3WHQA

Crystal structure of gamma-glutamyltranspeptidase from bacillus subtilis (crystal soaked for 0 min. in acivicin soln. )
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
360
structure length
360
Chain Sequence
EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-glutamyltranspeptidase large chain
publication title Structure of Bacillus subtilis gamma-glutamyl-transpeptidase in complex with acivicin: diversity of the binding mode of a classical and electrophilic active-site-directed glutamate analogue
doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase, transferase
total genus 104
structure length 360
sequence length 360
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3whqA02
2Z8JA 2Z8KA 4ZBKA 5B5TA 2Z8IA 2NQOA 2QM6A 4OTUA 3WHQA 2DBWA 5BPKA 2DBUA 3A75A 2QMCA 3FNMA 4Z9OA 3WHSA 3WHRA 2E0YA 4GG2A 4OTTA 2DG5A 2E0XA 4ZCGA 2DBXA 4GDXA 2V36A 4ZC6A
chains in the Genus database with same CATH superfamily
2Z8JA 2Z8KA 2VUEA 2I2ZA 1AO6A 3ECPA 1LOTA 1HK2A 3NVMA 4L8UA 1E78A 2GUTA 3JQZA 4IW1A 2DYMA 3B9MA 2BXGA 2CKXA 4G01A 1MA9A 4J2VA 2QMCA 5GIOA 4JK4A 4Z9OA 2OZBB 3G9KD 1HK5A 1HK3A 2BXMA 2E0YA 4LA0A 1KDXA 3M99C 1BJ5A 1J78A 2BXQA 1VZSA 2DG5A 5ID9A 4N3ZA 2E0XA 1HK4A 5IJEA 2XW1A 2LQIA 4D7XA 3B9LA 5ID7A 2XVQA 2LXSA 5IFOA 4ZUXV 2V36A 3GQUA 1J7EA 2LQHA 1O9XA 4PO0A 4LB2A 3H37A 5IIXA 5GINA 2ROHA 2NQOA 3FWBC 4OTUA 4TQ0A 4HGKA 4F5TA 1MIYA 2XVVA 2DBUA 3FWCC 4G03A 2EFDA 2DYOA 3FNMA 3BPJA 1JNBA 4FIPB 2YDFA 3MHHB 3SIUB 5HOZA 1E7GA 3WHRA 4M70B 2KWFA 5D7GA 3NMUA 4OTTA 3W1SA 4FJCB 4G04A 2BXFA 1H9ZA 2BXBA 1E7EA 4C31B 2BXKA 4L9KA 3V03A 5GIPA 1KW2A 3V09A 1MIVA 4OT2A 1E7HA 3PLAA 1MIWA 1IJGA 3CX9A 3TDLA 1N5UA 2LOQA 2I30A 4ZBQA 4BKEA 4NAWB 2VDBA 4HGMB 4ZC6A 4TQ1A 2XSIA 4ZBKA 1GNIA 4L9QA 5B5TA 5IJFA 3WHQA 2QM6A 5BPKA 2DBWA 4F5VA 4F5SA 2XVWA 1BKEA 4LB9A 3JRYA 2BXHA 4K2CA 2QHBA 4GDLB 3GQXA 4FK5B 3MHSB 5FUOA 4W4UB 4DHXB 4Z69A 4OR0A 3LU6A 2BXDA 2KBZA 4GG2A 4E99A 1SB0A 5GHKA 4IW2A 4K71A 2AGHB 3KIKA 3SQJA 5IIUA 1E7IA 4N0UD 2DBXA 3LU7A 3V08A 4MBEC 1H5WA 4EMXA 1HK1A 1MUSA 1E7FA 2OT3A 2XVUA 1UORA 2EFEA 1LNSA 4GDKB 1E7BA 2XMOA 2BXEA 2BXCA 4N0FD 1E7AA 3UIVA 3VQIA 1MM8A 3SIVB 2BXIA 2Z8IA 1VFIA 2BX8A 5IIHA 1KXPD 1TXUA 2BXPA 2BXAA 2NNWA 3A75A 4S1YA 3A73A 1FOUA 4I9OA 2BXLA 4F5UA 2BXOA 2XW0A 2K0NA 1HA2A 2VUFA 4LUHA 2JUHA 3WHSA 3NVKA 1GNJA 1BM0A 5DQFA 2BXNA 4LUFA 2LXTA 3KJLA 4DM0A 4ZCGA 3ICXA 2EFHA 3NVIA 1E7CA 3GA9L 1TF0A 3LU8A 5DBYA 4ZBRA 2EFCA 3H3AA 2AJEA 4GDXA 4BY9C 4WA6B 1NT2B 1MUHA 5IJ5A
chains in the Genus database with same CATH topology
2Z8JA 2Z8KA 2VUEA 2I2ZA 1AO6A 1LOTA 1HK2A 3NVMA 4L8UA 1E78A 3JQZA 4IW1A 2DYMA 3B9MA 2BXGA 2CKXA 4G01A 1MA9A 4J2VA 2QMCA 5GIOA 4JK4A 4Z9OA 2OZBB 3G9KD 1HK5A 1HK3A 2BXMA 2E0YA 4LA0A 3M99C 1BJ5A 1J78A 2BXQA 1VZSA 2DG5A 5ID9A 4N3ZA 2E0XA 1HK4A 5IJEA 2XW1A 3B9LA 5ID7A 2XVQA 4ZUXV 5IFOA 2V36A 3GQUA 1J7EA 1O9XA 4PO0A 4LB2A 3H37A 5IIXA 5GINA 2ROHA 2NQOA 3FWBC 4OTUA 4TQ0A 4HGKA 4F5TA 1MIYA 2XVVA 2DBUA 3FWCC 4G03A 2EFDA 2DYOA 3FNMA 4FIPB 1JNBA 2YDFA 3MHHB 3SIUB 5HOZA 1E7GA 3WHRA 4M70B 5D7GA 3NMUA 4OTTA 3W1SA 4FJCB 4G04A 2BXFA 1H9ZA 2BXBA 1E7EA 4C31B 2BXKA 4L9KA 3V03A 5GIPA 1KW2A 3V09A 1MIVA 4OT2A 1E7HA 3PLAA 1MIWA 1IJGA 3CX9A 3TDLA 1N5UA 2LOQA 2I30A 4ZBQA 4BKEA 4NAWB 2VDBA 4HGMB 4ZC6A 4TQ1A 2XSIA 4ZBKA 1GNIA 4L9QA 5B5TA 5IJFA 3WHQA 2QM6A 5BPKA 2DBWA 4F5VA 4F5SA 2XVWA 1BKEA 4LB9A 3JRYA 2BXHA 4K2CA 2QHBA 4GDLB 3GQXA 4FK5B 3MHSB 5FUOA 4W4UB 4DHXB 4Z69A 4OR0A 3LU6A 2BXDA 2KBZA 4GG2A 4E99A 5GHKA 4IW2A 4K71A 3KIKA 3SQJA 5IIUA 1E7IA 4N0UD 2DBXA 3LU7A 3V08A 4MBEC 1H5WA 4EMXA 1HK1A 1E7FA 2OT3A 2XVUA 1UORA 2EFEA 1LNSA 4GDKB 1E7BA 2XMOA 2BXEA 2BXCA 4N0FD 1E7AA 3UIVA 3VQIA 3SIVB 2BXIA 2Z8IA 1VFIA 2BX8A 5IIHA 1KXPD 1TXUA 2BXPA 2BXAA 2NNWA 3A75A 4S1YA 3A73A 1FOUA 2BXLA 4F5UA 2BXOA 2XW0A 1HA2A 2VUFA 4LUHA 2JUHA 3WHSA 3NVKA 1GNJA 1BM0A 5DQFA 2BXNA 4LUFA 3KJLA 4ZCGA 3ICXA 2EFHA 3NVIA 1E7CA 3GA9L 1TF0A 3LU8A 5DBYA 4ZBRA 2EFCA 3H3AA 2AJEA 4GDXA 4BY9C 4WA6B 1NT2B 5IJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8J A;  2Z8K A;  4ZBK A;  5B5T A;  2Z8I A;  2NQO A;  2QM6 A;  4OTU A;  3WHQ A;  2DBW A;  5BPK A;  2DBU A;  3A75 A;  2QMC A;  3FNM A;  4Z9O A;  3WHS A;  3WHR A;  2E0Y A;  4GG2 A;  4OTT A;  2DG5 A;  2E0X A;  4ZCG A;  2DBX A;  4GDX A;  2V36 A;  4ZC6 A; 
#chains in the Genus database with same CATH topology
 2Z8J A;  2Z8K A;  2VUE A;  2I2Z A;  1AO6 A;  3ECP A;  1LOT A;  1HK2 A;  3NVM A;  4L8U A;  1E78 A;  2GUT A;  3JQZ A;  4IW1 A;  2DYM A;  3B9M A;  2BXG A;  2CKX A;  4G01 A;  1MA9 A;  4J2V A;  2QMC A;  5GIO A;  4JK4 A;  4Z9O A;  2OZB B;  3G9K D;  1HK5 A;  1HK3 A;  2BXM A;  2E0Y A;  4LA0 A;  1KDX A;  3M99 C;  1BJ5 A;  1J78 A;  2BXQ A;  1VZS A;  2DG5 A;  5ID9 A;  4N3Z A;  2E0X A;  1HK4 A;  5IJE A;  2XW1 A;  2LQI A;  4D7X A;  3B9L A;  5ID7 A;  2XVQ A;  2LXS A;  5IFO A;  4ZUX V;  2V36 A;  3GQU A;  1J7E A;  2LQH A;  1O9X A;  4PO0 A;  4LB2 A;  3H37 A;  5IIX A;  5GIN A;  2ROH A;  2NQO A;  3FWB C;  4OTU A;  4TQ0 A;  4HGK A;  4F5T A;  1MIY A;  2XVV A;  2DBU A;  3FWC C;  4G03 A;  2EFD A;  2DYO A;  3FNM A;  3BPJ A;  1JNB A;  4FIP B;  2YDF A;  3MHH B;  3SIU B;  5HOZ A;  1E7G A;  3WHR A;  4M70 B;  2KWF A;  5D7G A;  3NMU A;  4OTT A;  3W1S A;  4FJC B;  4G04 A;  2BXF A;  1H9Z A;  2BXB A;  1E7E A;  4C31 B;  2BXK A;  4L9K A;  3V03 A;  5GIP A;  1KW2 A;  3V09 A;  1MIV A;  4OT2 A;  1E7H A;  3PLA A;  1MIW A;  1IJG A;  3CX9 A;  3TDL A;  1N5U A;  2LOQ A;  2I30 A;  4ZBQ A;  4BKE A;  4NAW B;  2VDB A;  4HGM B;  4ZC6 A;  4TQ1 A;  2XSI A;  4ZBK A;  1GNI A;  4L9Q A;  5B5T A;  5IJF A;  3WHQ A;  2QM6 A;  5BPK A;  2DBW A;  4F5V A;  4F5S A;  2XVW A;  1BKE A;  4LB9 A;  3JRY A;  2BXH A;  4K2C A;  2QHB A;  4GDL B;  3GQX A;  4FK5 B;  3MHS B;  5FUO A;  4W4U B;  4DHX B;  4Z69 A;  4OR0 A;  3LU6 A;  2BXD A;  2KBZ A;  4GG2 A;  4E99 A;  1SB0 A;  5GHK A;  4IW2 A;  4K71 A;  2AGH B;  3KIK A;  3SQJ A;  5IIU A;  1E7I A;  4N0U D;  2DBX A;  3LU7 A;  3V08 A;  4MBE C;  1H5W A;  4EMX A;  1HK1 A;  1MUS A;  1E7F A;  2OT3 A;  2XVU A;  1UOR A;  2EFE A;  1LNS A;  4GDK B;  1E7B A;  2XMO A;  2BXE A;  2BXC A;  4N0F D;  1E7A A;  3UIV A;  3VQI A;  1MM8 A;  3SIV B;  2BXI A;  2Z8I A;  1VFI A;  2BX8 A;  5IIH A;  1KXP D;  1TXU A;  2BXP A;  2BXA A;  2NNW A;  3A75 A;  4S1Y A;  3A73 A;  1FOU A;  4I9O A;  2BXL A;  4F5U A;  2BXO A;  2XW0 A;  2K0N A;  1HA2 A;  2VUF A;  4LUH A;  2JUH A;  3WHS A;  3NVK A;  1GNJ A;  1BM0 A;  5DQF A;  2BXN A;  4LUF A;  2LXT A;  3KJL A;  4DM0 A;  4ZCG A;  3ICX A;  2EFH A;  3NVI A;  1E7C A;  3GA9 L;  1TF0 A;  3LU8 A;  5DBY A;  4ZBR A;  2EFC A;  3H3A A;  2AJE A;  4GDX A;  4BY9 C;  4WA6 B;  1NT2 B;  1MUH A;  5IJ5 A; 
#chains in the Genus database with same CATH homology
 2Z8J A;  2Z8K A;  2VUE A;  2I2Z A;  1AO6 A;  1LOT A;  1HK2 A;  3NVM A;  4L8U A;  1E78 A;  3JQZ A;  4IW1 A;  2DYM A;  3B9M A;  2BXG A;  2CKX A;  4G01 A;  1MA9 A;  4J2V A;  2QMC A;  5GIO A;  4JK4 A;  4Z9O A;  2OZB B;  3G9K D;  1HK5 A;  1HK3 A;  2BXM A;  2E0Y A;  4LA0 A;  3M99 C;  1BJ5 A;  1J78 A;  2BXQ A;  1VZS A;  2DG5 A;  5ID9 A;  4N3Z A;  2E0X A;  1HK4 A;  5IJE A;  2XW1 A;  3B9L A;  5ID7 A;  2XVQ A;  4ZUX V;  5IFO A;  2V36 A;  3GQU A;  1J7E A;  1O9X A;  4PO0 A;  4LB2 A;  3H37 A;  5IIX A;  5GIN A;  2ROH A;  2NQO A;  3FWB C;  4OTU A;  4TQ0 A;  4HGK A;  4F5T A;  1MIY A;  2XVV A;  2DBU A;  3FWC C;  4G03 A;  2EFD A;  2DYO A;  3FNM A;  4FIP B;  1JNB A;  2YDF A;  3MHH B;  3SIU B;  5HOZ A;  1E7G A;  3WHR A;  4M70 B;  5D7G A;  3NMU A;  4OTT A;  3W1S A;  4FJC B;  4G04 A;  2BXF A;  1H9Z A;  2BXB A;  1E7E A;  4C31 B;  2BXK A;  4L9K A;  3V03 A;  5GIP A;  1KW2 A;  3V09 A;  1MIV A;  4OT2 A;  1E7H A;  3PLA A;  1MIW A;  1IJG A;  3CX9 A;  3TDL A;  1N5U A;  2LOQ A;  2I30 A;  4ZBQ A;  4BKE A;  4NAW B;  2VDB A;  4HGM B;  4ZC6 A;  4TQ1 A;  2XSI A;  4ZBK A;  1GNI A;  4L9Q A;  5B5T A;  5IJF A;  3WHQ A;  2QM6 A;  5BPK A;  2DBW A;  4F5V A;  4F5S A;  2XVW A;  1BKE A;  4LB9 A;  3JRY A;  2BXH A;  4K2C A;  2QHB A;  4GDL B;  3GQX A;  4FK5 B;  3MHS B;  5FUO A;  4W4U B;  4DHX B;  4Z69 A;  4OR0 A;  3LU6 A;  2BXD A;  2KBZ A;  4GG2 A;  4E99 A;  5GHK A;  4IW2 A;  4K71 A;  3KIK A;  3SQJ A;  5IIU A;  1E7I A;  4N0U D;  2DBX A;  3LU7 A;  3V08 A;  4MBE C;  1H5W A;  4EMX A;  1HK1 A;  1E7F A;  2OT3 A;  2XVU A;  1UOR A;  2EFE A;  1LNS A;  4GDK B;  1E7B A;  2XMO A;  2BXE A;  2BXC A;  4N0F D;  1E7A A;  3UIV A;  3VQI A;  3SIV B;  2BXI A;  2Z8I A;  1VFI A;  2BX8 A;  5IIH A;  1KXP D;  1TXU A;  2BXP A;  2BXA A;  2NNW A;  3A75 A;  4S1Y A;  3A73 A;  1FOU A;  2BXL A;  4F5U A;  2BXO A;  2XW0 A;  1HA2 A;  2VUF A;  4LUH A;  2JUH A;  3WHS A;  3NVK A;  1GNJ A;  1BM0 A;  5DQF A;  2BXN A;  4LUF A;  3KJL A;  4ZCG A;  3ICX A;  2EFH A;  3NVI A;  1E7C A;  3GA9 L;  1TF0 A;  3LU8 A;  5DBY A;  4ZBR A;  2EFC A;  3H3A A;  2AJE A;  4GDX A;  4BY9 C;  4WA6 B;  1NT2 B;  5IJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...