3WHXA

Crystal structure of anti-prostaglandin e2 fab fragment pge1 complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
211
Chain Sequence
b'KVQLQQSGAELVKPGASVKLSCKASGYTFTEYFIHWVKQRSGQGLEWIGWFYPGSGSLNYNGKFKDKATFTADKSSSTVYLELSRLTSEDSAVYFCASHAYDKEPYWGQGTLVTVSAAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mAb Fab H fragment
publication title Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2
rcsb
molecule tags Immune system
total genus 45
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2013-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxA02
4JO2H 3O3DB 4LAJH 3QAZB 4ONOA 2D2OA 3KPMB 5BRZA 5JNYB 3WNMA 1TZGL 4E0RB 3HI1A 2ED9A 1J0HA 5HHQA 5JO5B 4O5LL 2R2CA 3ULVC 1BX2A 4ZFOL 4GW4B 2X41A 3NTCL 4JFDE 2EICA 3RX8A 1CICC 4HFWB 4FQ1H 4KVCH 2OTPA 4Y2DA 4YPGB 5BS0E 1T1XA 2O5YL 3PABB 1IGIL 1WWWX 2C1OB 3BMWA 4URTB 5J3HC 4RWYH 4DN4H 2NW3A 4XRCB 2AK4E 1CD1B 3CLFH 3TYFA 2Y9RT 1U8JA 4TNWF 5JDJA 3OAUH 1T1WB 3V0VB 1CR9L 3WV0A 2MTPA 3C8HA 2WAHA 5C0FA 3GMNB 1FL6A 4G6JL 1S78C 4BKLA 5D5MF 5B3NA 4EKXA 4X7FC 5TDOA 3ARDB 3MPCA 4HCRL 4HGKC 5DJ6A 4UAOB 2R56L 3P30L 4WFFD 4XHJD 1YEEH 4M1CD 1TNNA 2BY2A 3WS6C 2AXGB 1GZPA 3QUMA 1SJEB 3JV5A 1KT2B 3VGDA 1QR1A 2AABL 3HB3D 2UWEA 1MHCA 1CLCA 1K9TA 1VHPA 3C09C 3AM8C 5J8OA 4JFQB 2VXVH 3IJHA 4X9HA 2WZPD 4Z77B 2NNAA 5C0RH 1F3RB 4OLXH 4KAQH 5F88A 4JZJC 1BBDH 4P9MH 2HJKA 4MXQC 4PJEA 4OLYH 1ZVHA 1D9KA 1BWWA 5F89A 2I60L 5EBMB 3MRBB 1QKZH 3BPNB 1ZXQA 4YHKH 1D5IL 3TVMA 3HMWL 1XCTB 4GAFB 4HWEL 5IMLB 3AREB 3VRLF 3MLSH 3QDGD 4P2OA 4C56D 2CJUL 4P9HL 5KS9F 1JNNL 3KJ4C 5D6DC 1J0KA 5ENWB 5HHME 1C08A 1OAKH 1B9ZA 4PJCB 1H5BC 1A5FH 1UZ6E 1AI1H 2Z8WC 5EC1B 1RHHB 5HD8C 3ULVD 5I18H 2OTUB 2BVQB 3R0MA 4TUOB 2R2HA 3BZDA 4ZO8A 5EU5B 4YGAB 2PCPB 3ARGB 5E5MA 5HHXL 2DBLL 3V7MA 4YO0B 1E6JL 1P9MA 1XCQA 1BBJA 3V52L 5HHVL 4CN4A 2C9AA 1KACB 5AG9A 5J3HD 1EK3A 4H88L 5C09B 3DARA 3S88L 2JE8A 5CHNA 1MQKL 1IE5A 3GJFB 1M6OA 4OF7A 5I8KL 2QQKL 1CLOL 4ZUTB 5GGSY 5FUZL 2HFFB 3EKCA 4N90D 4OF6A 4S2SB 1AFVL 1SQ2N 4FQCH 3R1GH 1QEWA 4PJXF 1MCSA 4YGVA 3OXRB 1KB5A 1LP9E 3P9WB 4RAVA 5DTFB 1YEFL 5DQ9A 3QIWA 1EEYB 1J87A 1AQKH 1D6VL 1GHFH 5DI8A 3JWOL 2BNQD 3PGDA 3NVQA 4HBCH 1QHOA 4ZNCD 4YHMH 5KZCD 3L3HB 4OZHA 3GSQB 2OR8A 4FQLH 5KJRH 3G04A 2H32A 3T0BA 2G60H 4L8SB 5CJXA 5DJAA 2BHZA 5I66B 4LHUD 5T5FL 1CDBA 5AD0B 4Y5XB 1FO0L 4CN6A 4PGDB 4PGCA 4NQCD 3A6CL 4H1LA 1CT8B 1KV3A 4LEOA 3JTTB 4HWUA 4WUUB 5FHBL 3KPLB 4PG2A 2IMMA 5T5NF 1MJJB 1KTLB 4LDLB 3SKNB 5H2BB 1CBVL 5D1XB 3QJHB 3VXQB 3P0YH 4JKPH 3REVB 3NCCB 1XZ0A 5D7SH 5FK9B 4I0PD 1BF2A 2Q76A 1OAQL 1U0QA 1NL0L 5HYJA 2XFXB 1Z0MA 2ZUYA 2APFA 4PJGA 3A67H 1FN4B 1FLRL 4QT5A 2XN9B 3QXVA 4KPHH 4FQIL 1YPZF 5HHOE 3CUPB 1F58H 2CO7B 4KHTH 1MH5B 3PWLB 5IMMA 1I4FA 1WEJH 4G9DB 4R9HA 1JZ3A 2ICEA 2DYPD 4CVUA 1N26A 3D9AH 3FN9A 4GRMA 5F7WC 2GJ6B 4PRAB 3TZVB 2UUDH 4NO2A 1IC7H 4NC0B 3QBTB 4QHMB 1J1XH 1IAKB 4JFXA 4KHXH 5T1KB 1MFCH 1FYTB 1L9MA 3SY0B 3KPPB 4QNPF 1IC5L 4FFYH 4PS4L 3BPCA 3CZJA 3NN8B 3FFCA 4MJ6B 3BKCH 4MJIE 1RJYB 3CDGB 1V7ML 3MYJA 3HZVA 2WBJB 3HC0A 4PJ7B 4TPRH 1S9YB 5DC9B 4M6AA 1YEHL 4KMTL 3PQYD 1XF5B 1UWEL 3RWEA 1QACA 3O0RH 3FOLB 1VA9A 2GT9A 4JPIA 1EHLH 4P3CL 5C9JB 1FL3B 4YHLL 1T7XA 4HXBH 3KYKL 4CKVX 4ONGH 1VGKA 2AXFA 1YUHA 3T09A 5ID0B 1X6NA 2Z31A 4FG6C 5L6YL 4DQOH 3QFDA 2AJUL 4KVNL 4N5EC 5DR5H 3RY5A 3LRSB 1AR1C 4HF5H 3RA7H 4JFFA 2FEEI 4HDIA 4PJDB 1MF2L 1ZEAH 2N7AA 2H3NB 4Z7UA 1XAUA 1QLRB 1U8KB 3QCVL 3RWDA 3CXDH 4E41B 3RGVC 5A2LH 1AKJA 3PDOA 4GFTB 2AEWA 2ZCHH 3BUTA 4BH8A 1KEGH 1JWUA 5TQ2L 1PKOA 1RZ7H 4PJAF 2FECI 3JXAA 1S9VB 1EFXA 2BVUA 4L4VD 4HV8B 4ODHL 4NZJA 2VITB 4C57C 32C2A 4JG0H 4MHHI 5EU3B 3RBSA 5C3LD 4ZUVA 2JIXB 1P7KA 2DIAA 2H1PH 3QI9B 4OKDA 5F3BB 4FQXD 4TOYH 2MFNA 1F6FB 4AJ0A 2BFVL 4Z7OE 2BXZA 5I19L 3MRHB 4YWGL 4M43L 3QUMH 3QEUA 2P5WD 2AKRA 3O45A 1GC1C 4XVJL 2BHUA 4CU8A 1EMTH 4LNVA 4XH2B 1I3RB 4G8IA 4IDJH 3VFRB 3HNSH 5BZWB 5BQ7A 1P84J 3PWJA 2V9QA 4X8JA 4OZIB 4QRUB 2IAMC 4RGNC 4EN3B 1W8OA 3UZQA 1RJLB 5CZXC 1UG9A 3LMJL 4XP9L 1RUMH 5IBTL 3S3PA 5I1EL 4MXVF 3CFDB 4LLWB 2VN4A 4XGZB 2A74B 3BP4A 1VEPA 3ARFD 4LQ1A 5HI3D 2V6HA 4WU7A 2GTWB 1SY6A 5JTWA 4OUUB 4I9WD 3GJFK 3EOYG 2C3WA 2D9CA 3OKLA 4OCWL 4R2GB 2ZCLL 1H3WM 1XIWB 4OF5A 2IQAA 1IAOB 4ENEC 4NSKA 2CIIA 2E9BA 4PJ9C 4QRQB 1J8HD 4UILH 5E9DB 3KHOA 3GKWL 1BOGB 3ZDYE 1NDGB 5CJQH 1ACYL 4NBXB 4NO3B 2NQCA 3TIDA 3V5HA 5C0GB 5BJTA 1D3CA 4GKNB 3WFZA 3ARVA 4JFPB 2R2BB 3OAZH 2W0FA 4LPXA 4NO5A 2WIIB 5I1HH 4RFNC 5GGTL 4HPYH 1A1OB 1BIIB 4X6FA 5E4EC 5C6TH 4LASH 2B5IB 5FGRA 4KZDL 1DQLL 3RGVD 1L6ZA 2VZOA 1HXYB 3CJJA 4PUBH 4TN9A 2HJFB 2QQLL 1WGOA 1YMHB 4XNZB 1CGXA 2CIKB 4XWOC 1LGVA 2V5SA 4Y4FD 1BZ9B 4FNLL 1R5VB 4JHWL 4RIRA 3QQ9D 2I07B 4TQEL 4UT9L 4GAYB 4IHOA 1ITCA 3K3QA 4WRLA 4PJ5E 5KAQF 4HS8H 5ERWA 1U8HB 3MOQA 4U6YA 3MRJB 3QUYC 2H32H 4Y16C 1OTTC 5J13C 2DLIA 5CEZE 2OMBA 1J0YA 5JDSB 4ODUB 1UWGL 1DDHB 3W5NA 1MRDL 1EEZB 2HVKB 2JELL 3BWAA 3D87B 3ULSB 2ZUQB 3BP7A 1FIGH 4LCWB 2IAMD 3TCLB 1LNUB 1PLGL 3WFCL 5C0DA 1QRNA 4UBDC 3GK8H 3FQUB 1QQDA 1I7TB 2E27H 4APQD 3ZSTA 1ZLVK 3E0GA 2PXYC 4L3EE 1NAKL 1CXLA 2R4RL 7FABL 5E1AA 2G5BB 3D85B 2X10A 2I24N 1OL0A 3VXSB 1FVCB 4F57L 1OTSD 2WP3O 4MD0B 2RR3A 5F6IC 1LD9A 2EDDA 3KPOB 5L2KD 3LKNB 3L1OH 2CDFB 2OYPA 1R3HA 4LDOB 3OKYA 4J3SA 3VH8B 1JK8A 1O7VA 1KNOA 3TNNB 1YMMA 4PRHD 1IM9D 5I1KL 3LPWA 5IOPA 4M9PA 4LARH 5A2FA 3X12A 4RCAA 1ROWA 1TQCC 4XP6H 2R1WA 4OFYD 4WW2B 1T6WA 4TSBH 2W9DL 1MCDA 3OKDA 4EXPX 2E6JA 4N68A 4XVUC 4TUKL 2DIBA 4ALAH 2VXQH 5JQ6L 2BNUB 4HK0B 1A47A 4JO1L 5EBWB 3T0EA 2E5EA 3L5XH 3QZWA 3OGCA 4LVHB 3VXTA 1DN0B 1BVKB 2G75B 1IC4H 4DZBA 4L4JA 3W9EA 2F74B 5ESVA 3BH9A 1A14L 4MXWL 5EORH 1OGAA 1QFWM 2X1XR 4NIKB 5HHNA 2OK0H 4PJBE 1WAAA 1PKQA 3L7FB 2DMBA 4FQJL 3SDXE 3EHBD 2FX9H 3KXFB 43C9A 4Y8DC 1JRHL 4LLYA 4EUPB 1QFWI 4EI5B 3B3IB 4UBDD 1NBYA 2NY2B 2UZIH 3DV6A 1YNTA 4Z7QE 1U3JA 3STLA 5TPWH 3TGXA 2BNRD 4XX1G 3OJ2C 5JORA 3RUGA 3EYQD 2FZ3B 1R3LA 1JHLL 4S1QL 5SWSB 4PJ8B 1KENH 2GQHA 1FGNL 3IYLW 3VGBA 2KKQA 5SWZB 1MFBL 3O3DA 4L4TD 3KR3H 2R29L 5I15L 4PD4J 3KPMA 5JNYA 4MS8C 4E0RA 1FRGH 4GO6B 2E7CA 3IJSB 1Z9LA 1JPFB 5JO5A 5D5MB 4KI1A 1I9JL 5DD1L 1BPVA 4GW4A 3I3EA 1ITBB 1UCBH 4HFWA 1T66D 3BIBX 3M07A 1RZJH 4YPGA 2W0KA 4A2MA 3PABA 5FGCB 4LQFH 5CBEB 4XVUD 3T04D 3H7LA 4XRCA 1EVUA 1CD1A 3EOTH 4MCYB 4C54A 4OGXL 4R4FL 3BD5A 2WWKT 1T1WA 3V0VA 3ZTNH 4P59H 5CLTA 3GMNA 1KJMB 4UINL 3MCLH 1MJUH 2HT3C 4N9GB 4MLSA 3CH8A 1R0AH 4BQ8A 2NX5E 4FRWA 5SV3A 5F8QC 4WGWB 4KJWC 3ARDA 1SY6H 1TVHB 1MAKA 5KS9B 4HMEA 5L88H 4Z7WE 4OBSA 2AXGA 5T1LB 2BCKB 1SJEA 2P42B 3QZWG 3KJ6H 1KT2A 3JTSB 3GBML 3V8CA 4ONHB 4P3DB 5EIIB 2X4NB 4JFQA 4Y0GA 1QVOB 2W07A 4Z77A 1YEKH 3UTSE 3FRPA 1UM4H 4IIQC 1CCZA 4P5KB 3MV8D 1MFEL 1I1RA 2NR6D 5EBMA 3MRBA 3U9PH 3LS5H 3RVUC 5IMLA 3FQXB 1G9NL 1XCTA 5TGBB 1IBGL 3AREA 3WEXB 1E4XH 4OQTA 3WFDH 3GM8A 2GFBB 1KJ2B 2IBBA 3VJ6B 1NCCL 3P0GB 2WV3A 1T22B 1H3GA 1KTDB 2DQTL 1HQ4B 3V5DB 5ENWA 1N64L 1EERB 4PJCA 5K9KB 2QL1A 4PJXB 2EXWC 2P5EB 1XR9B 1RHHA 5EC1A 2VDQL 2OTUA 2BVQA 4ODSH 4UTBL 4TUOA 4BQCA 2VE6B 2OI9C 2EYSB 3V6FB 5EU5A 3B4NA 2PCPA 2FJFB 3ARGA 3GIZH 4H0GA 4HWBA 4JO4L 1CGWA 3MUY1 1UYWH 4YO0A 1F6AB 4ZDHB 3MRFB 4M93B 1JGLL 2V7NB 3QPQD 4WVRA 5ADOH 5HY9B 5J11B 5C09A 3MR9B 3EBAA 4NQDE 4CDHA 4PLJC 4WHDA 4B0MM 1Z9SA 3GJFA 5FIEA 1CL7L 4KRLB 4NBZB 4ZUTA 4YHYC 2E9JA 1P6FA 2ESVD 2HFFA 4S2SA 1MY5A 2J88H 4WI3A 5D72L 3GM0A 3BESR 3OXRA 4POYA 4HUNB 3UJJH 2HT3D 5DTFA 1DBJL 4M7JL 4Q6IA 4Z0XB 5I0DA 1G6RB 1QOKA 4FFZL 1EEYA 3DSFL 4N8CL 4LSVL 4XNMB 1N0XL 4U1GB 2LTQC 3CZFB 1A3QA 5L0QB 3ZKXB 3L3HA 1P69B 1G9MC 3FQTB 3RZCC 1BJ1J 1N4XH 1GRWA 4KK8D 3I50L 5FYKH 1EO5A 2E6PA 5CGYD 4L8SA 1J8KA 1J1PH 4NC1C 4H5SB 1UEMA 3KPSB 4HHAB 1YPZB 2NZ9C 1G7IB 5I66A 3RVWC 3VMNA 4OFVA 4U1SB 5AD0A 4Y5XA 4D9RD 2W91A 1QNZL 1AY1H 4OZFG 1FSKC 1CT8A 4Y5YC 1KYOK 1LK3H 3JTTA 4KKCD 3RVUD 3QPXH 4WUUA 3KPLA 1MJJA 4OLZL 1KTLA 4Q58C 1OP5K 3SKNA 5H2BA 4ETQB 5D1XA 1KN2H 3QJHA 3VXQA 1MCOL 3REVA 2FHFA 5FK9A 4ZTPH 5F72S 1GJIA 1JZ8A 1MCRA 2XFXA 3Q5OA 3FRPG 4ONFL 4GG6F 2YN3A 1FN4A 2R9HC 1DVFB 2XN9A 4HJ0C 5F71A 4O02H 5EWIL 4PJFF 1E4WH 1X5LA 3NCYP 1TJHL 3CUPA 5DRNB 1QBML 5FGBC 1MH5A 3EJYD 2ID5A 4G9DA 1MWAL 2VB5A 3DRTA 5I16B 1CQKA 2Y6SC 5MI0B 4PIRF 1NFKA 5T1DL 1UB5B 4Z95H 2WBJC 3M45A 4PLJD 2GJ6A 1U8OB 3MV9B 4PRAA 3TZVA 4JHAL 4K3DH 4QHMA 1FCCA 2R1YB 5DZNA 1IAKA 3IAGC 4BA8A 1NGWB 5T1KA 3F8UB 1FYTA 4YBLC 3SY0A 3KPPA 4OSUL 4X6CE 3NN8A 4AG4L 3NCJL 1JMZA 4MJ6A 3OB8A 4QHUB 1RJYA 3CDGA 3RIAF 4KRNA 2WBJA 4PJ7A 1S9YA 4LOUD 3OAYK 1EZVY 1S9XB 1RQ5A 4NJ9H 3H9HB 1X5IA 2HTLC 4O00A 5JMRA 2W38A 3OTTA 1XGTB 5GRYA 1XF5A 2ZWLT 1FNGB 3F65A 4NM4H 3FOLA 3FFDB 5DHXB 2KUTA 4PJAB 5C9JA 2O61B 3BKYH 1U8NB 1FL3A 3BFOA 4KRPC 12E8H 3RAJL 2E6QA 1GYAA 3MODH 5FCUL 4NYLB 2KZ1B 5ID0A 3WCYA 1YECH 2HT4C 5LQBH 2B2XL 4NQUA 1KCSH 3LRSA 4XNXH 1WFTA 5A2JH 1MSPA 4CGTA 4PJDA 3U1SH 2A9NH 3JWDC 2H3NA 4TULL 3ALWA 1QLRA 1U8KA 1C16B 4JCMA 4E41A 4WFFE 1NLBL 4J6RH 1IAIL 1SBSL 1WJ3A 4W81A 2VDMH 5K9QI 3LB6C 5C0AD 4X9FA 4Z7NE 3DLQR 4U2ZA 3W2DL 4YQXL 1SEBB 1S9VA 3KWWB 3LIZL 2FJGB 4GXVH 5IB1B 4KI5D 3T3MF 4LKCA 1P2CB 4HV8A 3FMGH 3UTTD 1EZVX 2VITA 3MREB 4EZMA 1BD2A 5EU3A 1J05B 2JIXA 5I1CH 1BECA 3QI9A 5F3BA 3HFML 4NPYB 5EDXA 3TBWB 2OLDA 1KXQE 4JR9L 4OZFH 1KF9B 4M1DH 5BVJB 3MRHA 2HKHH 2OP4L 2P46B 2YKLH 3QDGE 4FFWD 4C56E 3IKCB 4XH2A 1I3RA 5LCVH 2EEDA 4H26B 4MVBC 4ODBD 4X4MA 1NGPL 3VFRA 5BZWA 5KVFL 4OZIA 4QRUA 3HC4H 4EN3A 4YR6B 2MPAL 1RJLA 3ULVE 4UNTA 3CFDA 1L7IL 4LLWA 4XGZA 5TE4H 2A74A 4GRWH 2HTLD 2GTWA 3OX8B 4NQEB 3A6BH 4OQTH 4OUUA 1NUFA 1LO0H 5DEZA 3RVTD 3RFZC 2AJVH 5AZ2H 4RDQG 1XIWA 1UZ6F 1IAOA 1HKLL 1Q0XL 1ZT1A 4Q97A 4QRQA 3HAEB 1XT5A 3OPZH 2O93L 3QDMB 5E9DA 3BQUB 1BOGA 4N90E 1NDGA 5C0GA 4NO3A 4XNZC 4GKNA 3WIIL 5E99L 4JFPA 4WO4D 2R2BA 1PY4A 3UYPA 3MV7D 2WIIA 2YK1L 1IEAA 3S96B 3B6SB 1A1OA 4M03A 1I9RH 4F58L 2BNQE 4HPOH 3RVXD 4CMHC 1X4ZA 4XI5D 3STBA 3TJEH 3U4BH 3BOVA 1HXYA 3GSWB 1KOAA 4HS6B 1MI5B 3BH8B 2DKMA 3EDEA 1YMHA 2ZPKL 3S3SA 5F9JB 2CIKA 4JFEB 2P8LB 3CAFA 1PSKL 1BZ9A 1R5VA 2J12B 5FFLA 3BISA 4C59B 2I07A 4K3GA 4OCSL 4GAYA 1KELL 4BSJA 1K8IB 1WIOA 4NQCE 4DVRL 4G5ZL 2XY2A 1U8HA 3H42H 3CGTA 3MRJA 4ODVL 5D7LB 1JHKH 3UZVB 4PG9B 1KIUA 4D3CL 4AM0B 3BZEB 5JDSA 4ODUA 1DDHA 4IOIB 4JQVC 1S7TB 3ULSA 1EEZA 2HVKA 4JM4L 3I3DA 3EYSL 5T3ZH 2KQNA 4X6EB 1INDH 1LNUA 3CFJB 4I3SL 2R4SH 4PRID 3FQUA 4L9LB 3O11B 5DHYB 3O9WB 1I7TA 4KJPC 5JIPA 4HC1A 5E24E 3SN6N 1I75A 3AMKA 2AW2A 2JF1A 3HMXA 4OLWL 2G5BA 5IVNA 3D85A 4PY7B 2MSPA 1TFHA 3DMMC 3LQZB 3QG7L 1FVCA 3T0XA 1I9IH 4R26L 1T20A 3THMH 3O8XD 3RHWK 4MD0A 3TH4T 2OR9L 1YDPB 3RY6C 1HSAB 3KPOA 4LCCB 3LKNA 3H3PH 4QTHB 2CDFA 5AAMA 1U8IB 3CSGA 3B2VH 4D2NA 1CVSC 2DWDB 3I75B 5AG8A 3VH8A 2FB4H 3C5SB 3TNNA 1DBBL 1EEQA 1ADQL 4U1MB 3C5JB 1JIBA 3JV4B 4WI8A 1IKNA 4WW2A 4LU5H 1C5CL 5GRXG 5C0CD 3PQYE 2BVYA 1JN6B 2ZJSH 4XMKL 3CDCA 4YDKH 3I2CL 4DFIA 1J1OH 3CX5K 3MRPB 4D0CB 1CU4H 2ZKHL 1J18A 3ZYJA 5GS0D 2BNUA 4KXZH 5KW9L 4HK0A 3ARYA 5EBWA 3IETB 3L5WB 4LSDA 4QHNB 1DN0A 1BVKA 2G75A 4NWTH 3W0WB 1TPXB 4MB5A 1DZBA 5B4MD 4QWWC 5LGJB 5E8DH 3T1WA 2F74A 3NABH 2FX7L 3NAAL 1TJIH 4IOSD 3PJSB 3H9SB 1YQ2A 1UXSB 3DV4B 4MAUH 3CMOH 3H8NA 5CILH 3L7FA 3LPGA 3KXFA 3MUGB 4QHLB 5B22A 2P43B 4EUPA 5J7CC 1BQLH 2FIRT 3IKKA 1LEIB 4K3JL 4EI5A 3S35H 3B3IA 1JYNA 2YUWA 2E3VA 1BMGA 1HDMB 2P1YA 3SGJA 4RNRB 3SKJH 1U6AH 4TSAH 3FB8B 2HH0H 4L4VE 5K59E 2X9YA 4I0KA 5F8RC 3MXVL 2FZ3A 3MBXH 4PJ8A 3R06B 5SWZA 2ZP0T 4XP5H 3FB5B 2DD8L 3EO9H 4MDIB 2WUCL 5I1GH 2P5WE 1T04B 2GTZB 3PP3K 2A1WL 3O6KL 3JWDH 2WANA 5DT1L 3O4LB 1PVHA 3IJSA 1JPFA 1RUQL 5D5MA 5HI5D 3MZTA 3TF7C 3V4UL 4OLUH 4Z7OF 3WJLC 5E2VH 3MLZH 1KPRB 3VRJB 5D1QB 5F9DC 1VSCA 4P46B 1KULA 2I9TB 2EECA 3N85L 5CBEA 4I9WE 2VDOL 1A7QH 1X44A 2C4FT 3VH8G 3V4PH 3OB0H 4LSTH 3WN5B 5D2NB 4IRSB 1JNHB 4OB5L 1ZVYA 3D6GA 3SO5A 1J8HE 4JZOB 1KJMA 4JN2B 4N9GA 5BRZD 3QCTH 1SYSB 5DD0H 2QSCL 2YZ8A 3HE7B 4NKIH 5FM5O 4GSDL 1AHWC 4ZTOL 2Q8AH 2NY6C 2CR6A 1ZHBB 4PGJA 1J88A 4RFOH 4JO3H 1XGYH 1JUFB 3Q0HA 5KS9A 4I8DA 4C4KT 2P45B 5T1LA 3GDBA 2BCKA 3NZ8B 2DLTA 3JTSA 4Y2DD 1ZS8B 4ONHA 3VFSB 3V95A 4P3DA 4LFHG 5C08D 2X4NA 1D5MB 3K8KA 3ZDYF 2A77L 3UX9B 3UYRL 2DQIL 4YHOH 3OKOB 1QVOA 3HR5B 4P5TC 4YZFF 3O3AB 1MJ8H 5E00B 5D7JC 2BX5A 4P5KA 4PJIE 2UZYB 2DQEL 1ZT7B 4N0YH 2QADB 1DE4B 1OLLA 3FQNB 3FQXA 5TGBA 5IBLC 3EZ8A 2BP3A 2EDEA 3WEXA 1A0QL 2GFBA 1KJ2A 3VJ6A 1VFUA 1T22A 3EUUA 1KTDA 3KS0J 1HQ4A 3V5DA 5CSGA 5K9KA 1CFVL 2ATKB 2EC9U 4PJXA 5IKCA 1IFHH 3HS0B 2P5EA 1XR9A 2Z4QB 4MA7L 2NXYD 4UIKH 4YDLB 1BEYH 1UM5L 2VE6A 2FLBT 2EYSA 3V6FA 4MA1C 3RWCB 4I2XB 4HUVB 2FJFA 2Y07H 2YMXL 3VFGH 2F54B 4RISH 4JM2F 1F6AA 4ZDHA 4IMKA 2ZOKB 4DCQB 3MRFA 4QO1A 2V7NA 3BMVA 4TUJB 3MMEB 5JUEH 1G1CA 1TETL 4N0FB 5HY9A 1WBYB 4X5WB 3ZO0A 3MR9A 1D9KD 4MB3A 4LSPH 1DSFL 4QTIH 3WKML 4W4NA 5L0QC 3TVMD 3QNYB 2NW2B 4ZNEE 3KLHC 5I8OL 2ZCKL 3T0VA 4P2OD 5L2KE 4HC1H 3CXHK 4KKNA 5FAAA 2BVTA 1LMKA 1ZGLB 3GBNL 3U2SB 5A2IH 1SBBA 3OR7B 2GKIA 5ABDE 4KY1L 1WWAX 4Z0XA 1G6RA 3LCYA 1JWSB 3P9MB 1K4CB 1Q72H 3HMXH 2QEJA 4PRHE 4WWKB 4XNMA 1ED3B 3JWNC 3ZE0E 4Y88A 3RP1A 3FQTA 1MHHA 1PY9A 1QSFB 5FV2A 3MQIA 3L3KA 5J1AB 4GG6B 4H5SA 4ZSOE 3VWKB 4X8XA 3KPSA 4PJFB 4HHAA 5DUML 1YPZA 4DAGL 1G7IA 5ANME 1T2QH 1XH3B 4U1SA 4YNYB 1FVEB 3P73B 1NEZB 2Q8BH 3FT2B 5I30L 5MERA 4P23B 2HT2D 5M95B 4J4PC 3QIWD 4ETQA 1YN7B 4P2RB 3AY4A 4UI2A 4M7LL 3U83A 2VXSL 3TFKC 5ITBH 1S7XB 1CE1L 5EOQL 4OCYH 4G6KL 1KLFA 5HYQB 1OVZA 4EBQH 4KJQC 4W4OA 1DVFA 3WUWG 4BUHA 1TJGH 2YR3A 4NC2B 2FCBA 2PR4H 5DRNA 5IF0B 2BNRE 1NANH 1VPOL 1T4KB 3SDXF 2F5BH 3QQNA 5I16A 2ZG1A 4YJZL 3IDXH 1UB5A 2LVCA 2XTJC 4CBPA 4IRZH 5FCSH 1MCEA 1U8OA 3MV9A 3JV6A 3Q1SL 3OV6A 1I1AB 4L4TE 2R1YA 1JYVA 4NQXB 4RSVA 1NGWA 4Z7QF 5A43C 1ZT4B 1S3KL 4JFDB 4JO2L 2ZNXA 2D7MA 2RBLA 4QHUA 2OM5A 3AS0A 2DIJA 5HYJD 1MWAB 1GOGA 3VD7A 5HDQH 1F00I 5KN5B 1S9XA 3H9HA 4GKSB 3ROOB 3VI4F 2AK4B 2CPCA 3NFSH 2X7LB 4F15B 1XFPA 1XGTA 2YD5A 1VADB 4G8EB 3WJJC 5F7LB 5HPMB 1VACB 5T33H 1FNGA 3FFDA 3N1GC 1DJSA 4PJAA 4FQ1L 4KVCL 2O61A 2ARJQ 1U8NA 3N50A 5F9WB 4OM0H 4OFPA 1KLGB 3MFFB 3G5YB 4NYLA 1FIEA 3X11B 3MGOB 5T5NG 4DN4L 1PJ9A 3DUUB 5INCB 4F2MB 1B6UA 1AC0A 3WJJA 3CLFL 4NRXB 1UENA 4M7ZC 2ADGB 3OAUL 4OM1H 1C16A 2EZ0C 2XOTA 1IKFH 4YUEL 3RU8H 5IWLA 3BN9C 1YEEL 1SEBA 3ZYOA 3KWWA 5IB1A 2FJGA 4WWID 3F7YB 4JFZH 3WDJA 1KPUB 4G9FD 1R3IH 3BDYH 3QWRA 3MREA 1J05A 1HILB 1KB9K 4JLRB 3NPZB 4NPYA 2B4CC 3TBWA 5CD5D 1XGUB 3MV8E 4Z7WF 1V8HA 2Z31D 4PFEA 5BVJA 5C0RL 4OLXL 2JJUA 4KAQL 2XTJD 1BBDL 4P9ML 3EO1B 4OLYL 2NLJB 3ILQD 2WLZA 5BW7A 4YFDB 3IKCA 4ORZC 5CEXB 1G0DA 4H26A 1QKZL 4JPWH 4YHKL 3MLSL 1RY7B 3H9ZA 2QQNL 4YR6A 4UT7H 3QYCA 2R56H 3UDWC 5IJKC 3IS1X 4IEFB 1OAKL 1JZ7A 1A5FL 3Q6FB 4FQHB 1DBAL 1AI1L 5E6YA 3OX8A 4NQEA 5I18L 4OFDA 1EFXD 5EOCH 1KJ2H 4WTXA 1RK1B 1ZHLB 1RFDH 3QSKB 1O0VA 3L5IA 3UAJC 3C6SB 1E27B 1VGEH 3EO0B 3HAEA 3T4AB 4NUGH 3QDMA 4P4RB 3BQUA 2ESVE 4YK4B 2IPKB 5IVXB 3CX2A 3MGTA 2H9GB 3S34H 2I9LB 3Q6GH 2DM2A 3B6SA 3S96A 1JNNH 5EU6B 3R1GL 1EGJL 1T5WB 4PBWD 3GSWA 3OKEB 1MI5A 1AQKL 3BH8A 4DN3H 1A6TB 5KTEH 1GHFL 1U95A 1WCQA 3QDJD 1JZ2A 4HBCL 5F9JA 4JDVB 3MRCB 4M62H 4JFEA 2P8LA 3JBG7 2RHEA 4YHML 3U30C 3SE8H 5KJRL 2H8PA 3UP1A 1G6RH 3ALPA 2K9UA 2AK1L 5I9QB 5GGTA 1MUJB 4POUB 5EPMB 2G60L 4D9RE 1K8IA 5CBAB 2NY0C 5BVPH 1H3XA 5CSBA 3VRIB 2A6DB 3IT8D 3N1MC 5D7LA 5FUZH 4PG9A 4R7DB 1I9EA 3MCKB 4JFHD 4AM0A 4HKJB 4M5YH 1JZ6A 3BZEA 4PREB 3VFNB 4IOIA 1S7TA 3OL2A 2CKBB 3PHQB 1E4KA 1K6QH 5HHOB 4OIAA 3CFJA 1H9VA 4L9LA 5DHYA 3O9WA 4M3JA 2NXZD 1PD6A 3P0YL 4JKPL 3ULUD 5D7SL 5F97E 2JCCE 4NOFA 5C71A 2B1AH 3QIUB 3QQ4B 4P3WA 3LQZA 3AS3A 4KPHL 1X7QB 1IQDB 3U48A 1PZ5A 2X89A 1F58L 1YDPA 4YBQD 5T5FH 1HSAA 3KDMB 4KHTL 4LCCA 1WEJL 4QTHA 4MJIB 3DGGB 3Q3GB 5SX5H 3A6CH 1U8IA 4HKBB 3I75A 1S9WB 2DWDA 2CLVB 2EC8A 3C5SA 3D9AL 2DRUA 3PWVB 5J1TC 1QP1A 1IC7L 5B21A 5T3XL 4U1MA 1GPOH 1J1XL 2FATL 3C5JA 4XP4L 4C83A 4KHXL 3O6LH 3DSNA 3JV4A 1MFCL 3GMQB 1QRND 4JQIL 4XC3H 1KJ3H 5C86A 4YFLI 3QIBC 4FFYL 4ISVB 1CFTA 4BH7B 2FBOJ 5HVHB 4G42B 3LAFA 3HAEG 1IGFH 1JN6A 5C0IB 2XRAH 4U31A 4TPRL 3TESA 2XA8H 4KTDH 3MRPA 4NZDA 4D0CA 5KAQG 1AH1A 2NY1D 1OQXA 1I3GH 3MBEB 3TC9A 3IETA 3L5WA 4YHPA 1NSNH 1CG9B 4M7KH 3CVIH 4QHNA 2AXHA 3O0RL 5IHBA 1EHLL 1AJ7H 3W0WA 1HYSC 4NZTH 2NY0D 5LGJA 4LIQH 2Z93B 4HXBL 4ZFZB 4ONGL 3PJSA 3H9SA 5GJSH 4MNQB 2DL9A 1OW0C 4FQ2L 1UXSA 4AMKH 3VWJB 3MUGA 1IC5H 5DR5L 4QHLA 4OIBA 4HF5L 1F4AA 4QGTA 3RA7L 3VI3E 2ORBH 1LEIA 1ZEAL 4WEBL 1FAKT 3SO3C 5C0AE 3BW9B 3S35X 1WFUA 4U0QB 3CXDL 4FP8H 1PAMA 4HLZG 1HDMA 2ZCHL 4RNRA 5KSAB 1SJVA 1ERNA 1KEGL 4FHBD 4KI5E 1NCAH 3FB8A 1RZ7L 3UTTE 4RWHA 1NC2B 2AGJH 1J0IA 2AQ3A 4Z7NF 3FB5A 2VRAA 4JG0L 4MDIA 1WLHA 1T04A 2GTZA 1T6VN 3VFPB 2H1PL 4NCC1 3LRGA 2FD6H 3CSYB 3MFGB 4TOYL 3TT1H 4GMSL 2AJUH 4KVNH 1OGAD 4ZXBB 2PUQT 3O4LA 3QUML 3RIFF 1EMTL 3QXDB 3WN5C 2Y06H 4IRSC 1BWMA 4Z76B 3HNSL 1KPRA 3TBYB 1NFIB 5D1QA 3VRJA 5JXEC 3ZT5A 4P46A 5IK3B 3ROLB 2I9TA 3AAZB 4K71B 1P7QB 1RUML 2CRYA 3DO7B 4DEPB 4PRNB 2VDLH 3WN5A 2AXJA 1G7QB 4KK9C 5D2NA 4ODHH 5FA4B 4IRSA 1JNHA 3TWCH 4CMMB 3X3GH 3ULVF 4S1SH 1C5DA 3EGSA 4JZOA 4R0LB 1HYSD 4JN2A 4R97C 1NUDA 1T0MB 1G7MB 1SYSA 2Y1VA 4TRPH 3HE7A 1FZOB 2EEAA 5DVOA 3B5HA 4UILL 1ZHBA 3MV7E 5J12C 1B4JH 1JUFA 5CJQL 4Y4KB 1RZGA 2HP4A 3TJHD 3QDAA 1FP5A 1JHTB 1IJ9A 3HAEH 3NZ8A 3KYMB 1UM6H 3VFSA 3MLRH 1ZS8A 3ESUF 5IB5B 4HPYL 1D5MA 4LASL 4PJ5B 3OKOA 3HR5A 1JP5A 4OGYH 3O3AA 1HWHB 4L3AA 4PUBL 3DROB 2JJTC 4JM2B 2DQHH 1EPFA 1LO5B 3KVQA 1ZT7A 2ZCLH 1DE4A 4MX7B 3FQNA 2VLJD 5CS7A 1V3KA 3NMEA 1QTYT 4M7LT 3ARDD 2UY7A 3W9DB 1IGYB 4WNQB 1N59B 2ATKA 4HS8L 1L7TH 5D71H 2Z4QA 1IGJB 3TA3C 3EJZD 2XZQH 5DJYB 5GGTH 2BRRH 2R69H 4PRIE 3LHPH 3RWCA 1PBYA 1DQLH 1FH5H 2KL6A 4HUVA 4HLZH 3ZKSD 1FIGL 2F54A 2X1QA 5J9PB 2ZOKA 3DETC 4DCQA 1U41A 4TUJA 3MMEA 4R90H 2E27L 4N0FA 5JA8B 1WBYA 4X5WA 2OX5A 1JGEB 4WWKC 4TQEH 3UTQB 2PTTB 3D0LB 3QNYA 1AXTH 4NBYB 3ARED 1CGSH 4DGYH 1ZGLA 3U2SA 5B3JE 4HIXH 1PZUB 2IGFL 2Y36H 3OR7A 2NY3C 4K8RH 3P40A 3O6MH 4BUGA 1JWSA 3P9MA 1K4CA 1J7VR 1B4RA 3L3IB 4X9IA 1ED3A 5DA0B 4RRPA 4ESKA 1L6XA 4DTGL 1QSFA 4KQ4H 5C0CE 4MHHG 4LARL 5J1AA 4XBGB 4GG6A 1XF4B 1D5ZB 3GMLB 4XP6L 5GRJH 4MNGA 4TSBL 3VWKA 3NACL 2X4PB 4WEUD 4PJFA 5C09D 3OHXB 3NCBB 5D70H 1XH3A 4QRTB 1FVEA 4U3CA 4YNYA 3P73A 1NEZA 5CJBA 3IVKB 2A83B 3FT2A 2FWOB 4F57H 1ZLWH 3WL9B 4ALAL 2VXQL 3U7AA 5KSBF 3IDJB 2C3VB 5INDB 4P23A 1JL8A 4MAYB 3L5XL 1CD0A 1X5GA 2K7QA 1YN7A 4P2RA 1IEBB 1IC4L 2X1OA 2Q20A 3ZSSA 2PW1B 1MRFH 2RJMA 4WFGD 2I5YL 4NWUH 1S7XA 1OSZB 3RY4A 2XTLA 1ZLSH 5EORL 4Z9KB 5HYQA 5TQ0H 2OK0L 1BREA 4K23H 5C0NC 5I6XC 2FX9L 4NT6B 3ZHLA 2W9DH 4G7YH 1HH9A 1BQHB 3IFNL 5IF0A 5DK0B 2J1KA 5T3ZD 4PLNC 1T4KA 2UZIL 2Q3AA 4AEHH 3KLSA 5TPWL 5FKAB 1Q94B 1VCAA 1I1AA 4WUUD 2OXHA 4IJ3C 3CVHB 1KENL 3SGEH 1ZT4A 3HNTH 4Y4HC 4JFDA 1A6AB 5D1XD 1H0DB 3TIEB 2NY4C 2B8OT 3KR3L 1T7ZA 3O3BB 1MWAA 3QCUH 2XY1A 3V7AG 3MNVB 5KN5A 1FRGL 4YFLF 4GKSA 3SDDB 1UH2A 3ROOA 1FE8H 2XN9D 5GXBB 2X7LA 3O3EB 1VADA 4G8EA 1TQBB 1U93B 1VACA 1W8NA 2F5AH 3ZKNC 5IHUL 1UCBL 3MRIB 3G9AB 4KTYA 4PP1D 1Q9LB 1RZJL 2DTMH 4NKQB 1KLGA 3MFFA 1PX3A 3G5YA 2ARWA 2NX5B 3IRZA 3X11A 3MGOA 4LQFL 3DUUA 3LEYL 6FABH 3TZVD 4HS3B 4NRYB 5INCA 4F2MA 4HGWB 1FGNH 3ARBC 4RRPG 2OTWB 3EOTL 4NRXA 1FC1A 5BRZE 1FYTD 4N1CA 2ADGA 3MOAH 3IB4A 1VEMA 3ARZA 3H3BC 4J3XA 3ZTNL 4P59L 1A1MB 1I7RB 1R0AL 3MCG1 3OR6B 3QEGL 2KH2B 2VAJA 3V0WH 3ARWA 1SY6L 5DD1H 3UTSB 4AIZB 2P47B 3N9GH 2DKSA 5IB2B 1MCWW 1U3HB 4M6MH 5JHDB 5IHLB 5L88L 5C08E 5E1HB 3OBAA 4OJFH 3F62A 1RZKC 2AEQH 2HRLA 3D69B 5JIHA 5BV7C 4U1LB 1KPUA 2EKJA 5CFHA 3KJ6L 4WTWA 5DDHB 1HILA 2AQ1A 2FEDC 4WGVB 4JLRA 2N56A 2K1MA 1AD0B 1XGUA 1SM3H 4U1NB 5E6IC 1YEKL 4GBXD 1IAMA 4LVEA 3V79C 2YBRB 3EO1A 4LBEB 1UM4L 4TTDC 2NLJA 4HIEB 2PYFB 5C6PB 5DMKB 5CEXA 4NNYB 3U0WL 3U9PL 4KROC 3LS5L 1JPGB 2YZ1A 1D6EB 4E41D 3NH7H 1E4XL 3WFDL 2J6EA 3GSVA 4PJIF 3MXWH 3H2WA 1NMCB 3DECA 3Q6FA 4FQHA 4YXHH 3EOAB 4LPCA 1TCRB 4NQDB 5SWQB 4R4NC 3WIFB 5ADPL 1PX4A 4PB9H 5F7FA 3NIFF 4L5FH 1RK1A 3BO8B 1ZHLA 1BD2D 4PJEE 2JIXD 3GIZL 3QI9D 3C6SA 1E27A 1VFMA 1UYWL 1LO4H 3T77B 3EO0A 3KLDA 3T4AA 4TVSa 4P4RA 5ADOL 2O5ZH 4GXUN 2IPKA 5FEBA 5IVXA 2DICA 1IZJA 3HNVH 2YPLD 3TCXA 2H9GA 2I9LA 4WI6A 2J88L 5EU6A 2DQTH 4EN3D 1T5WA 4NZRH 3FO0H 25C8H 3UJJL 1S7QB 3SDAC 3OG4B 1JPSH 3ISWA 1AO7B 3OKEA 4UTBH 1A6TA 3K2UL 1DUYB 5GZNC 4JDVA 5FYJH 3MRCA 1FBIH 3D18A 3D39A 3LZFL 4UZGA 2PO6C 3WNKA 1N4XL 1XIWD 1U2CA 2DN7A 1GIGH 2PNDA 3UZEA 5FYKL 1U9KA 4CRPA 1MUJA 3O2DH 5EPMA 2UYLB 2HFGH 3ZE0F 1J1PL 2XWTB 5CBAA 3KNBB 2MKLC 5E9DD 5E6ID 2V9TA 3T0DA 5IQ9B 3VRIA 2A6DA 3T0AA 4R7DA 4MCZB 5D72H 3MCKA 2HKFH 4HKJA 4HMDA 1AY1L 3E1F1 4PREA 3VFNA 1YNLH 1LK3L 3IDNB 3ECBB 3PHQA 3QPXL 3FN0H 4UOJA 5HHOA 3AU1B 4FFZH 5SX4H 4JKMA 3SE3A 3VMPA 1FNAA 4OZGF 4OZHE 5HGHB 4X9GA 1KN2L 1I1YB 4XVTL 2RQ8A 1DR9A 4ZTPL 1SYVB 4P4KC 4JQXA 3SBWC 1KCLA 3RTQC 3QIUA 3QQ4A 5FO8B 4JY4B 3BEWB 2ICES 4O02L 2HFEB 1X7QA 1IQDA 1E4WL 3K4AA 1UH3A 3ARXA 2QSQA 4DKFH 3C5ZB 4LVNC 3KDMA 1HHJB 3AXLB 1J10A 3DGGA 3Q3GA 5E2WL 2BSRB 5EUKB 4HKBA 2YHGA 3HC3L 3DVFA 1S9WA 4Z95L 2CLVA 4RMTA 4ZOAA 1T0PB 3PWVA 3MROB 1JF6A 4OLZH 4JJHA 1Y6MR 1CK0H 8FABB 3S98A 4IRJC 3GMQA 2E9IA 3MJGX 1LEGB 5HYJE 4ISVA 1C7TA 4BH7A 4S0TD 4HK3N 4G42A 4XPTH 5C0IA 3TN0C 5GZND 4S1DC 1T80A 4LAQH 4NQVB 1M7IB 3P4MB 4JKLA 4J1UB 3D85D 4HZAA 5DJ2B 3PL6C 3GI8L 3MBEA 3FO2B 1ADQA 1CG9A 2K3TA 4NM4L 4X4YB 2J8OA 3BKYL 12E8L 2Z93A 4ZFZA 3B9KC 4JHAH 3SDCC 3MODL 4RGOH 3GMMB 3PDDA 4MNQA 3FZUD 1QFWH 4KTEH 3VWJA 4F7EB 1B88A 2ICWB 1KCSL 4UUJB 4XNXL 3NFPA 3U1SL 2A9NL 5F1NB 3C60B 2QJDA 5DJZB 3BW9A 3OG6B 3C6LC 2HMIC 3MNZB 4YHZH 3RL2B 5KSAA 1TNMA 2VDML 2OQJA 2X4SB 4G9FE 2WBKA 4ODWB 3CU7A 5TH2B 2VNCA 1T03H 4Y5VC 4C56B 1NC2A 2P8PB 4GXVL 3GSRB 3FMGL 2EIZB 2XTJE 1K4DB 4FTVB 5I1CL 4ACPA 3VFPA 1H15B 3U0TB 1SJXA 2MKWA 3CSYA 4JFFE 1A02N 1FZJB 2B2XH 4UQ2B 4ZXBA 4M1DL 4Z7UE 2HKHL 3KXFD 2BZDA 1CICB 1E6OH 2VUOA 2YKLL 3QXDA 2WSKA 3IDGB 5GS1C 1BAFH 5LCVL 3MOBH 4Z76A 2CRIA 2NY2D 4KFZC 1AGBA 3TBYA 1NFIA 2G9HB 4LP5A 3AB0C 2XI9A 3MA7B 3HC4L 4MNHB 5IIEB 5IK3A 3ROLA 3AAZA 3W2DH 1P7QA 2HTKC 3DO7A 1RZKH 5BV7H 4PRNA 1EEUA 4JJ5B 2APXA 5TE4L 1N5YH 5I1AB 2ILLA 1G7QA 3PL6D 3OMZA 5FA4A 1HN1A 1FDLL 1HHGB 4F7TB 2C5DC 4OQTL 3A6BL 4PTTB 4CMMA 3PP4H 1LO0L 2J6EH 2WBWB 5SWZD 3VGAC 4E5XB 3MLVH 2AJVL 1JZ4A 2HRPH 3QXUA 4AT6B 4R0LA 4HFUH 1T0MA 1G7MA 2OP4H 1W2KT 5EZOH 1TZHB 1FZOA 2I26N 2VLRB 1JV5B 5KZCB 3OPZL 3TH3T 1OT1A 3QFJB 2OCFD 1WISA 4Y4KA 2YS4A 1NGPH 3PE9A 3LKPB 5GISH 1JFQH 1JVKA 3KYMA 3SJVB 1Q9WB 3MUZ1 5IB5A 4JZJB 1I9RL 3E3QE 3QDJE 4HPOL 4HH9B 1P6AB 4PJ5A 2HMID 3BD4A 3U4BL 3IXTB 2FIKB 1K85A 1F97A 3MYZA 3RDTC 5L8LB 3DROA 4AL8H 4JM2A 2DTSA 1YEGH 3T0WA 43CAB 1LO5A 4MX7A 4UIMB 2OSLB 1HKLH 3LH2L 4YEFA 3KJ4B 1Q0XH 1UGNA 3DVIA 1H5BB 2MCPH 1AGCB 1UC6A 4IM8A 3W9DA 1IGYA 1YYMH 4WNQA 1N59A 4JFHE 4V1DB 3UJTL 5E99H 1MHPH 1KFAH 5F9OH 2AQ2A 1IGJA 1JHKL 4KK5D 5DJYA 2DL2A 5CUSH 2WLYA 2CUHA 2EDBA 4BJLA 3PF2A 3ULUE 5ALBH 4RMUA 1DEEB 5J9PA 4YDJB 2R4SL 4HJJH 3G5ZB 4HUKB 3SGKA 5E8PB 3BE1H 3JWOC 5FHAH 2CGRL 1ZANH 3RNKB 4DVBA 4FOMA 5CEYB 4F7PA 1ZMYA 1JGEA 2CKBH 3MLTB 3VA2C 3UTQA 2PTTA 4OCSH 2DLFH 3M17B 5IT2H 1N6QH 4DVRH 4LF3B 1OTUD 1I9IL 4B53A 3THML 4M3KB 5KSBB 3GSUB 3H3PL 2P5ED 3L3IA 3PQYB 2VKXA 3QQ3B 3B2VL 2FB4L 1QRNE 4LGRB 1A6ZB 1RZFL 5GRWA 2UUDK 3CIQA 2P7TB 5EH1A 4XBGA 1XF4A 1D5ZA 3GMLA 4FXLA 1YY9D 3BWUC 3DYOA 1I1CA 4LU5L 2X4PA 4M4RA 4GLRH 3OHXA 3STZB 5H94B 4F37K 2ZJSL 3NCMA 4QRTA 5DD5H 4YDKL 5A40E 4YC2C 2A83A 2E7LC 4L3ED 2FWOA 3IVKA 4GRLD 5DD6B 1J1OL 4HUWB 3WL9A 1CU4L 1OP3H 3IDJA 2C3VA 2WM0A 5INDA 2ZOLB 1LILA 1KXTB 4OGAD 4UDTB 4MAYA 4W6XB 3LOWA 2ZUTA 3DRQA 1S7RB 5DHVB 5HJ3B 1VB9A 2VH5H 4NWTL 1IEBA 5F96H 1T89C 2PW1A 1HIML 3B5GA 3NABL 1TVDA 2JJSC 4JKWA 5HGGS 1TJIL 2UV3A 4NM8L 1OSZA 5I8EA 1ADQH 5F7EH 4MAUL 3CMOL 5CILL 4OGZA 1YNKH 3P0VH 5E03A 5AZEL 1BQLL 4FQXB 5ICZB 5DK0A 4JGJA 1MIMH 3S35L 3ZDXE 3LEXB 4H8WC 2P5WB 2O5XH 3WO4C 2ZKHH 1UA6H 1UFUA 4N0UE 5KW9H 1DBMH 1NJ9B 5FKAA 3VI3F 3E2HC 1U6AL 4TSAL 1Q94A 2HH0L 5F7UA 5HYIA 4M8VA 2YD1A 3MBXL 4EJ1C 3CVHA 1N3NB 2GK2A 2VZSA 1A6AA 3LN5A 4K7PH 1OGAE 1H0DA 3TIEA 1WAAE 3EO9L 5I1GL 3O3BA 1OPGH 2E7MA 5D1ZC 3HTLX 3JWDL 4ELME 3SDDA 3LDBC 1DVFD 2AV7B 5HDLA 3O3EA 1U93A 3N1QC 3PGFH 4MA8H 2A73B 4F9LC 4OLUL 5E2VL 3MLZL 2AP2A 3RUGE 3MRIA 4LSRL 4GXUM 1Q9LA 3PWNB 3DHJA 3B9EA 1Q8MA 2H2PC 2NX5A 2MJWA 4HUUB 4J3TA 3WFEH 3MV9D 1QHPA 4HS3A 1A7QL 4NRYA 4HGWA 3V4PL 5FO9B 4LSTL 1HI6B 1AP2B 3RGVB 4OTXH 3VXOB 3W11C 5JW4M 1A1MA 1E28B 1UADC 3KLAB 5DMGD 1I7RA 1FNSH 3QCTL 5DD0L 3OR6A 5DQDH 4NKIL 2ADIB 4Y4FB 2X4RB 3UTSA 4P2QD 3V4UH 4AIZA 2H2SD 5IB2A 1U3HA 5JHDA 2VO5A 4JO3L 1XGYL 4PJIB 3D5OF 1EX0A 3D69A 4U1LA 4H20L 2Y5TB 5DDHA 2I27N 3N85H 3OAZK 4NP4L 3RBGA 4WHTB 4JE4B 1AD0A 4XNQB 1MHEB 2YUXA 4U1NA 4XTRC 4JVPA 4GS7C 1MJ8L 2YBRA 2VLKB 1NMCC 2VLJE 4LBEA 1MCLA 3RI5F 5E5UB 3KPTA 4HIEA 2PYFA 2IAMB 2YPVH 4RGNB 5DMKA 5F3HB 5HVFB 4N0YL 4NNYA 5C2UB 1GOHA 1BQHG 1JPGA 1D6EA 1F3DJ 4NGHH 3LKRB 1RI8A 4APQB 3BHBB 2QHLA 3M1BB 4JB9L 5JPNB 4JDZB 5GZOC 1UT9A 5CEZH 1NDMB 3EOAA 1IFHL 1HSBB 2C26A 1TCRA 4NQDA 5SWQA 3WIFA 1JGDB 3ZDZE 2COQA 4HWZB 4UIKL 1BEYL 2EH8H 3BO8A 4PJ9B 1KCRH 1W0YT 2DQIH 2RB8A 5CINH 1BZQK 2Y07L 3VFGL 4AEFA 1MRCH 4RISL 5DLMH 2YD3A 4YEEA 5GGVH 4Q9CA 3T77A 1UJ3B 5B8CC 3WIHA 2H2PD 4HIJB 3F7RA 2BOBB 1HKFA 2DQEH 5C0JB 4ZS6C 4KKBC 5JUEL 2A9MH 2XZCH 1EVTC 1F6LL 4RFNB 4UV4H 2BMKB 5LG1A 3GSXB 4LSPL 5E4EB 1CI5A 1NGQH 4ERSH 1YY8B 2XPGB 4QYOB 3I84A 4PJCE 3ZE1E 4XMLH 5AUMB 3LN9A 1S7QA 1AO7A 4ZSOB 1Q72L 3HMXL 1I8LA 5ANMB 1DUYA 1A3RH 2R0WL 2A6IB 4ZAKC 2HLFC 4NQED 5CIPB 4ODTL 5FO7A 4OZGB 3HLAB 5B3JF 2WW8A 4HJGB 2UZXB 1CE6B 5AAWA 5C09E 3S37H 1QFUH 3X17A 2R2EA 1EGJA 2UYLA 3QUYB 4LRIA 3IGAB 2XWTA 4Y16B 1KG0B 3BQUD 4KKAC 5IQ9A 1OCWL 1KIRB 1T2QL 4BFEA 1FGVH 5I8OH 2X42A 4MCZA 2Q8BL 2XXMB 3ZHDA 4L29B 3WS3B 3IDNA 3ECBA 4Q9RH 2XXCB 3AU1A 1A3LH 2V5TA 2Z92B 4WFGE 2W9EH 2PXYB 3K0WA 4QRSB 2BNRB 5GZOD 1I3UA 5EN2B 5HGHA 5DRXB 4JVWA 1MI5D 1I1YA 3PNWB 3V6OA 2VDPH 3QJFB 4S0SD 2CUIA 1SYVA 2BERA 5ITBL 2Z35B 2PYED 3V4VH 2EXYD 3GMRB 3MO1B 4HKZB 4JFED 2WK2A 4OCYL 4CADB 5HDBF 4EBQL 5FO8A 5T3ZE 1CD9B 1WV7T 3MJ7B 4JY4A 4L4TB 3BEWA 4D0BB 5F6IB 2HFEA 3C2AH 2AV1B 4NFDA 4JCLA 2PR4L 5C07D 5DUMH 1U8LB 1UZ8B 1WT5A 3MLUH 2ADFH 3C5ZA 3AXLA 4RAUB 5D7LD 3IU4H 2F5BL 5I30H 2BSRA 4KKBD 2GSGB 4WUUE 5EUKA 3IDXL 4QHKJ 5DRWB 3GSOB 3BRGC 4IRZL 3MROA 4PGZA 3VG0H 1TQCB 4LCUB 2QR0B 1RUKH 4FA8A 3OKKB 1NGXB 2XN9E 3JVGA 4NFBA 3D2UB 1JMXA 4XHJC 4PR5B 5HDQL 1F5WA 3CVHH 4M1CC 4NQVA 1M7IA 2NY7H 3P4MA 4J1UA 4PLOB 5DJ2A 5ITFB 3DHMA 4H8WH 3NFSL 3FO2A 5T33L 2X89D 1EJOH 2APTA 1V3LA 4X4YA 2YWZA 4I18C 4OM0L 3IDMB 3L5JA 2IBZY 3GMMA 2VYRE 4XC1H 1FYTE 4KU1A 1S9KC 3FB7B 1NH6A 3RWFB 4F7EA 1EFQA 5ETUB 2ICWA 1BJ1H 4UUJA 1CXEA 5F1OB 2FJHB 5F1NA 3C60A 2CH8A 4NHUB 5DJZA 4LPWA 4OM1L 2MWCA 1JJUA 2IWGA 3VFUB 1R5IB 1J5OL 3MNZA 5FYKU 4O2EB 3RL2A 1M05B 1KCUH 3MV8B 5HI4D 3BP6B 5FGSA 1IKFL 3RU8L 4ODWA 5T1MB 4C56A 2P8PA 5FV1L 1UXWB 4JFZL 4OQ1A 3W0WD 3GSRA 2EIZA 4FZ8H 1R3IL 3BDYL 4HW6A 4XB8A 4KJYB 1OGTA 1DBKH 1K4DA 4FTVA 5IW1B 3TNMB 1H15A 4NKMB 3U0TA 3GIVB 3QNXB 4GT7A 1FZJA 4PJDE 2GY7B 4UQ2A 5LXGH 5IEKB 4Q9BA 1CICA 4E41E 3IDGA 3U46B 2IBZX 4JPWL 3PV7A 1PEZA 3MA7A 4MNHA 5F7MC 3UROR 4UT7L 2EDOA 5IIEA 4YUEH 3J7HA 4GUPB 4JJ5A 4OZFB 3BKML 2IANB 1BD2E 1FVDB 3E6FB 4D9LH 3DVGB 5D93C 1HHGA 1ZGLP 1DQQA 4F7TA 5C9KA 5EOCL 3HPLB 1KJ2L 3G6JF 4E5XA 3EDKA 5F7NC 5ICXB 1RFDL 4AT6A 1XGRA 1HOCB 1TZHA 1VGEL 2VLRA 5DJXB 1JV5A 2GJZB 3O4LD 2YPLE 4NUGL 4WCYH 3WS6A 3QFJA 3CPLB 4OZIE 3WSQH 3T2NH 5J0BA 4PJEF 1QFPA 5D2LF 3LRHA 3LKPA 4GRWB 1RUPH 2CK0H 2QQNH 3S34L 3AM8A 3WIHH 1G9NC 4D9QD 3NIDE 3Q6GL 3SJVA 1FG9C 1Q9WA 4JZJA 1KIPB 4HH9A 5IW3A 4I0PC 4KUCD 1DBAH 3IXTA 4X0KB 1KTRL 2FIKA 2ZNWA 4IIQB 4ODXB 3BGFC 4D0DB 1CDUA 4DN3L 5KTEL 5FF6B 3MRLB 3K1KC 2BSTB 43CAA 4M62L 1KBGH 4U6VH 2PW2B 3SE8L 4UIMA 2OSLA 4X7EC 3MC0A 5D6DA 5E9DE 1G6RL 4MJ4A 1FNFA 1H5BA 1AGCA 2D3VA 1D5XB 2UY6A 4V1DA 3MA9H 3EDJA 4U6TA 5BVPL 4J23A 3BYYA 4J3VA 3PWUB 1RJCA 2OI9B 5F7DB 1NBZB 2ADJB 1X5XA 1RJZB 2Y4SA 1EGJH 4M5YL 4MZ2A 4PRBB 4U1JB 1K6QL 2F15A 5CAYB 5J57B 1DEEA 3UPRB 3WXVH 4YDJA 3BJ91 5TE7H 3G5ZA 4CJ0A 3QXAB 5E8PA 4YHYB 3RNKA 3P3YA 3PV6B 3MLTA 2QADD 3SCMC 2AK1H 1OM3H 1X5ZA 3M17A 2HA1A 2B1AL 3OWEA 3DURB 5DFTA 4LLDB 4LF3A 3VGGA 1VFBB 2LTQB 3QWQB 3GSUA 2A2QT 2MQ0A 5KSBA 1C1EH 2XNAB 5M94B 2A6JB 4ELKB 3I9GH 2EIBA 3MRRB 3PQYA 3RZCB 3GSNB 3QP3A 3QQ3A 4LP4A 2YC1B 3I85A 4G6FD 1CFBA 5I75C 4CDGC 5E8OB 1A6ZA 5MENB 1GPOL 2P7TA 4X80H 3O6LL 3BGAA 3FT3B 2PETA 1YQVH 3U7WH 4XC3L 1KJ3L 1YEIH 3STZA 5H94A 1FSKB 1IGFL 3GKZA 4Y5YB 3SE9H 1T83C 2XRAL 5ESQB 2LU7A 4C55A 5DD6A 2XA8L 4KTDL 4HUWA 2J2ZA 4RX4A 2VR4A 1OF2B 2ZOLA 1I3GL 3AFLA 4UDTA 1ZOXA 1NSNL 2EE2A 2MQ3A 4DFHA 4M7KL 3VGFA 3CVIL 4U3XA 1S7RA 2M1KA 4FQXC 5DHVA 4HIIB 5HJ3A 3LQMA 5JHLH 1AJ7L 1J11A 1MPAL 3MRGB 4NZTL 2OZ4L 2FHBA 1HWGB 2VDRH 4LIQL 4I13B 5T3XH 5GJSL 5ICYA 3GUTB 2FATH 1EH9A 3DUSB 4XP4H 1QSFD 4AMKL 2H6PB 4JQIH 3UTTB 4DKEH 1CQYA 4X5LA 4ZODA 5ICZA 2ORBL 4MQSB 1H8NA 4M8QB 3VWKD 4AIOA 3LEXA 2P5WA 3ARFC 4FP8L 5HI3C 1FPTH 5HGDB 1NJ9A 4DGVH 4HIHB 3SCMD 1NCAL 2UVEA 3LKQB 4YBLB 4YHNB 3QISA 4QXTB 1N3NA 2AGJL 4PPTA 4QEGA 4P2RD 4OF8A 1ZLUH 1IARB 3KXFE 4FQ2H 3ZHKA 3WHE0 3ARQA 2FD6L 3MV01 3TT1L 3ZL4H 3PWPD 1WFNA 4XNYH 5CGTA 2AV7A 1WCBB 4WEBH 1UEYA 4KRPB 2A73A 3DTXA 2Y06L 3ULVH 4X7TB 1C5BH 2AJ3B 2YD8A 2APBA 3PWNA 4GAJH 4WDIB 5DMYA 4OF3A 5IW6B 4HUUA 4LNRB 3D3VD 2VDLL 5SWZE 2BDNH 4Y4FC 3MV7B 4DKAA 1I1AD 5FO9A 3QQ9C 3S8WA 3OKMB 1HI6A 1AP2A 3RGVA 4QHKI 3TWCL 3X3GL 2ZG3A 4S1SL 1NC4B 2AEIT 4R8WH 4GMSH 1WTGT 1E28A 3KLAA 3DYMA 4TRPL 2ZSWB 2ADIA 2DJUA 2D7TH 4Y4FA 2X4RA 4WI4A 5D7KD 1QR4A 2WQRA 5B38B 3JZ7A 1B4JL 1OB1B 4PJIA 5GGVY 3DXAB 4KZEH 3MNWB 1R6VA 1URLA 2Y5TA 2VN7A 1UM6L 1NKOA 3MLRL 3SQOH 5IVZB 4WHTA 1ZWIB 2Z91B 4APQC 4Y1AB 3I6KB 1LE9B 3OZ9L 1QBBA 4XNQA 2R0KH 1MHEA 1J0JA 4OGYL 4NFCA 4ZOCA 2VLKA 3T2OA 2D31B 1FZMB 2DQHL 2IAMA 2YOCA 4N8VB 4KC3B 5F3HA 1OTSC 4H25B 4JRWA 1AE6H 3VRLE 3BT2H 3HI6H 3LKRA 5JQHC 4APQA 3BHBA 2FLRT 3M1BA 5CZVH 3A6OA 5ID1B 3L95B 4JDZA 1VESA 1UJ3C 1NDMA 3CU1A 1RSFA 1L7TL 1H3PH 5D71L 1JGDA 2XZQL 4HWZA 4KK6C 2BRRL 5MEOB 2R69L 3QA3B 1KYOJ 4PJ9A 3LHPL 2BRQA 1FH5L 3VE0B 3C8KB 4XPHH 2VQTA 2VR9A 1NUGA 1UJ3A 2PTVA 5TFSH 2C3GA 4HIJA 4BELD 2BOBA 5C0JA 4KMLB 2VDKH 4R90L 4TNVK 2D03L 1HK6A 2BMKA 3GSXA 3ULUF 2W59A 1YY8A 2XPGA 3K80A 5LKNA 4QYOA 4N0RA 4CMHB 4OFYA 1BVZA 2QTEA 3X14B 4J2XA 1AXTL 5DSCB 5EIQA 5AUMA 5C0CB 4PJXE 3BZ4B 3LY6A 1CGSL 2P5EE 3QHZL 4DGYL 4HIXL 4MD5B 2Y36L 2OL3B 5KBNC 4ZSOA 4K8RL 2FDBP 3O6ML 5I8CB 3RRQA 1HZHH 5ANMA 4HGMA 1PQZB 2A6IA 3EHBC 5CIPA 4OZGA 3HLAA 5CP3A 4FMKA 3R8QA 1NKRA 2DAVA 4HJGA 5C2BH 3ZKQD 4KQ4L 3O6FC 1EJ6A 1CE6A 1LO3H 1QFOA 2WUBH 3QUYA 1A64A 3S37X 3IGAA 3QUZD 4Y16A 4M9OA 4MQXC 1KG0A 4P49A 5GRJL 1S7UB 3D25B 2A0LD 3DO3A 3EYQC 2B39A 5D70L 1KIRA 4FZEH 3BI9X 3TT3H 3TO4D 1NMBH 4L29A 2IGFH 2I25N 5EU6D 3WS3A 1U8QB 2AJSL 3RJDA 2Z92A 1MOEA 3DBXB 2PXYA 3L5HA 4QRSA 1I8IB 2BNRA 3N06B 1OAZH 1MCIA 5EN2A 1RUAH 5DRXA 5LVEA 3PNWA 4XAWH 4DTGH 1MRFL 2Z35A 4NWUL 3DMMB 3GMRA 4HKZA 4V2BA 4XXCC 3CCHB 1NCDH 4CADA 4G80B 1ZLSL 3D39D 4KK6D 5TQ0L 5DHVH 4K23L 4KXZI 4D0BA 3MJ7A 4L4TA 3Q48A 3S4SB 1T66C 2AV1A 5C0BB 3NACH 4G7YL 2FGZA 3QNZB 1U8LA 1UZ8A 3KS0H 3CK0H 4RAUA 3HE6D 5J6HB 4XXCA 2GSGA 4AEHL 3L3JB 3RWHB 5DRWA 1VFAB 2A6KB 3GSOA 1JCKA 2IF7A 1TLKA 4WUKH 3ALXA 4WV1C 4HQQH 4HSQA 4LCUA 1MQ8A 1TIUA 3MACH 2QR0A 3BGMB 3SHSA 5FKPB 4QNPE 3TH2T 3JSSA 3HNTL 2RFXB 4ORGB 3DX6B 1GVIA 2I5YH 3ZKMC 5FM5M 2BK8A 3OKKA 1NGXA 2EIDA 5IFAH 3BPOB 1LVEA 3PHOB 1YYLH 3D2UA 3QCUL 5JA9A 5JPMB 1A6UH 3GI9H 4LCIH 4PR5A 4Q0XL 4WW1B 3D0VA 4QOKB 3QIUD 3IFNH 5ITFA 1FE8L 1P1ZB 2EH7H 3NGBB 1MVFA 2VZTA 3O6FD 4I3RH 2EDXA 1T0NB 3RKDD 2F5AL 3MV9E 4MQXD 1NCUA 3TP4A 4ELMF 2DTML 3OGOE 3IDMA 1FNHA 2FEEL 4MQTB 2XACC 3E8UH 3HA0A 3FB7A 6FABL 1EUTA 2NR6C 5BOPA 3RUGF 5ETUA 2XWBB 5C08B 2DBJA 3MOAL 3OB0K 2FJHA 1OAYH 3B43A 4NHUA 5GJTL 3X3FH 4P2QE 3UO1H 5BCAA 3VFUA 2FECL 5I1IH 3ZE2E 1R5IA 3NBNA 3TYFB 4O2EA 1M05A 3MV8A 3BP6A 3V0WL 4HUXB 3I02B 4FXKB 1A4JB 4PJAE 5HVGB 3N9GL 5T1MA 3MBED 4M6ML 5F9AC 5IHUH 1EDQA 4G8GB 4OJFL 1UXWA 2AEQL 4F9PC 3ILPB 1Z3GL 2CLZB 3SE4C 4KJYA 4I4WB 2C1OA 3IDYB 3QPQC 3TNMA 3LEYH 5IW1A 4NKMA 3GIVA 1LK2B 3QNXA 3G6JB 4MNQD 1DLHB 5EO0B 1SM3L 3GFUA 4DK6A 1S8DB 3VWJD 4ZUSB 5IFHH 5IEKA 1N8ZB 4LLQB 1MHCB 4F9PA 3IRPX 4MMXC 2IPTH 1GC1H 4PV8B 5EIVA 3U46A 3KPRD 1L4IA 4W6YB 5CCKH 3QEGH 3DX7B 2Q7NA 1JNLL 5D2LB 3NH7L 3ZKMD 5KSAD 2CD0A 5F89B 2WQ8A 4GUPA 4XB7A 3Q5YA 1MELA 1FZKB 1Z9OA 3MXWL 4OZFA 5A3ID 2IANA 4NCC2 4YXHL 4JHZA 1WFOA 1FVDA 2QQQA 3E6FA 3DVGA 4KK8C 2Q87A 4PB9L 3HPLA 5CGYC 2VXUH 1AXIB 4L5FL 4NNXB 5ICXA 2Y72A 1AHWB 3HPJB 2NY6B 1HOCA 2XQBH 3UJIH 4JN1H 1LO4L 5DJXA 2GJZA 4ZXBD 4PRPB 3CPLA 3WUWB 4DW2H 1UVQB 3U0WH 2O5ZL 4KKCC 4KGJA 2V7HB 3U82B 5EZLB 3HNVL 2GEEA 1ZTXH 2ERJB 3SPVB 1Q9OB 4P5TB 1QA9B 1IT9L 1CDCA 4XPBH 1CDHA 4YHIB 3CFCH 3C2SA 4NZRL 3FO0L 25C8L 4NQEE 1P7QD 5D7JB 4PGEB 4X0KA 2MQCA 1JPSL 4IIQA 1VDGA 1L0QA 4ODXA 4D0DA 4QCIB 4PB0H 5ADPH 5KVMC 4QRRD 3ZE1F 3LQAC 3MRLA 4HMCA 2BSTA 5FYJL 3LSOB 1N6VA 3QEHB 1FBIL 2PW2A 4LVOC 3MLWL 1OP9A 4RMSA 3EJYC 2IADB 2XG5A 1GIGL 4JRXD 1D5XA 2NTFB 3CSPA 3O2DL 2HFGL 5CIPH 3GZKA 5E56A 5CP3H 1KLUB 3ZZ1A 4U3HA 3BZFB 5EU7E 3PWUA 5F7DA 4MA1B 5EA0H 1NBZA 2ADJA 1RJZA 3CX5J 2YRPA 5JOEA 1Z6JT 2HKFL 4PRBA 5L8JB 3G08B 1YNLL 4U1JA 1MI5E 3FN0L 1V7NL 4PY8J 2G5RA 5D8JH 2D7QA 2YEZB 3UPRA 3VXRB 2PYEE 3K2UH 4JFEE 5GS3A 1NBVL 3VG9C 4LOUC 3QXAA 1F42A 4JM2D 3GSQA 3PV6A 3LZFH 3IFLH 4GMTH 5C07E 4DOHB 5CSZB 2R23B 2DDQH 3WDHA 3P2TA 4BSWB 3DURA 1CTOA 5D7LE 1VFBA 4DKFL 2JJVA 3EYVB 2CRMA 2XNAA 2A6JA 4ELKA 4PGDA 3MRRA 5IM7B 3RZCA 4HG4K 3GSNA 4PV9B 3B9DA 1Q0YH 4UT6H 1LEKB 4WU5B 2YC1A 1RU9H 4D8PB 1ODAA 1N2RB 1WZ1L 4YFEA 5E8OA 3VXUB 2VERN 4OV6F 2LVEA 5MENA 1NEUA 1CK0L 3FT3A 4XVTH 1IM3B 3WD5H 3B5TA 4LPVA 1N7MH 4XPTL 1U36A 4R6UA 5D7IF 4Y5YA 4Z7VE 5CMAB 4LAQL 1FFPB 4MLIA 2M8XA 4KI5C 5GS2D 4W70A 4O2CB 2EDYA 1OF2A 2C3XA 3PWLA 1OT2A 3WLWD 3TYGH 1F3JB 5IUSA 3CC5B 4HIIA 5E2WH 4TNWK 3MRGA 3HC3H 3L6FB 1A6WL 5DS8B 4RGOL 4FFWC 3GUTA 3DUSA 1QFWL 4KTEL 4G9FB 4H0HB 2H6PA 5FGBA 3UTTA 3W39B 4PLKD 1I7ZB 5L2JB 5HYFA 4M8QA 1FNLA 5ACLA 3HUJE 2XTJB 2WINB 4X4ZA 1VERA 4JRYB 3EYFB 4G8FB 4YHZL 4Q2ZB 5HGDA 1WSST 3BIKB 3GI8H 2Q7YB 4HIHA 3U6RB 3LKQA 1D7FA 3W0WE 2W60B 4YHNA 4HUMB 4BQBA 1GGCH 3RVTC 5JOFB 1IEHA 2PTUA 4MAYD 4QXTA 1T03L 4TYUA 1SJHB 2VSDA 3FN3A 3S3JA 4JREC 3QUXC 5FA3B 5GSRB 1FFQA 3NA9L 5JIIA 3RPIB 4X83A 1A7RH 4WO4C 3T65B 4YX2L 1WCBA 1E6OL 1BAFL 5M7QA 1I85C 2YUZA 3RVXC 5JXAH 3MOBL 1W0VB 4XI5C 4X7TA 2AJ3A 4WDIA 3O81A 5IW6A 4LNRA 1RZKL 5BV7L 4G8IB 4M7ZB 3MV7A 1N5YL 3PWJB 5FECB 3OKMA 4WY7L 3EFFB 3FHAA 1Q1JH 3RNQB 4U6XB 1UKQA 3PP4L 2J4WH 1FC2D 2J6EL 1CD8A 1MLCB 1NC4A 2VTFA 3MLVL 3O4LE 2F53B 2HRPL 3O41B 1MCKA 4HFUL 1WZKA 1GSMA 3QDJB 3VXPB 5EZOL 1ZA6B 4ZMAT 3SDDD 4NZUH 3MRKB 4D9QE 2EDLA 5B38A 5JW3H 3C87A 1OB1A 3UBXI 3SOBH 3DXAA 4M61B 3MNWA 4AENB 5FDWB 5GISL 4YAQB 1JFQL 3CXHJ 4NRZB 5DVLA 3OXSB 4OCRH 4G7VH 5IVZA 4OCXH 1ZWIA 2Z91A 4OZIF 4Y1AA 3I6KA 5D2NE 1LE9A 4HKXB 1K8DB 1GGBH 1FDLH 3ARUA 3QEQB 1S7VB 5TDPB 2D31A 3NIDF 3B2UD 3KGRA 4XNUH 4AL8L 1FZMA 4CU7A 4JG1H 1YEGL 4N8VA 4H25A 2DQFB 3O8XC 4G3YH 2NXZB 2W0LA 5GIRB 3QUXD 2MCPL 4CVWA 2XIDA 5ID1A 3L95A 2EE3A 1YYML 4M1GH 2Z0BA 4LPUA 1MFDH 3E6HB 3GGWB 1MHPL 1U3HD 1KFAL 5JHDD 5F9OL 3VFMB 1BIIA 5E5RB 5CUSL 3K81A 4W6WB 1RAMA 4Z5RB 1INEH 2X4QB 3VE0A 3C8KA 2HWZH 3U4EB 3LQAH 5ALBL 3CLEH 2HJFA 5D96C 1RPQA 4HJJL 2JB6B 4Y7MA 3BE1L 5FHAL 2MCG1 5GS0C 1LP9F 1ZANL 5FUCE 3LH2H 1BIHA 5LBSH 2CKBL 5ISZB 2D0GA 1E4JA 2EO1A 3X14A 2DLFL 1T1YB 5IT2L 2P24B 5DSCA 5KSUB 1KN4H 5C0CA 1N6QL 1NAMB 2NPLX 2DM7A 5B4MC 4G6AC 3UJTH 4I5BB 2C7UB 4YE4H 1A6VL 2OL3A 2MOVA 5GGRB 5I8CA 3U7YL 2Y25A 3U30B 1PQZA 3AVEA 2F54E 1CGUA 3FB6B 3CFEB 5SX5K 2DM3A 4LCWA 1MIEH 1IC1A 3TCLA 2EC9T 5I73C 1LHZA 3V7AE 2NY0B 1G9MH 3GSNH 4LPTA 2CGRH 2VZVA 3REWB 2R0ZH 1S7UA 3D25A 3SDYH 4JQVA 5DD5L 1BOYA 4NO0B 5B38G 1B2WH 3VXSA 1CGVA 4R3SB 5I71C 4O51B 1F4YH 4A6YB 1U8QA 3TPUB 1FNEB 1SVCP 5FYLH 2DLEA 2Z9TA 3P4NB 1R5WB 3WFBH 3DBXA 3GHEH 1AO7D 1I8IA 4AY0A 2VH5L 3HG1B 1QSFE 5F96L 3IFOB 5EG6C 2UVFA 3X13B 5HI5C 3DMMA 4N0UB 5EO9B 3CCHA 5DFVD 3MTRA 5F7EL 1RZFH 4G80A 4Y8AA 2E8ZA 4JHBA 4MNGE 4N8VG 2ZZUT 3RY6A 4KGLA 5AYQA 3S4SA 1YNKL 3P0VL 5C0BA 5LGHH 1BFOB 1R3JB 3QNZA 2R1XB 1NMAH 1MIML 4KDTC 3F6LA 4WW2F 2O5XL 5J6HA 4XPFL 2IJ0C 4LLYB 1GGYA 3BPOC 3RWHA 1UA6L 1VFAA 2A6KA 6CGTA 1DBML 3EJJX 1MCFA 3LKOB 3MUHL 4ELMB 5KOVC 4P2RE 2VZ3A 3QIBB 4C58B 1YNTB 8CGTA 1QLEL 3BGMA 3NGBC 5FKPA 1CZ8H 4G6AD 2RFXA 4ORGA 4JZNB 3DX6A 1HIMH 3PWPE 2YA2A 3RUGB 4K7PL 4NM8H 4TVPH 1KB9J 2X2YA 1WBXB 5I74C 3PHOA 3S5LB 4U7KA 1DEDA 5JPMA 4PY8I 2LFGA 1OPGL 1RMFH 2BY0A 2YWYA 4WW1A 4QOKA 5AZEH 2Y7QB 5FDYA 4EDWH 1P1ZA 2NCMA 4Y2DC 4POZD 1EBPA 1WQVT 3QH3B 5DO2D 4XCFH 1T0NA 3PGFL 4MA8L 3C5ZD 5BOZG 1REIA 4XPGH 3D3VE 2YN5A 5JW5B 4Y19D 4OD3L 2BSED 3WFEL 1U8MB 5SWSA 3WNLA 4XT1C 2VXTH 3SO3B 5GHWH 2XWBA 5C08A 2WWMC 2VIRB 5DQJB 4EOWL 1F8TH 1W72B 2JLLA 4LSSH 5DURB 4HWNA 1MEXH 2VLLB 4OTXL 2Z8RA 4JAMB 5D7KE 5ELIA 5FXCH 1JPST 2XQYG 3IDYC 5IROC 1FNSL 5DQDL 5BO1H 4X98B 2HG5B 4HUXA 3I02A 5EBLB 4FXKA 2NXYC 4YDIH 1A4JA 2VLJB 5T3XD 3FQWB 4G8GA 3T3ME 4LSRH 5C7XH 3OQ3B 4B7LA 1OSPL 4S11A 3ILPA 2CLZA 3IS0X 4I4WA 1CGYA 5IROA 3T1FB 1LK2A 3K46A 3G6JA 1D9KC 1DLHA 5EO0A 4MCYA 1S8DA 4K2UH 4ZUSA 5DYOB 3W5MA 3WJLA 3TVMC 1N8ZA 4QY8B 4LLQA 1S7WB 4P2OC 2YPVL 3S4SG 4GQ9H 3C60D 4PV8A 3GRWA 4WI5A 3DX7A 3ZYIA 4NGHL 4N0CD 1Y18B 5D2LA 4XZUB 1TVHA 5E70A 1JTPA 1OAUH 1FZKA 5CEZL 1X3DA 2X9XA 4H20H 3S6CA 1QLFB 2FX8H 5HYSB 4BK4A 4NP4H 4R97B 5EIIA 4LKXB 1P9MC 1DANU 1YZZA 2EH8L 4NNXA 4F3FB 1KCRL 2ERJC 1AHWA 3HPJA 5CINL 4FTVD 1MRCL 1P4BH 5DLML 5J12B 5GGVL 2ZUXA 4PRPA 4OI7A 4XWGH 1A2YB 5KVGH 3WUWA 4QRPB 1UVQA 1CICD 2A9ML 4TTGA 2XZCL 2GITB 4UV4L 1NGQL 3IF1B 2V7HA 7CGTA 2HT2C 2WWMD 5EZLA 4ERSL 5DWUH 4JB9H 1AXSB 3HRZB 5CZKA 3QIWC 3SPVA 1Q9OA 4P5TA 1QA9A 3B83A 4XMLL 4YHIA 5GRZA 3AMLA 3H9YA 5D7JA 4PGEA 1FJ1B 4QCIA 4RQQB 4KKLC 4EQ3A 1A3RL 1JF1B 5E8EB 3LSOA 1S78D 3QEHA 4Q6IB 4NKOB 2OL3H 2IQ9H 5CJXC 2IADA 1T7VA 2VAAB 5GS0H 4UQ3B 1CGTA 3S37L 1QFUL 2NTFA 2VLRD 5IVXE 3TA3B 2J8UE 3LEVH 1KLUA 4R7NB 3U36B 1R24B 3QFJD 1BQSA 2XZZA 2B0SH 3BZFA 3BKJH 3LD8C 5EU6E 1FGVL 3G5XB 1E0OB 4PG2C 2J5LC 3G08A 3SJVD 2IMNA 3R0NA 1Y6KR 4Q9RL 1QSEB 1ZLWK 4MXQD 2C3HA 1A3LL 2YEZA 3VXRA 2W9EL 2R0WH 5TE6H 3FO9B 3D39E 4ODTH 4U1KB 3CZFA 1QZ1A 2VDPL 3FO1B 1KEMH 3V4VL 4ZFGH 3FKUS 2DWEB 3P9LB 5CSZA 5DMJB 2R23A 1OWWA 5D7IB 2NY3B 3GNMH 2CUMA 4BSWA 3C2AL 3RWGB 2V2WB 4JVUA 4N5UA 1X5AA 3QHTC 4HAGA 1OCWH 5HD8D 3EYVA 4V1DD 3MLUL 2ADFL 2IALB 3RVVC 3DJ9A 2EIEA 1BZ7B 1MCBA 5IM7A 4PBXA 3IU4L 4PV9A 4WU5A 1LEKA 5ILTH 2LAGB 4EXKA 4D8PA 5EFIB 1RIHH 3VG0L 1N2RA 3TV3H 2A38A 3VXUA 1HHHB 4RZCB 3DRTB 1X5FA 4PYGA 3L3DB 1RUKL 1IM3A 4U7SA 4FXGB 3ARSA 5IVOA 2Z8SA 4KKLD 1BVLB 5CMAA 4DGIH 1MCPH 2IPUG 4EVNB 1QPXA 3VXMB 1FFPA 3CVHL 1MY7A 2NY7L 4J4PA 3IXAB 4O2CA 4H8WL 4YH6A 3SGEI 4PJBF 1F3JA 1EJOL 3CC5A 4X4XB 5CD5C 1MJ7H 5K9OB 2Z31C 3L6FA 2IH3B 5DS8A 1YN6B 1H3VA 5I6XB 1GH7A 4NN5C 3O4OC 3V2AR 4RFEB 3ILQC 4XC1L 1JRHI 1MNUH 3ZT6A 4G9FA 4WJ5B 3FTGB 4NUJB 3W39A 1I7ZA 2FHCA 3MZGB 1U2HA 5FYJU 3RHWF 5BS0B 5L2JA 2IG2H 4GBXB 2WINA 4JRYA 4IMLB 2OZ4A 1EA9C 1GAFH 3EYFA 4G8FA 4G43B 4Q2ZA 1KCUL 5HGBB 4HD9A 4IJ3B 3BIKA 3P4LA 1K3ZA 2Q7YA 1HQRB 3GMPB 4RX4D 3U6RA 3WYRA 4JGMA 1GGIL 2W60A 4Y4HB 5JOFA 2D7PA 3KYNB 2NY4B 3ZE2F 1QYGH 1SJHA 4MNQE 4RGMB 2ATPB 4FZ8L 5FA3A 1RZJC 4XCYB 3RVVD 1DBKL 5GSRA 4X9BA 3S7GA 1XF2B 4H1LG 4LDEB 4A2LA 1JGVH 4X99B 3RPIA 2AERT 4LKCB 3GHBH 5LXGL 2YRZA 3KPRE 3T65A 2D4DA 1BD2B 3ZT7A 3TLRA 2ZG2A 3FFCD 5EZIL 1W0VA 1J5OH 2OXGA 2DQUH 2FBJH 3LS4H 3DYPA 3ARBB 1A7NH 3E3QC 1RULH 1EO8H 2YPLB 3ZLQC 5HSFA 1AQDB 3GRWH 1CTNA 2EE6A 4P0DA 1P2CA 5FECA 4D9LL 3EFFA 3HZKB 4O4YH 3RNQA 4U6XA 3SKOB 1MLCA 3L7EB 3IU3B 3FT4B 2F53A 3O41A 5HHMB 4O9HH 3MSPA 3QDJA 3VXPA 4UOW0 1ZA6A 3BJLA 2W9LA 3NIGE 4JFFD 4WCYL 2XWJB 5BV7B 2NYYC 2EEBA 3ELAT 3BXNB 3MRKA 3WSQL 3T2NL 1ZT1B 2OJEB 4M61A 4NN7C 1IQWH 4AENA 1RUPL 2CK0L 2LU3A 5FDWA 4YAQA 1AKJD 3MUJA 3WIHL 3TBVB 4GAGH 4KDVA 2V5YA 4FG6D 5E6IB 4NRZA 3OXSA 5DJCB 3V6ZB 4U4BA 2NXZC 4QRRE 2V17H 1UWXH 2IH1B 4DZ8B 3BKMH 3ULUC 4HKXA 4N5ED 1K8DA 1AR1D 4YZFE 3K8LA 3QEQA 1S7VA 5TDPA 1IEAB 4KROB 5ACZB 4JRXE 1KBGL 2YSSB 4RBPH 4NN6C 4U6VL 4M6OH 2DQFA 4IDLA 3UDWA 2HN7B 5IJKA 1IZKA 3GJEB 4YBQC 1LP9B 1S5HB 5GIRA 1FCGA 1OWRM 1ZGLM 1AD9B 1KB5H 5IB4B 3MA9L 3DNKA 3E6HA 3GGWA 4OCNC 4OZ4B 5CJ5A 4X6DE 3VFMA 4EI6B 2OR7A 3GO1H 4Z5RA 2SEBB 4ZO9A 4YXKL 2X4QA 4BSVB 3O2VH 3IAQA 2C1PB 3U4EA 4HS6A 3WXVL 1P4LB 4BM7A 2JB6A 2VLKD 5TE7L 1CL7I 2NY1C 3IAPA 3QT2A 1KJVB 4RGND 5ISZA 5CZXD 2CXKA 4Q7DA 1OM3L 1HHIB 1T1YA 5KSUA 2P24A 4YBHA 3SDAB 3KYOB 4H1LH 1BM3H 1NAMA 5HHPB 4AH2B 5E08H 4CVXB 2R15A 1CIDA 3QRGH 5SX4I 4Z8FH 4I5BA 1A7PL 2C7UA 4AEIH 5GGRA 4O2FB 3M8OH 1C1EL 3I9GL