FPHA 1VBMA 2RGWA 3R44A 4MQUA 3SCZA 3L05A 1SELA 3G8DA 1Z62A 4KB5A 5ICEA 3EGEA 3JVDA 2GR9A 5REQB 1IOWA 3VBCA 5SYAA 2EP7A 3BULA 1RU3A 3LLUA 1G2PA 5BR7A 2VNKA 1IEWA 2R97A 4PX2A 3EXEB 2QY6A 4IIGA 5C5DA 1EXMA 2Q7DA 2A78A 2FH5B 3WSVA 4RZ2A 3VPCA 4Q4CA 1DUVG 2HMWA 5D7NA 4ZREA 4PG6A 4FGKA 3WGMA 3F4BA 1BS1A 5EPUA 1YAJA 4IDEA 4AROA 2B69A 5EIXA 3BGSA 3SEFA 3ZVMA 3QENA 3G82C 1Y6JA 5K3CA 1E3TA 3DE5X 2AVNA 3GUZA 4FOOA 1UKVY 1Y5RA 3ROXA 5BVGB 4JUIA 2J6ZA 1I3CA 1K6XA 4IXTA 4BNUA 5K8CA 5EVCA 1G5IA 1XYVA 1E3JA 4A0QA 1RE0A 1MDFA 3KD2A 3RYTC 4E2XA 3GLHE 3R3ZA 2REOA 1THTA 1AO0A 3D4PA 3BXGA 1HDXA 2QP3A 5A3JA 4LMPA 3ESAA 5CLQA 4KGXA 1Y7PA 4AF7A 2EP5A 4C0AC 2GZRA 3IKTA 1TNDA 4HNSA 4LXIA 3ZCRA 2DWOA 4E5NA 3TGLA 5B4UA 3PXCX 2F1IA 1NE7A 3CNEA 1LLFA 1WDTA 1YQQA 4NICA 2B8NA 2XUFA 5EUMA 5D1NA 2Y2VA 4Z0TA 5HRUA 1KU0A 1J25A 4C4YA 1SC6A 2GN2A 4H4CA 4JV5B 2O8DB 2QHXA 4R0NA 3CX6A 1UDBA 4TYNA 4QLBA 3OJLA 5LQJA 1UDCA 4L95C 4ON9A 4ERXA 2IBTA 5A4DA 4U3JA 1NMXA 4PQYA 5IKXA 2X5JO 1QKIA 1BQ3A 2J31A 4RY8A 2HT6A 2VSOA 1FJGB 1N2JA 1ZU5A 1VIAA 2PWZA 4IXWA 1LV8A 4ZA2A 5EL0A 2PZGA 5LQMA 3BXXA 2QX4A 1W9MA 2Q3MA 3QV1A 1U5AA 2ODQA 3SM9A 1P19A 4HTAA 2JFVA 2PUFA 1BROA 3DM9B 3I2FA 4N8EA 3V4VB 2HMSA 3WB0A 5JJ5A 4DR7B 2OPHA 1QIFA 2C9OA 3H04A 1ZN2A 1EFVB 2J46A 3ZWAA 5AWFC 3ITNA 2YHIA 1FTWA 4I8DA 4K1XA 4YJ3F 4I9HA 4B47A 3ZW9A 2VYVA 1W5FA 2G7MC 5HTKA 5FOVA 3EB9A 3ZLBA 3A32A 3P1JA 4FYWA 1MAWA 2INGX 3EVGA 1UH5A 2PKYX 2GETA 3BKWA 4I0WB 1Q17A 2EBFX 1YFZA 2P30A 2W2QA 4LYEA 3IPLA 3KX2A 1E3SA 1HG0A 4QFCA 3B5JA 3TIVA 4EQ6A 4KXWA 3A04A 4LXQA 3KLNA 4XYEA 1T0HB 1Y82A 3R5HA 1VP9A 4IINA 4AYTA 5IDWA 4ZOLF 3ZJTA 3M5DA 2DGDA 1PZHA 1T24A 1U2DC 1CETA 2FX3A 5CLJA 4GUAA 4EY8A 3EAQA 4Y9SA 1QS0A 3G2QA 2ZJ2A 4KP7A 4BO7A 1KAOA 1ATZA 2IHNA 1E3WB 1XCOA 3A26A 1UBCA 3BF7A 1D9XA 3LYUA 4QPCA 5M34A 2REBA 1P0FA 3WQQA 3CRRA 2ARKA 2XHEA 5B37A 1TYZA 5HJ5A 4EBBA 2P79A 5A1TA 5BNFA 3QNMA 3IUQA 1KYQA 3RS0A 2RGAA 1P2UA 2PSJA 4P54A 5KOHA 3DHYA 4NENA 3PFHA 2CDBA 3G0DA 4ATNA 1PW5A 5D85A 1XRLA 3OJEA 3GLFA 4KE6A 4L2IB 4MAMA 4D0NA 3L0ZA 1NNUA 3EN0A 1D1PA 1J22A 2RKOA 1U1IA 3BK1A 1XTIA 3B36A 2MINA 2QIPA 3K09C 4WKGA 3DTVB 3FLBA 2ANCA 2NO6A 2KPOA 1YMVA 2XCTB 1QHXA 2EXXA 3IDOA 1J07A 3QK7A 1H69A 1I36A 2Z83A 3D4LA 3KHKA 3SSMA 2ZUEA 1B73A 3A11A 3E5NA 4MITA 1QRAA 4KQJA 3DMDA 4XPZA 4HAWA 1MV8A 2G63A 2HQOA 4W5NA 3FAKA 4JWTA 1XEWX 3TOSA 1YVUA 2FPWA 1CJVC 3C39A 4GMKA 4FX2A 4RM2A 2XMQA 2ZWVA 4KK3A 4GX0A 3E9CA 4QAQA 4URYR 1XMPA 1FP2A 3K05A 4YWHA 1W2GA 5AKYA 2H52A 3ECCA 4YLGA 2GF9A 4R6XA 1ZAKA 1K5DA 2J9YB 4KXUA 2IZ7A 1GRNA 2JAPA 2RHMA 3RS3A 4CHGA 4E2ZA 1KJ9A 1RJFA 2I6TA 2M6SA 1F2UB 1UZUA 3JVIA 1FDSA 1SCIA 2E2WA 1HO3A 5TPZA 3R9KA 3RVPA 2VXBA 3KEOA 1EA5A 4Y2RA 1L5NA 4Z51A 1BW9A 4L2IA 4NE7A 1MC1A 4COOA 1QQAA 2GM3A 2FR1A 2DYKA 4O59O 3SJAA 3OZIA 3KHUA 4G84A 3OI7A 4F5EA 3OQPA 1TYAE 3BILA 1GU7A 3TXYA 3ZIUA 1OWLA 1W87A 2C4NA 3D4OA 4G9GA 4J43A 3IVMA 4QSMA 2YUIA 3O0DA 4KQ1A 2I7DA 3ZOZA 4P5PA 3AP1A 3FUVA 4R1MA 4UM9B 3VOAA 2GVDC 4DBLE 1PWZA 1X9HA 3ABQB 2DPGA 4XIIA 3SSAA 1Q95A 4KQ9A 2H5LA 2J59A 4LVOA 3GK3A 1QBKC 1CDDA 3OZWA 4M21A 3ZU4A 1NULA 1MB2A 4M8SA 1TOAA 1USIA 3Q7SA 2OFFA 5E9QA 1NN3A 1UJCA 3ND6A 1QBGA 3USES 3CX3A 3WGLA 4B5KA 4J4TA 3KVRA 1JJIA 2P6OA 2ZDHA 3PD7A 4X54A 4KLNA 4BEJA 2V4MA 3DDOA 1SU6A 2J0UA 3GJRA 4PPFA 3TLGA 1D7AA 5J4HA 2R2AA 3N70A 3QF4B 4RWZA 5BV0A 1OREA 2AJCA 2FB9A 2IF2A 1QGOA 2PRYA 1NXSA 3D8UA 3DCNA 3QVTA 4J1NA 3WIUA 1XLWA 3BMCA 1TUEA 5C8ZA 5EMLA 1RDFA 3AI2A 4Q7EA 4OHYA 5DOVA 2GZ2A 4D3YA 4YRSA 3N8HA 1TIPA 4HNRA 2OSVA 4S1WA 4TMXA 1CZLA 1K97A 3DF7A 1TMYA 4JJFA 1D6NA 2AZMA 2XQIA 4DRYA 2FP4B 3S29A 3TCXB 4LHXA 2BDEA 3X1YA 1ILWA 1KEUA 2AZDA 2EW2A 3A4MA 3H1PA 3IQDB 3QKSB 4MP3A 4M7OA 5KOJA 3HY6A 4J0JA 3INGA 2VK2A 2RCYA 1E1MA 2W2KA 4L16A 4ZO6A 1E9BA 5EJ2A 2ZJBA 4JT4A 1BXRA 2PT6A 5FTKA 3FOBA 4J94A 3HWWA 2QE6A 2O5EA 4LZZA 3L7LA 1OT5A 1S2MA 1WVGA 3FFAA 3GMIA 3BIOA 4X1KB 1ORVA 3PE6A 3QE9Y 1VA5A 3WIBA 3F2VA 4PO9A 5K09A 5AR1A 3GLRA 4DA4A 1YB6A 3KSAC 1EE2A 4M7RA 1UIMA 1LC0A 4WV3A 4NJEB 3KOMA 2C78A 4YALA 1QOZA 1VL5A 4NARA 5FUVA 3ES9A 1SQGA 4U2GA 3UJCA 3HJBA 2HR1A 1RM4A 1TUBA 1XZCA 2QYOA 2ZI6A 1YC2A 4LBZA 4U7FA 5EXDA 5JARA 3U9SA 3JQRA 2YDYA 3C7DB 1P2FA 1RM3A 1XQ1A 1YBMA 3U7HB 3VU3A 1R3UA 3CLKA 3Q7QA 4KLRA 1QDLB 3A1DA 4QDXA 3U1TA 1YMQA 2JJ8A 1KMCA 4IILA 1NJSA 4X6YA 3UAXA 4INAA 4B2PA 1IN8A 1FZQA 4N0EA 3H2BA 2CVPA 1CJMA 4KYVA 1H85A 5FX2A 1U7HA 3MTEA 2HK7A 4DIBA 1CYEA 4EYQA 3F3YA 5L4NA 1I33A 5A4JA 1YTUA 1UC5B 1Y9AA 1ZRMA 2DWCA 3AWDA 4MW2A 3WWOA 1H0KA 2UZAA 4WE3A 3AKDA 4RD0A 4OMUA 3AVUA 2Z9DA 1RKQA 1Z2OX 2RGNA 1X1BA 2J41A 1NY6A 2PJUA 2ZRGA 2GPWA 3IMKA 3V1KA 1P1JA 4AUNA 3A2LA 4EG7A 1QGUA 3RLIA 5HDBB 2WABA 1EUQA 4YAGA 4I5DA 4YJFA 2AHRA 2PK3A 3NXSA 4O08A 4EO7A 8ABPA 4YPFA 1O97C 1K7YA 1EHYA 4OHWA 1F4VA 1LBQA 2UVPB 2ZM5A 4Y1EA 5T6BA 1BG6A 1FS6A 2YZGA 3QPWA 4PGFA 2VO1A 5BN3A 2MYUA 3TG8A 2UYGA 2C3MA 3JY6A 1FDOA 4RLSA 4MV0A 1BHJA 4DR4B 2LBPA 1L5GB 1JPUA 1ZM4A 2P27A 4MSUA 3R9WA 3JQBA 1AUXA 4EKEA 5IJWA 4RVHA 2ZRFA 5T4EA 1HLPA 3S2IA 2X5OA 1BSVA 1E69A 5IDVA 2ODBA 3O74A 1MOQA 3E9NA 4GBJA 2FXVA 3I9FA 4RDCA 3K31A 1K3TA 3KTAA 2PX5A 3TQTA 5IZ4A 4H1HA 3CY6A 4ME6A 3WJ1A 4I8XA 1PFGA 2Z30A 1T1SA 2DCUA 5AK6A 5T4BA 2A5FA 2PZMA 3DFIA 3L4EA 3RWOA 1D8TA 1E8DA 2WQ6A 4C0SA 2JAXA 1JR6A 4BVKA 2OORA 3NHJA 2ECQA 4ADSG 1NG9A 3OSUA 4YVFA 2ZU0C 5AI8A 5BR4A 4DR3B 2DEUA 5A3VA 1N3BA 4FZJA 2FOIA 2EL9A 2L17A 5SY6A 3W1WA 1J0BA 2B4RO 2BTQA 4OJYA 4FKBA 3C3BA 4JN6B 1X8LA 4A6EA 3LFTA 1ZIOA 1Z7YA 3KQPA 1U8AA 2CL7X 4JCCA 4M1EA 3WLAA 2C03A 5L7WA 1NLFA 1XZEA 1GA1A 1X86B 2C4WA 2ZYDA 1CUAA 4M1QA 4NE9A 1IY2A 1SEPA 4QU5A 4MR9B 2Y05A 4A2CA 5A0TA 1BRMA 2JBHA 4P4SA 5AJXA 3T9CA 1X70A 1G42A 1NVBA 2JCGA 2B7BA 3FNEA 4CKWA 3W4KA 3ZGLA 2AC2A 3OP1A 3VX4A 2GAFA 3DLTA 4NDAA 4ZXPA 3W2GA 5AMXA 5JG7A 4GWGA 5B64A 5K0TA 1R50A 1QVRA 2YOHA 3SKYA 1Q11A 2P2DA 2MR6A 4X94A 4LI0A 1KI8A 2QU8A 3GVXA 4TMTA 2I3ZA 4EHDA 4QLAA 9LDBA 1IWOA 1QLWA 4F2GA 3HBFA 1ETUA 4AJEA 2W2MA 3KUUA 3WC4A 1GLNA 1OLSB 2XVXA 3N2YA 1NA5A 2REQB 2HA5A 4LF5B 3RR2A 3LC7O 5EKDA 4TS1A 4LY0A 4MW7A 2EX1A 1MIHA 1HEUA 2WHQA 3DO8A 2VRBA 4Q7LA 4I2VA 1X3LA 5A4IS 4TTRA 4AJPA 2PZ8A 4DSTA 2DAPA 3U16A 1QP0A 3GGJA 1U6JA 3CLRC 4TV8B 1QP8A 1SOUA 1XQVA 3U19A 3EIUA 1Z3IX 4XJSA 1C7RA 3FDXA 2VXYA 3GJSA 3LC0A 1NPYA 3RAJA 3OKCA 4BRWA 3A8TA 1QTQA 3O7MA 3PK0A 4ZCIA 2XUAA 2DWPA 1A88A 1ZJZA 2HQRA 3QKRB 2EZ4A 1EFLA 10MHA 2QD5A 4MW0A 1JVBA 4U7JA 4P93A 4JEIA 3MRXA 3H2SA 3O8BA 4YRIA 2IHVA 1JAIA 4PX3A 1LUAA 1Z28A 3EYWA 2HPVA 4Q4JB 5AKEA 3F7MA 1NDHA 1KEEB 4Q00A 4HDCA 3HYTA 2P2ZA 3LVBA 3UA3A 2CLOB 3R3UA 2Z6QA 4ZO7A 1AV6A 4FFWA 5BMVB 3A1SA 2VCEA 2IEZA 3FCEA 4R8VA 1RSZA 5K9ZA 2JANA 3AL0C 1YWGO 4FCCA 3PTAA 3KFVA 2V7PA 2OZLB 2XW6A 4OJNA 4CQJA 4TUYB 3RS8A 1DXYA 2JJ1D 5F98A 4RY9A 1OX5A 3D1VA 4WNAA 1CE8B 2JK0A 3EVCA 2I2CA 3V2HA 4KK4A 2VPZA 1PT7A 1BH2A 5HIKA 3TQCA 4ZAYA 3E9EA 2Q2WA 1AB6A 4RK4A 2Z6UA 1BRTA 1N2GA 2IYPA 3ZIAA 5C3UA 4NCAA 3WS7A 4DE5A 4OK5A 1CS4C 4OHFA 5AVOA 4ZVNA 4DQ0A 4DMFA 3QLTA 2RJNA 4KHZA 4F97A 3G2MA 3BPSA 4NF2A 2O1EA 1Q92A 3QEOA 2AH5A 3NC4A 3WWPA 1H2WA 1W46A 1QS0B 5C1OA 2HWUA 3HXMA 5GONB 3MT9A 5I7EA 5HPYB 3EOAI 4JLJA 2GAOA 1HT3A 1LFAA 1YZYA 3SR0A 3KAJA 1I94B 3OLWA 2XT6A 1HG1A 2GVNA 2RAVA 2Q2VA 1QLHA 5F2OA 3GI1A 4O2BF 4UUAA 2AJBA 4EEXA 1N1MA 3HZZA 4NDZA 4Q6BA 4F6RA 3AM1A 2XA1A 4JR0A 4OXXA 4TV9F 3PYXA 1S7GA 1PFQA 1UCFA 2E4WA 3DMPA 4LZJA 1NI4A 4J7CA 3RSZA 4L7QA 4G9EA 4POOA 4HRAA 2AXEA 3MVEA 1H2YA 2WIBA 2A5JA 2DSTA 4HWRA 4HH0A 4BHTA 3CUEF 3AFHA 3SS8A 5FIUA 3LHKA 4CNBA 1KIFA 2WWRA 4ROTA 2HSJA 1D6JA 1VXOA 3DBLA 1VFPA 1K9SA 3I6YA 3KV3O 1KZ6A 3IB3A 1SVNA 3Q9SA 1KMMA 2DE0X 4LPSA 1FTQA 1SBCA 4HDQB 2Q9BA 2H4YA 3M2PA 3OLQA 4NX2A 4BP8A 1Q1NA 2HHJA 4IQ8A 3G9QA 4REQA 5GONF 2OC4A 4CWAA 4FQ8A 1NONA 1V4NA 3KOWA 4LY6A 3PTZA 1ABFA 1L3IA 2JIBA 2GLXA 3OEED 3PEYA 2CHEA 3ZQ4A 1C4XA 1EMDA 1GPAA 2VDVE 4PHHA 4AKTA 4Z86A 3LIIA 1CY6A 4ZEMA 1EVQA 3I01M 1KVRA 4EH1A 4HQLA 4AT1A 5JD6A 3S8MA 3UF0A 3F97A 1FUUA 4Q12A 4AZVA 3WL5A 1Z8HA 1WJGA 2ZRQA 3DV2A 4NNOA 1MFPA 3L8ZA 2AEMA 3AUFA 1DHRA 1N3YA 4XR4A 3FFBA 1ISFA 4RLHA 4QELA 4P0QB 3IOBA 1ZOIA 2IXFA 1T2CA 5F7ZA 1DX4A 1RP1A 2D1FA 3DT8A 1FUYB 3KSZO 4L3OA 2FPGB 1H0RA 2HA4A 3EEIA 3FYHA 4G01B 4OGFA 4ACBA 3T9FA 2OV6A 5FO0A 5F21A 1AXRA 3FYUC 4TGLA 5E7JA 3ID6C 3L6RA 3Q8XB 5CLHA 5F3DA 3RSQA 2I54A 1O77A 2P4SA 3QV2A 3G0CA 2GK3A 4QXOA 5FV7A 3SXUB 4XVRA 2ZJOA 5H4HA 5JD5A 2OOSA 2Z1MA 2IHTA 2XVMA 3KKZA 1GPBA 1PK9A 2ZQYA 1W75A 3FNIA 2BI7A 5FUMA 2CXTA 1IDOA 3OUUA 3WNZA 2R6ZA 5EHGA 3V5NA 3DDHA 5LN1A 2PM8A 2O7VA 3FVQA 2CFTA 1NVXQ 2CLIB 1A82A 2OBXA 5JNTA 2ZXFA 5TQ0A 5IMBA 3FOZA 3OOEA 4CMIA 1AT1A 3SEAA 5I9IA 2X9NA 1UOPA 4XWOA 5EVJA 3TZHA 4EZEA 3HDYA 4TTVA 1ZN9A 4FKMA 2VC2B 2YTZA 1E7YA 1GG8A 1RI2A 3L84A 4G5YA 4U39A 5DRTA 3PJEA 3PVZA 4PQRA 3VYSB 4C3OB 1WR8A 1FJHA 4LJLA 3H5NA 5DBGA 1WF6A 1QCCA 2D2XA 4CQMD 3V4LA 4DSNA 1OH8A 3DFZA 2DBYA 3AHIA 4GLBA 4M1TA 5B30A 3IP8A 5HE9A 2GCNA 2Q5LA 5B3JC 4NMXB 4OCZA 3WWZA 2WT4A 3EUAA 5ALMA 5JWOA 2FZ5A 3VXKA 2FGKA 1BGVA 4PXAA 4BN0A 2YWXA 1GITA 1U9YA 5EYPB 4Z7OB 1E3MA 3HB9A 3OCUA 3HVHA 3PWTA 4Y2YA 4JYBA 5LB4A 2Q6IA 3CR8A 4PF1A 4NAHA 1TF2A 2JZNA 3NG1A 4LECA 2RJ3A 4NULA 4W7HA 3X44A 4B9AA 2PUDA 4MKZA 3OHSX 4DCUA 3DXFA 4G63A 5CCXA 2QRJA 4WJKB 3K7EA 3L9XA 2J7KA 3B2QA 3OICA 3WIOA 3GRVA 4QXAA 2XTJA 4RNDB 5FI0B 3NBAA 1KDZA 1J0EA 1UDAA 3ROTA 3EQ9A 3PC3A 4O2AA 2X8JB 2R5WA 5CNMA 3AOGA 4WFKA 2Q5QA 2QT1A 4B82A 5IXYA 2IU6A 3E3LA 1LZKA 2XDAA 3DNFA 3C70A 4OHXA 4YMTA 3O9MA 5IBQA 1GPH1 1ZNWA 2OHIA 1LRLA 1E2PA 4NYJR 3EARA 4OQ4A 2AFHB 1OPXA 4P38A 4RFSB 5JQGB 3I5YA 5K8UA 2P6UA 1ECBA 4PSAA 1RE1A 3LPLA 2ZR9A 5H59A 3EEOA 4R54A 3VV2A 1QRUA 1EG7A 3OMWA 1T9GR 2QRVB 4X95A 3MTIA 1AGPA 5EEGA 3KUDA 4WZ6A 5F9MA 5K99A 4GPAA 5E2BA 1D2MA 4AICA 1YR7A 2H48A 4EM6A 2Q1SA 2HCFA 2WJJA 4RAOA 4ZFNA 2WTNA 1ZIXA 5EIWA 1PJCA 1R15A 1VPVA 1JL3A 2PVCA 1W0JD 2B37A 3PKZA 2CC2A 2NLOA 1C7JA 5K0EA 3DE2X 2DPLA 1Z3CA 4WA8A 4Q9LA 3T5DA 3SOPA 3U09A 4EEKA 3PC4A 3ORHA 3MXOA 3W7AA 4DT1A 1PL6A 2B6NA 3B85A 3NI2A 2CJPA 1XDSA 1L5SA 2BISA 2IU4A 4LJ8A 3WIDA 1DCTA 2QM7A 5DLQC 2ZQZA 3LSTA 3DT9A 4R40A 2C98A 1EPUA 4H3KB 4GICA 1SCKA 2HAEA 3CLUC 3FJYA 3GN1A 3HKDB 4TVSA 3K2IA 1FP7A 1KYIA 3KKLA 3E1SA 2JL1A 3IX7A 3GFRA 5FEMA 1RKVA 1REQB 3KVOA 4YRCA 3D3WB 3LYLA 4G5OA 3UJ3X 1CIVA 1T6BY 2H7YA 1J2JA 1FXSA 5LSAA 2EKPA 2PL5A 3NYWA 2AYXA 1YONA 4ZC1A 4ZCTA 1MB9A 1NUSA 2G82A 2UKDA 4URZR 3R5XA 1BMQA 2FUEA 3U4HA 4OM8A 3WKCA 1YI8A 4TZ6A 4FDVA 4P3OA 3OX2A 3KR2A 4C3VA 5BSKA 4HLNA 4JCOA 3IUYA 2XLBA 3OM1A 1TQ4A 2GQ0A 5A04A 1T8WA 4IHJA 2VP0A 3G0IA 3NRCA 4AZTA 4QTZA 1HYEA 4O0MA 1R12A 2O14A 4IQFA 4LI3X 4NNPA 1QCDA 2AG5A 2BFDB 4YP0A 1C3EA 1IOLA 2GBFA 4NEHB 5AHKA 1WDKA 2HQSA 3NDRA 4EUSA 4A03A 5FT9A 3ACBA 4BVHA 3ZE8A 3NKLA 4P81A 3MJFA 4YUVA 2XJ9A 5KSOA 1FYWA 2EVWX 1OSNA 3JZIA 1ABBA 1RYDA 1KVTA 2AK2A 1LC3A 2O3TA 1IATA 2PBLA 3DM5A 1EBUA 2BMAA 4IMIB 5CB4F 5TSDA 2IH4A 2XAUA 1CIPA 1I0ZA 3I83A 3SMQA 2VXOA 5FLKA 4UZEA 2Z2ZA 2WDZA 4MGKR 4RIEA 1YNSA 2V9ZA 3QHPA 1V5IA 1WLYA 1E98A 4J0KA 2MR5A 1M6VB 2R6R1 3MC1A 1VE6A 4AZSA 2LNDA 3GLQA 2FR8C 1X15A 2XUJA 3MTJA 2PDAA 3QG5A 2HLHA 1C9JA 3NONA 4RKFA 5J5AA 1FVHA 4H7DA 2JASA 4C4ZA 2A7QA 4H08A 1FTSA 2D0DA 2IGBA 2PRIA 2CHFA 2XDQB 2QZSA 2H1OA 2C54A 1QU3A 2D1QA 3PC7A 5CRIA 3OQOA 3LLCA 3NALA 5K1ZA 2O2SA 1NMSA 5UKDA 1NRXA 2K7ZA 4I55F 3WISA 4ONEA 1OBHA 1Z5NA 4GQIA 3B8EA 2JLWA 1D5WA 2FEOA 2V7QA 1HQCA 1O5IA 1Q1GA 1OPRA 2J07A 2SCUA 3EZ2A 3OU7A 1PR1A 4XZ3A 2QD4A 4KI0A 4C4OA 1JH9A 1I13A 1IEVA 2R68A 1WULS 4WZBE 3TLKA 4BV2A 3ZLJA 3HYRA 5C2JB 3H5RA 4ENTA 1Y3HA 3MWEB 3QITA 1LS6A 1J9GA 1ZK4A 2JFPA 2VF7A 1Q74A 3L1UA 3QBVA 3OEHA 3K1TA 4C78A 2ZUBA 3A6PC 3RSGA 4AO7A 4B3IA 1A9XB 3DGFC 4BZXA 1Z39A 3OECA 4G8BA 5LQCA 1XNQB 3UXEA 3NTLA 4DR2B 4HNVA 1ISRA 1JIIA 1JNXX 1UC4B 4L6IA 3AFNA 4HQNA 2QN9A 4EELA 3R0VA 4G3XA 3EZXA 4Q4JA 5CVJA 5FTNA 4RTJA 2EFCB 2QZZA 1KEEA 2KBFA 3NWOA 4BAZA 4JITA 1IQPA 1Z6GA 2KW5A 2WKPA 3QYAA 3T7AA 4B3HA 3KHSA 4C7BA 4G0VA 3B6KA 3NIGB 2C4HA 3VNSA 4P6VF 4FB5A 1EAMA 1JXQA 4MKGA 3NGMA 1G21B 1QUEA 4PXSA 3E3MA 2LD4A 3F6CA 1JEQA 3TQQA 3NT5A 1W5SA 5F1KA 2VHEA 5TEWA 3R7NA 3VHQA 2O7RA 3P9ZA 3QPDA 4I1PA 1JJBA 2N46A 3UXHA 4PC2A 2IS4A 2OEPA 4RA6B 4FYPA 3GNTA 2UYQA 3EXEA 1G2QA 4EG0A 2J9ZB 1UFQA 3SIRA 3A6EA 4DMCA 4GAEA 2B35A 1Z0AA 2ZYUX 3KELA 5LM3A 3AVXA 3L8HA 1ZXBA 1UBFA 1QJCA 3TPZA 1II8A 1Q0UA 2VF4X 3UOGA 1QFXA 3F96A 3RVNA 3MCWA 2WZQA 3U4MA 1VIYA 2YBEA 2ZROA 2IYLD 4LYJA 3UICA 4AY4A 4B45A 4PRYA 4KDCA 4LE1A 1OFUX 5BVGA 3LWZA 2AUNA 2A9OA 1YL7A 1NBEA 1CP2A 2V0NA 3PDCA 4S2UA 5JPDA 1AUPA 3TGPA 5HILA 2IT1A 4HAYA 4WCFA 2ZSHA 2K2QB 2F3QA 3F8SA 3O0TA 4KQGA 5CM9C 1K8ZB 1U1CA 4R9UC 1A9YA 3F4LA 3ETCA 1JIKA 2H29A 1Q1AA 4XVQA 2CB9A 4BLVA 4ZYYA 3TG2A 2IQIA 1QG0A 3COJA 3CF4G 1Q12A 4HRXA 4RCZA 1FMFA 1T9GS 2KM1A 2CBZA 4XPIA 2F90A 1SKUA 3AR6A 1Z5WA 5INTA 3CB2A 3T1YB 5GGXA 1EDZA 2ZJ8A 3R41A 3ZDEA 5AVRA 3LKVA 1AN9A 4C4TA 1W4RA 1QF9A 1W44A 3QUAA 4L0DA 3QOXA 3DV9A 4MIOA 4CN8A 2XKAA 2HOQA 4G5HA 1I9GA 3VGJA 5ALGA 1R5OA 4N7RA 1GSIA 2VJQA 1MLDA 5I4IA 3AUJB 4U3JB 4FM9A 2WJAA 1TAHA 4IJQA 5EWLA 2HDNB 1F6WA 2PGLA 1L3CA 4PLVA 3RUCA 4NH0A 4FHGA 5KTKA 1V8ZA 2ZU6A 2I6SA 2XA2A 4GOND 3K6SA 2BC9A 1FBTA 1ZRHA 3QUTA 4UEOA 4XFJA 5DT9A 4JLUA 2H1LA 4CCYB 1G291 4KMMA 1E3EA 4INOA 1HL3A 5FWDA 5LZ7A 4CR7A 4B17A 2CT8A 3SG0A 4OOFA 4TMFA 1U63A 3OJFA 2BMJA 1EFVA 1MAVA 3LKZA 3F5MA 4MGEA 2JD0A 2YFKA 5FJIA 3O5AA 4TTAA 3KEFA 4XM2A 4YJ3B 4WMLA 4B71A 5KIAA 1QPZA 3PDWA 2FPGA 2QU7A 4RMIA 2EKZA 4A27A 2X13A 1CBUA 2DUMA 4IS3A 4PXYA 1IFXA 3BGWA 3CNLA 2Q0SA 4Y2GA 2IP2A 2Q4DA 2R44A 4OYRA 2DHEA 1L4HA 1N2IA 1NW9B 3G2PA 3TXAA 3ILHA 5JIBA 3HHEA 4JHXA 2GHRA 1LSUA 2QAGC 3OLZA 4DKJA 4S04A 5E1BA 4GUDA 2P68A 1HX7A 1PUIA 3M1YA 2I71A 4IDFA 1E94E 4ER3A 4P3NA 3QIAA 1K6JA 4ARAA 2YCBA 2VHZA 2GXAA 3QF7A 5JPIA 4MTCA 3GGCA 4HB0A 3GEDA 2P41A 3IVGA 1KFJB 2YNMA 5JSYA 1KBOA 1P74A 1L5HB 1QHFA 2CXRA 2VP5A 3B70A 1TGYA 3BJIC 3H1FA 4HMQA 4P7KA 4Z6KA 2O2IA 4C9BA 1OILA 4BGIA 3F3MA 3HJFA 2H1WA 1KYVA 2MIIA 4L74A 2E55A 5DTEA 4BNFA 3NBKA 4BZZA 1TL7C 1USVA 1ZJJA 2XQKA 1ENZA 2NP6A 1UXJA 3O1HB 4CT0A 1ZC3A 3DHVA 3LVRE 1WIWA 1ADGA 9GPBA 1DHTA 3IURA 3FSGA 3KU4A 2OKCA 4TRRA 1NBMD 1V5EA 2C9CA 4WNAB 1QHYA 3KDPA 3SXPA 3TMAA 4OIFA 1NBIA 2CDAA 5ER6A 4AB1A 3G2IA 2W6NA 1TT5A 4Y8VA 1HKHA 1EINA 3GD7A 1SJ9A 3RC7A 2E1RA 1SRRA 3NHSA 3OX4A 3PUZA 2H3EA 3R3YA 5AM4A 5JMWA 5IT9A 1V96A 5EYPA 2G9NA 2MSKA 4X64B 3Q8MA 1F7VA 4HEA1 3SIWA 4KAAA 5HWSA 5B7QA 4BNDB 2CE7A 2ZB2A 2QW1A 4Q4HB 4Y2JA 1QTEA 2BFFB 1BE8A 1JXMA 1VDMA 4KSBA 1GKLA 2DUWA 2ZAIA 3E53A 4MQ5A 2J5XA 4X6XA 2VF5X 3MWLA 1JKJA 2XQJA 1NURA 4DV4B 2CNLA 2BY4A 5IEBA 3WDLA 1J20A 4XVUA 3GMTA 1RBYA 3DVQX 4FD2A 4EUKA 4MUIA 5A7GA 3N8IA 4WTOA 1VMEA 3S2FA 1KKUA 1KPHA 1Q7CA 2QTHA 4JC4A 4TN1A 1QAQA 1V1RB 2BGRA 4QE3A 4U0KA 2W4IA 3PX2A 3TDKA 2VUHB 1CPYA 4Y3UA 5AKGA 1OROA 3GVPA 1VPEA 4D3SA 2EKQA 4O1HA 2GBLC 4MK4A 1V45E 2NYUA 4HVTA 1TC1A 1OYOA 4P0TA 1ENOA 2XF8A 3VI3B 4KIUA 3KQYA 1HE1C 2X23A 3HCCA 3L3BA 3PHHA 4N39A 3TLYA 3UPDA 4IS2A 5BXYA 4MPTA 2HEGA 2VRCD 1KK2A 3N3AC 3EMDA 1VOTA 1Q77A 2WD7B 4YFYA 5ECGC 1GNRA 2WIAA 4RWEA 4ARBA 1CWUA 4ZAGA 3VNUA 2GSWA 2QR3A 4N5LA 3VMFA 2A3NA 5J2UF 4GGPA 3I0NA 4MUEA 3ENWA 2VQ3A 4LSZA 4UHHA 4AG5A 2Z2XA 2QQFA 2QTRA 2ZE8A 1N5JA 1OA1A 3H2YA 5JS7A 1G38A 3WHPA 2PZAA 4R2KA 5K8JB 1EWVA 2ZRCA 4ARSA 4KIWA 4KG7A 1BGWA 4MHSA 4R2WA 1KDYA 1PWEA 2NG1A 3HU3A 3MGBA 3CINA 3FYTA 5HS6A 4EY7A 3J7AC 1GRQA 4XOUA 1U90A 3GFFA 4A0RA 4J4BA 1TAGA 4UDOA 2WSSA 3SQDA 1U8EA 2HF8A 5M2QA 3JASB 4FHFA 1E89A 1O97D 3UATA 3FLAA 4NEGA 1ZAYA 5AK5A 2FWPA 4GWKA 4W9RA 2SBTA 3U7IA 1T26A 3I5MA 3F5DA 2GAAA 1YO6A 3WGOA 2Z2JA 3H84A 1LNQA 2H7VA 1PUXA 3E22A 4MQFA 3R7AA 1V5WA 3ZD7A 1Z74A 3N6RA 2RGEA 3EBLA 4E7OA 2CY0A 4HAZA 4DSUA 3V7WA 1E7WA 1Z2EA 1VMKA 4ZCMA 1BE1A 5ALVA 1E2BA 2E0IA 2EV9A 3T3DA 4C76A 3BE6A 3PPYA 4EG4A 1NQWA 2FW9A 1Z2NX 4I50B 2H4WA 3WK8A 3PFBA 2GKSA 4ZZ1A 4P98A 3B1ZA 2VWPA 3QBTA 3IV9A 2DPMA 3A1UA 4RD6A 4A92A 3EFBA 3N2GB 4O4JF 2CXNA 4F5WA 3KYDB 2IC5A 4LRSB 4DC1A 3FW1A 1OU0A 4QPNA 4YDQA 9LDTA 2E82A 2WV7A 5EEHA 7MHTA 1XWIA 3CLSC 3WA7A 2Q0QA 1AKWA 3GFQA 4GMDA 1G3UA 3B5EA 8LDHA 1AKEA 3PI7A 1Y6FA 1VJCA 1J70A 2W0SA 4RJTA 1GSAA 2CZCA 3EAFA 4IKOA 1R0CA 1UM9B 1V6AA 2C9MA 2ZR0A 4MQ4A 4BLQA 2WFLA 2WIKA 3PITA 4E5PA 3FIUA 2WC1A 2QY9A 3HWSA 1NQ5A 4RKQA 2FMUA 3R5SA 4N5HX 1WXIA 5T3YA 4X6LA 3NIWA 4MQFB 3FCSB 2ZE5A 1XD8A 4FGZA 4OK6A 1TAUA 4E03A 3GJTA 1ZCJA 1GZUA 4L9RA 2P11A 8ATCA 3EVDA 3PBKA 5D51S 1ZR4A 3MTAA 1SB8A 4JQSA 4P08A 4ETMA 3CKYA 3Q11A 1SHZA 1R3DA 1ZA1A 2COUA 5KB3A 2F9LA 1NBME 2AJDA 3ONFA 2LZ0A 2X6QA 2RHHA 3BWEA 4K6OA 4EKNB 1GAWA 2VK8A 2Z4RA 4HO1X 3R3XA 4BQIA 4UXJA 1QB7A 4D41A 5AW7A 5LJLA 5IS2A 3DW1X 3JD2A 3G1TA 4HNQA 1AKMA 4KDFA 3T1NA 5CFPA 4MW4A 5KX5A 4IGIA 5DN6D 3VZCA 4LE2A 3RTEA 1DAOA 1N8NA 2V7UA 4QGFA 4RGQA 1U2TA 2ZDGA 3RK0A 3TLEA 1NXWA 1TTPB 5FOUA 1FVXA 3MGAA 4NH4A 5F73A 5K3DA 4NBTA 2OO7A 1Z6TA 3RGGA 5F3RA 1BZYA 2MSWA 1EE9A 4IOKA 2PFSA 3VBEA 4EYGA 3WBFA 1XJWA 1OZFA 3H0EA 4F4CA 2ONYA 3TQHA 4GS5A 1FFEA 1U8ZA 2Z8ZA 3PUWA 4RIGA 1F0KA 2C0CA 4UBIA 4W8OA 3RTAA 1WQ4A 4OVKA 5CVDA 1RRVA 2IH2A 1Z8DA 3JZMA 4LJ4A 2NVBA 4LWOA 2WR8A 1T9ZA 2NO4A 1XDWA 2IYNA 2G1JA 1X7GA 3BFKA 3IT2A 3NR2A 4IIDA 1CKEA 3E05A 2IHYA 2C1EA 5H3CA 2GPYA 1I6LA 2W4MA 2XKJE 4EFLA 1FP4A 1VLZA 1KC1A 1WW3A 2FMIA 2GBGA 2PXHA 1I0IA 4CDMA 2A6PA 2O0JA 3R1IA 1QO0A 4BO9A 1A9PA 5JMTA 1BA2A 1BWSA 2ZG6A 2PRZA 3IDAA 2FSHA 4V0RA 2HTEA 2LDBA 3FGPA 1WXFA 4QRIA 3VH2A 4CMJA 4CKCB 5JNLA 1FDVA 3JZFA 3UEOA 3W6OA 1OXXK 3HKBA 2JH3A 3R4VA 2I8CA 3GT3A 1NFQA 2UZ1B 3HH8A 5AP9A 5CFMA 1EE1A 2YVKA 4EMSA 1F0PA 5LYJF 3BFJA 2Q5OA 3UJBA 1VP3A 1ESCA 5L4LA 4RS3A 1JVSA 5EKSA 1XTTA 4Q3KA 1GL6A 6ABPA 5DBIA 2ERCA 3PR2B 3V2UA 3ESDA 1RYZA 2XOXA 4DCTA 2ZRJA 1AVTA 3M4YA 4HTFA 5J4VA 4UDYX 5DTQA 2H51A 3EUFA 2CB0A 1SHJA 3GMSA 5JUWA 4QYXA 1FX0A 4MWCA 3DPIA 3HKCB 2PLWA 4MV7A 3QUQA 3SYMA 3T61A 2VOEA 1LWNA 1YDMA 2LXNA 2XCOA 2ZBEA 3N2KA 4TLEA 4J0EA 3JQEA 4UNNA 3RF7A 3RT9A 1QZ3A 2YDXA 3V55A 4E32A 2C7OA 2J0EA 2XITA 1DBWA 1XEWY 3IP3A 1V43A 1RTKA 4UHFA 1H4SA 2WU4A 1HE3A 5M7EA 2VJDA 1JLHA 3OSZA 2VNHA 2FW0A 1P5RA 4HS4A 3SD7A 4ANFA 1JQBA 2V98A 4AECA 1M67A 2Z9CA 4CCSA 1C0PA 1BDBA 1YA8A 3G2KA 3N53A 3NVAA 1RT9A 4TROA 2WJIA 3EHEA 4XDGA 3RJTA 2VDLB 5M04A 1YDFA 4FDLA 3L4JA 3GPDG 3H18A 2P65A 2G9QA 2Z56A 3TS1A 4IYRA 3SHWA 2ES4A 4DJEC 3CNOA 3N7UA 1OIVA 1LWOA 2WZCA 1K7FB 4YRPA 1I1QB 5K6TA 2VH1A 2YVAA 2DHRA 2YJZA 4W4TA 5ALIA 1RBQA 4BX0A 4CLOA 3NORA 2PG3A 2Z5GA 3LUCA 4RO0A 4HUTA 2XADA 1CRPA 2BMDA 2FN7A 3FZYA 1M6VA 4IDPA 5IHPA 4L4RA 2AE2A 1XD2A 4RYLA 1M1NA 3WMWA 5ESWA 1RLTA 3MT0A 4LK3A 4RLFA 1VYVA 5DX8A 4I08A 2HTFA 1O95A 4MWSA 2QTVB 3FLMA 4ESOA 3A28A 1UMCA 4WBNA 3CCFA 4UTOA 4V1CB 3LX4A 4FHZA 4D4JA 2D2EA 1YBFA 1YKSA 1QK4A 2Z57A 3MBKA 3L8YA 1RABA 5KBYA 4E5VA 1V8OA 1WL8A 3IRUA 3TNDA 4ITVA 4NG5A 3GLIB 2FWJA 5G40A 3V8VA 4IZHA 2XUOA 2FI1A 2I8AA 4ALJA 5BW8A 4GG1A 3OZCA 4A73A 3AR8A 2BDTA 1RWKA 1Z2DA 2M32A 3O1IC 3DA8A 3TQFA 3HTXA 3DWGA 1RYEA 1MF7A 1VPLA 2AD1A 5FCDA 3FJ1A 4FBLA 4KXNA 4K05A 4Y6OA 1WE2A 2F3TA 3AESA 5H82A 1SMKA 2FDCA 1DG1G 1S9HA 3L77A 2UXDB 4TWZA 4D0GA 1Y1PA 1WZCA 4OJTA 5H5JA 1NHWA 1OH5A 3G9XA 1FU7A 4YUWA 2C1XA 1YSCA 3A2KA 3TRJA 2PL1A 2PS0A 1T3LA 3RRMA 2Q6LA 1P1HA 1JXOA 1EWRA 1OC2A 3NHRA 3CZ9A 4DZRA 1MP0A 1WP4A 2PZEA 4JXKA 3CWZA 2VYQA 3HDGA 1JDJA 4PPQA 4G1VA 1M2HA 1R37A 4LJ6A 4NBSA 4OLHA 5AVWA 1JF8A 1N9GA 2C7VA 2V54A 3AJ8A 3WGTA 4AJ9A 1SBZA 5DNCA 3STTA 3WDSA 2V4ZA 3EG9A 2XT0A 4K40A 1OBOA 4LMAA 4TUYF 3OOYA 5D8DA 3SFZA 1VLMA 1IXYA 5BMOA 1KBZA 2YV5A 4WESB 4A8PA 3WP1B 5A4KA 1GDHA 1M5TA 1O4VA 3SYRA 4QZVA 3QKWA 4M6WB 3UMMA 4D45A 3BB3A 1WPXA 2QI9C 5EHQA 3QEMA 4IF4A 3JQ8B 3LX8A 1UTUA 3WL4A 2BHSA 1JIXA 4X7BA 3W34A 4ZOCA 3AW8A 4C1BA 4YJ2A 1NF8A 1P0QA 2DLNA 2HFJA 2JD1A 4LOLA 5CP8A 1U3UA 4C7MA 1FQKA 1YVDA 2Q3LA 4KIGA 4HEA6 3KIPA 4A0FA 1MX3A 2ONJA 4EJFA 1G64A 4F3NA 4BWGA 3ILVA 4IDAA 3VPFA 3LA6A 4Z3KA 3A6ZA 1FEZA 3A4TA 4Q82A 2Z3WA 2Z58A 5CYPA 3U13A 4J8PA 4A9AA 1GQOA 4XUGB 1QVAA 3GUVA 1EP3B 5EKUA 4OGLA 2YJNA 2ZT8A 2NO5A 3MS7A 1CUFA 3WLEA 4PRKA 1LFDB 1YDGA 1YZUA 4FMBB 2R5FA 4JELA 3B52X 1BD4A 2AOVA 1Q0HA 1Y4DE 2AV6A 2FRDC 3OTIA 2NYRA 4OUDA 3WQRA 4ZO9A 3JQGA 3HJAA 4UOZA 3CA8A 1XROA 3DJFA 3EDRA 3N58A 3CRQA 4LUCA 4U0JA 3GLGB 3KXPA 5HNKA 5FFMA 2R62A 1ZZEA 3H5OA 4X61A 1AXEA 2PUJA 5DJ5A 5TF0A 4UUPA 3DLIA 2FU5C 5AVQA 5KNLA 3OU6A 4GPIB 4P0PB 2QLJA 4MVJE 4MB6A 2QA5A 5YASA 4REMA 3S1LA 3RFVA 3EIXA 4YR9A 2BHLA 2NGRA 3ZNPA 1EX6A 2YMPA 3R6GA 2C20A 4GX2A 2FNAA 1YL5A 3LCUA 4U6SA 4YP1A 3M3DA 3PCRB 2B1JA 5CVEA 2GB4A 4KO8A 4NABA 4RJ2A 2HRDA 4ZVLA 1D8AA 3F5SA 1M9NA 4MOWA 2H4HA 1TCUA 4IX1A 4ZDJA 3CXUA 4UMDA 1ZS9A 2PO7A 1U0LA 2GYYA 3BA1A 3SX4A 4AJ4A 5KJCA 4NNJA 4BBAA 4JI0B 1L7DA 1OWNA 2R85A 3GPIA 1RACA 1YJBA 1OBCA 1RXYA 1T6XA 4OUKX 4EVRA 1MHTA 4G9BA 5CFLA 1X6VA 1ZXLA 3VDXA 2OFXA 1A2BA 1AV7A 2WYWA 3OJXA 3VKFA 2B94A 4P4NA 4JLAA 2Q41A 2D2VA 4EMTA 4F96A 3EXHB 3PC8C 4TL7A 5L6MB 1NWCA 4O4LB 4HWOA 3VX3A 4A8TA 2O8CA 1R4NA 2WWWA 3ZNNA 3OQIA 1O0SA 3ZD8A 1C0IA 4QXRA 2EJWA 4UAGA 3OA0A 4LWPA 4KV9A 4CV1A 3OE7A 3EPKA 5EUCA 1E2KA 1S5PA 1TJYA 3QOFA 2GM5A 4NESA 3QI2A 4UM8B 1E6KA 3UB2A 3KT0A 1FMLA 1MC4A 1W36C 3EXIB 3IODA 2PMWB 1ZPDA 4FB4A 2VDWB 4XI9A 3GBSA 3UAOA 1TF7A 3JX9A 1NLUA 3CGWA 3HO1A 1DJPA 1FTNA 5JLJA 3NBYC 2JJ2D 3V48A 1K6IA 5IARA 1KSFX 2CL6X 1RXCA 4HLUA 5M29A 3R7DA 4TQ9A 4ND8B 3T0GA 3LRXA 4WY2A 1UBJS 2R7AA 3V4SA 2WIJA 4NCIA 2Z6AA 4TXJA 1TADA 1L1QA 4NBNA 1EEXB 1IY9A 1YZLA 2XUZA 4DNFA 3IAUA 4JB0A 3P2MA 1A7KA 3AFOA 2VG8A 1F1JA 2XYQA 2V5AA 3NHZA 4WH0A 4IV8A 1RPAA 4UVHA 4AKHA 3B82A 5A05A 3KQNA 1EUCB 2QD2A 4GECA 2C77A 5FQNA 3SBOA 3T7TA 5F7OA 1ONSA 2BBWA 2EFDB 1Z7BA 1CJUC 3MMXA 4O1MA 2KSQA 2RHCA 5LBUA 2H2IA 2GRJA 2PRKA 2FTKE 3Q6NA 4WUTA 1LSOA 5JW6A 1YFKA 1UDRA 3BCRA 1I4DD 2C2YA 4NZZA 3HYSA 2GDJA 4OLBA 3Q85A 1J09A 5LMCA 3A1WA 3IUPA 5FLXA 3TLAA 3W8FA 4Q3EA 4DLKA 1BIFA 2VDQB 4G09A 8ADHA 3K9QO 3EW7A 4LQDA 1WD7A 3VNQA 3K96A 1QG6A 4RBNA 2LCQA 4N4AA 4KGZA 2PT7A 3EW9A 1QIJA 1OV4A 5DHAA 2YZNA 2KYRA 1RYMA 1UK7A 2MSNA 3K70D 4P1ZA 1ANKA 3BWBA 3LXUX 3RTGA 3TE6A 1E58A 3MINB 5KAMA 2QM8A 3LXXA 1UUFA 1YDHA 4DPMA 4AKGA 4C88A 1RJ9A 4MPDA 1T2DA 2IIVA 4I36A 3B5IA 5TGZA 4EF6A 1ZD3A 2OHOA 2LUOA 3JQ6A 2HWKA 3PVCA 4OAOA 1KE1A 2Q1TA 3CN7A 1DC5A 1L7PA 3EMBA 3O3CA 4X3PA 3TGWA 5K8IA 1B43A 1FLDA 3MRTA 4E5KA 1VJRA 2GX6A 1LX7A 4EHBA 1KYXA 2PKCA 3K15A 4N7MA 4I9GA 5FULA 5CDGA 1SUFA 4EUFA 4MJ3A 3IEKA 2AXNA 3OAAD 1BCRA 1EGAA 2C5AA 2HJGA 1NXPA 1I1OA 1ZVKA 1F06A 4FWIB 5B1EA 1XZKA 4MH0R 2WDPA 5T67A 4LXYA 5JO9A 4D8TA 3NU1A 5L4SA 1RPNA 2Q3EA 4F4FA 4X20B 3HUFA 3GOQA 2Q45A 3WFJA 5G2OA 3HXPA 3V4PB 2W48A 5CA1A 4EB3A 2VHQA 3SIXA 1JMVA 1Z4OA 3B3AA 3CO5A 2GHTA 1K98A 3NAGA 4IH9A 2ON6A 2JLBA 4JP8A 4UTZA 6LDHA 5FPKA 4YAWA 3C3MA 4F2WA 3HSKA 1BGXT 4P8RA 3DR5A 2C8VA 1G8AA 4X9XA 4BQOA 2D0PB 4BQRA 3BTOA 5EJEA 5LZ8A 3KTOA 3H6KA 1YE8A 5IM5A 1J5XA 4HGRA 1SVWA 5BSVA 4QOFA 4D96A 4EJSC 4EI8A 1X14A 2CL5A 2BKAA 3G88A 4FQ5A 1UIRA 2G7ZA 4KR9A 2D7CA 3USCS 4CIDA 1AMOA 2PLAA 4D46A 1RLJA 4JYCA 1G63A 3Q12A 2WYHA 4ZDWA 3HEMA 5DBFA 4QBIA 4G1FA 3LT2A 3M3HA 3NS7A 3BC1A 1HFWA 2NZ2A 3P4YA 4FQ7A 1DLJA 5FD8A 5CAEA 1XTJA 2FCRA 1Q19A 3JQFC 1ZMXA 2C84A 2BGMA 2FQWA 1MVOA 2WYUA 3K4HA 1L5LA 3T1TA 4CIBA 5HIJA 5ALLA 3KK0A 3OEYA 1TQDA 5BWBA 1CR1A 3OLYA 4LS3A 4MCHA 4EB8A 1HDIA 2H5IA 2X0JA 4IICA 4RL6A 1ZD8A 1VKZA 2GILA 4MP6A 4QODA 2PX3A 3DEKA 1ONBA 1ZGGA 1YHZA 3QFFA 4IJUA 3H5WA 4OU5A 4C30A 1PFWA 5G3ZA 5KOHB 1K5HA 2F9FA 4IFTA 4IUCS 2GTHA 3EGDB 4AJHA 4R9RA 1PHRA 1YS1X 4BQFA 2PQ0A 3IKJA 4J03A 3RRXA 3UH0A 5FUXA 5IUKC 4HDSB 3PNQA 1E7SA 5IMSA 2NO7A 5AKLA 3WGKA 3TQSA 3JD1A 1VBKA 3WYDA 3S2GA 2RGCA 2J5KA 1R9GA 2XDYA 3JTMA 2KMLA 4GOMD 1DG3A 4L85A 1JKFA 4CKWB 5JEDA 5JXIA 2BEWB 2FLVA 1GAEO 3WJ2A 1R16A 5GMOA 4KQKA 3P2IA 4UHEA 3E8XA 2F55A 5KX5F 1LW6E 3L2OB 1PD0A 2JLZA 2FFAA 3KZVA 1Z6YA 3CJTA 4F06A 2VYND 1NASA 3Q6IA 1UJ2A 1CVIA 1QIHA 5AVKA 3IUBA 3KAPA 4E46A 1C3LA 2PUEA 3UJPA 4TV9A 1ZITA 4R98A 5A9TA 3RS9A 3TRHA 3GPBA 4N82A 3SX2A 4L76A 5T4HA 4H17A 1NLMA 1QIDA 1Z33A 4YNBA 3T7JA 4BATA 1RI1A 1Y6QA 4FOSA 2ORED 1BA3A 3KUXA 4PLYA 4BLSA 4CKBA 3ND8A 4OLJA 4UTRA 3VKWA 1E6CA 4FHDA 2VVTA 5JH7F 4E09A 2O52A 4LC1A 2O8BA 3HP7A 2NSHA 4JYAB 2RCNA 2XJ4A 5ICGA 2ZPUA 1MUUA 1JZSA 3RLFA 3D8HA 3HB1A 1ZDMA 1H93A 3O8NA 3SZOA 4JC8A 3KT3A 4KMSA 4M8LA 1IIBA 2BH2A 5C8YF 5DM0A 5JXWA 3GH1A 3TD6A 4PONA 5JZMA 4QPDA 1FFSA 2GPAA 1M0TA 2OV1A 1ELOA 4WN9B 2I3GA 3DAFA 3MWDA 2E5WA 3AY7A 4MLZA 1BMFA 2IKSA 3FCAA 4MDHA 4TTPA 4UCWA 3RJZA 4PBTA 1AJEA 2PT5A 3D7SA 1U8YA 4MTLA 5CDYA 1JKMA 5I9TA 4BEWA 2X14A 3NOXA 4JODA 2VUUA 2J9GA 4GBMA 3HBLA 1K7XB 4WASA 1P7CA 2HLDA 3DO6A 5LP6F 3L7NA 2FDRA 4OQNA 5AOBA 2VWGA 4CUKA 1B8OA 1OLXB 1T5OA 2P5SA 3EMKA 2AI1A 4Y98A 3IHLA 3CGGA 1LXCA 4D4HA 2H1SA 2O2YA 2QRQA 3PLAE 3WA6A 3P4UA 1N5RA 2QMQA 4I46A 2FPRA 1W96A 4DR5B 3UK2A 2PFGA 4MXDA 4RK1A 5EQFA 4RF5A 1ATIA 1E59A 3PQEA 3PT9A 2EYQA 5H8WA 4BEVA 4DCPA 1KQGA 3ZU6A 5A2GA 4LZLA 1M83A 5KSPA 1GTVA 2KX7A 4JVOA 1XDBA 3DTVA 4N7BA 4DLRA 4GSLA 4PZPA 4CKZA 2JHAA 2IXBA 5HKKA 3LT0A 1EWTA 1OI3A 3RCBA 2OBNA 3E18A 4RMNA 3BBPA 4U6NA 2OBBA 5HDQA 3C5CA 4NJOA 3ZJUA 1EVZA 1OH7A 2V7GA 4EGQA 3B1JA 4QYTA 4DWJA 1QKKA 2M6KA 2PX6A 1KI7A 1NE2A 2Z08A 4GFDA 2OC9A 5J5VA 4XYLA 3OH8A 4CF7A 4H35A 4NAVA 1JHUA 1R6AA 4KMRA 2ZTUA 5B4VA 1YZNA 3RFUA 3HRHA 1NN0A 2HQBA 2IIBA 3FWNA 4GI5A 2WB2A 4YDHB 5EOVA 2J3KA 2I6QA 1DFIA 4M9RA 3STYA 4F6RB 5G1OA 3FGOA 1MXHA 4C3ZA 1X19A 2C88A 2V7WA 3TTWA 4R5HA 3AR7A 4UPVA 4A0GA 1E2FA 2W2TA 1E79A 3EE6A 3DYBA 1ADCA 4XGRA 1JDVA 4NTZA 1DCMA 3HKCA 1G2IA 2BCJQ 1H5NA 5IYZA 2HL6A 3I01A 3Q7RA 4KMOA 4RE5A 3S68A 1PJSA 5F4ZA 4EYSA 2FR8A 1U9ZA 4H18A 1W93A 3D6MA 2HBYA 1V16A 4QEZA 4Q4AA 5FBKA 4YAIA 2QPTA 4DRZA 2GZAA 2DFDA 1F3LA 3JQCA 3RIYA 1Z0FA 1G18A 1TZKA 2BHTA 3NH9A 2VJYA 4BASA 4D9GA 5LZ4A 1Z37A 3KQMA 4DR1B 4GSKA 5HCUA 3P0JA 1CEQA 1SCDA 3NJRA 5KKAA 3EIHA 4X3OA 2NMVA 2RONA 2WB4A 1H5QA 2Y4OA 2A9RA 2VCHA 2I9KA 2H2DA 3WNVA 1HETA 1S0UA 2VQFB 5F9FA 1G20B 2P9ZA 5F33A 3VR5H 4JBHA 1EHCA 1J9ZA 3I37X 2CJWA 4BMDA 4JVNA 4LYGA 3EXAA 5I7VA 5K0JA 3W8EA 4RK5A 3F6PA 4WA7A 2GARA 2JGRA 2WJWA 2PZLA 3UWMA 3QU9A 4DRXA 1EXVA 3O47A 4TVOA 1NI3A 4LMRA 4Q02A 1J99A 3IE2A 3RUFA 1YR8A 4C4SA 2KB0A 1J4AA 2A9VA 4BZPA 5IU6A 1A3CA 2GM4A 5B36A 5IJ9A 4GPTA 2N75A 1W5TA 2Z95A 2BLNA 4G81A 4ISBA 4Q4AB 1DG9A 1NQVA 3WK5A 3IJPA 4FI3F 5JCJD 2PV0A 5EP3A 1Z9BA 1PAUA 2Q5JA 4YMIA 2Y1EA 2X3FA 2IPOA 3BL8A 4JH0A 5FPQA 3KLPX 5A4AA 4CLRA 1MBZA 2QG4A 3NUGA 3B48A 1SH7A 3VPBA 5E3IA 2GAJA 4AXXA 5C7LO 5DLDA 3S2UA 1XALA 1SVMA 3V7YA 2WTBA 2YIJA 3SC6A 4HDMA 5DLYA 3ESXA 1G20A 2FMME 1KL7A 1M6NA 2H65A 4GI3A 3WL8A 4R01A 2C9BA 3WZ2A 4AJ1A 4P5DA 4B8ZA 3D8TA 4HZGA 4AF8A 3GNSA 3H2IA 4LHZA 4FN5A 4N18A 4QBKA 5EZSA 5FL3A 1HNZB 3SQMA 1EFHA 1XUOA 2LPMA 1T0BA 1NNEA 4Y6PA 2BDUA 2WP0A 4DF3A 4N3GA 1KARA 1QZZA 1TTHA 3C3CA 4NV3A 1Q6ZA 3TNYA 4OAPA 3QGMA 3NIFB 1F0NA 1SKAA 3RU7A 3E27A 1N0HA 1E3WA 4I4TB 3NFRA 1Q15A 3AVQA 4UAJA 2QTMA 3T7IA 3BSWA 1M2OB 2P9JA 4U2EA 3G5LA 3KM0A 1YF3A 1TYDE 4Q0MA 1JSLA 4C0BA 1ISJA 4G6ZA 1WBJB 3R3VA 1HDCA 1VI2A 2PSDA 4TTQA 3K0AB 1JILA 3P2YA 3ZHQA 2JGLA 1Z2PX 2WWIA 1M8PA 1N0UA 2A9PA 2G36A 2OXEA 4ITRC 3F7NA 1GKKA 1KI3A 1M2NA 1Z8FA 3FR8A 1L8LA 3O4VA 2VDMB 4NHEA 4CQMB 4B8WA 3AMVA 4R84A 5H83A 2O48X 1EFRA 2O54A 2QF7A 3Q2IA 4GEKA 4OBXA 3I52A 3SC4A 1SO8A 1XKLA 2AG0A 3SF8B 4HPJB 3HUTA 3HYNA 4YJ2B 1A95A 3VYTB 3OQ6A 4TKVA 1J7JA 1T5BA 3PX3A 3CZMA 1B8UA 2J3IA 1K89A 2WIFA 2R3SA 3JVVA 3MLBA 3QYFA 1H9CA 5T64A 2W22A 1G17A 4HC4A 2BEJA 3ABSB 3NM5A 4JVLA 1FNDA 5DSTA 3HFRA 1NZDA 3DULA 4CQLB 1J5EB 5JSHA 4MRPA 3CYFA 3IAM1 3ZYCA 1NYQA 1UAGA 3K92A 3R23A 4CE6A 5CXQA 2YNMC 3IS3A 5F51A 3TB6A 3TM4A 1CY8A 2P1RA 4HFMA 1NKVA 3U7QB 4GI2A 3ZDYB 5B1SA 5A5EA 2P78A 4I55B 1ZY2A 4YA6A 1SIWA 1BN7A 1VCIA 1L6IA 1AG9A 4JFRA 3EPLA 1W0CA 3SYTA 1M1XB 2Z2KA 1Z29A 1NFFA 3HBAA 1OAOC 3OC6A 4RFSA 4RPKA 5BYAA 3RVKA 3W4IA 1RAGA 3L9WA 4RCVA 1RBMA 1AF7A 3EBOA 4E2WA 1NTRA 2CK3D 2QJTA 2MYNA 3BMXA 3QBDA 5E7MA 7REQB 4E08A 1NUAA 1BQ4A 2D5CA 4RZSA 3UQYS 3N8NA 5HOEA 3MMNA 2P4EA 5PNTA 1Z5GA 2D0OB 2JBAB 2AZTA 2WK1A 3GEGA 4TXMA 1O6CA 4X20A 2C3PA 5D7BA 4GOJA 3BM5A 1IY0A 4KLAA 2X0KA 4V0NA 1F2VA 4HDAA 1P3Y1 5HCIA 3TINA 3T7RA 1KMIY 3NDPA 1CYDA 2AEFA 1R4AA 5COAA 3TRKA 2Y3IA 1D3AA 3OE5A 1VL2A 3DMNA 1T4DA 3INNA 3U0BA 3EGXB 2NU9B 2OKGA 1TKRA 3S7ZA 5LU9A 3I64A 1WB5A 1K8QA 3FHCB 4JQOA 2ET6A 5AI6A 1M1YA 1NZFA 3ZHYA 4EGFA 1T4GA 3B20A 4F5DA 4GXQA 4UQLA 4C6HA 3MQ4A 2FP3A 3FDZB 2NV2B 3NWPA 3OY2A 3RSLA 3EOZA 4J1QA 1UMBA 1GSOA 1SXJA 1X1SA 3D6HA 2CV2A 2Q6TA 4JROA 3VKVA 5AD1A 1QANA 5JVDF 1S8OA 2XWBF 1LZLA 2IYFA 3LKBA 3IJ5A 4FR0A 4JWKA 4PC6A 3M89A 4R1UA 4BX8A 1JDNA 2AOTB 1TA0A 2QUKA 3UJNA 3GLGE 4XFDA 4CM8B 4M53A 1M7GA 4LE0A 2IUTA 3TCKA 4W99A 3BQMB 5GVSA 3WFIA 2GHQA 4L8LA 4NYJQ 4Q48A 4DPLA 4HXGA 3SBEA 1OXMA 1THZA 3V34A 2Z6VA 2PUAA 1WXDA 1V25A 2AC7A 3MCUA 1T8SA 4XSHA 3FIJA 3S4YA 4YCMA 2J9FB 2G6BA 5IVKA 2IXTA 1OE0A 1COWD 1SUIA 2QQ5A 2VN8A 4R9VA 2CYCA 3H2HA 3FPEA 3UHJA