The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
61
|
sequence length |
192
|
structure length |
192
|
Chain Sequence |
EDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the C-terminal domain of Themus thermophilus LitR in complex with cobalamin
rcsb |
molecule keywords |
Probable transcriptional regulator
|
source organism |
Thermus thermophilus
|
molecule tags |
Gene regulation
|
total genus |
61
|
structure length |
192
|
sequence length |
192
|
ec nomenclature | |
pdb deposition date | 2013-08-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02310 | B12-binding | B12 binding domain |
A | PF02607 | B12-binding_2 | B12 binding domain |
A | PF13411 | MerR_1 | MerR HTH family regulatory protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 | Methionine synthase domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Cobalamin-binding domain |