3WHSA

Crystal structure of bacillus subtilis gamma-glutamyltranspeptidase in complex with acivicin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
359
structure length
359
Chain Sequence
EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bacillus subtilis gamma-glutamyl-transpeptidase in complex with acivicin: diversity of the binding mode of a classical and electrophilic active-site-directed glutamate analogue
doi rcsb
molecule keywords Gamma-glutamyltranspeptidase large chain
molecule tags Hydrolase, transferase
source organism Bacillus subtilis
total genus 106
structure length 359
sequence length 359
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2013-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3whsA02
2DBXA 3A75A 3WHQA 4GDXA 3WHRA 5BPKA 4OTUA 2DBUA 2V36A 2Z8KA 2NQOA 2Z8JA 4GG2A 4ZBKA 2QMCA 4ZCGA 4OTTA 2DG5A 2Z8IA 4ZC6A 3FNMA 2QM6A 3WHSA 2E0XA 2DBWA 5B5TA 2E0YA 4Z9OA
chains in the Genus database with same CATH superfamily
4Z69A 1H5WA 3B9LA 3H3AA 4FK5B 2YDFA 2BXOA 4LB9A 1LOTA 2V36A 1HA2A 4IW1A 2NNWA 1TF0A 1AO6A 2BXPA 4N3ZA 2Z8JA 1HK3A 2KWFA 3W1SA 5IJFA 3ECPA 2EFDA 3A73A 4F5SA 3NVKA 2EFEA 3TDLA 3LU8A 4OTTA 5GIOA 2BXEA 2DYOA 4ZUXV 4ZC6A 3FWBC 4IW2A 3GQUA 2QM6A 3MHSB 4L9KA 2XVVA 3NVMA 2LXTA 4C31B 1FOUA 3KIKA 1MIWA 1BKEA 1VZSA 3VQIA 3JQZA 4OR0A 2LQIA 2DBXA 4L8UA 1BJ5A 3WHRA 4M70B 1TXUA 4HGKA 1KXPD 2DBUA 3MHHB 2XW1A 4NAWB 1HK2A 1E7IA 3H37A 4BY9C 1KDXA 2BXIA 5IIHA 1E7FA 5IIUA 1E7HA 2QMCA 3ICXA 4ZCGA 4ZBQA 2OZBB 1E7CA 2BXQA 4S1YA 2GUTA 2BXGA 4HGMB 4OT2A 4F5UA 2LXSA 2VUEA 4LUFA 5GHKA 1HK1A 4W4UB 3V08A 1E7EA 1KW2A 2XSIA 1O9XA 1E7GA 5D7GA 5GINA 1HK4A 2AJEA 2E0XA 2XVUA 2EFCA 2BXAA 3B9MA 1BM0A 2BX8A 2I30A 4G03A 4WA6B 4FIPB 4DHXB 2VDBA 4F5TA 4GDKB 5IFOA 3LU6A 4J2VA 2OT3A 4GDXA 5BPKA 2BXDA 5ID9A 4EMXA 1E7BA 2BXFA 4PO0A 3CX9A 1JNBA 4G04A 5FUOA 4GG2A 4K71A 1MIVA 1MUHA 1N5UA 3SQJA 3UIVA 1LNSA 1SB0A 2JUHA 1E78A 2DG5A 3GA9L 1MA9A 2BXHA 4N0UD 4TQ1A 2AGHB 2BXKA 3KJLA 2ROHA 2QHBA 3G9KD 3V09A 3WHSA 4K2CA 1J78A 4F5VA 3JRYA 1MIYA 3GQXA 5DBYA 4LUHA 1NT2B 2BXMA 2E0YA 4GDLB 4Z9OA 1GNIA 4D7XA 2BXLA 4TQ0A 4DM0A 3NVIA 4LB2A 3M99C 4JK4A 1GNJA 4E99A 5IJEA 3A75A 4FJCB 4ZBRA 3BPJA 3WHQA 2BXCA 2K0NA 2BXBA 4OTUA 5HOZA 5IJ5A 1UORA 5GIPA 3SIUB 4L9QA 1IJGA 3V03A 2KBZA 5ID7A 2Z8KA 2NQOA 5IIXA 4MBEC 2LOQA 4ZBKA 2CKXA 1H9ZA 2Z8IA 4G01A 2LQHA 3LU7A 3NMUA 2XVQA 3FNMA 4I9OA 4BKEA 2XVWA 4LA0A 3FWCC 2DYMA 1E7AA 3SIVB 2DBWA 4N0FD 1MM8A 2VUFA 5DQFA 5B5TA 1MUSA 1VFIA 2EFHA 2XW0A 2XMOA 2I2ZA 3PLAA 1HK5A 1J7EA 2BXNA
chains in the Genus database with same CATH topology
4Z69A 1H5WA 3B9LA 3H3AA 4FK5B 2YDFA 2BXOA 4LB9A 1LOTA 2V36A 1HA2A 4IW1A 2NNWA 1TF0A 1AO6A 2BXPA 4N3ZA 2Z8JA 1HK3A 3W1SA 5IJFA 2EFDA 3A73A 4F5SA 3NVKA 2EFEA 3TDLA 3LU8A 4OTTA 5GIOA 2BXEA 2DYOA 4ZUXV 4ZC6A 3FWBC 4IW2A 3GQUA 2QM6A 3MHSB 4L9KA 2XVVA 3NVMA 4C31B 1FOUA 3KIKA 1MIWA 1BKEA 1VZSA 3VQIA 3JQZA 4OR0A 2DBXA 4L8UA 1BJ5A 3WHRA 4M70B 1TXUA 4HGKA 1KXPD 2DBUA 3MHHB 2XW1A 4NAWB 1HK2A 1E7IA 3H37A 4BY9C 2BXIA 5IIHA 1E7FA 5IIUA 1E7HA 2QMCA 3ICXA 4ZCGA 4ZBQA 2OZBB 1E7CA 2BXQA 4S1YA 4F5UA 2BXGA 4HGMB 4OT2A 2VUEA 4LUFA 5GHKA 1HK1A 4W4UB 3V08A 1E7EA 1KW2A 2XSIA 1O9XA 1E7GA 5D7GA 5GINA 1HK4A 2AJEA 2E0XA 2XVUA 2EFCA 2BXAA 3B9MA 1BM0A 2BX8A 2I30A 4G03A 4WA6B 4FIPB 4DHXB 2VDBA 4F5TA 4GDKB 5IFOA 3LU6A 4J2VA 2OT3A 4GDXA 5BPKA 2BXDA 5ID9A 4EMXA 1E7BA 2BXFA 4PO0A 3CX9A 1JNBA 4G04A 5FUOA 4GG2A 4K71A 1MIVA 1N5UA 3SQJA 3UIVA 1LNSA 2JUHA 1E78A 2DG5A 3GA9L 1MA9A 2BXHA 4N0UD 4TQ1A 2BXKA 3KJLA 2ROHA 2QHBA 3G9KD 3V09A 3WHSA 4K2CA 1J78A 4F5VA 3JRYA 1MIYA 3GQXA 5DBYA 4LUHA 1NT2B 2BXMA 2E0YA 4GDLB 4Z9OA 1GNIA 2BXLA 4TQ0A 3NVIA 4LB2A 3M99C 4JK4A 1GNJA 4E99A 5IJEA 3A75A 4FJCB 4ZBRA 3WHQA 2BXCA 4OTUA 2BXBA 5HOZA 5IJ5A 5GIPA 1UORA 3SIUB 4L9QA 1IJGA 3V03A 2KBZA 5ID7A 2Z8KA 2NQOA 5IIXA 4MBEC 2LOQA 4ZBKA 2CKXA 1H9ZA 2Z8IA 4G01A 3NMUA 3LU7A 2XVQA 3FNMA 4BKEA 2XVWA 4LA0A 3FWCC 2DYMA 1E7AA 3SIVB 2DBWA 4N0FD 2VUFA 5DQFA 5B5TA 1VFIA 2EFHA 2XW0A 2XMOA 2I2ZA 3PLAA 1HK5A 1J7EA 2BXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBX A;  3A75 A;  3WHQ A;  4GDX A;  3WHR A;  5BPK A;  4OTU A;  2DBU A;  2V36 A;  2Z8K A;  2NQO A;  2Z8J A;  4GG2 A;  4ZBK A;  2QMC A;  4ZCG A;  4OTT A;  2DG5 A;  2Z8I A;  4ZC6 A;  3FNM A;  2QM6 A;  3WHS A;  2E0X A;  2DBW A;  5B5T A;  2E0Y A;  4Z9O A; 
#chains in the Genus database with same CATH topology
 4Z69 A;  1H5W A;  3B9L A;  3H3A A;  4FK5 B;  2YDF A;  2BXO A;  4LB9 A;  1LOT A;  2V36 A;  1HA2 A;  4IW1 A;  2NNW A;  1TF0 A;  1AO6 A;  2BXP A;  4N3Z A;  2Z8J A;  1HK3 A;  2KWF A;  3W1S A;  5IJF A;  3ECP A;  2EFD A;  3A73 A;  4F5S A;  3NVK A;  2EFE A;  3TDL A;  3LU8 A;  4OTT A;  5GIO A;  2BXE A;  2DYO A;  4ZUX V;  4ZC6 A;  3FWB C;  4IW2 A;  3GQU A;  2QM6 A;  3MHS B;  4L9K A;  2XVV A;  3NVM A;  2LXT A;  4C31 B;  1FOU A;  3KIK A;  1MIW A;  1BKE A;  1VZS A;  3VQI A;  3JQZ A;  4OR0 A;  2LQI A;  2DBX A;  4L8U A;  1BJ5 A;  3WHR A;  4M70 B;  1TXU A;  4HGK A;  1KXP D;  2DBU A;  3MHH B;  2XW1 A;  4NAW B;  1HK2 A;  1E7I A;  3H37 A;  4BY9 C;  1KDX A;  2BXI A;  5IIH A;  1E7F A;  5IIU A;  1E7H A;  2QMC A;  3ICX A;  4ZCG A;  4ZBQ A;  2OZB B;  1E7C A;  2BXQ A;  4S1Y A;  2GUT A;  2BXG A;  4HGM B;  4OT2 A;  4F5U A;  2LXS A;  2VUE A;  4LUF A;  5GHK A;  1HK1 A;  4W4U B;  3V08 A;  1E7E A;  1KW2 A;  2XSI A;  1O9X A;  1E7G A;  5D7G A;  5GIN A;  1HK4 A;  2AJE A;  2E0X A;  2XVU A;  2EFC A;  2BXA A;  3B9M A;  1BM0 A;  2BX8 A;  2I30 A;  4G03 A;  4WA6 B;  4FIP B;  4DHX B;  2VDB A;  4F5T A;  4GDK B;  5IFO A;  3LU6 A;  4J2V A;  2OT3 A;  4GDX A;  5BPK A;  2BXD A;  5ID9 A;  4EMX A;  1E7B A;  2BXF A;  4PO0 A;  3CX9 A;  1JNB A;  4G04 A;  5FUO A;  4GG2 A;  4K71 A;  1MIV A;  1MUH A;  1N5U A;  3SQJ A;  3UIV A;  1LNS A;  1SB0 A;  2JUH A;  1E78 A;  2DG5 A;  3GA9 L;  1MA9 A;  2BXH A;  4N0U D;  4TQ1 A;  2AGH B;  2BXK A;  3KJL A;  2ROH A;  2QHB A;  3G9K D;  3V09 A;  3WHS A;  4K2C A;  1J78 A;  4F5V A;  3JRY A;  1MIY A;  3GQX A;  5DBY A;  4LUH A;  1NT2 B;  2BXM A;  2E0Y A;  4GDL B;  4Z9O A;  1GNI A;  4D7X A;  2BXL A;  4TQ0 A;  4DM0 A;  3NVI A;  4LB2 A;  3M99 C;  4JK4 A;  1GNJ A;  4E99 A;  5IJE A;  3A75 A;  4FJC B;  4ZBR A;  3BPJ A;  3WHQ A;  2BXC A;  2K0N A;  2BXB A;  4OTU A;  5HOZ A;  5IJ5 A;  1UOR A;  5GIP A;  3SIU B;  4L9Q A;  1IJG A;  3V03 A;  2KBZ A;  5ID7 A;  2Z8K A;  2NQO A;  5IIX A;  4MBE C;  2LOQ A;  4ZBK A;  2CKX A;  1H9Z A;  2Z8I A;  4G01 A;  2LQH A;  3LU7 A;  3NMU A;  2XVQ A;  3FNM A;  4I9O A;  4BKE A;  2XVW A;  4LA0 A;  3FWC C;  2DYM A;  1E7A A;  3SIV B;  2DBW A;  4N0F D;  1MM8 A;  2VUF A;  5DQF A;  5B5T A;  1MUS A;  1VFI A;  2EFH A;  2XW0 A;  2XMO A;  2I2Z A;  3PLA A;  1HK5 A;  1J7E A;  2BXN A; 
#chains in the Genus database with same CATH homology
 4Z69 A;  1H5W A;  3B9L A;  3H3A A;  4FK5 B;  2YDF A;  2BXO A;  4LB9 A;  1LOT A;  2V36 A;  1HA2 A;  4IW1 A;  2NNW A;  1TF0 A;  1AO6 A;  2BXP A;  4N3Z A;  2Z8J A;  1HK3 A;  3W1S A;  5IJF A;  2EFD A;  3A73 A;  4F5S A;  3NVK A;  2EFE A;  3TDL A;  3LU8 A;  4OTT A;  5GIO A;  2BXE A;  2DYO A;  4ZUX V;  4ZC6 A;  3FWB C;  4IW2 A;  3GQU A;  2QM6 A;  3MHS B;  4L9K A;  2XVV A;  3NVM A;  4C31 B;  1FOU A;  3KIK A;  1MIW A;  1BKE A;  1VZS A;  3VQI A;  3JQZ A;  4OR0 A;  2DBX A;  4L8U A;  1BJ5 A;  3WHR A;  4M70 B;  1TXU A;  4HGK A;  1KXP D;  2DBU A;  3MHH B;  2XW1 A;  4NAW B;  1HK2 A;  1E7I A;  3H37 A;  4BY9 C;  2BXI A;  5IIH A;  1E7F A;  5IIU A;  1E7H A;  2QMC A;  3ICX A;  4ZCG A;  4ZBQ A;  2OZB B;  1E7C A;  2BXQ A;  4S1Y A;  4F5U A;  2BXG A;  4HGM B;  4OT2 A;  2VUE A;  4LUF A;  5GHK A;  1HK1 A;  4W4U B;  3V08 A;  1E7E A;  1KW2 A;  2XSI A;  1O9X A;  1E7G A;  5D7G A;  5GIN A;  1HK4 A;  2AJE A;  2E0X A;  2XVU A;  2EFC A;  2BXA A;  3B9M A;  1BM0 A;  2BX8 A;  2I30 A;  4G03 A;  4WA6 B;  4FIP B;  4DHX B;  2VDB A;  4F5T A;  4GDK B;  5IFO A;  3LU6 A;  4J2V A;  2OT3 A;  4GDX A;  5BPK A;  2BXD A;  5ID9 A;  4EMX A;  1E7B A;  2BXF A;  4PO0 A;  3CX9 A;  1JNB A;  4G04 A;  5FUO A;  4GG2 A;  4K71 A;  1MIV A;  1N5U A;  3SQJ A;  3UIV A;  1LNS A;  2JUH A;  1E78 A;  2DG5 A;  3GA9 L;  1MA9 A;  2BXH A;  4N0U D;  4TQ1 A;  2BXK A;  3KJL A;  2ROH A;  2QHB A;  3G9K D;  3V09 A;  3WHS A;  4K2C A;  1J78 A;  4F5V A;  3JRY A;  1MIY A;  3GQX A;  5DBY A;  4LUH A;  1NT2 B;  2BXM A;  2E0Y A;  4GDL B;  4Z9O A;  1GNI A;  2BXL A;  4TQ0 A;  3NVI A;  4LB2 A;  3M99 C;  4JK4 A;  1GNJ A;  4E99 A;  5IJE A;  3A75 A;  4FJC B;  4ZBR A;  3WHQ A;  2BXC A;  4OTU A;  2BXB A;  5HOZ A;  5IJ5 A;  5GIP A;  1UOR A;  3SIU B;  4L9Q A;  1IJG A;  3V03 A;  2KBZ A;  5ID7 A;  2Z8K A;  2NQO A;  5IIX A;  4MBE C;  2LOQ A;  4ZBK A;  2CKX A;  1H9Z A;  2Z8I A;  4G01 A;  3NMU A;  3LU7 A;  2XVQ A;  3FNM A;  4BKE A;  2XVW A;  4LA0 A;  3FWC C;  2DYM A;  1E7A A;  3SIV B;  2DBW A;  4N0F D;  2VUF A;  5DQF A;  5B5T A;  1VFI A;  2EFH A;  2XW0 A;  2XMO A;  2I2Z A;  3PLA A;  1HK5 A;  1J7E A;  2BXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...