3WHXA

Crystal structure of anti-prostaglandin e2 fab fragment pge1 complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
211
Chain Sequence
KVQLQQSGAELVKPGASVKLSCKASGYTFTEYFIHWVKQRSGQGLEWIGWFYPGSGSLNYNGKFKDKATFTADKSSSTVYLELSRLTSEDSAVYFCASHAYDKEPYWGQGTLVTVSAAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mAb Fab H fragment
publication title Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2
rcsb
molecule tags Immune system
total genus 45
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2013-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxA02
2YD4A 2ZOLB 1RD6A 4HK0A 4HCRA 2JIXA 3QEQB 1V3JA 2DLFL 3V9FA 2X7LA 1JHTA 3PABA 4X6CA 2XFXB 3TJHD 1WV7T 5LKNA 5MEOB 4J3VA 5DT1L 4E41A 4DVRH 3K4DA 3C6LA 4Z5RA 3U4EB 2DL9A 5A43C 1KLUB 3UPCA 3ILQC 1C08B 3F12B 3V4VH 4DEPC 5HVFB 2YS4A 5I1HL 5I73B 2I25N 4OI8A 1TVHA 1IGMH 3RNKA 1FNFA 1VKXA 4NIKB 3U6RA 1PX4A 3CSBA 5T3ZH 1N6UA 4QXWA 3HS0A 4HZLB 2ZZUT 4ODSH 4F37K 1JTOA 1FL5A 3GBMH 3GSWB 4NQEB 3QRFM 5J13C 4KPHL 1CG9B 1I8KB 3MXVL 4AQOA 2N56A 5MI0B 2H6PA 2XQBL 4X6EB 2G9HB 1VACB 5IK3A 4OCSH 3R1GL 1V3LA 5ADPH 5GJTL 3GJFH 3EZ8A 1FJ1A 1H3PL 2YSSA 2EDFA 5I0ZA 2LVCA 3LKNB 4M6OH 5CILH 5LCVL 3BGAA 3RWDA 3RVVC 5T3ZD 2F15A 4S0TD 1A2YA 2PW2B 4XP9L 5L88L 4QWWD 3TCLB 1U58B 4RNRA 3MR9A 4WI3A 3BGMB 2A74B 2BFVH 4NN5B 1KCRL 1I9IL 4NQVA 3O4LE 4K71B 4MLSA 5T1DL 1OSPH 3P0GB 1T2QH 5TQ2H 5E70A 3QHZL 1TNNA 2JE8A 4BA8A 1IAIH 1QRNE 5I30H 2VN7A 3IFOB 3WE6B 3D0VB 1CU4H 1E4JA 4U1HA 3FQUB 3OHXB 1OARL 3BFOA 4G43B 5HI3C 4PB0H 4YO0B 4LEOA 4WVRA 2ARWA 4NO3B 3QUMB 3QFDA 4ZTPH 4UT6H 3GJFA 2OR8A 3VXUA 4P99A 1LNUA 2EECA 4LNRA 2ZPKL 2ZUVA 1EXUA 5KSBE 5T1MB 3GI8L 5CAYB 5J9PB 2FHBA 2VABA 4FQXC 4P9HC 5CZVL 1S7WA 1I75A 5D7LD 3AS1A 2APXA 2CRIA 4FP8H 2Z8WC 4P46B 3T0EB 1BD2E 1BFSA 2AXGA 3BP5A 3ULVE 1F02I 4PTUA 2NY0B 3KYMB 2VLJB 3NIDF 4MJ4A 4LHUB 3OKEA 3QQNA 3BZEB 3BKJH 3RI5K 3LKOA 4GAFB 3ZYZA 2FJHA 4ZOAA 1A7PH 3VXNA 3QO1A 2F9BT 1SMOA 4PGBB 5I17B 2GUOA 4ZS6C 1KFAH 1YN7B 3HI5L 5D7LA 4P57B 4UMGA 4OD1L 2R0ZL 3PGCA 3FCTA 4LLWB 4OAWB 4U3CA 1OSZA 1N26A 4WHTA 4MCZA 1B2WH 4JM2C 3U1SH 1NL0L 4HWNA 5I8EA 3K80A 1DEDA 2PYEE 3G5ZA 3O0RH 3UJJL 2VXSL 5FO9A 1UWGL 2ED7A 5KSVA 2A9NL 2FGWL 2R2CA 2VDOL 4MA8H 3MLYH 4ONFL 3WUWA 1C16A 4KJWD 1YEDA 2J8HA 4Q2ZA 4NCC2 5ITBL 4C56B 2CDFA 5LXGL 3KPLB 5F1NA 1E6JH 2FRGP 3HC4L 4XP4L 4U6VH 2YC1B 1JRHL 1FYHB 3O6MH 4JFHE 3UCRA 1AGDB 2I9TB 3RZCB 2WMPA 4R90H 1KNOA 5H35A 2W60B 5E99H 5F96L 3EOAA 2NY2C 4FG6C 3LZFH 1WC7A 4HXAH 4TSCL 1O5DT 1KCVL 1H3XA 4PJ8C 4G6AC 5BVPH 1ZVHA 5L9DL 4BJLA 2GITA 5CLWA 1FO0B 4ZYKB 1RK1B 1R24A 4EXKA 4HH9B 4XNQB 1DSFL 4I2XA 5A2LH 3NIFF 1QLRB 1KG0A 3QUYC 4EUPG 5CGMA 1JTTA 1JZ6A 5D96C 4MD0A 2Y4SA 2ICEA 4PJEA 3WL9B 3P77B 3DXAD 4GXVL 3O81A 3VH8G 2HLFC 5FKAA 1U3YA 2GAZB 3SKNB 3HR5B 2NX5E 3JWOH 3W9DB 2Q8BL 1DQDL 4DWHA 4J7RA 2H1PH 4PRBB 1N8ZA 4XMLL 1VEPA 4PJXE 3HZKA 4ELKB 1WZ1L 4KGJA 1NKRA 1NAMH 4NC2B 3HPLB 5JXAL 2A9ML 5A2JH 4OGYL 1DBMH 5IMOB 4XXCC 2EO9A 5E2WL 3DPBA 1YEHL 3DXAA 5B39B 4AYFA 2BY0A 3HB3D 4IIQA 1VA9A 4M9PA 5C9JB 4YX2H 5IMLB 3EFDH 3P3YA 4IRSD 4N9GB 4D9QE 3WNLA 1CGWA 1J8HD 1RHHB 4U49A 2RGSA 2PTTA 1N4XL 2HVKA 1AFVL 5L2JB 3GUTB 3IAPA 3KR3L 3D6GA 5D5MA 2QADC 4KMQA 1HIML 3QEUB 1MRDH 1P4LB 1WIOA 1FNSL 1YNKL 1A9BA 4BSWB 4EXPX 2OI9C 4M4PA 1TPXB 4JO2H 5GZND 2JTDA 4RWYL 2O61A 4HGWA 3K2UL 3STZA 1FFOB 4IRSA 2BSED 3VFPA 4NM4H 5I16A 2ADGB 1WWCA 4GQ9H 3F7YB 3QCUL 1NAMA 1UM4H 3QZWB 3CLEL 2QQQA 1ED3A 3G6DL 1AI1L 4OLWH 3WFDH 1INEH 5JW5B 5SWSA 1F4XH 1CFVL 4JVWA 3LHPH 4NHUA 3GSNL 1CXIA 3HE6D 5KS9A 3GIVA 5E8OA 3QI9D 3ZDYF 3WDHA 4WU7B 3HUJE 4NO2A 4NQDD 4XPHH 5EO0B 1RUAL 5MERB 4LAJH 1U8HA 3GRWH 5KOVC 3OJMB 4KK6D 2V9QA 1CQYA 1QBMH 3WFCL 4L3ED 1ACYL 1OLLA 1VGKB 3TPUB 4GAGH 5DURD 4IOIA 1KGCE 4KMLB 4N8VB 5JDSB 3HE6A 2Z0BA 3QI9A 4OQ1A 4OZIF 3AMKA 4Z7NF 5E8PB 5HVHC 3X13A 1XF3A 3HE7B 2OK0H 1EJOH 1G6RH 1SEQH 4NQDA 5LBSL 5D71L 1VFOA 4PGDA 4RMUA 4OZFH 1EHLL 1EIBA 2R1WB 4HPYL 3WO3B 3RX7A 3VFVB 5IB1B 3CSPA 1G7HA 5GGVL 3HI1B 4F33A 4L3EA 5HGDB 1CGTA 1IT9H 1VCAA 5EOCJ 5F7EL 4O2CA 3KLSA 1GOGA 3OKDB 4S1DC 3FTGA 3RKDC 4WI6A 1F3JA 2C3XA 4LLDB 5B8CA 1F8TL 2HJFA 3QFJE 3TBTB 5SWQA 4RIRB 3GNMH 4JHBA 3GRWA 4DN4H 5AD0A 3UYRH 4Z0BH 5FIEA 5F7HA 4WUKL 1SMAA 2FH8A 1KJ2B 3Q1SL 3PQYD 4JANA 4MMXC 4TYUA 1KB5L 2AV7B 4MHHG 2ERJC 2MFNA 1HSBA 1MF2L 4CN4A 3HTLX 1L7TH 1Z5LA 1G6RA 4NQXA 4ISVB 5IM7A 4AMKH 4OZFA 5CJ5A 1TJHH 3BDYL 1QHOA 2JELH 1QBLH 2YD2A 1FYTE 3C8HA 5FEBA 3DYPA 2YPLD 1XZ0B 4NSKA 4BH8B 1YNLL 1ORSB 1Q9KA 3EO9H 3PQYA 5KVFH 1GGBH 4EI5D 1F90H 1MJ8H 1I9EA 2VQUA 3B9KB 1RJZA 3BAEH 1QACA 2A83A 3NH7L 4TRPL 5F8QC 3BRDA 1WF5A 4IDJL 5GISH 2ZJSH 3HMXL 2NZ9C 5GHWH 4UDUB 1JMXA 4OSUH 4YDKL 2FIRT 3W0WE 3O6KL 4L3AA 2YPLA 3T04D 5FK9A 4J3UA 5KVDL 2W07A 4ELMF 4J4PD 3MLVL 3FO0H 5EO9A 1MLCA 3VWKC 4YBHA 4TUKH 4OLYL 4NKMA 4EI5A 2OQJB 1RIHL 3ES6A 4E0RA 1DFBL 2Q76B 1BQSA 4X9HA 2EYRB 1HI6B 4PJAA 5AG8A 1T21A 4U2ZA 1LVEA 4MQTB 3QDGB 4WHDA 1INDH 5C0BB 1T0MB 3FFCA 3ALWA 4NYLA 4XVSH 4YXKH 4J4PA 5HTSA 3GI9L 2VYRE 3V6OA 1ZVSA 4AH2A 3X14A 1PYWA 2MTPA 4JRXE 4FFWC 3OZ9H 3EYQC 5IW6B 5EZLA 2QR0A 3DUUB 4JFXA 5EOTB 4LCWB 3JXAA 4WW2A 4PR5A 1UWXH 4MWFA 3RUGF 1WLHA 2VL4A 3BKML 4XHQA 2R23B 5FHAL 1X5LA 3DMMB 3HAEB 4ZFGL 4CMHB 3NPSB 2R0KH 2FLRT 2DI7A 4OUOA 3QXAA 5EIIA 3OXSB 4EOWL 1T1XA 1CFTA 3B43A 3KPNB 4KJPC 4QY8A 1Z6JT 3EOYG 1RVFH 5JW4R 4YPGB 1YQVH 2OJEA 1WCBA 2DQUL 2NLJA 4X4XA 1SVCP 1FHGA 2QKIA 1G0YR 3S5LA 5D9SB 5IF0A 2VZTA 3MGTA 1S9KC 4X7CC 2YZ1A 1OF2A 1JFQH 3LD8B 4BZ2L 4AY0A 3Q6FA 3U4BH 1GAFH 5FF6B 4I48A 5ABDE 2AXFA 4R2GC 1MFBL 4OCNC 4WFGD 3W39A 5J6GA 3C8KA 3IDXL 1KJMB 2Y6SC 5AUMB 2VDLL 3X3FL 4CDGC 1WFNA 5SV3A 1OGAB 4PJ5D 5GS0D 4GRWE 3GSNB 3PHOB 1UZ8B 3EFFA 2ZSWB 3FL7A 4OUUA 2UUDK 3F7RA 2Z8RA 4WO4B 3VXRE 2APTA 3H7LA 3QAZC 3DX8B 3WKMH 1DE4B 5K9JL 2Z92A 2ZG3A 1T5WA 3HMWL 3MTRA 4P23B 2NY3C 5E1HB 5DLMH 1CDIA 2ADIA 5IVZA 4MJ5A 1K5NB 1RFDL 4NUJA 4WIQA 4PJ5A 1M4KA 4X6CE 4H20H 1VB9A 5E9DB 1J5OH 5E5RB 3T77A 4E41E 3BP7B 5BO1H 4FZEH 4TSBL 1UADC 1FFNA 2XA8H 3P9LB 1JHLH 3CFKB 3NGBC 4U7SA 3V6BR 1QR1B 3SKOB 2CO6B 4WJ5A 4LKXA 1Q8MA 5MEPA 2O26U 2BVTA 5HDOA 4JR9H 1QA9B 1ZT7A 4DJMA 2F53A 4QKXB 1T6VN 2EE6A 3DJ9A 4LK4A 4C83A 3C87A 1BOGA 5DRXA 4JFPB 2BVQA 2AW2A 4M7JH 1CFNA 3WXWL 4TVPL 3CMGA 1M1SA 4ZAKB 4XP5L 1DN0B 4ZFFA 4HAFA 2M26A 4ZUTB 2JCCA 2ZOLA 3RL1A 1NC4B 1KIUA 5FYLL 2HMIC 4NQED 1IMHC 4KRPB 2CDGA 3DVNB 2DQCL 3PG2A 5MEOA 2JJVA 5EZIL 4XT1C 4QHNB 3AM8C 2VE6A 2XTJD 4QTIL 3U4EA 2X1QA 4NC0B 1KB5B 5EPMB 4PGEA 5J0BA 3INUL 3RWJA 2DQIL 5E03A 4YUEL 1JPGA 3F12A 4LIQH 5LJYH 4NGHH 1JK8B 4OJFH 3BD4A 5KVEH 4PRNA 3TYFB 1MQ8A 2FATL 2IALB 3GSWA 4NQEA 3MUY1 4ACPA 1CG9A 2IG2H 3GMPA 1IQWH 2BNRB 5HSFA 5T3ZE 3DETC 4DFHA 4DZ8B 1DUYA 5LVEA 3RGVD 1AD9B 3MOAL 4OCLC 3G6JB 1CVSC 1TMCB 1FE8L 3OR6B 4UT9L 1BGXH 1G7PA 3LKNA 4GRLD 2L0DA 5I1GH 1FG2B 5D1ZC 3LH2H 4YHIB 2PW2A 3WS6C 3VXUE 4HWUA 2NQCA 3TCLA 1U58A 2W0LA 2AK4B 3BDXA 5TDOA 1CBVL 3FN0L 4Q9QH 2ITCA 1AKJB 4NC1E 1VERA 2W65A 5D4QA 1NDGB 3QNXB 1D6VH 1SY6H 3FQTB 3RGVA 5I8OL 4HGKC 3OV6A 4HFUL 4J6RL 3PWNB 3IFOA 3WE6A 4B7IA 2F58H 2P48B 3D0VA 4E42B 2Y9RT 1WBZA 1X5GA 4GRLA 1I9RH 3FQUA 2BSRB 4G43A 2WQRA 1YEKH 3M8OL 4M3JA 4P46D 1DZBA 3TH3T 5I76B 3AU1B 4ONGL 2NY0D 3TT1L 4YHZL 5HYJB 5D7LE 4LHUD 4NO3A 3MJ9L 3U0WH 3QUKB 3MOBH 5EO1B 3MV8B 4PJFF 3SBWC 1RIUL 5CZXD 5IB2A 1U8JB 2R2HB 1ODAA 2R56L 5J9PA 5J3HC 4MDJA 3C2SA 4YXHH 2EDWA 4U05A 2J2ZA 1V7NH 4J3OC 4PJGF 1SJEB 4P46A 3T0EA 4LSUH 3CFBB 1NC2B 3V4PH 2FNBA 2N7BA 1IAMA 1A7QL 1SY6A 3KYMA 4LHUA 4GRMB 2LQRA 1B90A 2VUYA 3BZEA 5JHDB 3WUWG 1NDMB 5B4MD 4GBXD 3IF1B 5ADOL 1S7SB 5DWUL 1BVKB 4KQ3H 1BFVL 3FO9A 2OCFD 3LQAC 1F42A 5I17A 4CRPA 5DHXB 1BX2B 1JPFB 1RZJL 4P57A 3VGAB 1FZOB 3S97C 4N5UA 4C56D 1FIGH 1MCOL 1U91A 4W6YB 1FN4B 4FFYL 4HH8A 1H5BA 3O45A 3DHJA 1LGVA 3AB0C 3O8XB 1D9KC 4I1NB 2R69L 4LRIA 3UO1L 5GGSB 3T0VA 4OD3H 4Q0XH 1D5XA 5KVGL 4GBXA 2VXUH 5AG9A 1ZGLM 1FO0H 1X9QA 4MGXA 1JE6A 3LKSB 1DVFB 4YBQD 5DR5L 1D5MA 1UQSB 5EORL 3TN0B 1WWBX 2YMXL 4JFQB 1E6OH 3SE3A 4C56A 3KPLA 1DN2A 2VXQH 5HHQA 4I2XE 5DJ6A 4LDOB 1S8DB 1N6QL 5HHVH 5JO5B 5DK0B 2AAVA 2P44B 4PJEE 4Q97A 4PJBF 5IVNA 3ELAT 4JB9L 5IWLC 3GSOA 5D1XD 3RQ3A 4XNUL 3QCTH 4K3JL 4UV7L 2CUIA 1T2XA 4CVZB 4RBPH 1WUNT 4UTAH 4HIHA 2V2WA 4F58L 1U8KB 5FCUL 4YHYC 1XGYH 4D9RD 3R06B 4P3CH 1WICA 3D85B 4L8SB 5GJSL 5L6YH 3AAZB 3ULVF 3HRPA 4RGOL 3AROA 3A0OA 1CQKA 3DXAE 1FO0A 4HUNB 2CRYA 5D1XA 5DJAB 3BOVA 1WIUA 2XNAB 2BCKB 2LU7A 1MAJA 2QSCH 1CDBA 3BXNB 3MJ6A 4JQIH 2V2XB 4P5MB 1J86A 1CLZL 1NLBL 1AY1L 5CKAA 3QJFB 5DK2B 1MRCL 2DM3A 1CTNA 1PDKA 3BJ91 5IROC 3SKNA 3HR5A 4PG2C 5C07D 5D5ME 1MUJA 5FGSA 5E08L 3ZYIA 3X17A 4PRBA 1RU9H 2WINA 1OAYL 1A7OH 1JF1B 2HVJB 1JGUH 3MLSH 5HGAA 4OTXL 1J0IA 5KZCD 1SBBA 4YHPB 3IDIA 5DUPH 3U7WL 3BEWB 2Q7NA 3CSYA 4HDIB 3KPQA 1J8HE 5I66B 4EBQL 3MNZB 1KTLB 3O2WL 4MX7A 3E8UL 5SWSE 2X89A 5C07A 4WFED 3JWDL 5C0DB 4N9GA 1OPGL 2DTSA 4QOKD 5D2NC 1U2HA 4WW1B 3T1FA 5KS9E 2BXZA 1KC5L 1QFWL 1RHHA 5FGBC 3DSFL 1XR9B 5HD8D 2IPUG 1IM9D 5FO8B 5L2JA 2M2DA 4NKDA 4FFZL 1MIEL 3OAUL 1U92A 3QEUA 1FBIL 1VHPA 2B0SH 3C08L 1J12A 4K8RC 5E7BA 1YEEL 5A40E 4GKSB 4LHJB 5DJ8B 1MCQA 2PYFB 5ITFB 4OZGF 4HFWB 1G1YA 1FFOA 4FQ2H 3EJZD 4LSRL 4Y7MA 2ADGA 5HGGS 3QIBC 5GGVY 2FHFA 3JVGC 3ZYOA 3F7YA 5I6XC 2BHYA 5CJ8A 1TVBB 2QQKL 4O02H 5JW5A 4NQDE 2IH3A 4YFDB 2G60H 1FL6B 1JF6A 1R0AL 5DRNA 1O7VA 1ONQB 5DZLA 3KNBA 4L3EE 5C0CB 4WU7A 1MFAL 2WAHA 1KPVB 5EO0A 3DUHA 3SCMB 5MERA 2D7QA 1MAKA 3VD4A 3BN3B 5EBMA 4UIKL 4UU9B 5CINH 1UKQA 5F1IA 1FLRH 5CBAA 3B3IB 3IS1X 4LHQB 5BS0B 1EVTC 4PV9A 4P5TC 4ZOEA 1KJ2H 4PJXF 3QO0A 4DUVA 1VGKA 3TPUA 5JW4M 3B83A 1KPUB 4I3RL 4N8VA 5DSCB 3NIGF 4RFOL 3L5XH 3NABL 4R97B 4FQ1L 2X9YA 2NY4B 4XWOC 1HOCB 4WV1B 4YJZL 5GGRB 5FYJL 1MRFH 4NWUL 5IB1A 5IIEA 3DX6A 3N1FC 3HI1A 3MBED 4X5XB 5CEZH 3SGDI 2C3VB 4CDHA 3Q48A 3F62A 1VEMA 1FSKC 1FFQA 5IHBA 3OKDA 4L5FH 1QHPA 4ZNEA 1A5FH 2UZIL 4OZFG 3WO4B 5E2UH 4MS8C 4LLDA 2EZ0D 3IXAA 1NGXA 4M4RA 3TBTA 2QEJA 1X3DA 3PQYE 3TNMA 4E5XB 1HCVA 5BMFH 1JGLL 2NTSP 1BF2A 4PD4J 4YDIL 1N2RB 1J05B 2KQMA 3B2UD 1Y18B 5EU5B 2DQGL 4U3HA 4PLNC 5CEZD 2MCPL 1KJ2A 3MBEA 4OB5L 4HHAB 5TE7H 1FVDA 1XGUA 2AV7A 4L4VD 3VI3F 3SDCB 3MUGA 5JZ7D 2YPLE 4FQIH 1HNGA 1ND0B 4ISVA 4U1NB 3U7YH 1F4YL 1DLFH 5EFIB 4WWID 1EAPA 2VDNL 3WS3B 5TDNA 3KYNB 3RY6C 4YPJA 3KVQA 1JHKH 2I60L 5GGQL 1EPFA 5KG9A 3UDWA 1EBPA 1I8IB 4NKIL 2C9AA 3L5JA 3MRFB 4L4VA 4PJAE 4FNLL 4P59L 2AV1A 3RWCB 1P7QB 4UT7H 4M7ZC 4G9DA 4OBSA 3ZDZE 1T2JA 2IAMB 2H32B 4BKLB 4LPCA 4PJ9B 3FFCE 4XMKH 3RFZC 2WNGA 5D7JC 5JORB 3DOSA 3OAZK 3V6OE 3QEHB 4OI7A 4UDUA 5C0RL 5GQBA 2DI9A 5C0BD 2WWKO 1G1CA 3U0TB 1JWSB 4YXLH 1WQVT 5IUSA 2OQJA 3OX8B 5GXBB 3OKLB 2X1WL 5I18H 12E8H 1HHGB 2ZUUA 4KK9D 2HT2C 1HI6A 4F15B 1IE5A 4TUJB 4YQXH 1GHFH 4EVNB 2C3HA 5GSRB 3RVUD 3I6GB 5K33A 3SDYH 2JJSC 1ADQH 3QDGA 5C0BA 3MNVB 5CP7A 2CK0H 4QYOB 4K7PX 2L7UA 5DD5L 4M6AA 1A47A 1OCWL 3BP4A 1A6VH 1NCWL 3CH8A 5IW6A 4DVBB 2BVPA 2GK0A 2VC2L 4POYA 2BOBB 3DUUA 3S5LG 3WNPA 5IBLD 3GMLB 1BIIB 4LCWA 1XGTB 4P4KB 1CT8B 5H2BB 4B41A 5IFHL 2RHEA 4OLVH 1MCKA 5C09B 3B5TA 1T1ZB 1J0YA 2D9CA 1KPRB 4ONHB 1OAXH 1KIQB 2DN7A 4UOW0 3H9HB 4J23A 1XMWA 4HW6A 3KJ6L 2G5BB 2E9JA 1RUPH 1T7XA 2QQNH 3KPNA 2J88L 5ESQB 1G7IB 4F7EB 3DARA 4GLRI 3QP3A 2DOCA 1MREL 3L3DB 4OT1H 1FCCA 4YPGA 4Z7OE 5DEGB 1Q1JL 4HT1H 1YEIH 2N1KA 2H2PC 2HT3C 3HZVA 4HIIB 2EE3A 3WIHL 2M8XA 4WO4D 1GSMA 1UJ3C 2I07B 5FM5M 3MPCA 2O93L 1RURL 1CGSH 2X9WA 2NY1B 3UX9B 4PJ5E 3UYPA 4LLVB 2X4TB 4NNYA 1GGIH 2EDYA 3SQOH 4JHWL 1KJMA 3SPVB 3JUZA 3TA3C 2VR9A 5FHBH 1BM3H 5AUMA 3DX9B 4QRTA 2JKXA 1GGCL 1QD0A 1X7QB 4JY6A 2ICWJ 3MROB 3NTCL 4NJ9L 2ZSWA 3BKYL 2DYPD 1MWAB 4WO4A 3S3JA 2F53E 1A6UL 2D9QB 4MJIB 4HIJB 1HHHB 5J56B 3MV9B 4R8WL 2VWEC 4YHNB 4YLQT 4Y4HD 3VFMA 3ZHLA 4FTVB 3BIAX 3QQ9D 2JCCE 1K5NA 3PJSB 1I9JH 2HFGL 4Y16B 5BZWB 4NBZB 2C1PB 3CK0H 1YJDC 4ODVH 1SM3L 4JFYA 2AKRB 4JZOB 1CZ8H 4OCWH 1BPVA 2DYPA 3BP7A 3MUHL 4PB9L 1Z9MA 4YK4B 1CIDA 4EIZC 1NGYA 3GSUA 3I50L 1QR1A 1NFIB 1UXWB 2XZCH 3SKOA 5ENWB 3BO8B 3L5IA 1EV2E 3K4AA 5DEZA 1LP9F 1G7MB 1QA9A 3UTPD 2Q3ZA 4AIZB 4X8XA 3BT2L 1T7ZA 2WLZA 5CUSL 1RZIB 3T0WA 5K9KB 4LASL 5DQDH 4JFPA 1IRAY 4NQEE 4WUUD 1ZV5A 4Q6IB 2Z4QB 1REIA 2XTJE 3VWJC 1PQZB 4ZUTA 5HDLA 2BJML 1NC4A 3IKCB 4UINL 2C4XA 4OZIB 5D6DC 5JXEC 1RAMA 3EJJX 4M43H 2BNRD 1SYSA 4O9HL 3N50A 4M7KL 5HDQH 2XG5A 3VXPB 4PJCA 1QO3B 3O3EA 4F9LA 5T33H 4WUUA 5C0JA 1BJ8A 1WISA 1JK8A 5I74B 1QTYT 4OV5B 1CE1L 4WFHD 1NBVL 4PRHD 3TYFA 1YY8A 3GZKA 4YDVB 4LIQE 4W68A 4DTGH 2AK4D 5EU7E 2WSKA 2QV2A 2BNRA 1AKJD 4QHMB 2FEEI 3ZDXE 1AD9A 4O2FB 4RA0C 4JQVC 3P2TA 2G75B 1FCGA 1MAML 4JM2F 1ZHKB 1DL7L 1XF5A 4OV6F 3EGSB 3MUZ1 4WFFD 5GGRY 2HFFB 1FG2A 4YHIA 1N7MH 4JG0H 4PRHA 3MV11 1N59A 4DFIA 5IJVB 2AK4A 2VRAA 4M93C 3VMPA 1AKJA 3I3BA 1LWRA 2AJXL 5DO2D 5T3XL 3TZVC 1YYLH 1NDGA 3QNXA 2NXZC 2IQ9H 3MV8D 2VDPL 1DJSA 5EG6C 3T0EE 1N5AB 3BN9C 4FQJL 4FABH 2NW2B 4OGAC 4Y4KD 1DBJH 1GOHA 1UCBH 4QTHB 4E42A 1LE5B 2XICA 3VFGL 1UXSB 4NQSB 3TV3L 3LB6C 5EA0H 4Y1AB 3VDBA 1KELH 1QRKA 3BPCA 4DOHB 4LHUG 6FABL 1VFAB 3AU1A 1O7SA 1OWWA 5E5UB 1CICD 3ESVF 2Z8SA 4JHAH 4TUOB 3MV8A 5EO1A 5JHDD 2IFFH 2YN5A 2FIKA 3D2UB 1U8JA 5I1JL 2OMNA 4Y4KA 1IILE 5JLZA 4ELMB 1PX3A 3LS5L 1WJ3A 3K4ZA 3V4UH 2EKSB 3UJIH 2GTZB 1EEQA 4JREC 4N1CA 4XHJD 4PGZA 3RVXD 2X6MA 4XTRD 3NCFB 1CICA 2X4NB 4GRMA 2B8OT 2OTPA 2ESVB 1BWWA 4C56E 5JHDA 5F89A 5EBGA 3IF1A 5DQ9A 1NMAH 1S7SA 3BISA 5C2BL 1SEBA 3EYFA 2IAND 4HMEA 1JPFA 4AZ8A 1FZOA 5C3TA 3TESA 2A1WH 5FFLA 2AJSH 3TFKD 2XZZA 5F6HJ 4QT5B 1ZGLP 5GGSA 2VLRD 1YEGH 2LAAA 2Y7QA 1LO3L 4JKKA 3RUGB 4BQ9A 3KWWB 4H8WC 1B88A 1NGQH 4JDZA 5T1KB 4X7SL 3H7BB 1GC1L 3FJTA 1RQ5A 1UQSA 4IOFD 2MNUA 4JFQA 4MB5A 1QNZL 3NN8B 3WHE0 3GBNL 1MSPA 4JFDD 1PVHA 3DVGA 2H26B 3WIFA 4JFED 3D85D 1KULA 3BZFB 1N64L 4MAYB 3RAJH 1ULVA 3FQNB 4JANB 1ZLUH 4D9RE 5CLTA 1AE6L 3I9GH 2PW1B 1F3DH 2E27H 3B9AA 5C8JB 1EGJH 3BVNB 5KTEL 4MXWL 1U8KA 1BFOB 4IS6B 5EBWA 2WP3T 4LSSH 3X11A 4JFDA 2HJKB 3R06A 1CXHA 2MOVA 3D85A 3ARDB 1H15A 4L8BB 4NPYB 4MQXC 5CJBA 3DX7A 3CVIL 2KBGA 4PV8B 5CMAB 5DK3A 1IC7H 4I18A 3S37X 3GO1L 1JUFA 1S9VB 2XNAA 4LVNB 2BCKA 4KQ4L 5C07E 3FT4B 3BXNA 4P5MA 3BW9B 3QEGL 4NCC1 1RZ8A 5T5FH 5FYKU 1IFHH 1W8NA 3PWJB 1PSKL 2IQAB 3O4OC 1IGFH 4HWZA 1RK0B 2ZNWA 1N0LA 4DAGL 2R4RL 3C60B 4LPXA 4AG4L 4I3SH 2Y5EA 4O5LH 1X5XA 1JF1A 4GMSL 1UB6B 2OR9H 4JO3L 4U33A 4Q9BA 2FEDD 1G7LB 4WFEE 4Y5XA 1EGJA 4KUZH 1X4YA 1ORQB 1CDUA 3IXTB 4KROC 5DJZB 4YDLC 3QWRD 3IJHB 3MNZA 1FPTH 4MZ2A 3DVIA 5C0AB 1S7VB 3ARGC 3M07A 1VFUA 5C0DA 2X4OB 3I2CH 1R3IL 1MPAL 4WW1A 5C08D 3K1DA 4ERSL 5IMMA 3ARYA 4R3SB 5GRWA 5D93B 4PJEF 5HYQB 1XGRB 3FB7B 1I1FA 4XPBL 1UG9A 1MIML 3U9PH 4Y89A 1U8PB 2YKLL 3QWRA 4LMQE 1MHEB 5IFAL 2Q7YB 4KI5C 4GKSA 2NY6C 2WIIB 1S9XB 4GUPB 4LCIL 2PYFA 3QYCA 5ITFA 3ROOB 3CVHH 1EHAA 2OTUB 1TVDA 4P0DA 5B21A 5C08A 4BK4A 1U8LB 1JZ8A 4D8PA 2HG5B 8CGTA 4N8VG 3OKMB 3B6SB 1KENL 1K8IB 2L4OA 1FL6A 1UWEH 4HKJB 2ZCLL 1KBGH 4KJQC 1QZ1A 4R26L 4NDMB 5HHMD 1T1YB 4MA3A 4NZTH 3UPRB 2CIKB 5LGHH 1I85C 5C92A 1KPVA 1QBAA 3CX5K 4NT6B 2NTFB 4UQ2B 3VRLE 5EU6D 4U6YA 4ZNEE 2QSTA 5DEFA 2DQTL 1U8MB 2NXYC 4KXZI 4UU9A 2YK1H 5D5MF 1Q9OA 1BQLL 1R3LA 2ICCA 2GY7B 2ZCKH 3RIAK 1BWMA 1MCDA 3HHRB 5GRVL 1JNJA 1KPUA 4QRSB 1QEWA 4M6MH 1JZ7A 3C5JB 4BK5A 2OL3L 1JGEB 5AYUL 1T89C 4I0PB 1T03H 1YC7A 2CO7B 4EDWL 1IBGL 5DMIL 3TVMD 5JOFB 3CVHA 3G6AA 3QDMD 4PREA 4XAWH 1FAIL 3LPWA 3IGAA 5EU6A 2PO6B 4YZFE 5GGRA 4U1LB 1KLGB 5CZKA 3EOTH 2A77L 4LF3A 5KS9F 4X5XA 3U2SA 2C3VA 4JY5L 5FKPB 5E7FA 3SDCD 4L1DA 2DQJL 5F9OH 1K2DB 3LSOA 5BCAA 1JV5B 1YMMD 5A2FA 4IRJB 1P7KB 5CEZE 2GSGA 3TVMA 4E5XA 5CJOH 1ZLSH 4L4VE 1P4BL 5L2KD 3QDMA 4QCIA 3AREC 3RRQA 4PJFB 3OAYK 5HGHA 3LN4A 4YGVB 1J05A 1J9CT 1Y18A 1J0HA 1MFCL 3FO2B 4NKQB 1X6NA 4HJ0D 3EHBD 4HHAA 4GO6B 5E8EA 4U1SB 1XF2B 4PJGB 5EWIL 3SDCA 1OW0A 1YMMA 1GGTA 4PJ9D 2HFTA 2IJ0C 1E0OB 1ND0A 4W6WB 4ZFOB 5EFIA 5CD3B 2JB5H 3HFML 5DF0A 1YPZA 3MLWH 5L2KA 3LCYA 2ZCHL 3QDHA 4YE4H 1P1ZB 2FECI 5FB8B 3CFEA 4D0BB 3ARPA 1MCIA 3BE1L 2UY7A 3E3QC 3KYNA 1ZKAA 1LILA 2YA0A 1BBJB 4CMMB 4JZJC 3A67L 2VOTA 5FDWB 1M71B 4C57C 2BVYA 4WTZA 1I1AB 1I8IA 4LVHC 3RWEB 3TEUA 1WFTA 1ZS8B 3MRFA 3B4NA 1A0QH 4I4WB 1XCQB 3CMOL 4FQHB 3QDGE 5TF1L 5ECJE 2W92A 2H32A 5C0BE 4BKLA 4PJ9A 4CJ1A 4KRMB 1WZMA 4IEFB 4IJ3B 1LK3L 4LSTH 4AM0B 5HYSA 2A6IB 3SDAB 4HKBB 4G7YL 1FZMB 5IOPB 3SOBL 5A3IC 4HC1H 1ERNA 3B2VH 1QRNB 4G3YH 3U0TA 3MRMB 4LCWE 1JWSA 3S35H 1C1EH 5CSBA 3DLQR 2VERN 5FOBA 3V2AR 3A6OA 1E27B 1IKFH 1EO8H 2P8LA 5DQJB 3HG1B 3OKLA 1DBAL 3GK8H 1UEYA 3L9RA 3EKCA 4YNYB 2YD6A 4EJ1C 5EU4A 1P2CB 4PJBB 5GRVK 1JNNH 4EVNA 3AGVA 3MRDB 5GSRA 3I6GA 3W11C 3MNVA 4QYOA 1H3TA 1BEYH 3G9AB 1CL7L 4HJGA 3ARBC 1RY7B 3V0AC 1RZFL 3B8YA 2YUXA 2F74B 4LPTA 4HMDA 1QYGH 3A6CH 3FB8B 1BD2B 1OAQH 5CCKH 5JW3H 3KPPA 3D25B 2FB4H 5FUCC 5J12C 1JNLH 5LGJB 1I7ZB 4J8RB 1CT8A 4Q9RL 4HC1A 4JN1L 2XZAL 4FZ8H 3BHBB 4M6NL 3O3BB 4KJYB 4JM4L 3SE9H 1TTUA 1T1ZA 4JO1H 1JNHA 1KIQA 4WW2C 1N5YH 3H9HA 1FRGH 2G5BA 4JKPH 4WI9A 3ETBF 4PJAF 4LRNH 4LNVA 4M5ZH 5ESQA 4BFIB 4F7EA 5E6IB 1MEXL 3ZDZF 5GRZA 2WV3A 4J1UB 1EEZB 2BRRH 5DEGA 2OP4L 1F2XK 1AHWA 1OM3H 3RNQB 2PYEB 1KT2A 2YD3A 4MAUH 3ZKMD 4HIIA 3OKNB 3ARFC 4LBEB 3TJEH 1AGBA 2D7PA 3A6BL 3FMGL 1IKNC 1BIHA 3QXDB 4RFNB 5FUOL 3RA7L 5L7XH 1AP2A 3MV9D 4LLVA 1C12B 2NMSA 2AXHA 4HWBA 3SPVA 4PTTA 4Y16D 1WIPA 4HG4J 5C0EA 1Y0LA 3ROLB 1EHNA 5GRUL 2VQ1B 2BMKA 2XWJB 1CCZA 3IFNL 1ZTXL 5IBTH 1MWAA 3HC3L 4S1RH 3BIKB 3QISA 2EDDA 1C5CH 1GH7A 3VCLB 4HIJA 1HHHA 8FABB 5F9WB 1NQBA 3MV9A 3P4NB 4YHNA 5BW7A 1FZJB 5BV7C 1HILB 4PP2B 3BQUD 2YUVA 3LMJL 4OZGB 4XNZB 2GY5A 3BYTA 1IGIL 3IFPB 5DMYA 5DHVH 5BZWA 4Y16A 3THMH 3ULUC 4XAKD 2AKRA 2OL3B 3QG6B 1E4KC 4M8QB 4EUPB 1QSVA 2VITA 1AR1D 3UTPE 3CXDH 1S9WA 4PJDA 4PJCE 1A4JB 3VH8B 4WUUE 1OB1A 5GS0C 1RUQL 5ENWA 1E4XH 1UZ6E 1BZ9B 2RJMA 4HKZB 3E2HC 4XNXL 1XGQA 4RMRA 1RJYB 5K9OA 1LO0H 3WNNA 4GW1B 4K23H 4JRYB 2Z9TA 3PWLA 4KHXL 1RULH 4ONOA 3X3GH 5I2IA 2BNRE 3MA7B 5I75B 5I71C 1FH5L 4PJXB 3CFCH 1A6ZA 4G80B 5DD0H 4JCLA 1A7NL 3HI6H 2K3TA 4G42A 4O00A 3CH1A 3IKCA 3PGDA 5HVGB 1FNEA 1FQ9C 3KYAA 4MD5B 1QVOB 1U8OA 1UACH 3ALPA 1QLFB 2CKBH 2X42A 5DHVA 4WFHE 5TQ0L 4KAQL 4PRHE 4NHCL 4JKMA 1QO3A 2AK4E 3NCJH 1X4ZA 4KTDH 2D3VA 5IKCA 3OB0K 4YHOH 1NBQA 4X4YA 3VFUB 1X5HA 1PFCA 4N5ED 4PS4L 4OV5A 3D3VD 3V0WH 2Y25A 2DKMA 1A02N 5GIRB 5I73C 1Q72H 2V9RA 1FGNL 1I8MB 4QHMA 4WFFE 4QXUL 4OBRA 4K94H 2Q87A 4OM1H 5INCB 3LV3A 1NBYA 4P48A 2G75A 2JCCF 3MZTA 5JR1H 4PBXA 5D1QB 1U3HC 5MI0C 1EZVY 3FRPA 1FLTX 3C9NB 3TO4D 5ICZA 5IESL 3EGSA 2HFFA 1OTUC 3LQMA 3MRQB 2DLFH 4Y1AD 3MV8E 4NO5A 1GGYA 1N0XL 5I1LB 2VDQL 3D3VA 3QPXH 5IJVA 5DT1H 4LLAA 1CF8H 5DS8B 1EBAA 2NY5C 4FXGB 2WBJD 5GGTL 4CGTA 3J8F7 4JHZA 3O3DB 1UFUA 4K71C 2NYYC 3LY6A 3TO4A 1LE5A 1ES0B 3K2MC 1QLEH 4AT6B 4NQSA 4KUCD 4Y1AA 1A8JH 5JHDE 5EBLA 3WFZA 4HCRL 2AJ3A 4KPHH 1MHPL 3REWB 5HHPB 3TNNB 4JDTH 1XIWB 1KB9J 1DDHB 4W6XB 1T66C 4XPTL 2ESVD 4ALAL 3MLRH 1H3PH 3IJYB 4UQ3A 1F11B 2WBJA 4LLUA 5E8DL 3D9AH 4QRQB 2V5TA 1W8OA 1OP3H 2EYSB 3D39D 4ZDHA 3CLFL 4BM7A 3GSVB 3ZL4L 4MA1B 4I77H 5JOPD 2EKSA 5EU3B 3VG0L 4X80L 1KCRH 3DUSB 2GTZA 3D69B 1I9IH 2EC9T 4PJIF 4Z8FH 3DRQA 1JWMB 2J12B 2B5IB 1U0QA 2IC2A 2X4NA 4PRPD 4YHMH 2ESVA 4CVXA 4OLZH 1RZKL 2DM7A 3T0EC 3ZDXF 4HULB 5T1KD 3HNVL 1IGYA 2R2EB 1WZKA 3MLZL 5DJCA 3D39A 3IVKA 3TT3L 3S96B 3IT8D 3P4MB 4S0SD 1S7UA 1ETZB 4ODWB 4TN9A 1TIUA 5I15H 4TULH 2HJLB 4LFHD 4PRPA 3RUGA 1DQMH 3N1PC 3OGCB 3GI8H 2ZOKB 3KWWA 4F7CB 2X4PB 2EYTA 4JFDE 5T1KA 1FGVH 4P2OC 1KJVB 4YDJB 3AS2A 4JFEE 4LRIC 1L7IL 1IGML 3O9WB 5DD6B 4X7TB 2FJGB 5T3ZL 1NCAH 1K3IA 1F45A 1OAZH 4ODSL 3NN8A 3GBML 4GFTB 3N9GH 4TPRH 2ATKB 2WUCH 2H26A 1GPOL 3GIZH 3IDGA 4S1QH 3ARDD 1MH5B 5INDA 2HT4C 1XT5A 2A0LD 4OCSL 3BZFA 4X8JA 5SX4H 3FQNA 1KEGL 4YEFA 1DLHB 2JK5B 3V6FB 4KC3B 2W9DL 2E7MA 5CILL 2LVEA 2PW1A 3RZCC 5IB3A 3W0WB 3REVB 3CFDA 3IAQA 5C8JA 1G9NC 1PD6A 4WNQA 4ZTOL 1BFOA 4IS6A 2BFVL 4DEPB 5CBEB 5DI8B 5ICYB 1AGFB 1NL0H 4DW2H 1OSPL 3ARDA 1T2QL 4L8BA 4NPYA 3UJJH 2VXSH 5TQ2L 1F3DJ 1Q9WB 1PKOA 4LSVH 2A9NH 5TE4H 3S3SA 4WWKB 3MMEB 5I30L 4PPTA 3RWFA 2PCPB 4ONFH 5I1CH 2O5XL 3UAJD 3BW9A 2FDBP 3WFBL 1AIFB 4PB0L 3P40A 3WEXB 1JRHH 3IDMB 3V52H 4ZPTB 3SDDB 5HGBB 5C0AD 1D7FA 2A2QT 3I6KB 4ZTPL 4UT6L 1UM6H 3IU3B 1ZT4A 2IBBA 2CIIA 3V5HB 4Y8DC 4XVTH 4N8CH 4CU7A 1NMBL 3TO2B 4HD9A 3DGCR 2DMBA 4G6JL 2OZ4H 5AAWA 4UOW1 3CUPB 3MRCB 3C2AH 1G7LA 3DV4B 2NCMA 3KPOB 1FNLA 2Z91B 3IXTA 5C08E 2BK8A 3IDJB 5KSAB 3OF6D 1I3GL 3QJHA 4KHTL 1LP9B 5F21B 2JF1A 1JGVH 5C0AA 1JI1A 1S7VA 5M94B 4X9GA 3ZE1E 2CLVA 3BKJL 1RZ7L 4K9EH 4LCUA 4P2QB 3SE8H 3NCCB 1A7PL 4KK8D 4B53A 4PFEA 3DGGB 5HYQA 1XGRA 2NR6C 3FB7A 1NCDH 3E6HA 1KFAL 4QHLB 2GJJA 3OR7A 1D5IH 4Z7QF 5LWYH 4MD4A 3OJVC 4GXVH 3L6FB 3OGOE 2PXYC 1A6AB 4TNWK 1U8PA 5DZOA 3C5SB 5AZ2L 4YH6A 1B2WL 3PXJA 1D6EB 3OF6A 4U0QB 3T2QA 1MHEA 4Y5VB 2Q7YA 3K1KC 5B3JF 4EN3B 2WIIA 4PRIB 4GUPA 3O0RL 3ROOA 4XMLH 2OTUA 1IM3B 2DWDA 3T8XB 2VDRH 1BLNA 1TPXC 1WZ1H 5HHME 1E4WH 2OZ4A 5JXAH 1WVZA 1V3MA 1WBYA 5L8LB 1HEZA 3MLYL 4OGYH 3MJGX 3VG9B 5CHNB 3NFPB 4HPOH 5EU6E 2JJTA 2CLZB 3VXRB 4R4BB 1E6JL 3QPQC 1VPOH 4U6VL 3LKPB 4I0PD 4A6YH 4NDMA 3O6ML 1RV6X 3UPRA 3PDOB 3LRSB 2XKSA 3LDBC 3H6JA 4M1CD 3BKCL 4NT6A 1FVCB 5E99L 4OCXH 4HK0B 1NSNL 4GW4B 2JIXB 5HI5D 1AFVH 4JM2B 3VD3A 2X7LB 1U93A 3G04B 4HXAL 4W4OA 3TCXA 5F9JA 2YD9A 3QDME 2ZUQB 4K3HA 1YNKH 3MRLB 3SHSA 3MLXL 3C6LB 1UGNA 4F2MA 3C5JA 1UA6L 5IBUB 2XXMB 5KANI 4IRJD 1Q0XH 4I0PA 4XC3L 2FX7H 3K2UH 5C7XH 3B9VA 2GJZA 3RNKB 2ADFH 3VI4F 3KDMA 3U6RB 1YMHA 3OJDA 1A1OA 4P2YA 3CLEH 1YMME 4U1LA 3G6DH 1FL5B 1AI1H 5JMOC 3HE7C 2A6DB 5SX5K 1YPZE 5L2KE 1ZT1A 1RUMH 1ROWA 2EE2A 2H6PB 2AK1L 3KLAA 4M02A 1K2DA 1JV5A 4POZD 4A6YA 2NY2B 4IRJA 1FJ1B 4GS7B 2YSSB 3JWOL 3L3GA 4XCNA 1A6TA 1MY7A 1HYRC 2H1PL 3RWDB 1ZLVK 4PJFA 4WTZG 3DI3B 1A2YB 4YGVA 2R4SH 2KPNA 3WFCH 3U9UA 1NBZA 4RNRB 1ACYH 3FO2A 1NAML 3MR9B 3GHBL 4GXUN 4U0RC 4UIMB 5GGUB 4R96A 4ZUSA 4PJGA 2DKSA 4X4MA 4KZDL 3WFHB 5HYSG 1MJJB 2E9BA 2CQVA 3QUYB 4XCEB 4ZFOA 5MENB 1EHLH 5CD3A 3EFDL 1PAMA 5D96B 4HPYH 1M7XA 1MJ7L 4MB3A 4QF1B 4D0BA 5IJKA 1F6FB 4EKXA 1BBJA 1P9MA 3O2VH 4LEOB 3CDCA 5FDWA 1T3FB 4NBYB 1M71A 5A1AA 1XR8B 3DV6A 5F7EH 4Z95L 3MXWH 1MRDL 5EZJA 3TH2T 5BXFB 4AENA 4RA3A 2VN4A 3GJFB 2Z31D 3OJ2C 1M7DA 4FQHA 3HG1D 4LNRB 5LGKA 4JO2L 1A6WH 5DJ2B 4UZGA 2Y5TA 2BVUA 2VABB 4AM0A 4F3FB 4YFLF 2A6IA 1S7WB 3RU8L 4HKBA 1EA9C 4N68A 3B9KC 3U79A 1UM4L 3BPNB 1DANT 3GMOA 3FRUB 1GL4B 4XI5D 1INEL 3BP5B 2AXGB 1F4XL 3L3OB 3MRMA 3C8DA 4PTUB 4JKWA 3LHPL 3CJJA 3OKEB 3PHSA 3ZT6A 1OTSC 1S7TB 1X6LA 2Z31A 3LKOB 5DQJA 3HG1A 5I1KH 3O6LH 4DN3H 3QO1B 1BVLA 4XPHL 4NRZB 3MGAA 1P2CA 2GUOB 3GRWL 4PJBA 2YRZA 5D7LB 4KKBD 1EEUA 5AAMA 4UILL 3FT3A 3FCTB 1IGTA 2VTFA 1OSZB 3WXVH 1S9YB 5CSZA 4GAGL 2WBKA 3G5XB 3QB7C 4WI2A 5I8EB 3G5ZB 3VFTB 1I8LA 4OQTH 4XVUC 4MJ6B 2HRLA 2B39A 5C0ND 1LO4H 5BRZD 3NH7H 4R9HA 5KSVB 3FB8A 5E6ID 2OK0L 1G6RL 4IDJH 1SEQL 4KKCD 5DRZA 4KDTC 3P9MB 4RMWA 4RQQA 5LGJA 1I7ZA 1CTOA 1YEDB 5CD5C 4Q2ZB 3O3UN 3UPAA 4JE4B 3KLHC 5F1NB 4ZUVA 5F6IC 5KVDH 1IT9L 3O3BA 4KJYA 3QCVH 1MQKH 2ZUXA 4FHBD 2VZ1A 4KMTH 1DFBH 1HH6B 2Q20A 3FZUD 5E6IA 1R5WB 3DMMC 3GNML 4J1UA 4CMHC 3NPSC 4XCYB 4BZ1H 3FO1A 4DN4L 2XYCA 5B22A 4HSQA 4Z0BL 3MV9E 1DR9A 4GAJH 3RNQA 4ZO6A 3AY4A 2EDOA 3NZHH 2XZQL 3OKNA 4F9PC 4JKLA 1JCKA 4CW1B 1ZEAL 1A1NA 2I24N 3WHE1 4RISL 3AXLA 4OQTA 1RMFH 4HMCA 1A3RH 1L7TL 2CH8A 4TTDC 1C12A 4ZS7H 4R0LB 3LD8C 1FDLH 1CR9L 4PBWD 4AMKL 5FM5O 4I2XB 1TJHL 1SJHA 2JELL 1KG0B 4PJDE 1QBLL 3FB5B 3RWIA 2ATPA 3WJJA 3ZDYE 4U1KB 3WN5A 3BKMH 5F1SA 4MD0B 4PJEB 4XB8A 2CK2A 3ROLA 3WIIH 3MFFB 7FABH 3ZKND 2FCBA 5FKAB 4XH2A 3EO9L 1GGUA 3ZKQD 2K7QA 1MJ8L 2BC4B 3BWAA 4XAKE 3BAEL 4QHKJ 1HILA 3MC0A 3HZKB 5ISZD 5A2KH 2DD8L 4OZGA 5GISL 2ZJSL 5GHWL 4OSUL 4JRYD 1X5FA 4P23C 2AXJA 4X7FC 4BZ2H 4AEIL 2CUHA 1OWRM 1W2KT 2VSCA 4FFVD 3FO0L 4IIQB 2VR5A 4TUKL 5E00B 5DUMH 1Z0MA 3F5WA 3IDXH 1BZ9A 2N4IA 3QUZC 5ISZA 1RJYA 2PTTB 2VDLH 2HVKB 4N0FA 3M1BB 2WWMC 1VENA 5SV4A 5D5MB 4GW1A 2OJZH 4HEME 4JEGB 4JRYA 3ARSA 2AJUH 5FM4A 3HLAA 1YEJH 4XVSL 3MRRB 4YXKL 4O58H 4G80A 2O61B 4HGWB 4IMKC 1F13A 3STZB 3HMWH 4IRSB 4XMPL 3SY0B 4ZAKC 3VFPB 5I16B 1J88A 4MD5A 4ZODA 1J8HB 4HZAA 3P0YL 3TBWB 3WD5H 4Y5YB 1NAMB 2CJUH 1ED3B 1RFDH 4JAMA 3FRPG 5IVXA 3D3VE 1CDGA 4KRPC 2VKWA 2HP4A 5D1QD 4J3SA 4NHUB 3DRTB 2YD8A 4XP1L 5A16B 5KS9B 1UH4A 1VADA 2QLVB 5BV7L 3VFUA 4JRWA 1KN4L 2R0KL 2EEAA 3K0WA 3D87B 1U8HB 3KPRB 5GIRA 2DQEH 3FQRB 4FQLH 2HH0H 4Y1AE 2DBLL 4XB7A 5INCA 2P8MB 4DOHE 3NACH 5GS0L 5D1QA 4OGXH 3G5VB 3R0NA 4X7DC 3HNTH 1JFQL 5IQ9A 5FCSH 2VAJA 3U4BL 3EJYC 3H42H 2R0WL 3X13B 3MRQA 1GAFL 5FYLH 4IBLT 4NQDB 1VDGA 4PGDB 1U41A 1AQKH 5EZIH 1T83A 1XIWD 4PJCF 1AXTH 1UZ6F 4APQC 4UBDC 4L1HA 4L3EB 3BD3A 5JMRA 4DZBA 1T0PB 1PG7L 4O2CB 4RAUB 1YA5A 3F7QA 2F8XC 4R6UA 4N0CC 3IDNA 5C3LD 1K9TA 3O6FD 5FYLD 1ES0A 2HJFB 2FECL 3I02A 2ESVE 5SWQB 4AT6A 1I4FA 2HKHH 1T0NB 1UYWH 4R7NB 5HHPA 4BQ8A 1XIWA 1A9EA 4U1MA 3D39E 5DLML 2BSTB 5JOPE 3M17B 1FE8H 2UWEF 2VZVA 1CD1A 1NH6A 1F11A 2HN7B 3IJYA 2WK2A 4K3DL 4R2GB 4UT9H 4H20L 1J0ZA 3CC5A 2EYSA 5DRWA 3CAFA 2E7BA 4FZEL 3O6FA 4JCMA 4P3WA 4PRPE 1G6RB 4NQXB 1NANH 3RUGE 3GSVA 2XA8L 1JHLL 4LSPH 2LAGB 5EU3A 1BZQK 1YYMH 2FHCA 2LU4A 3FN0H 3DUSA 3D69A 5HI4C 5TH2B 3QXUA 4JR9L 4OD2B 4NSKB 5I8OH 2RCSH 2FL5A 3PQYB 1MCLA 1Q9KB 2MSPA 4HFUH 4M7JL 1IC4H 4OM0L 1PLGH 4Z18A 5JHLH 1MFEL 3Q2CA 3V6ZA 2R2EA 4U1IB 4QRRD 3O9WD 4L9DA 3SJVB 1Q0YH 4UUJA 4K55A 2A83B 4K3EH 3M8OH 4HIEA 1UWXK 3KJ4B 4PYGA 4LFHG 4ONGH 2H2SC 4OF8A 3HRZA 4GW5A 4NFDA 2E7CA 2HJLA 5AZEH 2YPLB 5JW4N 3RVWC 5FK9B 5F44A 1RIUH 3OGCA 1JYNA 5EO9B 3FOLA 1MLCB 2ZOKA 3HZMA 4F7CA 2X4PA 2EDEA 4NKMB 4LIQL 3T65A 4EI5B 3O8XC 4YDJA 3NVQA 1VESA 4OJFL 3O9WA 1M05B 4E0RB 4ODTH 2V2TB 5KVEL 4HQQH 3ILQD 3KLDA 4PJAB 2ATKA 1DVFC 2IG2L 3UZQA 1IQWL 3CD4A 1A7QH 4JQXC 3KYKH 3TN0C 2LU3A 3QUML 5DA4A 5HVWA 3UZEA 1JPTH 2JK5A 3P9WB 2XOTA 4Q74A 3WLBB 4AH2B 1PYWB 2EXYC 1NMCB 2HWZL 3EAKA 5EUKA 3EDKA 5I1GL 3LH2L 4JVUA 4I8DA 4U1JA 5AEAA 4OKVB 1MVUA 3MBXL 5DI8A 5ALCH 4PUBL 3RVVD 3HC0A 5DDHA 3UO1H 4N1HB 4DK6A 1P69B 1SY6L 1CN4A 1Q9WA 3BD5A 3V8OA 3MMEA 3TM6A 2Z8VC 5DR5H 1AGCB 2F58L 4L8SC 2X44D 5C0AE 1T1XB 1I9RL 5CJXA 4QY8B 4DKEH 3BESR 1AIFA 2OJEB 1WCBB 3WEXA 3CZJA 2NLJB 2E9IA 4GJTB 1DBBH 3PP4H 3IDMA 4G8FB 5GZOC 2QKIB 1N6QH 3S5LB 4P9HH 1MJUL 1MY5A 1OF2B 3U0WL 5HI3D 3MOBL 4JB9H 5T1LB 4P2QD 3WKNA 3WCYA 4I48B 2YD7A 1K4DB 5F3BA 3CPLA 1JP5A 4PLKC 3W39B 2E5EA 5J6GB 4PLOB 4XX1E 3U0PA 3C8KB 3KPOA 4F58H 1V7NL 2Z91A 3VGBA 2HTLC 3IDJA 4LSUL 2V17H 3V4PL 4FQXD 1LP9A 4IHOA 3IU4H 4PRID 3TC9A 4B7LA 5CGYC 2IMNA 4P2QA 4KU1A 1T5WB 2IBGA 4XVJL 3QRGH 1AY1H 4PBVC 1IJ9A 3LVEA 1A6AA 1FIGL 5IVZB 3C5SA 4MJ5B 1SHMA 4HIXL 4JDVA 3SDXF 4GKZB 5EUOF 1KXVC 4FQXA 4ZS6D 5E08H 5L8JB 4PRIA 4OD3L 3T77B 2GTWB 4Q0XL 2ICWB 3MRGA 2BNQB 2SEBA 3T8XA 1FFNB 2VXUL 4OTXH 1FO0L 4P5KA 2VAAB 1YNTA 4JM2D 1QFUH 4JN2B 3W9EA 5MEPB 3WLWD 2X1PA 1E6OL 4HUXB 4D0CA 3T4YA 1ZT7B 2W9EH 4R4BA 4PY7A 3VDAA 2FO1A 2VXQL 4TOYH 5DRXB 1PKQB 4MZ3A 5FXCH 2GT9A 5HHVL 1CLOH 2VLKD 4MVBC 4ZFFB 1FVCA 1QFWH 5HHNA 1K6QH 4ZD3H 3OB8A 2JCCB 3PWVB 3RL1B 3QCTL 4GW4A 2IGFH 4N0RA 4JM2A 2IPTH 2D7OA 1X5JA 2DTML 3ARUA 3G04A 4H1LB 5E2TH 1MIEH 2CDGB 3QXTA 5HXMA 4K3GA 2YWZA 3SCMC 5IQ7H 3MRLA 3H9ZA 4PJFE 2VE6B 3C08H 2EH7H 4FXLA 3WV0A 2NY2D 1G7QB 1YEEH 3BUYB 4PGEB 3JTSB 4FG6D 3RWJB 2DMKA 4R4FH 1JPGB 2B2XL 4RMVA 5L6YL 2VLKA 4BUGA 4PJ8D 1I7UB 4LSRH 1W72B 1XCTA 4G6AD 2ZKHH 2GJ6D 4PJGE 4X4ME 2XKNA 1HNFA 3QUXC 4PRNB 1FVEB 3ZE1F 4BH7A 3C5ZB 3RWGB 1MCCA 4PRDB 3ZYJA 2QSCL 2A6DA 4JQIL 2J7LA 4R97C 2PKDA 3GMPB 4C54A 4X0KB 2NY4C 4WV1C 2XTJB 1DUYB 1V8HA 1JL8A 5F88A 1MFAH 3QUYD 5MEND 1G7PB 3VXQA 2GJ6A 3S98A 2HLFD 2YZ8A 3GMNB 1JGUL 3L3IA 1EMTL 3MLSL 1JJUA 3IYLW 4H88H 2YPKB 3CZFA 5DUPL 5TDOB 4I0KA 3ZKXC 4UIMA 4HF5L 5GGUA 2IEPA 2ITCB 1RZJC 2W65B 1NCNA 5IEHA 3RGVB 4RFOH 4V1DD 1B0WA 4PJIB 3WFHA 1NUDA 5CP3H 1MJJA 3NABH 5TFSH 3QUYA 4XCEA 4FQ1H 5MENA 3VW3H 2F8VA 4NN7B 1WBZB 1DANU 4GRLB 4OLXL 4QF1A 5FYJH 2DJSA 4NWUH 2HLAA 3GKWH 1IEHA 3HG1E 4CU8A 3BIBX 4YFEA 1T3FA 1XR8A 3HR6A 2X4SA 1J0JA 4PJBE 1J10A 2AEPH 4LEXH 5BXFA 4V1DA 4YAQA 4NWTH 5IB2B 3U36B 4MB4A 2QADD 5DJ2A 4LSQL 4U7MA 4XXCA 4MDJB 4F3FA 3ALXA 4FQ2L 5FYJD 4IRZH 5HHOB 1AXSA 2IAMC 2ORBH 1VFMA 2MCPH 1FIEA 5E24E 4GAYA 1PGRB 3FRUA 4OCRH 4O02L 3L3OA 4IOSD 5D7IF 1MCNA 1QUNA 1TCRA 2G60L 4DQOH 2CKNA 4ZSOA 4B50A 4YC2B 4RGNC 1S7TA 1YPZF 1R3JA 2Y36H 3L3HB 3LN9A 1F4YH 3QDAA 3FO9B 4NRZA 4LPWA 5DFVC 2XWBB 4L8CB 5CINL 5JTWA 2Y1VA 5GGQH 1U91B 2EC8A 2MKLC 1H5BB 3O45B 1KJ2L 1S9YA 4G8GD 3JUYA 3BPOC 2AQ1A 4PRAA 3G5XA 1EVUA 3L1OH 1X5YA 3QIBB 1W0WA 1KYOK 3VFTA 1D5XB 4MJ6A 4GBXB 1OAUH 5E4EB 3S36H 3P9MA 5F70A 1D5MB 3BH9A 3H3KA 1X4XA 4RX4D 4JPIA 1MRFL 1C5DA 3UTOA 3I6LD 1I3UA 3SGKC 3GMRA 5CEZL 5HHQB 2DQHH 4G8GA 5DJ6B 1S7RA 4L5FL 3FONA 1A5FL 4P4KC 4WDIA 4DK3A 4GMTH 5E2UL 4TNVK 4XZUB 3P4LA 3GSOB 1HH6A 5DVOA 4FN0A 1R5WA 3NPZB 5C0GB 2IWGA 4Z6AT 4XCYA 5BMFL 3JWDC 4S1DD 2FLBT 1T5XA 3RKDD 4RX4A 4HIHB 1DEEA 2V2WB 1RJLA 4H0GA 4OZGE 4CW1A 4LGRB 4S11A 3OXRB 5TE7L 1OCWH 4KTYA 3LQZB 5ICXB 1MVFA 4G7VH 4ZXBC 4FQIL 1RZGA 4R0LA 1B6UA 5D1XB 3U7YL 1IEAA 1DLFL 4EIGB 1A6PA 2NY1C 3RHWF 4FS0A 3FB5A 3QH3B 4R4NC 4U1KA 3QDJB 2MKWA 2DM2A 4X5WB 3MFFA 5ISZE 1HN1A 5GRXG 3I75B 1HXMA 3T4AB 1T4KB 2B4CC 4UT7L 3S88H 3GJEA 1MUJB 5DMJB 2BC4A 4RZCB 4JRYE 1FFPA 3VFOA 2WINB 3QQ3A 3IRZA 4XMKL 2KZ1B 5HGAB 5HHXH 3PGFL 1J1OL 2UVFA 4U2YA 4TQEH 2XACC 4QO1A 3IDIB 3NIGE 5DHYB 3CSYB 1S3KH 3V7MA 3MLUH 3KPQB 3WIHH 3MJ7A 4FMFA 4MX7B 5E0QA 5F7YC 2FX8L 3STBA 3B5GA 1UH2A 2NZ9D 5IVXE 5E00A 5C07B 3IFLH 1Y6NR 5CIPH 1IAKA 1IC1A 3PHQB 3T1FB 5I18L 2FBJH 4WI8A 2A6KA 4YK4C 3VWKD 5K93A 1KCSH 5KZCB 1ZANH 3M1BA 4RDQG 1CDYA 4M7ZB 3S7GA 4NKDB 2E3VA 4GOSA 2IPKA 1U92B 2R1XA 4I0CC 1ZA3B 2VL5B 2CK0L 2ZUSA 3MZGB 2XWTB 1K4CA 3MRRA 1HHJA 1R6VA 2H9GA 5ALBH 3P0VL 3T2NH 4CN6A 2VO5A 1A6VL 2AEQH 5EB9A 1A4KA 4Q6IC 2B1AL 2BDNH 3KPRD 4QOKB 3SY0A 1J8HA 3TBWA 4Y5YA 3VI3E 3VWKA 2HFGH 4PLJC 2RAMA 1IM9B 1SM3H 3NA9H 4FFWD 2IH3B 2D7TL 3EYQD 1P84K 3WIHA 4PJDF 4S2SB 3DRTA 5A16A 5DRNB 5HBBA 3F58H 2ID5A 2X40A 4KK5C 3KNBB 3RIFF 1E28A 1OAXL 3I50H 5CIPA 3LAFA 1RUPL 3MA9H 3PP3K 1V7ML 5L0QB 3KPRA 2QQNL 5EBMB 2V6HA 4OCYH 5IB5A 1CI5A 3G5YA 5I74C 4Y19D 5F1IB 3FQRA 4OT1L 4QNPF 5CBAB 3I3DA 4KTEL 4PV9B 4HT1L 3QO0B 1YEIL 2OS7A 2P8MA 2CMRH 2X70B 4KJPD 4XNYH 1NCCH 3G5VA 3SE4C 2EEDA 3WJLC 4X5LA 2RR3A 1CGSL 4C59B 1R5VA 1EFXD 1S7XB 4F37F 5IW1A 2VDKH 3N85H 1GGIL 4O9HH 3SQOL 3DNKA 4XBGA 5FYLE 5IIEB 3DX6B 5FHBL 1BM3L 3GSRA 4P2RD 4R2GD 4PG9A 4RAUA 1NUNB 4FQQA 1IAIM 3ZT5A 2Y6SD 1TZHA 4HBCL 3IXAB 1NGXB 2ZG2A 2B1HH 2YPVH 3P4OA 3TNMB 1KOAA 1T0NA 2UYLA 5MEQB 4R7NA 4HLJA 3T3ME 2BSTA 1I9JL 3BDBA 3MBEB 5J8OA 3CK0L 3ECBA 1QR4A 3M17A 4P2RA 2HN7A 4ODVL 1FVDB 1XGUB 1CXFA 1MAMH 5E2JA 2NY3D 4L4TD 1DBKH 4OCWL 2ZNXA 3MUGB 1LMKA 1LK2B 3SJVD 4XCFL 5IHZB 1YY9C 4Q9CA 2XZCL 1P4IH 1IGCH 4HK3N 1EAPB 3FN9A 5T3XH 5TH2A 2AJXH 5TDNB 4C4KO 5J06A 4OD2A 2NW3A 3UYOD 5KG9B 4J2XA 1JPSH 5KJRL 4FQJH 4L4VB 2AV1B 5I1EL 1MLBA 2J8OA 4G9DB 4L4TA 3VFGH 4U1IA 1OTTC 1JTPA 3SJVA 2Q1EA 3RWHA 3TBYA 4U7KA 2B7DT 5KBNC 6FABH 1MHHA 3PNWA 4PGJA 2X1OA 1L6ZA 4M43L 4HKXA 2LE9A 4HWEL 4XPGH 1H9VA 2XA3A 5HDQL 4NNPH 4JGMA 2HMID 3RI5F 1H8NA 5T33L 1Z2KA 3TBSA 4KUCF 1NCTA 2RFXA 3H8NA 3LS5H 1GIGH 1M05A 4BZYA 5DD3L 2VH5H 2V2TA 1S5IL 5D72L 4KKNA 2EDHA 3IAGC 4Z78A 3QIUB 5D6CA 3F7VB 5CP7B 5FOJA 3WMSA 5HJ3A 1X5IA 3WLBA 3V95A 3BP4B 3AM8A 4MAYC 1NPUA 5CS7A 2BVPB 2GK0B 1TZIB 4M48L 3VU2A 4JG0L 2HRPH 4OKVA 5ELIA 3O11B 1AH1A 3NZ8B 1NAKH 2BVOB 1WGOA 1VGEH 4JJ5A 3ARVA 5D1ZD 5F7KC 1YYLL 2KKQA 3OSKA 4ODHH 5T1LD 2IQ9L 1YDPB 4KDWA 1BJMA 4X7SH 2FSEA 1AGCA 1LP9E 1UCBL 5E94B 1N3NB 3CXHK 5I8CB 3WSQH 4XXDA 1QNZH 5EA0L 3FKUS 1KELL 4P2QE 1T1WB 4XBEL 2GCYA 3QA3B 4JPVL 4M00A 4G8FA 35C8H 4UNTA 4LVNC 4F57H 4XPAL 3MLTA 5D1ZA 4JHAL 2DBJA 3HZVB 3WS6A 5M7QA 2CR3A 5E2VL 5T1LA 4CVWA 2DB8A 1Z9OA 2IFFL 2HAZA 1AE6H 1P7HL 4XRCA 2R2BB 4MSWB 1K4DA 3G08B 3T0DA 4PRIE 2VKXA 3TZVB 3C60C 4NNYB 3U82B 3L3KB 4ZUWB 4PJHF 5ACLA 3JTTB 2C4FU 4RGMB 4QRTB 5J3HD 4JY6B 3N1GC 4LCYB 3VE0B 3LQAH 2Q6WA 4BUHA 2BNQD 4LQFH 3LIZL 3O4LD 2VIRA 4U31A 5J11C 2YOCA 1LDSA 1TETL 4BELD 1M6OB 4H1LH 4M62H 3VFMB 4O2EB 4D3CH 4D9LL 4GXUM 2A1WL 2MMXA 3PWPB 2AJSL 5D93C 4HUVA 4GKZA 4LOUC 2HTKC 4JFYB 1U3ZA 3U46A 3L3JB 1YEGL 4Z7UF 2DYPB 2GTWA 3QIWC 4X9BA 2ICWA 1W72H 2BNQA 4MDIA 1J1PH 1WEJL 3X12A 1NGYB 2VAAA 1D9KD 3GSUB 4QXTA 4JN2A 4NP4H 2VLKE 3OAYH 5IBUG 4AQ1B 1WFUA 4Y4HB 2YRPA 4HUXA 1HYSD 2DQDH 3DTXB 3GHEH 1PKQA 5DFTA 4AJ0A 1OY3B 5I1AB 4NZRL 1AXIB 3LEYH 2GFBA 4PP1C 4NZUL 3KGRA 3PWVA 3IKKA 4Z7VA 2P1YA 3C5ZD 3I9GL 1D9KA 4XPBH 4H1LA 2E27L 2P49B 1SYSB 1EGJL 2AP2A 2GJ6E 3MRNA 2O5YL 2VQTA 2F54B 1J8KA 1G7QA 4PJCB 3BUYA 3JTSA 4NOBA 3O3EB 4WUUB 5CEYA 5C0JB 4XC1H 1I7UA 1W72A 1KJ3H 3CGTA 4ETQA 1IC7L 1TQCB 1FVEA 1YY8B 3C5ZA 3FQWA 3RWGA 4PRDA 1KENH 5MENE 1P6AB 4K2UH 4UOJA 1ITBB 2ZCLH 4X0KA 5IWLA 1IFHL 2P24A 1JVKA 2PO6C 4NQCD 4R26H 3U7AA 1IGFL 4J3XA 2AS5M 3HPJA 4K7FA 1A1MB 1XF5B 2UWEB 2Y23A 4I3SL 1BBDH 3P11H 4O5LL 3GMNA 3ARRA 4V1DE 2OR9L 4JFHD 4PRHB 3IETA 1N59B 3FQXA 2V7NB 2YPKA 4KUZL 4L3CB 4WENB 4NQCA 5AYUH 5C6WH 3FHAA 1FPTL 4PJIA 5FV2A 5D7SL 4EDWH 1IBGH 3ZHDA 3D0LB 1ACZA 3EYSL 4X6BA 1KTDB 2JB6B 3QXVA 3RVTC 5HHOD 1KXTB 4ZSOE 5E8NB 1A3LH 3MODH 3O4OB 5IROA 3T1WA 3EOBB 1HXYB 4K8RH 3BPCB 4PG2A 4RMSA 3QG7H 1GC1C 1XH3A 3U9PL 2DQJH 3L7EA 2HKFH 4EQ2A 1P9MC 1ZE3C 2QQLL 3IDYB 4ZUUA 43CAA 5FGRA 2FIKB 1D5ZB 1I1AC 5FECA 3U36A 4Y4KB 3SGEI 4Y2DC 5JLZB 4KWUA 3CVHL 4L9LB 1NFKA 4Z77A 4YDLB 5HHOA 2J8UF 4K8RD 1A22B 2EO1A 4IJ3C 4UAOB 5EWIH 2CPCA 1UWEL 4KKLC 5D2NA 3SDAC 1CICB 3QIBD 1ZLUK 2XN9B 5FGBA 1KUMA 5F89B 3CNKA 3L3HA 4NZTL 5DQ9B 3HFMH 5LGHL 3I84A 4G8GE 2ZCHH 1SEBB 2Y06L 3EYFB 4H0HB 2XWBA 2QL1A 4L8CA 2ENSA 2YK1L 3SGJC 4CL7A 4OIIH 2NY6B 1HSAA 3VFWB 1G9MC 2Y7QB 3QIBA 3JVGA 1R5IA 5I1DB 1T03L 4JG1L 3I6LE 1JPST 4TSAL 4P5TD 1QKZH 4JDZB 1ZVYA 1K85A 3W5MA 3UZVB 4NO0D 1JZ5A 5C0IA 1TTGA 3MNWA 4XAWL 2Z93B 2IANB 5F7FA 4EDXA 5I9QB 3SOBH 3EOTL 2I27N 5DMKA 3RX5A 3NFNB 1F58H 2BX5A 3ULVC 3DVGB 3WIFB 3LEVH 4XWOD 3OPZH 2VLRB 4JO4H 2AERT 3QWOB 1EX0A 4XZUA 1CL7I 2OLDA 5C0GA 4NO0A 3GM8A 3RDTC 5IG7A 5K59F 3NFSH 3QDJD 4MS8D 2MHAA 3R4DA 5EBWB 5IFJA 3X11B 3MRBA 4JFDB 4KKAC 3OXRA 2FR4A 1YC8A 3ZKSD 4JFEB 1DCLA 1H15B 3LQZA 4L8DA 5F7MC 5ICXA 5F93C 3DX7B 3DECA 4G6FB 4MXQC 3CFJB 4I18B 4M1GH 2D31A 2IADA 2JB5L 1JUFB 4G9FD 4NRXB 3MLWL 1KGCD 4RFNC 2EDXA 3QH3A 4G6KL 4YE4L 4BQCA 4Q9RH 2BHUA 5D7KD 4MHHI 1RZ8B 3QDJA 4MNHA 4X5WA 3JV6A 1KEMH 4OF5A 4JM4H 4M03A 2GHWB 3EYOA 2EXWC 4HWZB 3I75A 5DMGC 3PV7A 3T4AA 1T4KA 3WJJC 4RAVA 1A0QL 2ENYA 4RZCA 1F4WH 3SDXB 3OB0H 4Z7WF 5EUOB 1OT1A 1Z3GH 2YD5A 1ZWIA 4LSTL 3MACL 2OP4H 4G9FA 4Y5XB 5DHYA 32C2A 5F9WC 1QBBA 4NCDA 1TQBC 4X6DF 4HC1L 3VXSB 1NFDF 3B2VL 5D7JD 4G3YL 4XNZC 2E8ZA 3FMGH 5FUOH 3S35L 3RA7H 4QRUB 1WT5C 3L5WA 3RY6A 1IKFL 3PHQA 1Z9SA 5IMMB 2FZ3B 4LVHB 4WCYH 2ADJB 5DVKA 3L7FB 4DKAA 1I1FB 1JWUA 3GFUA 2OBGA 3KPRE 5GRUH 1ZA3A 2VL5A 3S8WA 3HC3H 4WEUD 5D7JA 2XWTA 2RB8A 4CKVX 1BEYL 2HT2D 4NRYA 1MCPL 1HQRA 3VGHA 1EEYA 2FJFA 4QOKA 2Y72A 5I75C 5C08B 1QYGL 4D8PB 1OAQL 4DGVH 5CCKL 5JW3L 5LQBL 4HWBL 2FB4L 1IM9A 3TIEB 1NCBH 2NY7L 5ETUB 2B4CL 1AO7B 4S2SA 2AJYH 3CDGB 4A2LA 2P7TA 4GG6A 2X4QB 3EO0B 1IQDB 1MWAL 4MA3B 4LPYA 4JGUA 5ANMA 1FRGL 1V05A 2E9WA 4DGYH 1B0GA 1CDCA 4JKPL 4KY1H 2JJSA 2J4WH 4U6YB 2D03H 4XNXH 4M5ZL 2VZUA 5DEFB 2FO4B 1NUFA 1Q9OB 4URTB 3VXOB 1CGXA 1R3LB 2BRRL 3ARBB 5IHLB 4CADA 3AMLA 4KHXH 5BOZG 5AWNH 2X70A 1XF4A 4MAUL 2PN5A 1QEWB 2YXFA 5EN2A 1FH5H 2O5ZH 1F00I 3MGOA 2VISB 3VGFA 5HHMB 2VXVH 1LDPH 1TITA 5J57B 4P2RE 1YECH 1IVLA 5L7XL 1S7XA 3CVHB 3G6AB 4PREB 3ZLQC 2H2PD 3IGAB 5I0DA 2HT3D 5EU6B 5IVXF 1VSCA 2P45B 4KAQH 4LF3B 1T22B 4RDQF 2WWKT 3U2SB 1L9MA 1MFNA 1UVQA 4DGIH 4EZMA 3ILPA 3LSOB 5JNYB 1M7IB 5IBTL 3TA3D 1IC5L 4S1RL 2APBA 2GSGB 4GSDH 3TVMB 1C5CL 1G0XA 1YJDH 3QDMB 4LVOB 4QCIB 3SGDH 5MEQA 5HGHB 3LN4B 4L4TE 2GKIA 1BAFH 3NAAH 2YA2A 3QULB 3SJVE 1UJ3A 2G2RA 2AQ3A 1NCUA 2DI8A 5E8EB 1RSFA 5C86A 1C8PA 3OWEA 1LK2A 1YMMB 4KV5E 3TA3A 5D7IB 3CXDL 1I7TA 3PL6B 1AQDB 5IHZA 1N0XH 3U4AA 2C3GA 1YPZB 3BGFB 5L2KB 1E4XL 3CFEB 3SEPA 1OQXA 4MA1C 2K7PA 1LO0L 2VMFA 4K23L 3RPKA 1RULL 3X3GL 3MRIA 1LEKB 3MCLH 2B5IC 2J5LC 1SJXA 2PTUA 4U1GB 1DQLH 1PG7W 1MCFA 3CFCL 5DD0L 3HI6L 5HYSB 5BVJB 5JQ6H 2NNAA 3DVFA 1UACL 1UKSA 1A7RL 2W0KA 3VWJD 3QIUD 2WUBL 2D7MA 4P4RB 5E8DH 5JXED 3CCHA 3NCJL 4KTDL 3MQIA 4RWHA 5FOBB 1CFQA 1C5BH 4YHOL 2E7LC 3OMZA 5J6HA 2P8LB 3BZDA 3ZL4H 4BQBA 3L9RB 3VG0H 4K07A 3UTSB 3V0WL 5EU4B 3LS4H 2OTWB 1TZGH 3RZWA 4UDTA 5GGSY 1CFSA 3VWJA 3QIUA 3F7VA 4K94L 3DO3A 4OM1L 1CLCA 4LU5H 2X10A 4I5BA 5FGCB 1SBSH 3HNVH 4HJGB 3T3MF 5JXEA 5JR1L 5IR1A 2QHRH 1QFPA 5GSVA 3D18A 4JPKH 3ULSA 1XEDA 1TZIA 3KPPB 3QPXL 4WTWA 3MJ8A 3CDFA 3O11A 5D70L 2DLHA 3NZ8A 3MREA 3H3BC 2BVOA 1CXLA 1IL1A 1CF8L 4D94A 2C3WA 5B3NA 5MHSD 1OP5K 1YDPA 3KXFB 1JNHB 1L7IH 4B5EA 5E94A 1N3NA 5I8CA 2R9HC 3TZVD 3B9DA 1QLEL 4PGCB 2NXZD 2GK2A 4JQVA 4WWKC 4CJ0A 3BZ4B 1NGZB 4ENEC 3BN9D 1T1WA 4KVNL 3BP6B 1GPOH 3QA3A 4OGAD 1U3HB 4JDTL 1Y6MR 4ODXA 1AHWB 1ADQA 1KT2B 1CK0H 4WFGE 5CJXC 3LB6D 3MLRL 1KEGH 5FO7B 1AGBB 4GLRH 2W9DH 3D9AL 4F8QA 2R2BA 1HHIB 3LKQA 4MSWA 3SDDC 1AP2B 3G08A 4HAGA 3TZVA 1IAII 3L3KA 4ZUWA 2D4FA 4I77L 4ZTOH 2X05A 3JTTA 3PWPD 2BNQE 5KN5B 4PTTB 1B4RA 5C0EB 3MO1A 4ZOBA 2VB5A 4LCYA 3VE0A 3ISWA 4Z8FL 1Y0LB 4LARH 3IB4A 2BERA 3VXUD 2BMKB 4YHML 3CX5J 4OLZL 4HUKB 4YEEA 5KSAC 4ZO8A 2EE9A 1PKQE 2O5XH 2VLMD 3BPLB 1EERB 5BOPA 1H0DA 3WNMA 1W0VB 3WFBH 3KPSD 1M6OA 4MCYA 4O2EA 3UC0H 3PWPA 1V5JA 4H8WH 4Z7VE 1ZHLA 4OI9A 3NMEA 3JV4B 5SX5H 3TBVA 5I15L 4TULL 5D2LA 3L3JA 2VITB 1DQML 1HH9B 1WTLA 1V3KA 4H1LG 1NMBH 1S9WB 3Q5YA 4PJDB 4Y4FC 1FGVL 4G6JH 4Y5VC 5F1KC 1OB1B 4EN3C 2D2OA 2OXHA 1ZLVH 3UBXB 1DP0A 5E4IA 1NCAL 3KPSA 3BQUB 4Y4HA 1XGQB 1OAZL 1UH3A 1TJGH 3DTXA 1I3GH 3N9GL 4TPRL 4KHTH 2F54D 5K9OB 4KRLB 2WUCL 5I1IL 4KVCL 3GIZL 4S1QL 2P5WD 3TYGL 2XPGB 3PWLB 2W59A 5I1AA 5I2IB 3VG9C 2YUZA 1RZ7H 1CD0A 3SO5A 2AJVL 5IEKB 1A6ZB 4NNXA 4G42B 1QPPA 3CH1B 3PGDB 4UV4L 1FNEB 4U6HB 1U8OB 4F7TB 2KDGA 3CU7A 5AZ2H 5DHVB 2AI0L 4P2OB 2F54A 1U8NA 4DW2L 2P5WA 3WLWC 5IKCB 2ZUQC 1BZ7A 4X4YB 4MNQD 1KTRL 3C6LC 2AGJH 4LSVL 4NQCE 4X6FA 5TE4L 4CUCA 4NQTA 4PJIE 4FXKB 4X4ZA 2V5MA 5I1CL 2FD6L 4OF0A 4MQXD 3GGWB 4JFZL 1UT9A 3S3PA 3HN3A 1OAKH 2LTQB 1S7QA 2CRMA 2VNCA 3V52L 3LV3B 2I9LB 1NBYB 1OP3K 4UB0H 3K8MA 3UJTH 3BKCH 3TJHC 3HNSH 1UM6L 1A1MA 2UWEA 5ICZB 3QNYB 4MNQA 2W0FB 1NSNH 2BNUB 4XVTL 1RZKC 4N8CL 3T2OA 2ZSVB 4NO5B 4GS7C 3D3VB 4YBLB 4NOFA 2OZ4L 2V7NA 3C2AL 4N8PA 4L3CA 2CKBB 4XPFH 3MLXH 2OSLA 5HHOE 1UA6H 1I3VA 3TPKA 2HFEB 4XC3H 3NCEB 3S4SB 1OGTA 5I19L 3Q6GH 1MCHA 1KTKE 1JGVL 5CFHA 3D0LA 1KTDA 2JB6A 5D2NE 1B4JH 3TO4B 4KROD 4FMKA 4K9EL 5E8NA 4G6ML 3SE8L 3DURA 2QSVA 5EBLB 3EOBA 1HXYA 3K3QA 2AJ3B 1NCDL 4LDLB 3ARGD 2XV6B 4S10A 2XTLA 1D5IL 2AK1H 3UEZA 5LWYL 3VXTB 3O41B 4M5YH 2XN9D 4QWWC 4UQ3B 1OT2A 2WBJB 4XWGL 4LLUB 1D5ZA 2EDNA 3GB7B 1NJ9A 3VGDA 3JWNC 4L9LA 4ZDHB 2VDRL 4K7PH 4AIXA 4JY4A 1E4WL 1OD7A 3BWUC 3GHBH 2NY6D 4KI5D 5I8KL 1HINH 4ETYA 2DAVA 5GRYA 3ARGA 4OFDA 3SQBA 4HPOL 1XFPA 4N1EA 4NC1C 43C9A 3BJLA 3DRQB 4KZDH 3BMWA 1OVZA 4CU6A 1TNMA 1VPOL 2XN9A 5IGXL 4CVXB 3BPNC 4A6YL 1QSEB 5JPNA 1IGYB 5D8JH 5FA3A 1MJ7H 3LOWA 2PXYB 4WY7H 4KJQD 3D39B 5DJCB 1X5KA 4JJHA 4OCXL 3IVKB 1QQDA 2R0LH 2R1YA 2F5AH 5SWSD 3BH8A 1S7UB 4Z95H 1FL3A 3VFWA 3E0GA 4OZHA 5EZOH 3GEWB 5IHUH 2NXYD 2R39A 2D7NA 4PRPB 2UY6A 1Q0XL 5TDPA 5I1DA 2FX7L 2WBWB 4OGZA 2EYTB 3O3AB 5C7XL 4ZFOL 2ADFL 3RU8H 1PG7X 2P47B 2Z93A 2IANA 2PETA 4QRPD 4MXVE 2EH8L 2DDQH 4M7LH 1HKLH 3NFNA 4OIAA 1I85A 3LDBB 2R8SH 3IDGB 5ERWA 1RUML 1YQ2A 5INDB 5ESVA 4X8JB 2FX9H 2VLRA 3QDJE 1INQB 4HXBH 4G6FD 3QWOA 1NEZA 4D0DA 2EDBA 4Z7QE 2K9UA 1F4AA 5IB3B 2N7AA 3CFDB 4QRPA 4UILH 4Z0XB 2R4SL 1T89A 4FQCL 1TTFA 2W91A 4WNQB 5B3JE 1I1CA 3RTQB 3W2DH 4G9FE 4YWGH 3ARED 4HJJH 4PJHB 4LLYB 1I7RB 4JFEA 4KJWC 5KVMC 5D7KE 2OMBA 1L0YA 3CFJA 4YIQA 3RWFB 3VGEA 5ID0B 4NRXA 3MRKB 5JIIA 2F19L 5BQ7B 1G9ML 3O2VL 5B38G 4R0LC 3VXSD 2ZUTA 2I5YH 1HZHL 1TJIH 3AREA 3MXWL 3P73A 3STLB 3SDXA 5IT2H 1ZT4B 4X99B 2CIIB 5EUOA 1YEFH 3MX0A 4U0RB 4HUWB 1A6WL 4Z7UB 4M1DL 1Q9LA 3ULVL 3OKOA 2DMCA 1NGWB 1YN6A 2EEBA 4QOKE 2XZQH 3VXSA 1ZEAH 1ZSDB 2H45A 3QJHB 4HUMB 4RISH 3VI4E 4QRUA 3IRPX 3MSPA 4GG8A 5DYOA 2CLVB 4JZJA 5A3ID 3O2DH 1CR9H 4F7MA 1WZLA 5I1KL 4LCUB 4GG6E 2FZ3A 3ZSTA 3O6LL 4DN3L 2WQ8A 2EDLA 2ADJA 3L7FA 4IIQC 5ANME 2PR4L 5C6TL 3E6HB 3OR7B 1AO7D 4MD4B 4DCQA 4MMZC 2A73B 1ZMYA 3WXVL 5FUZH 1CS6A 3U30B 4AL8L 5JUEH 1CLYL 4PIRF 4OQTL 1ZHBA 1LO4L 2DWDB 3W11D 1LD9A 1HKFA 1KIRA 1BLNB 2DD8H 5EULV 3JWOC 4F80A 3HB3C 1WBYB 3ARBD 1HEZB 3M45A 2WW8A 3ME0A 3TIEA 3VGGA 2UV3A 2EDJA 5ETUA 4IRSC 3ZO0A 1AO7A 4AEIH 3FFCD 4Y5YC 2ARJQ 3CDGA 2X4QA 3EO0A 1IQDA 3QCVL 1MQKL 4V2BA 1RIVH 5KSUA 5KOMC 4PYHA 4ZQKB 3O2DA 4KMTL 1OL0A 1J1XH 3WDIA 3ZTNL 4ESKA 2FO4A 5FAAA 4NJAH 3VXOA 4NUGL 4BZ1L 5GZNC 3ARBA 1U93B 2EIBA