3WHXB

Crystal structure of anti-prostaglandin e2 fab fragment pge1 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKINRVEAEDLGIYYCLQGSHVPLTFGAGTTLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2
rcsb
molecule tags Immune system
molecule keywords mAb Fab H fragment
total genus 55
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxB01
1TPXC 1FFNA 2B1AL 4TOYH 3CDCA 2JE8A 1AXTL 3VWKD 2VZSA 1CE1L 3O11B 3ULVD 2QHRL 4FQHA 4CU7A 3IF1A 3MLYL 5GGQH 1PYWA 1F6FB 4YWGH 3MRHB 4IRSC 4WUKH 1DLHA 2EDOA 2D03L 4OF0A 4AEEA 4X99A 2VDQL 4EOWH 1C5BH 4Q9QL 5CJOH 1FBIH 5F3BB 1FZJB 5IR1A 4BH7B 5IESL 1A4JA 5FB8A 2HFEB 2C4FT 1IGYB 4ERSL 3MNWB 5J11B 2GYSA 1KTDB 2DQIL 4WW2F 4JN1H 3MX0A 2AK4E 3B8YA 3QQ4B 5DYOB 5JMOC 3ARTA 1S5IL 4MA1B 1A02N 3ARFD 1QSEA 4JO1L 2EIZB 5H2BA 1UH2A 4H25B 1MNUH 1QNZL 1CICB 3EYQD 4H88L 3UXFA 1KG0B 3QDJA 3DMMA 3LV3B 5GGSY 1S9VB 4FTVB 4ODSL 3BRDA 5C0GA 1WTGT 1L4IA 3MRIB 1MAMH 3VFOA 2MSPA 1CTOA 1KFAL 4DW2L 1QSVA 3RGVD 5FUOH 3CVHH 5EN2B 4DFIA 5LGKA 4PJBA 1HNGA 3IDNB 1NCWL 4WTZA 4GH7B 3ZDYE 4KTYA 5C9JA 4N8VB 1ZV5A 3N0PB 4ZOBA 2OP4L 2FD6H 1QFPA 1UYWH 1P6FA 1EJOL 3QZWG 2DI8A 3KVQA 2XTLA 4WUUE 3QSKB 1OT1A 1OM3L 4XP6H 5D1XC 3GGWB 4NQDE 8CGTA 3CCHB 2CKBB 2X4SB 4PRBB 1IGMH 2VWEC 2AV7A 4HIXH 4RISL 5EUOE 4Y5YA 3NCFB 2MPAH 2ZUSA 3QEGH 5ANMB 1QA9A 3L3OA 5DJ2A 5MERA 4U1HA 3O6LH 1A3RL 3EYFB 2F54B 3LHPH 2PW1A 5FYJE 3S96B 5IFJB 1NBZB 1WZMA 5T1DH 2CXKA 2IALA 1NBVL 2W60B 3OWEA 5C08B 5I1LA 3C6LB 5IKCB 1EFXD 1L0XA 5A2LH 3MNWA 4DQOL 2LAAA 3HS0A 4HUWA 5DEFA 4YHYB 4PY7A 3TT3H 1J11A 5H2BB 4FMKA 2A77L 4EI5C 5J6GA 2VDPL 1KC5L 5EU3A 2ADJB 4Y5YC 1CICA 3BXNB 3GJFH 1KPRA 1J1XL 5HHQB 1OAYL 5ELIA 1OP3H 1LEKA 3MUHL 2D0HA 2Y7QB 3WFDL 4I0CC 2I26N 4F7PA 3P4MA 5CEYB 3C60D 5DJ8B 5EZLB 3IJSA 4JHAH 1VGEL 1CGXA 5IHLB 1FFPA 4HMCA 3VRLF 1L7IH 3GK8L 1MFBL 2PO6D 4K8RH 2P7TA 1ETZB 4JJ5A 1INDL 2PR4L 1JWSA 1XGQA 4X4XA 1JPTL 2E9WA 1ZGLB 4J3OC 1CTNA 5EN2A 1JE6A 3QO1B 3S3SA 1P1ZA 1PKQA 1T7WA 2RBLA 4HBCL 4H5SB 3E3QC 3GI8L 2BRRL 3P9WB 2PO6C 4JFOA 2I27N 4QRPA 1F3DH 4R4ND 2VDKH 4DGYL 4WW2B 2VLRD 1Z5LA 4NZUH 1NCCH 3EDKA 1OCWH 4LNRA 5CILH 3VCLA 1CT8A 3DVNA 3G08A 2ADIA 2E9JA 3FOMB 3RL1A 3ZYIA 1JGUH 2J6EL 3TJHC 2WZPD 2Q6WA 1MRCH 1WAAE 3VFWB 5GS1B 4OSUH 2XRAH 1ZA6B 3FO2A 4HS8L 1HYSD 1RUML 4CU8A 5ETUA 4X7SH 5HDOA 1MFDL 5CJ5A 4RIRA 4PG2A 3WV0A 3L3JA 3WNNA 5FYJL 5KSAB 3PNWB 1T03H 1XIWC 3S4SG 4MDIA 2J4WL 1ZT1B 4HUNB 3CSYB 1RZ7L 5C2BL 3UDWA 4PS4L 4BUHA 4DN3L 3VD7A 5CJ8A 5F9JB 2R23B 4IBLT 4MMZC 2LVCA 2IBGA 3WBDA 1B2WL 4NNYA 2MTPA 4L3AA 4UNTA 1BZ9A 5IJVB 1KPRB 4XAWH 1YYLH 4FABH 3QDMD 1NFKA 3UBXI 5BRZE 5D6CA 5L8LB 5MEPB 2W92A 1J7VR 3QFJB 1AD0B 2MKWA 4OD1H 3KJ4C 1OD9A 4KPHH 4KQ4H 5KSVA 4JKWA 4L4TB 2NX5A 1WAAA 5E4EB 5E7FA 2ZJSL 2Q8AH 3LEYH 4X4YA 5FKAA 1J05A 5FK9B 2X89A 2R2EA 2A2QT 5INDA 4F7EB 3VXMD 4LLMA 4F57H 1MAML 1ZHNB 4KK6D 3GSQB 3GSUA 4V1DD 5HI4D 1Z5LB 4PJ5A 3QUZA 4P23A 1RZKL 3CXHJ 2F53E 4PYHA 3VCLB 4LL9A 4C59B 2KBGA 1DBBH 3LS5L 2HFEA 4M7JH 4GSDL 5EIIB 1T1ZA 5BS0A 1G9ML 4KDTA 1MCOH 3TIEB 1ZHLA 2BMKB 2R2BB 1YC7A 4P2RA 5J12B 5IMKA 4X8JB 1V5JA 1V7ML 3HFMH 3AMLA 3O4OB 4H25A 2VZ1A 4PJGB 3MNZA 5B8CA 1HQRA 3QYCA 2ZPKL 4NKOA 2QKIA 3C2AH 4CJ0A 4ONOA 2AXGB 1R5IB 3CDGB 5BW7C 4FTVD 3BKJL 4TULL 3CSYA 5DD1H 1D6VH 3RDTA 1DBKH 1KCKA 4F7CB 1MLCA 4NIKB 2BNRE 2H32B 3DSFH 3GIVB 5J1TC 1U93B 1T1YB 4OCSH 3NABL 2FHBA 3JTSA 2X4UA 4PJBB 2DB8A 2DQTL 5D6CB 2V17H 5IEKA 2J8UE 3QFJA 5A43C 4LP4A 1GIGH 3ZDZF 4YHYC 1VADB 3MJ9L 1TJGL 1HDMB 4OCWH 4QTHB 1U6AL 3RWDB 4R2GB 3K1DA 3W0WD 5IW1A 4L4TA 2NX5B 3GMNA 4V1DE 2BVYA 2LTQC 4NQXB 3RPIA 4JHZA 2R4RL 1N7ML 3MV9D 3PHQA 3NCYP 4LCWB 3F65A 2BOBA 4OZGE 2Z35A 4O51A 4EEEA 1A3QA 1I7TA 1MFBH 3HPLA 5EU7E 4NQCA 4YIQA 3HZMB 1WCQA 2KQMA 3PQYE 4AMKH 4ODTH 5I1LB 1YJDC 4X6CF 1KJVB 1PDKA 5D8JL 3BZEA 5BS0B 3IFLL 4BFEA 1B0RA 1MI5A 2KZWA 1NCDL 2VL4A 5E1AA 3VD5A 4WHDA 1OAZL 5HHMD 5DRWB 1MCPH 4X7FC 3HUJE 4HCRA 4GXUM 3RA7H 5E08H 1Q94A 1UXSA 4CUCA 4Q9CA 3BAEL 4TUKH 4ODXA 1BFOB 5I6XC 4ISVB 4D3CH 2EH8H 4Z78A 4KKBC 3T0VA 5EZIH 4WEUD 5T1DL 1O7SA 1T2JA 1GAFL 3GIVA 5DTFA 1Z9MA 3GSNB 5HHVH 1J8HB 2ARJA 2J88L 1U93A 3AY4C 4MA8L 4JJ5B 4KWUA 3CU1A 3U9PH 2FJFA 1FL6A 2JLLA 5TDPB 1MNUL 3TT3L 1P1ZB 1I9RH 5E2WH 1AJ7L 5D1XB 5IBTH 2XI9A 3KLAB 1LP9E 2VLKE 3LPFA 4LLVA 5D70H 5DRNB 5B22A 5IEKB 3TV3L 1MF2H 5DS8A 2XY2A 3ARBA 1A22B 2K3TA 4PV9B 3MREB 5BVPL 1E6OL 3G08B 3IF1B 1XT5A 2GCYB 4Q6IA 1D9KA 4Z5RA 3GSNH 2FEDC 3PQYD 2CIIA 1DLHB 3L3HB 2XWBA 3Q2CA 4PJXE 4KI5D 5GGVH 2F58H 3PV6B 4EN3D 5BJTA 2XZZA 3HZMA 3DYPA 3HA0A 1UYWL 2YD3A 2FLBT 3O8XD 4LHUG 3BZEB 2YUVA 1MWAL 4MD5B 5HD8D 4U2ZA 4F9LC 1K6QL 4Y19A 4AM0A 4P0DA 5I9QC 1I85C 5LBSH 5E1AB 1EX0A 1N6UA 5AZ2H 3MCKA 1JPGA 1ZE3C 3BD5A 3FQRB 3ZTNL 3IGAB 2W0PA 5HHPA 1IBGH 3HNVH 3L9RB 2KH2B 3QUMA 4MVBC 3RVTD 4NKMA 4XNMA 1UGNA 3QNYB 4X6DB 1F8TH 5E8NA 1S7XA 1IC4H 2WINB 3CMGA 1U6AH 1IZKA 3JXAA 4I77H 4XNQA 3HG1A 3RI5F 5SX4I 4B53A 1FNHA 1VHPA 4KH2A 5SWQB 1LDSA 4HS8H 4ISVA 3ECBA 2VL5B 3MRFB 5CILL 1KLFA 2GK2A 5IVNA 1U3HC 2E6QA 1FBIL 1J8HA 1CICD 1FORH 4N5ED 3KHQA 1YEGL 1FL6B 3MPCA 2C5DC 4JFZH 2VKWA 5I1HL 3DGCR 2R2EB 4F7EA 5I19L 2VN7A 5INDB 3CIQA 3VWJD 5C9JB 5SWZE 3QA3B 4X98B 1QLRA 3OPZL 1TXKA 1CU4H 3MLWL 3MOAL 1FSKB 2ERJC 1IM3B 1GXEA 3VGDA 1AO7E 4PJ7F 3FO9B 1OPGH 4X7TB 1AFVL 1BD2E 4RAVB 4JHAL 4XP1L 2OMNA 2R0ZL 4QXTB 4K3JH 4Y2DA 3MRNA 2CIIB 1WT5A 4JFZL 4E0RA 3KYMB 5I19H 2BMKA 2R2BA 1ZT7B 4KQ4L 5EPMB 3FO1A 5EOQL 4HMDA 3RZCC 2BVEA 1HQRB 1QSFB 3RJQB 2WW8A 1QQDB 3MLVH 4M1CD 4YFEA 3ALWA 5HHVL 5C0DB 1VFMA 4Z7WF 1CXKA 2L7UA 1EVTC 5D96B 4WWID 3CFCL 3S34L 2OP4H 3NCCB 2P5WD 3IGAA 4PRIA 4F7TB 5CD3A 4KK8C 4FQXD 2ADJA 3QNYA 4X6DA 5E8NB 3ZTJH 2XY1A 1E28B 2EH7L 4OZHB 5AD0A 4KGJA 1IGML 4PJXA 4IRSA 4TNVK 1HI6A 4GKSB 3VI3E 3H7BB 1T80A 1IAKA 3TH2T 5EZLA 4P5TD 3IJSB 1YEFH 4L3CA 2XYCA 3O6LL 2EIEA 4M9PA 4O2FB 3WHXB 3D3VA 3U7AA 2DQCL 5TDOA 3GMNB 1NFIB 4PGCA 3SGDI 3E6HB 2VXSH 1YECL 2EH8L 3ZYJA 3BZDA 3SKJL 3DX8A 1E4XH 1QLRB 2VLKA 2YA0A 3LDBB 3NA4A 3HC0A 2W0FB 4OAWB 4LVNC 4WY7L 2E6JA 1S8DB 3VRJB 2NW3B 4UINH 1JWMB 2A6KA 2X6MA 1N5AA 3MRQB 5F97E 3DVNB 2HWZH 5D7IA 1HIML 4PIRF 3CX5J 3P2TA 1RVFL 1FFQA 3FT4B 1GZPB 2EO1A 4MAUL 3WLBB 5HGHA 2B4CC 1EIBA 1QEWB 3FO1B 3IYLW 4TUJB 4Z7WE 2NYYD 1GOGA 1A7BA 4JQVC 5ETUB 5EA0H 3LD8C 4XHQA 3TN0D 4WO4B 2FR4A 1V3MA 3U1SL 1WISA 4MA7L 4NCC1 4IMKA 5GISH 3HNTL 1P7QA 2X42A 1U41A 4K9EH 4YR6B 2EDYA 5B38B 5I1EH 1FAIH 1JNHA 1FNGA 2R56H 4HIIA 5JIHA 2O26U 1T83A 1M71B 1MFDH 2NY5H 1WWWX 4N9GB 3BUTA 3KLAA 2V2WA 2KDGA 3PUCA 1A64A 3AB0C 3H7BA 4RMUA 2EKSA 5JO5B 4PREA 4K55A 3ZO0A 5DEZA 3G5XA 3TFKD 2P8LA 3ULVF 3GKWL 4V1DA 1KV3A 3MREA 4QRTB 3LN4A 4Q6IB 2AVGA 3B2VH 5C1MB 5I76B 4U7SA 4LLYB 3V0VB 4D2NA 3RWFA 3L3HA 4XP4L 1BOGA 2E6PA 3MO1A 4UDUB 1QZ1A 1U3HB 2HG5A 1SM3L 3V5KB 2VXVL 3QP3A 4U7MA 2IPUG 1KJ3H 4YLQT 3QUXA 1WEJH 3U6RB 3QT2A 3KYOB 3AGVA 1WQVT 3CC5A 4MSWB 1DUYB 1AD9A 3BW9A 4K3EH 4TUJA 1QFUL 3MRDA 3UTZB 3U4EB 1HSBB 3O0RL 4K3JL 1N59A 3LKOB 3SDDB 2OTWA 3IDMA 5F9OH 2P46B 1NCBL 3HG1B 3DJ9A 1R5IA 2WWMD 2YKLL 3CDGA 3LS4H 4XPAH 1P2CA 1J8HD 1B0GA 3QHFH 4HUUB 4JZNB 2CUIA 3JUZA 4L9DA 3O2WL 5KVDH 1PY4A 1YN6A 1MLCB 4N90E 2OL3H 3DETC 5E0QA 5BS0E 5B3JE 2GTZB 1PZ5A 5I1CH 1L7TL 5EBLB 5JOPE 1LDPH 4OB5L 4APQC 5ADOH 2PTTB 4U1NA 3MV8B 3RVVC 3IS1X 2PCPB 3QXUA 1OQOA 5D96C 2A9ML 3WHE0 3L5WA 1I75A 2Y6SC 2GSGA 1MREL 3VA2C 3EJJX 2AJYL 4XP6L 1A4KA 1H3WM 3O11A 2BVUA 4UOW0 1HCVA 3ET9F 5BW7A 3O8XA 1XF4A 4Y2DB 2PYEE 4LLYA 1CICC 2CIKA 5JUEL 1KPUA 3D39B 4OI7A 4M7ZB 1I3VA 4UDTA 4KTDH 3AFLA 4HQQL 1GPOL 1J12A 4NDMA 2A1WH 1FVCB 3ARYA 1NCAH 5F7EH 1IMHC 1HHHB 2MJWA 1OW0C 2DQGH 1PKOA 4JKKA 3SO3C 3CFKA 1J86A 2GJZA 1RUQH 4ONHB 3R06B 4CVZB 5FECA 2BZDA 5BVJB 3DUSA 4P2OC 4DKFL 3BW9B 2BSED 1KF9B 3JWOC 5EORL 5IHUH 4BZ1L 4GXVH 5I8OH 2HAZA 4X80L 4RX4D 1I1CA 5BXFA 2C7UB 3JV6A 2BRRH 2JJSA 4QLRA 5HHOD 4XPBH 4YXLH 4Z78B 4TUOB 2AEQL 4O2FA 5F8QC 5FYKL 3I84A 2X9YA 1W72H 2VLRE 5FO7B 2UUDH 3WKML 4YDIH 5L8JB 4Z95H 4PGCB 3MOQA 4DAGL 1PX4A 3FT3A 1CS6A 2WBWB 3KPOB 4N8VA 1T7VA 4N9OB 5FGBC 1ZEAL 3G6DH 1WWAX 4C58B 2G2RB 3UDWC 2B4CL 2NY4B 2OI9C 5D7KD 3T77A 3X12A 4PV9A 5JOFA 1JYXA 1BVKA 1UCTA 2FYYA 4NWUL 5CP7B 4WTXA 4LARL 4Z7OE 5JDJA 4Y5YB 4P2OA 3HNTH 4BSVB 3FT4A 1YNLH 4P3WA 3E8UL 2AJZB 5T3ZL 1REIA 4RWYH 2EZ0C 3LQAC 1F02I 3MOBL 5IF0A 5DWUH 2J2ZA 3FQWA 4DN4H 5F3HA 5DJYA 4X6FA 1AKJA 3VMOA 3MLZH 4AENB 2DAVA 2HTKD 5ILTL 4JRWA 3CFDA 4HIIB 3TBWB 4NKMB 4PB9H 1EJOH 4ZAKB 4M4PA 3NN8B 5I0ZA 2Z31A 3RI5K 4HWZB 1AXSB 2O5ZL 4PJAA 5DLMH 1XGYL 5E6IC 4BFGA 2X7LA 5HYJE 1N4XH 5JO5A 5E2JA 4HC1A 1JHKL 5DUPL 3FFCD 3NBNA 4MJID 2O5YL 1Q9WB 4KK6C 4V1DB 2ZSVA 3DX7A 4RMWA 3VWJC 4WFEE 1DFBL 3QO1A 1ITCA 2H1PL 1D7FA 1I7UA 1ONQB 4KKAC 4UDUA 3AS1A 3H2WA 2HFGL 2LV4A 1TCRA 4KRPB 4JDTL 7FABL 1IM3A 3O0RH 2L0DA 3SJVE 4KDWA 5DQDL 3GSVA 2NY1D 3KGRA 1N6QH 3T77B 4G9DA 2NY3C 4ZFFB 2GUOA 2ZZUT 5MEND 3VFGH 4FHBD 3LKQA 3KYMA 3ULUH 4AEFA 4JJHA 4O4YL 1V7MH 1DUYA 5EPMA 1D5IL 4Y89A 4N8PA 4DW2H 4NO2A 4R96A 1QSFD 3PF2A 4J3UA 5DMGD 1ADQL 4QXUL 4RIRB 4FG6C 1NFDF 5BV7C 4OIIH 1OARH 3BDYL 3MV11 3CFJB 3RVTC 4R26H 4DVBB 4C56A 1QSEE 1PD6A 1MCQA 4YGVA 1C5CH 1ZT1A 1N64H 5D7LD 4KY1H 4KKLC 1FYTE 4M7ZC 2IFFL 4JHWH 3MLYH 4Y88A 4Y4HD 5LJYH 1IAII 3TNMA 4HBQA 2VABB 1IE5A 4ZAKA 4JN1L 4HS3B 3IETA 3MCLL 4QRRE 5AD0B 5L8KB 1E4KA 1KTRL 4YNYA 5MEPA 1GH7A 1AD0A 3P30H 4FQPA 1G7PA 2H8PB 4DUWA 2ADGA 2NXZD 4GLRH 3O3AA 4IRJB 3R8QA 1RQ5A 1Q9WA 4OT1H 5F6IC 2IH3B 2X10A 1U58B 4K9EL 3FHAA 4XPAL 3C6SB 3EO9L 1KLUB 2FX8L 2V7NB 2F5BH 2DQDH 5A16A 3DX8B 3U1SH 4ZS6C 3GSQA 1QD0A 4DZ8A 5ICZB 3HC0B 4G6JH 4OAWA 4PGEB 2AJUH 4POUB 1HHHA 3TN0A 5CHNB 5HGDA 3RIAF 3VW3H 3QUZB 2A0LC 3EOBA 4LVOB 3EOTH 3L3KA 2DL9A 3B9KA 1LO0H 3VRIB 3X11A 3LKQB 4JFFB 1A5FL 4NFDA 1AQKL 3GNMH 4U3XA 3VDBA 5DHYB 4UQ2A 1FCGA 4DOHE 4EKXA 3UTTB 2F74B 2I5YL 4HGMA 5GZND 4NKOB 4PD4K 5DC9B 1U2CA 4H20H 3WFZA 1AE6H 4WO4A 2FR4B 3HC4L 3DV4B 4LASH 1XR9B 1I7RB 5GRZA 2JF1A 3NOIA 4TUOA 4K3HA 3QJHB 3ZDZE 4CVUA 3FQTB 4FNLL 5D5MB 3S35H 3U9PL 2WV3A 5DJZB 3O9WA 4QHMA 5B38A 3OAUH 5FOBB 3EYSL 1RUQL 4QGTA 4NM4H 1BVLB 3T0EC 3WFBL 1GPOH 4N9GA 4XCCL 1BIIB 1U3YA 2CRYA 3KPOA 4PJEA 4MJ5B 1WT5C 4PGZA 1DBAH 3RGVB 4G8FB 4JQVA 3ZKXC 2EKSB 4I4WA 3NCYS 2BXYA 1WBYA 1A2YB 4XC1H 2UY6A 4EQ2A 1EEZB 2VTFA 5MP6L 3KPSE 1MRFL 4FQXA 5EZJB 1NCDH 3UYRL 1Z0NA 5IWLA 1BZ7A 4I48A 2A77H 4PJFA 4MB5A 3EFDH 3WYRA 1T6VN 2DLFH 4X9GA 3OKLA 4HKJA 3UZQA 4WO4C 5GSVB 1B2WH 2NTSP 3VI4F 4CDHA 2YS4A 3UZVB 4F9PA 3FL7A 1TZIA 1KGCD 4ZOEA 3EOYG 4Z77A 1EVUA 2VDNH 5GS0L 1KN4H 5DR5L 3VXUD 4MQXC 4UQ2B 5H35A 4JGJA 3CFDB 3TBWA 2XTJD 4NYLB 4YXKH 4DCQB 4PP1C 3O2DH 2EDNA 1QO3B 1F6AB 4NN6B 4HWZA 1P4BL 1RV6X 1BFOA 3T65B 4MX7B 1I7RA 2GITA 3CVIH 4HK3N 3MV7D 1UB5B 4KVNH 5TF0A 3EO9H 3PABA 5GIRB 2G75B 5DTFB 3KPPA 4LHUB 1MIML 1RJCA 3SDYH 1ZLVK 1LO5A 2ZUTA 4APQD 1S5HB 3PG2A 1P6AB 2HH0L 2RFXB 3F7VA 5ALCH 3O3DB 5TDPA 2J6EA 4FFYL 1Z9OA 3KYNB 4JRYD 3FQUB 2PCPA 2EIBA 5I1JH 2CGRL 1Q9KA 3ROOA 3CSBA 4PGBB 2DQEL 1A6UH 4S11A 2J8OA 4WHYG 4P2QE 5GRWA 2AXFB 3ZMRA 4PTUB 1TETH 1FL5B 3ARBB 4F9LA 4ZFFA 2B20A 3WXWL 4Z5RB 5T5FH 2CKBH 2ZUQB 5HYJD 4U3CA 1M7XA 5E2UH 1LEIA 1BM3H 2XWBB 3KJ6L 1PVHA 3TVMD 2RJMA 4X7CC 5BJTB 2R0KL 4OGYH 3OKKA 3QEQE 5C0ND 4X9IA 3FQNA 3B9KD 4F57L 4OV5B 1MCKA 4TRPL 1JCKA 2XN9B 2W65B 2LABA 2ZJSH 3I50H 1AC0A 4UT9L 3LS5H 3HC3L 5EU6B 3TNMB 1L6XA 4M6OH 3B6SB 4MCZA 4D94A 1QO3A 2ZCLL 2HFGH 5KVEH 3TPUB 5B3NA 2CDEA 3QEGL 4MNGE 4Z18A 2H8PA 1MRDL 3SKMB 1ULVA 1AR1C 3F7PC 4TPRL 5B38G 4OZ4A 3KPPB 4NQCD 3TBYB 4XC3L 2Y06H 1U58A 3BP4B 2YUWA 5SWSE 3TYFB 4LSSL 3HNSH 4FP8L 1NSNH 5IBUG 5C09B 3I6GA 3UTSA 4PGBA 4WGWB 2IQAA 3LVEA 3RVXD 1UJTA 4NRXB 1EA9C 2ZG2A 5JHDD 4RAVA 3L3KB 5HPMB 2DQJH 1L9NA 3IFNH 1BVKB 1N64L 2JJSC 3L7EB 3VRIA 1SYSB 1MFCL 4JFFD 3QCUH 4E0RB 2GJ6D 3WO4B 4XRCB 3W9EB 4PRPE 3UTSD 2BJML 2XZAL 2BY3A 4TQEH 1SY6A 4RCAA 3SEPA 5HYJB 3BO8B 2JJVA 4YAQB 1TDQA 2RCSL 4LPYA 3FQWB 4PJDE 3O3UN 3CXDH 1CK0L 4U6XB 3G6JA 4I2XB 4NQSA 1OAUH 1RIVL 4G6FB 1G0YR 5I30L 1IAIH 4OM1L 3ARDA 3FO0L 1ZHKA 5F72S 1DANT 4TVPE 1NEZA 1LO2L 1MFNA 1BIIA 4UUJB 3HLAB 3MRJA 3HMXA 1KYOJ 2X7LB 4JO2H 4MXWL 1MVFA 32C2A 3L5JA 5IROC 5JIPA 4P46C 5J6HB 4PJ5D 4KAQH 3DX7B 1BQHA 4P2CG 2DLIA 4YDLB 1XCQB 3THML 1E4XI 4ZPVB 3ES6A 1MCNA 4PRPB 1KB9J 2J8UF 1WZKA 3JWDH 4PJFB 1ONQA 5CJOL 2D4FA 1KN4L 5DR5H 2DMBA 1YMME 5HYFA 3CZJA 5D72L 1Z2KA 2H3NA 2FO4A 2VAAB 5CINL 2WSKA 5JIIA 3AS2A 4EN3B 2HMIC 4HKJB 3L3DB 3MLZL 4PJDB 3UTSE 3I02B 3IJHA 2A6KB 2AK1H 1N5AB 3QCVL 4YHIA 4HWNA 3P0VH 2V2XA 3IDYC 4CW1B 4D9LH 2GUOB 1GC1H 3EYUL 3VFPA 1RJLA 4G7YL 3C6LD 4MJ6B 3MJ7A 2DTML 3OKEB 2NZ9D 5MENA 1H15B 4HUKB 1UACL 1DUZB 2VYRE 3UZEA 3CGTA 4MNGA 4RFNC 4BZYA 1VSCA 4RAHA 2DIAA 1QR4A 4DUXA 1EH9A 4GO6B 3HZYB 4PRNB 4KV5E 4NQSB 3C09C 4F8QA 2EO9A 4KMTH 4NZTH 4CVXA 2ZSWB 2VZ3A 5IQ7L 2HT3C 3MXWH 1JWUA 1LO5B 5ISZD 2RFXA 3F7VB 1M71A 1OSZB 4FXLA 1G7JA 2ICWA 2UWEA 3GFUA 5D7LB 4YJZL 4UUJA 3QEQA 2D9QB 5ICYB 3D25A 3MGOA 4KXZI 2ADGB 1MHEB 1VB9A 3VXPA 1ZA3B 3KPRB 4NO3A 1VPOL 2BJMH 4DOHB 3QG7L 2WUBL 4IDJL 3IVKA 4TSAL 4RX4A 5K9OA 1OT2A 1FFOA 4K3DL 4EVNB 4XHJD 3QIUB 3CFCH 3S34H 5F7EL 2UZIL 3JV0A 2XACC 1IEBA 3RJDA 1HXYB 2YD1A 5C0EB 2ICCA 2DLTA 1MCRA 5D5ME 5I6XB 5IB1A 7CGTA 4WW1B 3RDTC 3B9KB 1NMAH 4PJXF 3ARQA 1K5NA 4X6EB 1A7OH 4M7KH 1L7TH 1S7WB 2E9BA 3UTTA 4NQEE 3B6SA 2BCKB 3V5DA 3T4YB 3GI8H 4ZFZB 4EUPA 4M61B 4NNPH 1NKOA 1RIUL 1H5BA 1RK0B 3QJHA 3ZL4H 4JAMA 3FRUA 4OGYL 3DRTB 2ZSWA 3BQUB 4M6NL 3PJSB 3BJLA 3QPQC 5F71A 2UVEA 5EBLA 4U1KB 3VXUA 1CCZA 3VI4E 2WQRA 3KDMB 5ITBH 2A83A 3GB7A 4LASL 2DI7A 5DZLA 5ICYA 5ALBL 5I1AA 3QUMH 3TBSA 5A3IC 3FFDA 1ZA3A 4HEPG 1GGBH 1T89C 1MFAL 4QXGH 1KCUH 2APXA 4MQXD 2X1OA 1OAQH 2EYSB 4LHJB 4U6YB 2DM3A 5IW3A 2X70A 3B9DA 4FFYH 3W9EA 4D9RD 3O9WC 4TSBH 5CLWA 2HKFL 1M6OB 3EGSA 2EDHA 3OAUL 2CO6B 4BELD 6FABH 5GZNC 5JORA 5KSBF 4WI4A 4JDZB 4P9HC 3PWPE 5D7SL 3IAGC 2IQ9L 5E6ID 4NWTH 1T89A 4PJ9A 1G7HB 3OHXA 3RGHA 1MFEH 4NN5B 4P2QD 4WFFE 2PNDA 1A6AA 3RKPA 3DYOA 2C7UA 4I9WE 3RVWC 3QDMB 4UAOC 2QQKL 2HJFA 4HIJA 3H9SE 3K2UL 3OQ3B 7FABH 3BPOC 32C2B 1CXIA 5FO7A 3DWTA 2OR8A 3RP1A 3QIBB 3V4UL 1G9MH 5F1IB 3V6OE 4U1KA 1T21A 3EFFB 4J3SA 2VLLB 1NQBA 3ZDYF 1JPFB 4TVSa 1C08A 3BN9C 1QLFA 1J18A 3BD3A 5HY9A 5JZ7D 1VFUA 1NFDE 3T0EE 3FFDB 4OLEA 5GHWL 3S5LA 1HKLH 4ETQB 2OK0L 3SDDC 3U30C 1T2QL 5ALCL 1DQQA 4ZAKC 3RUGE 1A6TA 3BKCL 3NPZB 4HWBH 3QWOB 4LSRL 1R3IH 1CDIA 1RI8A 4M00A 3KPLB 2YEZA 1EERB 1KELH 3IB4A 4PJ8C 2ZOLA 2EDTA 4NQVA 5D71L 2K7QA 1AGEB 2O61A 3LN5B 4FQ1H 3HZYA 5CEZD 3D9AH 4AEIL 4DKAA 3SCMB 4H1LA 5HTSA 2XA8L 4OCXL 3LH2L 3RWJB 1RUKL 4JREC 1Q72H 1NCTA 2XQBH 4XT1C 1CLOL 4P4KA 5I8EB 4WI5A 3GRWL 4LSPH 2BNRB 2GSIB 5CP3H 2CXGA 4PJHB 1RURL 2QADC 5D7LA 2GKIA 1B0WA 2EZ0D 2MQ0A 4XNZC 5DA4A 4GG6E 5E2VL 5D1ZB 3LSOA 1AKJD 5T33H 5E2UL 4PJ7E 3NFSL 4XVSL 1X5LA 2AJVH 4Z0XB 4YHZH 4M6OL 3BE1L 5HVHB 4XWGL 1X4XA 2P42B 1FGNL 3QIUA 2E27L 3NIFE 3OBAA 5JA9A 1QBBA 1JPFA 1TCRB 3BQUC 1IEBB 3SJVA 2IQAB 4WI6A 4F7MB 3V4PH 4MXQD 4FQLH 4YC2C 5C86A 1G1YA 3QUZD 3NH7L 3NCBB 4G9DB 4G7VL 4WENB 1CXFA 5FKPA 3BGFC 3DI3B 4P5MB 5ITBL 1BEYH 1BOYA 3H9SA 4U2YA 3V9FA 4XRCA 3WFDH 3S35L 3QWOA 3QCTL 5JXAL 4Y16D 3U0PA 1M7IA 1DQDL 4K71C 5HYJA 1C12B 1JGVH 1I3RB 4NQVB 3HC4H 2C3HA 4MJ4A 4HGWB 2B7DT 5E56A 5L2KE 4G7VH 1AH1A 4X9BA 2EDEA 2X4RB 4FQXC 1F11B 1H9VA 1VCAA 1H5BB 1RK0A 4XPGH 4XC1L 5JPMA 1MCCA 1ES0B 3VXRA 4HIEB 5DT1L 2Y36H 4ODUB 3GMRB 4GRMA 2GIYA 4GRWF 3STBA 4GAYA 2AQ2A 3BIAX 1JPSH 4RFEB 3RY6C 2UZXB 3PDOB 4HHAA 4GKNB 1R6VA 1RULH 4YNYB 3SDAD 1U8QA 2EEBA 4LFHG 1PY9A 2IPKB 5J1SC 4RMVA 4YDJB 1UWGL 4OFDA 5GS3A 5GS2H 5IW6B 2EIDA 4KKCD 4YO0A 1BQSA 6CGTA 3C6SA 1JK8B 5KZCD 2X70B 1JRHI 4AEIH 2Z31D 5F89A 3L3DA 1KIQB 5HGDB 2H2SD 5EO9A 1CDCA 3X11B 1XGRA 4FMFA 3GJFA 3CUPB 4WWKD 5IVXA 2IBZY 4DVRL 4M6MH 3TBTA 5F1NB 2ZCKH 1CFVH 3DX9B 2HVKA 5IB3A 1H15A 2K1MA 2IF7A 3HE6B 2H1PH 4GRWB 4I3RH 4ZO6A 5SX4H 3FCTB 4LCIH 4PRHB 2DQEH 1YDPB 1FLTX 1LD9A 4KUCF 3VXQA 5TDNA 3FQTA 4JFEA 5D5MA 5E99L 4GBXB 5KVMC 4NO5B 4HIEA 4BQCA 4X8XA 4QHMB 5FOBA 3MLPA 3EOAB 3FN0H 1FGVH 4JKPL 5T3ZH 3NA9L 3V4PL 1BVLA 4UV7H 3MACH 1BX2B 5F21B 5C6TL 2VLLA 5D7SH 1GC1L 1BM3L 3KJ6H 3O9WD 3LS4L 3UYOD 5ILTH 2YK1H 4QYOB 1X5FA 4AQ1B 4LCYA 1NBYA 4JPIB 1QBLL 1GGCH 3C8KB 1LK2B 2X4QA 1YC8A 3S5LB 1RZFL 4J3TA 3BX7C 3MLRL 5AYUH 3CVHA 2PYEA 3J7HA 4ODTL 1BJ1J 4BQBA 3MACL 4F15B 2UWEE 2O5YH 1IT9L 3CAFA 4ZNEA 5J12C 5IEHA 3GI9L 4XXDA 1G7IB 2YEZB 1JRHL 3PGFH 5D1ZC 1DBJL 5CS7A 1MY7A 1HSAB 3TO4B 4HWEL 1XEDA 3FQXB 3DURB 2EDLA 2DL2A 2GQHA 3GSXB 3GJFB 2YUZA 2DQTH 4MA3B 3LRGA 2VLJB 1S9KC 1ZTXH 3ROLA 1OGAE 4F15C 3A6OA 4YC2B 3VFVB 5H35B 5IP4A 4LEXL 3HRZA 2Z8WC 1KCLA 1O5DT 3LEVL 4LSRH 4ZFZA 4EUPB 1ZKAA 1YEJL 2GITB 5L7XL 2V2TB 1YDPA 5D1ZA 4KUZL 3FRUB 3RVVD 1E4WH 3GJEB 4Z7WB 1DDHA 3V4VH 4MQSB 4FFZH 4L9LC 4UILL 1MWAA 1U36A 4YBLC 4M43H 4KKCC 1Q1JH 3O3DA 3HNSL 2VZTA 3OR6A 4YHKH 2I07B 3VDCA 2UZYB 4XAKD 2AJXH 1Q9KB 4QYOA 1QFHA 1IKNC 1F58L 1RIUH 5E9DA 4WU5A 4Y5VB 2GJ6A 4R7DB 3OSKA 1FPTH 4Z76A 1MHPL 3F58H 1IQDB 3BWUC 4R26L 3ZKMD 1M4KA 5DVLA 4Z7UA 4C56D 4WFFD 1D6VL 5L9DL 3Q1SH 5CIPB 5I18L 5T5NG 1WF5A 3CVHB 4XPGL 4LCWE 3BRFA 3TZVD 1LEIB 4J7RA 2APWA 4X0KB 4ZFGH 3I6KA 2XFXA 1R0AL 4UBDC 3QBTB 1EPFA 4XH2A 1NDGB 1WWCA 5DQJA 4IHOA 4WI8A 4ZQKA 4BSWB 3GSXA 3Q1SL 2FNBA 1TZGL 4P5TA 4U0QB 1JPST 1KIRA 2QHRH 3MGAA 4NZJA 5HI3C 1QR1A 4TN9A 1CDHA 1XH3B 1NEUA 4ZTOH 1J0IA 2N56A 4PPTA 1AGCA 1IGCH 3WEXB 4MCZB 1OTUD 2ILLA 5F7MC 5DJCA 4HHAB 4GKNA 1I7ZB 5I15L 4N0RA 5E6YA 4JM2B 3BQUD 5AWNL 4CBPA 2V2TA 1W8NA 5GZOD 1EZVY 1X6LA 4RWYL 4LLWA 5FYJU 1MHHA 5EU4A 4Z7WA 1RUMH 2FGWL 4IOFC 4PR5B 1N8ZA 5F1IA 3MYZA 1HZHL 3V52H 1JF1A 4KMQA 2XPGB 4JG1H 4FFVC 2VQ1B 3QEHB 3WXWH 4FQ1L 2A74B 2QV2A 1NGQH 1HH6A 1RURH 1VACB 4FFWD 5FCSH 3KLSA 4MQ7B 1MCJA 5E8EB 1Q9LA 4X5LA 1F8TL 3GIZL 1HZHH 4YDKL 4LSPL 3KNBA 1P7QD 4EI6A 2OL3L 1TZHA 3DYMA 3D3VE 1UWXK 4LPTA 5BS0D 2C3GA 3DBXB 4NFCA 4E42B 5AG9A 5CZVL 3O6FD 1MVUA 1T66C 1IKFH 2ATKA 1A1MA 2VDLL 5TGBB 5IBLD 2IAMB 4JZOB 3QDHA 4OZFG 1N6QL 1J87A 1BPVA 4Y0GA 4XX1E 4I2XA 4O2CB 3LKSA 3ILPA 3OKMA 1FIEA 2AJYH 4NQED 2WUCL 3TPKA 4RGNB 4HJGA 4KI5C 2C1OA 3TO4C 1EK3A 4I0PD 2PYFA 1H3UA 2QTEA 1NEZB 2NX5D 1YUHA 4LVHB 4NO0B 4HDIB 3X3GH 4J4PA 4PJHA 1MSPA 3ARVA 1HIMH 2VZOA 2E7MA 3TP4A 3V7AG 3U0WH 1NBYB 5L2KB 5LAXB 2KUTA 1NANI 4LLUA 1EXUB 2D7QA 3QO0B 2J8HA 4P2QA 5FGSA 3OGCB 4NBXB 3GMPB 3NVQA 1NGXA 3NGBB 1HH9B 4M8QB 4D0DA 3TO2A 3GUTB 3G6AB 2EDJA 1HHKA 2CKNA 2FATH 1HOCA 5J13B 3RBSA 4F7MA 3NFNA 4Y4KA 5A2IH 1R5WB 1N6VA 4K94H 5I1GL 5E8EA 1KLGB 1E4KC 1IC7H 1S5IH 1BAFL 2OJZH 3CK0H 3DIFB 2Q86B 1EZVX 3WFBH 2BNQA 1OAZH 4LEOA 3ARGC 1J8HE 3MJ7B 1BVZA 4F58L 3D1MC 1RZ7H 1M7DB 4MZ2A 4XBGB 3H3BC 3BPNB 5GISL 3U0PB 1M7IB 5IGXH 3RQ3A 1PAMA 4HT1L 4MNGB 2QL1A 3QDAA 3P4NB 4GAJH 4D9QE 1II4E 3TA3D 5F88B 1B4RA 2ZCHH 1JHLL 3AAZB 3PL6B 2A9NH 4AJ0A 4YHLL 3DV6B 4O2CA 3LKSB 1V3LA 3EYOA 4YWGL 1FJ1B 2PO6B 3OMZA 3W39B 2ED9A 2C1OB 4YHOH 3QDGB 3GMRA 2YBRA 3OR7B 4J4PD 1MJ8L 4QHNA 4GAYB 4XNXH 1OAQL 1G7JB 1FLRL 4O2EB 2PN5A 1KJ3L 1K4CB 1NGPH 5ALBH 1FN4A 2YA2A 3QEQB 2VDKL 4DGYH 5LWYL 1FDLL 4JN2B 1TQCB 3VXNB 3UTQB 5ISZE 3FB8B 3UPCA 3QO0A 4R3SA 3REWB 5CBAA 1RZ8B 4RRPA 4CDGC 1IRAY 4X6CE 2GI7A 2XZCL 3HI1B 5DO2D 3L3IA 5IVZA 4B7LA 1I1FB 4M8QA 3FOLB 4PJEE 2Y9RT 3UAJD 3F6IA 3AM8C 4Y8AA 5I8CB 4O00A 1NUGA 3I3DA 5DWUL 2H45A 4S10A 3Q5TA 3F8UB 1A47A 5DO2C 4Q97A 4ZQKB 1A9EA 4JO4H 1X5GA 2CJUH 1RSFA 2WMPA 4Y16B 4KRLB 1T7YA 1G7LA 1O0VA 4K8RL 4M6AA 4R90L 5F1NA 3HNVL 4I0PA 1MAKA 1H3GA 2HLAA 5DRXB 1KN2H 3RNQA 1BBJB 3HMWH 3V5DB 4TNWK 3K8LA 3KPMB 3T4YA 5DJCB 2I60L 1U8JB 4C83A 5C0BA 4YFDB 4XB8A 5I73B 5DD0L 3FB7A 3DV6A 3UJTL 1MCDA 3UEZA 5EU4B 4U1JB 3BQUA 5CLTA 4PR5A 4H26A 1L9MA 4NGHL 4CMHB 2D0FA 1TVDA 3ARBD 5C0IA 2EEDA 4F3FB 4O4YH 4O2EA 1C5DB 2B1HL 1F97A 1J0YA 1MWAH 3N1QC 1KCVL 1PG7L 2FSEB 3GB7B 1VFAA 4L1DA 2FBOJ 4OGAD 4JN2A 2HTLC 3E6FB 4KVNL 3A6BL 4Q7DA 4FXGB 5FEBA 4LARH 1A3RH 3LHPL 4MQ7A 2K9UA 5JA8B 3TEUA 5IV2A 2LQRA 2DLEA 2EDBA 3ULUC 4YPJA 4DTGL 4GOSA 2E7HA 1T5XA 3K4ZA 4HKXA 5SV4A 1NGYA 2XRAL 3L3IB 4JFYB 5JW4R 4DK6A 4J6RH 4DGVL 5C8JB 1B6UA 5KVEL 5DK2A 1JP5A 1CLYL 3RRQA 1KELL 4OFPA 5I8CA 2E3VA 4XP5H 3WNLA 4PGDB 4XP9L 5J11C 2J8UA 2X89D 1DBMH 4JB9L 5D2LE 5B4MD 2BVQA 3SE4A 4H88H 1XGYH 3L95A 1HXMA 2ESVD 4PJHF 4LVEA 5JORB 3HE7D 4Y16A 3FN9A 4ZUVA 5E4IA 5EWIH 3BAEH 4PLKD 3DO7B 1YJDH 3C60B 3D6GA 4OQTL 3T0WA 2Q8AL 3SPVB 4P2YA 1FHGA 1FZKB 3SDXA 3HRZB 1SYVA 2O5XL 2W1NA 4G7YH 1T83C 1S9XA 1SEQL 3RHWF 2HJFB 5D1QA 4NJAH 4ZSOA 4PJCE 5MEQA 2D7NA 2PXYA 3TJEL 5CFHA 1XCTB 1WBXB 1TIUA 5H37H 5TH2A 1ZEAH 2BSTB 1XGUB 2OLDA 3OJDA 4NT6A 3QQ9C 2AXJA 1BEYL 1T21B 2ITCB 3S88H 3NACL 1JBJA 2GFBB 2AJ3A 2HTKC 2VC2H 4GRWH 2X4TA 3MJGX 4NCC2 5J7CC 5DQDH 3EBAA 5ECJE 5DQ9A 2EDFA 3VD3A 2P24A 2DQFB 4RDQG 2CLRA 5H94B 3WS3B 1JZ2A 4TTDC 3C5SA 3NFNB 4Y4KB 3MBEB 1MJ7H 3FRPG 3RX5A 4LFHD 4P4KD 4KMLB 5IHUL 1NBVH 2HJLB 1WZLA 1I3UA 4KI5E 4NC0B 4O5LH 1P9MA 4AEHH 3VXMA 3SDCA 2BNQB 4F2MA 5KBNC 4GW5B 2IAMD 4QHUB 4Y4FC 3C87A 4HAGA 1MPAL 4HCRL 2CMRH 1W72L 2G5BB 5JHDA 1BFVL 5DQJB 3TT1L 1DTUA 4BSWA 4PB9L 4JLRB 1AHWC 1PSKH 5E7BA 1DEEA 1S9YA 4P2RD 3EIFA 1E4XL 3O3EA 1FJ1A 3RWJA 5GGRA 5HHOA 3SPVA 4KK5C 1UWGH 1S7TA 2PW2B 3MCLH 4O9HL 3BN3B 3QUML 4P5KA 1U8KB 2C3XA 2DM7A 3KXFA 3DUUA 4Z7VE 3QZWB 2I9TB 3GBML 1G6RB 2FB4L 4WU7A 5DGRA 1FORL 5F1OB 1A1OA 5JPNB 4APQA 5DMGC 3RVUD 1A6WL 3KG5A 3LKPA 3RIFF 4ZSOB 5IGXL 4JVUA 3O6KH 3PWJB 5A40E 1KIUA 2XG5A 1XGTA 4HWBL 2MMXA 3REWA 5CBAB 4XPTL 4OLVH 5M94B 5GGTA 3C5ZC 2OR9H 2I25N 3MNVA 1A21A 5E8PB 3FFCA 1WK0A 4XVTL 2DLFL 1Y0LA 1AR1D 4NZDA 1X5AA 1W8OA 1ZLVH 4E5XB 1GGUA 1X9QA 5TJWK 3GMOA 2XKUA 2VWEE 4U6HA 1FE8L 2VLRA 3I2CH 4M93B 1AP2B 4X6CB 1PKQE 3TA3A 3PIQB 4FABL 2CD0A 4YX2L 4XI5C 3MQIA 3ARDC 4BZ2L 4UQ3A 1D5MB 3V0WL 1DBKL 2BNQD 2P8PA 1RJZB 2B2XL 3GSRB 4L8SB 5EFIB 1U8MB 3GSOB 1NLDH 1RAMA 3QI9C 4TYUA 5C0BB 4C83B 4FNLH 3QG7H 3MOAH 3Q6GH 2P5WE 2F9BT 3BE1H 2J5LB 4YK4B 1RD6A 1ES0A 4OD1L 3VXRB 5GGRB 5HHOB 4IEFB 2PYFB 1JZ3A 1X5YA 3RKDC 4ZXBC 1R3KA 2AJUL 2B0SH 3D39E 2VOTA 1DBBL 4M7JL 2HTLD 5EG6C 3BUYB 2DQHH 4AH2A 1I8LA 1CLZH 1OOAA 3C60C 2CK0L 2X1WL 4CMMA 3OZ9L 4FXGA 5J1AA 5C6WH 1OM3H 1XGTB 1YEEH 4NZTL 4W81A 1JL8A 3W82A 3TC9A 5LCVH 4IM8A 3GHEH 1YQVL 5JW4Q 2VDNL 3WJJC 4OKVB 5F93C 1X5JA 2NNAA 3U46B 1FIGL 1RU9L 4RAUB 3PGFL 1Y6KR 4NQDB 4L8CB 3NCMA 4LEXH 4LKXB 1FQ9C 3QRGL 4WHTB 5C08E 2ID5A 4Q2ZA 5JXAH 4IRZH 1DLFL 2VLRB 2ESVB 4KFZC 1F3JA 5KW9L 4WDIB 3DIFA 1UXWA 3RGVC 4J8RA 4QTIH 5JQ6H 1J0KA 3MGTA 3T8XB 3R4DA 4K7PY 3U7YH 5FHAL 1IC5H 4QHLA 4JFHD 1KC5H 5DJDB 1LK3H 4I77L 1C1EH 2IC2A 1IARB 4JRXB 1QG3A 3HB3C 2ZUVA 1ZLWK 3QDJE 3GSOA 1FGNH 4S2SA 4WJ5A 4ZUWA 5F88A 5IHZA 2WQ8A 2VDML 4PRHA 1J1OL 1ZVSB 3SE8L 4LVNB 2A6DB 1L7IL 3GK8H 4R97C 2NLJB 1DN2A 3INUH 3RWGB 4RMTA 3CPLB 4NT6B 4JFDE 1IEAA 2AV1A 2YRZA 3ARFA 3PL6D 4KROB 2AJ3B 1U9KA 1K4CA 3JTTA 1N3NA 2VUOA 3QWQB 1WFUA 2HJKB 1UEYA 3C8HA 2X4QB 5KN5A 4HBCH 4CJ1A 2EDQA 1HE7A 2HJLA 5KAQF 2F54D 4MNQA 2C4XA 4KQ3H 1IGJA 3WIFA 5BRZB 1X5ZA 2D2OA 5K9QG 5FUZH 4NJ9L 4K7FB 2PXYD 1SY6H 5FOJA 2G5BA 5AZEH 3LEVH 3TO4A 1T20A 1YNKL 1EAPA 1JGUL 4LSUL 2B39A 3NTCH 4UV4L 1UXWB 3TO4D 1CGSH 3D3VD 4NKDB 3O3EB 4KUCD 4QNPE 1R3LA 3DXAE 3QAZC 1KULA 5KS9B 4LRNL 5DJDA 1FZMB 3VFVA 1U8KA 3TZVA 1OVZA 2VKXA 5CKAA 3DUUB 3V52L 2I9TA 4ZPTA 2OR9L 4U1IA 2L4OA 3H0TA 4FP8H 1CQKA 2VXUH 2PETA 5B39A 3QFJD 4KPHL 1G0XA 1AI1H 5ACZB 4XBEH 5HYQB 4EDXB 5FDWA 3L6FB 4JKMA 1WLHA 3IDXH 1KPVB 4LDOB 3MLWH 4KJWC 1I8IA 5GQBA 1QFWL 3M17B 5C09E 4M9OA 4Y4KC 3WJLC 2AV1B 2VSCA 4I18B 3RWIB 5TQ2H 4HKZB 1JUFA 5L2JB 5CINH 2NY6B 5EU6E 4NZRH 2P5EB 4NZUL 4CVWA 3PGDA 2UYLB 3MRMA 3PWVA 4U7KA 2NCMA 5GGUB 2EYTB 2VDLH 5EO1A 3IU3B 1IQDA 1HINH 1MLBA 1IBGL 4ZFOB 1WFTA 4X6CA 3WE6A 2FBJL 1OP5K 4IIQA 3P11H 1HEZB 4LLDB 1RUAH 2R2HB 5LKNA 1V05A 1K6QH 1CD9B 1QRKA 1QRNB 4JPKL 5DK0B 5HYSG 2DI9A 4X0KA 1YEIH 4NJAL 4NN6C 1F5WA 4JFFE 4G9FE 5DDHA 5GGSB 1YEKH 4ZYKA 1NDGA 3JVGC 1C5CL 3L95B 5TE7H 4LKCA 1H0DB 4Q0XL 1W0VB 5CZXC 3AU1A 4Z7UF 1CE1H 1ORQB 2K7PA 3WL9B 3DVGA 2OZ4A 4KTEL 1A0QL 2AJXL 5KS9A 4M62H 1FZKA 1OP3K 4IOIB 3V7AE 3V6OC 1WC7B 4X7EC 1RZJC 5KSUB 2V7HB 3V6FB 4H0HB 4UILH 35C8L 2YA1A 1INDH 1KXVC 4F8TA 5FUOL 2FL5B 1XF1A 3VFGL 3H6JA 2VLKD 4M5ZH 5FO8A 4KI5F 5E1HB 4W4OC 4AEHL 4I13B 2BNQE 1NUFA 4LSDA 3EDEA 1I8IB 3IXTB 4M1GH 3C5JA 1ERNA 3FTGA 3PWLB 3RVWD 1AO7A 5EOTA 2VR5A 5CSZA 4QOKB 3RWEB 3QUXC 2NW2A 3OKNB 2A1WL 5SWZA 3JV4B 2NNAB 3U9UA 5F7HA 5D1ZD 3NZ8A 4Z7QF 5EZOL 4MAUH 3ULVE 2Y72A 1PSKL 2CLRB 3WS3A 1OTUC 1NLDL 1ZS8B 4MLSA 4X5WB 3G9AB 4Q2ZB 4JY5L 1MLBB 5IMMA 2BSRB 2C3WA 2QHLA 4GQ9H 5CMAA 3K8KA 1LE9A 5F1SA 2W91A 5D9SA 1KCRL 4NKQB 4HC1H 5I16A 4GW5A 2P49B 5D93C 2IH1B 1QRNA 4J23A 1TZHB 1X4ZA 5FM5O 3M8OH 5FF6B 2E5EA 4Z7VB 2R1WB 5CGTA 4PJHE 1MCHA 1A3LL 4ZUWB 2Y07L 4D3CL 3DXAA 3KPSB 5C0CE 4PBWD 5IHZB 4NHCH 3REVA 2V6HA 3RA7L 4HJGB 1U2HA 1N4XL 4MCYA 2APTA 3KXFB 4HS6A 4KJPD 2EXYC 4XPFL 2NY4C 2PR4H 4OBRA 43C9B 1GIGL 5I17A 3FMGH 5HHXL 5E2TH 4APQB 3W0WB 4NO0D 3E0GA 4PJIE 2HJKA 1ZWIB 4GAGH 1DLFH 2P5ED 2R29H 2B8OT 1TJIL 1K8IB 4LLUB 1KBGL 2ENSA 4KZDL 2X1XR 3B43A 2OTUB 3H42L 3BKML 4O9HH 3ZE0F 3GO1H 1ZTXL 1NGXB 5BZWB 2ORBL 3RWEA 1F4AA 2VZUA 1LP9A 3ULSA 2ICWI 1B88A 3NZ8B 1JV5B 3PL6C 1HOCB 2VERN 2YR3A 4A6YA 1T04B 5GS1C 1WBZB 4E5XA 3OXSA 4RGMC 3GMOB 3RY6A 4X7SL 4ZUTA 1FAIL 1KLGA 2A6IA 2FHCA 5F9WC 1D5XA 1IGFH 4DKFH 5HYEA 5KJRL 2OL3B 4M7LH 2ORBH 3WUWG 4IJ3B 1K2DA 4U1GB 2NY6C 1DSFL 4OFIA 3QFDA 4W6XB 1UZ6E 3DSFL 4P48A 4UIMB 1U95B 1QBLH 2R56L 1KOAA 3GM8A 1UA6L 4EI5D 4GUPA 4ODWB 4LQFH 3UBXB 4AIOA 5B39B 1RZGA 3L3OB 5DJ2B 5MERB 3WFCL 1FCCA 1P5UA 5F7YC 1CD1B 2FECL 3BGAA 3OXRB 3M07A 2AQ1A 3MA7A 2B1AH 1CG9A 3VXSA 3RDTD 1SJEB 3SJVD 3W11D 25C8H 1JN6B 3LEYL 1IC4L 4P46B 3D18A 3QDGA 4NQCE 5C08A 1FP5A 2IGFH 3VFNB 4ELMA 3GSWA 4K94L 3WIIL 5I1GH 3TM6A 5LXGH 5C0AB 3HR5B 2R4SH 2R1YB 3SDAA 4OF5A 2YC1A 5AAMA 4FA8A 2EYTA 3IDYB 5IK3B 1EO8H 4UV4H 1UEMA 1QACA 4ZFOA 1LEKB 1BQLL 3S35X 3TCXA 1UKTA 4GW4B 4IIQB 3HI1A 4P23D 3HAEB 3QFJE 2X5PA 1EMTH 1I8MA 3FOLA 1RMFH 4LPVA 3MLTB 3U46A 5E9DE 4B0MM 4L8BB 3C6LC 4JRXE 2CRMA 1JWSB 1XGQB 2ITDA 3OL2A 3QI9B 3SQOL 4PJAF 2ESVA 1F3JB 3MRRB 2Q1EA 4MMXC 5HPOA 1V3JA 3SCMD 2XA8H 4OCXH 4ZO9A 1FH5H 1NAKH 1SJXA 4YHLH 4I0PB 4NGHH 3T1FB 3MRKB 4JRXA 1ZANH 5GSRB 3SKNB 2DYPB 3KS0H 5EOCJ 5HHNB 5GJTH 4G8EB 3S97C 4YE4L 2V5TA 2JIXB 1IL1A 3HPJA 3LKRB 1F13A 3LCYA 4JPKH 4HG4K 5LQBH 5IG7B 5IFHL 2A6DA 1ZA6A 3FO2B 3S6CA 4XC3H 4H0GA 2GT9A 2YXMA 4U1JA 1JN6A 5TE7L 4PJ5E 4XZUB 3FTGB 4MDIB 2YD9A 5C0IB 4ELMB 1KJ2B 4I1NB 1C5DA 2FECI 4CNIB 4ZMAT 3JV4A 4L3ED 1D5BA 4KDTC 4JO4L 2P47B 4P4RA 5HVFB 4PP2B 3SDAB 1E6JH 4OCRL 4OLUL 1U8PB 4XHJC 3SE8H 1ZS8A 2MHAB 2DBLL 2NX5E 5E5UB 1YEHH 4U05A 1NCNA 3KWWB 4XCEB 1OF2B 2R1XA 3IDXL 4KJQC 3WDJA 5I66A 4KZEL 2FJGA 1UB6B 4PJCB 4JANB 3WXVH 2FX7L 4UU9B 4W6YB 5C7XH 2C3VB 4Y5XC 1IGJB 5BRZA 2BC4B 5C07E 5J0BA 2MOVA 1S7UA 4PJ9D 4QWWC 1U92A 1U42A 2QR0B 3OX8B 3T0ED 1W0WB 1X5XA 4Z7VA 1OD7A 4XNXL 2KQNA 3MV7B 1NAMB 2JB6B 4YHNA 1KTLA 1GSMA 4R97B 1QTYT 1TVHB 1ZLUH 4ZUVB 4G5ZH 4KJWD 3NIGE 3RTQD 3GSUB 1CFNA 3MV8E 3VD4A 1I3GH 3C60A 5D2NA 4OV6F 3RVUC 1GRWA 3G6DL 5JHDE 1KB9K 2NXYC 3FONA 1HILA 1NGWB 3GMLA 3FT2A 4G3YL 1T3FB 2JJUA 5IVOA 4HUVB 3UJIL 5HHNA 2VDOH 1OWRM 2W9LA 1DJSA 2UWEF 5DJXA 2YD4A 5CZXD 3P11L 3VE0A 2CRZA 3AXLB 4KQ3L 1AIFA 3SKOB 2VE6A 3MNZB 3MR9B 4EDXA 1Z9SA 3L6FA 5B8CB 2QJDA 4MQTB 4KRPD 1D5IH 1QUNA 4Y1AD 1AGFA 2CK2A 3TH3T 3WIHA 5T1KD 4R2GD 1LP9B 4PUBL 1DQTA 5I8KL 1RZJL 2CUHA 4F7CA 4Q0XH 5DQ9B 5T3ZE 4MNHA 4PP2A 1JHTB 2P48B 1EGJA 1T1YA 5GGQL 4OM1H 3DTXA 4ELKA 1E27B 2YN3A 1TQBB 1W72B 5T1KB 4RBPH 1UH4A 1WIUA 4GW1B 4JRYA 2FJGB 4PJCA 2FZ3B 2JELH 1Z3GL 3V0WH 1DQLL 4MAYC 2YSSB 2XWJA 3BOVA 5IESH 1LE5B 4OLZL 4YH6A 2E7BA 3SDXE 4UIMA 5E8DL 5HVHC 3V0AC 1QRNE 3RNKA 3MRHA 1RMFL 3IKCB 4ODSH 5E70A 3UBXA 4OIAA 1T1XB 3QJFA 2ICEA 4OCMC 3LOWA 2X4PB 3VXSB 2EE3A 2X40A 4P2OD 5D2NB 1GGIL 2PTUA 1T0PB 1S7TB 2PW2A 1T0NA 4HEME 3AVEA 1RHHA 5DVKA 4YFLF 4JZJA 2YPVH 5CZVH 3DRQB 3CH8A 1U8IB 4WU7B 3TVMC 3VFTA 3ZE1F 2DM2A 2FL5A 4I0KA 3AXLA 3D85B 5EUOA 3WXVL 4V2BA 1CLYH 1AGDA 4ORGB 2GK0A 4GG8B 3U36B 1F4XH 3ARGA 1I8KA 2FX9L 3QEQD 5EC1A 3L5IA 3QDME 2ZG3A 3PP3H 1AY1H 4EOWL 4HG4J 4JDVB 3CFEB 2WP3T 4WFGE 1A6PA 4KK9D 5JQ6L 3TYGH 1QFWI 4ODVL 5SWZB 2F5AL 3ALPA 2Q7NA 1FG2B 1J88A 2EE9A 2YZ1A 1U91B 2XN9E 5HHMB 4U6HB 2XV6B 3P9LB 3QDJD 3ZE0E 3OKOA 1BFVH 5CEZH 3VWKA 4A6YH 4PLNC 3PIQA 3IS0X 1UCBH 5DZNA 5DS8B 4UQ3B 5FYKE 3MRGB 4GG6A 5E6ZA 5JNYA 4FQIL 1EFXA 4OD2B 3MRKA 5FF6A 1Q72L 3W81A 2GCYA 4GMSH 4OUUB 3CCHA 3Q3GB 5DD3L 1MJJB 3D0LB 2JIXA 1CLZL 3LKRA 3DXAB 2AK4A 2Z31C 4OGXL 4L4TD 1QNZH 1DEDA 5E2WL 5IBTL 1UZ8B 4XNZB 5EORH 1FNEA 3QUYC 1TETL 4BH8A 2UVFA 4POYA 5E94A 1TNNA 1KIPA 1OAYH 3QWRA 4HS6B 4Y1AB 2BVOB 1MH5B 3VFTB 4CNIA 1CWVA 4OQTH 3N85H 1I9JL 1FRGH 3BKYL 1G9NC 1I9EA 2DQUH 5DD6B 3T0DA 3BVNA 5HHPB 2IPUK 3QQ3A 4B41A 1NBQA 1C5BL 2Z4QB 1DQLH 3BXNA 5L9DH 4QOKD 2KPNA 1G7MA 1SEQH 5HHQA 1WIPA 5ISZA 1OSPH 4XNQB 4G80B 3CFEA 1BWWA 2QQNH 2Y07H 4XI5D 4GXUN 2BXZA 2Y5TA 5CUSL 1SY6L 3H8NA 1OTTC 4WTZG 2OMBA 1FYTB 1GAFH 5J56B 3X13A 1ZGLA 3GMMB 4LSQH 1D3CA 2D4DA 4Z0BH 3S8WA 1KTLB 4URTB 5IFHH 4ZS7H 2J12B 3IFOB 2AEPH 4ENED 1K8DB 2AGJL 4JO3H 4XMLL 1K2DB 2AI0L 4LCIL 1A6WH 3TBVA 3UTOA 4M43L 4WI7A 4NRYB 5IMLB 1T03L 5JNYB 1EAJA 1EFXB 4OD2A 5KVDL 2BVTA 1YYLL 4V2CB 3THMH 3GMLB 4XX1G 4M48H 1JTTA 1INEL 3IU4H 1EFQA 4HV8A 5DHVB 3NAAL 1HQ4A 3UYRH 4N0FB 1UQSA 2DJSA 5KTEH 4FZEL 1RZKC 1OQXA 5E9DD 1X44A 4TOYL 1KIPB 3ZT5A 4RMQA 3DGGA 4Y5VC 3K2MC 2XZQL 5L2KD 2NY0C 1JZ6A 1T7XA 4AYFA 1MH5A 3GSWB 2EE2A 4XP4H 3OKDB 4BYHA 1JHTA 3T0BA 2YC1B 3DHJA 4QT5B 4ELKB 4F9PC 2BHZA 4NN7B 1IC5L 1UWEH 1KG0A 1NEZG 2D7TH 3V95A 1E28A 5F96H 4OZHA 1Y6MR 4GRLB 1Y18B 4MAYD 4JRYB 4MNQB 3JWOH 3LV3A 4TQEL 2GW5A 3MBXH 4L3CB 5IMOB 4ZTOL 4M6ML 1X5IA 4ESKA 4PJDF 2NY5L 2ITDB 2R69L 1KSRA 5DMIH 2A0LD 3GMMA 1T66D 5IBLC 1EAPB 5FK9A 3TYGL 3ULUD 4GQPH 2ICEB 4QRUB 3CLEH 3IFOA 2XG4A 3S88L 5C0FB 2W0FA 1I4FA 4LSVL 3C8DA 4NHUB 3WS6C 1FZMA 2E8YA 2AERT 1CE6B 4FG6D 2YOCA 4GBXC 3OZ9H 5J89A 5TQ2L 1EO8L 5D7IB 5TFSH 3LEXB 4R2GC 1JZ8A 2PYED 2CR6A 1JNJA 5CIPH 3HPJB 4PJEF 1XZ0B 4JCMA 5EU7C 5HGHB 1AXTH 2XWTB 5ICXA 3UTTE 1PLGL 4N0FA 2YPLD 3U30B 1B4JL 4OLXH 1FE8H 4OT1L 1R3IL 5H37G 5JHLL 3N1FC 2IALB 1ITBB 4AY0A 5FGBA 2VXQH 4WFHD 3T4AA 1KNOA 1GGBL 4ZTPL 5EZOH 4L3EB 5HJ3B 5GRVK 2EXWD 4KKAD 3KLHC 1PGRB 5KOVC 1FNAA 3MRMB 4O02H 4GMTH 1CGSL 1U8PA 3UP1A 4OLYL 1YNTA 2HT2C 2XNAB 4XPHL 5I2IA 1T7ZA 1MCBA 4XCEA 2X2YA 4D0CB 1A14H 5AZEL 1NMBL 2P5WA 4LLDA 4F7PB 1SQ2N 3MMEA 3FB6B 1YMMB 1HWGB 2IPTH 4Q6YA 4K71B 2W59A 2J3SA 1ADQH 1D5ZA 1INQB 4QXUH 4KK9C 1HDMA 3NAAH 4F37K 1YEFL 3W0WE 3MJ8A 4O02L 4PV8B 4FQHB 3DUHA 4XWOC 3QXTA 1CGVA 5GRJL 4PB0L 1GGYA 2AK4B 4WRLA 4L4VA 3V5KA 4PBXA 4BKLB 4NQCB 4YIQB 4U0RC 4Z0BL 2Y06L 1A7PH 1IGYA 4PRDB 5ANME 4PP1D 4HXAL 3FOMA 1NL0H 3PDGA 1D9KD 3O2VH 4R4BB 1C16A 5DJXB 4MSWA 5FO8B 5E24E 1AIFB 3MRDB 4RGOL 4L1HA 1Q94B 1UXSB 4EJ1C 4OZIF 3C08H 1D6EA 3DARA 3MXVH 5E8DH 4LAQL 4OF3A 4LBEA 5AUMB 3ETBF 1LK3L 2APVA 4HX1A 1IAOB 3KXFE 4WUUD 2WP3O 4OZHF 1YY9C 3DTXB 3K74B 2BHUA 1A7RL 2AJSH 4GKOA 4K3EL 3TVMB 2XNAA 1KT2B 2NQCA 1CGWA 5IMMB 3A0OA 4JFPA 4GW1A 1U3JA 3MMEB 4XBEL 1QSFE 2BY2A 4ZO8A 3TBVB 5T3XE 1RZJH 4OF8A 4EDWL 4KY1L 2HN7A 4KKBD 4LP5A 1UWEL 1FLRH 2OZ4H 1UZ6F 1KEGH 1KXQE 5E2TL 1YA5A 1J05B 3BZ4A 3RAJL 1R3HA 5ANMA 5JW5B 5LBSL 1DVFC 3QJFB 4UDTB 4WV1B 5EU5B 3VXME 3IDGA 4LLMB 1J8KA 1YQVH 2BP3A 5KSBE 3I6LE 1FVCA 5AWNH 1FZOA 4FQQB 1EO7A 3LB6D 1NC4A 2X4OB 4PJ5B 3QIWD 5ESAB 4MCYB 3S4SA 2P5EE 1RHHB 4S1SH 2PTVA 4D8PA 5ID1B 3C6LA 1R5VA 1FO0L 2X09A 3NABH 4EZMA 3EZ8A 3RZCD 1VESA 3H7LA 4Y19B 2D9CA 5I17B 3RTQC 5FECB 1RUAL 2ARWA 2Z92A 3W0WA 1NMBH 3BPNC 3MCKB 4MJIB 3ZYZA 5HI5C 3NFPB 3CFBB 1KYOK 1INEH 3WFHA 1JNNH 2CR3A 3WLWD 2AEPL 3SE3A 2WM0A 2BHYA 4JDVA 4QWWD 4R90H 1S7VA 3ME0A 1QVOB 3ECBB 3WIHH 3EO1B 2IQ9H 4NP4H 2J1KA 1WWBX 5BO1H 4MYWB 3SCMC 4BFIB 3U0TA 1WBZA 1XAUA 3K0WA 4MD4B 1EHXA 3UJTH 4M6NH 1AI1L 5EOQH 2R9HD 3W2DL 2A73B 3WUZA 1YN7A 3HE7B 5HYIA 5CAYB 5DMYA 4MGXA 4CN4A 4NHUA 2G2RA 2VH5H 3V4UH 3B2UD 2FIKB 2PKDA 1BGXH 3QFDB 2DQUL 1KEML 4KJPC 3P9MA 3PXHA 2ADIB 4H8WC 4NBYB 1R3JA 4NQXA 4U1LA 3BZ4B 3QUYD 1AQDA 1ED3A 2Y6SD 3MV8D 2IFGA 4UZGA 3R8BB 5EOCH 4JVPA 2X44D 4UOW1 5HDBE 3VFWA 3IDGB 1RFDH 2P1YA 5DRZA 5BQ7B 4O51B 1OGTB 4QTIL 1BZQK 5F3BA 4FQLL 5F6IB 3W9DB 1S7RB 2X4OA 1MREH 4P46A 3S4SB 5IR1B 4M5YH 1J1PL 2E27H 5C0DA 4HULB 1DCLA 3QRFM 1TMCB 2NYYC 1ZK9A 2IANE 3HI5H 4FXKB 3VD9A 1MI5B 1I9IL 5F9JA 4PRID 4OGXH 4MJIA 1HHJA 4F7TA 1CGYA 4YBQD 3QQ3B 4BFBD 1FSKC 2ERJB 3RKDD 3BDYH 3FB5A 5MHSE 1ZOXA 3QUZC 1TTUA 3OAYK 3OAYH 4N0CC 4G80A 1G9NH 1P69B 3BPCA 1S7VB 1FO0A 1HI6B 3B3IA 4GKSA 1I8MB 4C57C 3EO1A 4KK5D 2Y5TB 3D3VB 1IGTA 4BFIA 4L8BA 4JM4L 4UIKL 3X3FL 4QHKI 2ZSVB 3O2VL 5E2VH 1I7UB 2YWZA 2P4AB 4N1EA 4PD4J 1TVBA 1NPUA 4FN0A 4OCSL 2WAHA 2H32H 5CCKH 1JFQH 1DE4A 1KBGH 4BKLA 3EDFA 2FIKA 5FYKH 3MRQA 4QKXB 2P8MB 3T09A 2DYPA 1D9KB 4OM0H 1R3JB 1S78C 4U1LB 3MV7E 1T5WA 2MCG1 1IAIM 1C16B 1CL7H 3D87B 1LP9F 3L1OL 1CFQB 1TQCC 4U1HB 3AM8A 4ZS7L 1U8NB 1ZGLP 5BQ7A 3VWJB 2ZUYA 2EICA 2Q8BL 3VU2A 3O6FC 3TNNB 4ELMF 3WFEH 1CGUA 4L5FL 3VH8A 2P44B 4B50A 3PQYB 2H9GB 4LSUH 5L0QC 4HUWB 1V3KA 1CFVL 1MCWW 4HT1H 1K9TA 15C8L 3EUUA 12E8H 3OG6B 4HMEA 5J6GB 1H3XA 4PJFE 1YJDL 2X4UB 4JFPB 1BGXL 4GRLA 2WIIA 5EO0B 3BPCB 8FABB 3RZCA 4LRIA 1I85A 3MTRA 5I15H 4JREB 1XIWB 5I74C 5D7LE 25C8L 3RZWA 1JYNA 4ODHL 5C08D 5EA0L 2YPLE 1IGTB 5GS0D 2ADFL 5D7KE 3T2NL 4K8RD 1FVEB 2F58L 1ETZA 2IH3A 1XR8B 4KGLA 4X4XB 4DEPC 5I76A 1MQKL 3MV7A 2VR9A 5FV2A 3V6BR 1Q8MA 1NDMB 4YHNB 1PKQB 5JW5A 1ZMYA 5K59F 4XPHH 5T5NF 5DA0B 2QQKH 5BO1L 2R29L 3T08A 5I73C 1ORSA 2I9LA 5EUKA 4Y2OA 4QRPB 1I4FB 4PGEA 4X7TA 3HE6D 2DWEA 4QHKJ 5F7FA 2UV3A 4IIQC 5DURB 5ID1A 5KJRH 1R5VB 3ZDXE 3U6RA 4J1UA 1WUNT 4MB4A 2OM5A 4UOJA 3T2OA 3LY6A 2XWTA 4KK8D 5ICXB 1AD9B 2BNUA 1U8NA 2DOCA 5DRWA 1OLLA 3AUVA 3I2CL 2F74A 4HJ0C 3N9GL 5E8OB 4CADA 1N59B 4JY4A 1QQDA 1F58H 5T5FL 5FYLL 5TF1L 1EHLL 1PG7W 2XQYG 3O4LA 2ZWLT 1AHWB 3QDJB 3DMMB 2OK0H 1P2CB 2EDDA 1B0GB 5C0AD 5GGTH 3EYVB 1BLNA 1DL7L 4KROD 1JMXA 1HHGA 3HMWL 3QRGH 4MJIE 4AL8L 4PRIB 5CD3B 4NNYB 1OB1A 4LIQH 2LU4A 2X9WA 2R0LH 4DJMA 4ZFGL 1K4DB 1S3KH 4AK1A 4D0CA 1RFDL 4BZ2H 1YEJH 4U33A 2DTMH 3C9NA 2FZ3A 2PF6A 4IRSB 1ZLWH 4XXCC 1MIMH 2RQ8A 5HVGB 3MXVL 3SGDH 4JQXA 4I4WB 3STLA 1PLGH 4NCDA 4UT7H 1A4KB 1FVEA 3RU8L 3KR3H 1C7SA 3QEUB 2VXTL 1AGBB 1DN0B 2AV7B 3HB3D 5JW3H 2CIKB 2UUDK 3E6HA 3AB0B 1AQDB 1ED3B 2B5IC 1BZ7B 4I48B 3K8MA 3DXAD 3B9VA 2PW1B 2VDPH 4NDMB 3WO3B 2QADD 4JM4H 3OKLB 4JKPH 3PV6A 2Q3ZA 4YEFA 1JWMA 3O2DA 4HJJL 2DWEB 3CXHK 3T3PE 1TZIB 2WWMC 4J1UB 1U8IA 1XF2A 3HS0B 5DEFB 3MFGB 4R4BA 3CDYA 4UT6H 1KXTB 3DUSB 1QEWA 2BNUB 4PLKC 2Y1VA 3JZ7A 5DUBA 1MIEL 3QUMB 3WHE1 2GK0B 3U36A 1QLEH 4EUPG 3MA9H 4JY4B 3HCVA 4JRYE 2OJEA 2QSTA 1AHWA 4NQDD 1U8LA 5KG9A 2VL5A 3MRFA 2G75A 4DKDC 5FHBH 1HHGB 1GGTA 4EIZC 1EGJL 4JPVH 3DMMD 4WGVB 5FYJH 4TVPD 4OCYH 4N68A 3P9LA 2IAND 3KYNA 5DI8B 4NM4L 4NOBA 3HI6H 3WNOA 5KAQG 4GSDH 1FFNB 4I3RL 15C8H 3LKNA 1DE4B 5E6IB 4KHTH 2XN9D 4PJAE 2HN7B 4RA0C 2BY1A 2P8MA 3IU4L 3SE9H 2G5RA 1AGBA 1BJMA 1DN0A 1PYWB 4HH8A 4P4KC 3V0VA 4TTGA 3RWFB 4N0UE 1LO4L 3O41B 1BECA 2MQ3A 1CFQA 3BT2L 3PHQB 4LCWA 4WV1A 5EU5A 4ODHH 5C6TH 1UM4L 5ADOL 3FZUD 3HPLB 4CMHC 1QSFA 2BDNL 4MB3A 5E94B 3Q6FB 3L3JB 4NC1C 1X3DA 4D8PB 3FQNB 1OLZA 1JIBA 1XF2B 5D2LB 1KTDA 3BYTA 1FPTL 5HDBF 4UTAL 3Q5YA 4Z8FL 4AENA 5J06A 4KRNA 3O8XC 4JQIH 2FIRT 4WNQA 2Z4QA 5KOMC 1BZ9B 5IJVA 3NN8A 3IDMB 2DD8L 3QI9D 4UT7L 5M7QA 2WIIB 3S98A 3R0MA 5EO0A 4C4KO 4IOSD 2WBJD 1KJ2H 1W2KT 1U8LB 3LPGA 5KG9B 1S9VA 3HKFA 2E7LC 4OZFH 1IAKB 1P4IH 3SKMA 4W68A 5KSVB 5DFWH 3VFOB 2OX5A 2QQLH 2VMFA 1UCBL 2GAZB 4D0BA 4HAFA 3QNZA 1NFIA 5TDOB 5FKAB 3SDDD 1OAUL 3VXOB 1P84K 5KVFH 2FRGP 1OAKH 4M1DL 3F12B 4OF6A 3MV01 3WUWB 2Q76B 4KTEH 5D8JH 1UJ3C 3WDHA 2V9TA 3L5WB 2ZP0T 5GRUL 4QRPD 3VMPA 2A9NL 1LO2H 3RX8A 3VRLE 5TE6L 1MAJA 1L0QA 5TE4H 5FYLH 5TF1H 1EHLH 3SDYL 4XB7A 3P9MB 1N2RA 1JGEA 2FGZA 3RTQB 2CKBA 2X4SA 4BM7A 2VAJA 4OJFL 3PHOA 1QHPA 4N8CH 1RUKH 4L9LA 3U7WH 4X8JA 2QEJA 4OLZH 2MCPL 1TLKA 1S7RA 2CQVA 3BO8A 2AEQH 5INCB 3PGCB 3Q6FA 2QKIB 1W0YT 3JWDL 2IADB 3MBED 1CN4A 4C56B 2HT2D 4ONHA 5CJXC 1DQML 4YPGB 4AM0B 3QCUL 4G43A 2RB8A 1LEGB 4PRPD 1Q0XH 3M8OL 1CR9H 1FNGB 1OB1B 3L9RA 4P9HH 1T2QH 2D31A 3JTSB 4JFEE 3NZHL 4D9QD 3MLVL 2WINA 1FG9C 4JHBA 5CKGA 3VJ6A 2RR3A 4KC3B 1JYWA 3P4MB 5CEYA 3NIDF 2VLJD 1NLBH 4N0UA 4KU1A 3WSQH 1WVZA 3L1OH 1FC1A 4PJIB 1ZVYA 2P7TB 3N06B 3QEUA 1UM4H 1BQHB 3TJHD 2JCCF 4CRPA 3DROB 1WFNA 3VFMB 4DGIH 3GJFK 4P59H 3RPIB 3VXOA 1I1AC 3NZHH 4P5TC 1BJ8A 1YEHL 1B4JH 1FRGL 2FO1A 2F19L 2AEWA 3LQAH 5FXCH 4QRUA 3WUWA 2Z35B 2Q76A 3QDGE 4JFOB 1MCPL 3LMJL 3TF7C 5EULV 4EN3A 1N0XL 5IHBA 1CDBA 4PJDA 2I24N 2Z0BA 3QIWA 2IG2H 4S1QL 3ULUE 3GRWA 4QXTA 4AT6A 3IFNL 3RL1B 4G8GB 5DHXB 3QXVA 1ZGLM 4L9LB 1PFCA 3P4OB 4PY8J 1C8PA 5K9JH 4EIGB 3VWJA 3UTZA 3U4EA 4FZ8L 1N0LA 5INCA 3PGCA 3U79A 5KSAA 3BSZL 2IADA 4POZC 1XR9A 4X7DC 1WICA 2F15A 3T4AB 2BRQA 3BGFB 5HGGS 2YD8A 1R24A 1WAAF 2OYPA 4U1SB 2ARJB 2X05A 3NIDE 4W6WB 4JEGB 3O9WB 2VLJE 4HXBH 4XGZB 5SWSA 1H3PH 1OP5H 2D31B 3VXRE 3OV6A 2PTTA 4U1NB 2UWEB 1XF5A 2P5WB 4KV5F 3VJ6B 5TFSL 5D2NC 4RGNC 3LKNB 3U48A 1CFSB 1LO0L 4PJIA 4CGTA 2XZQH 4RDQF 3MJ8B 5BMFL 2NY0B 3ULUF 2FEEL 1XR8A 3KPSD 4OLXL 3LH2H 3O8XB 2LAGB 1XF4B 3V7MA 1QFOA 2MFNA 3WFCH 4KAQL 5LGHH 1DZBA 1B6DA 4QRQB 1LHZA 3L5XL 3O41A 1LO3H 3O6ML 4JQIL 1F3DJ 2QSCH 2AQ3A 2NY0D 2APFA 3O2DL 1NFDB 1YEGH 1FO0H 5HD8C 2ADFH 2NXZB 3T2NH 5IB1B 5BMFH 1QFWH 3IDIB 5C0CD 1T1ZB 5D2LF 3ARBC 4MD5A 3VI3F 2BSSB 2V5YA 1FNFA 3O45B 2D7TL 4M7LT 2ZG1A 1GZPA 1F4WH 1S3KL 3WLBA 5JMRA 2YHGA 5BVJA 2EDWA 4HFUH 1I1YA 3SHSA 5EC2A 4E41D 4WNQB 1GCFA 3GHEL 1LO4H 1EMTL 3MRPA 2YXFA 1NMCC 3PP4H 3AS0A 4JPWL 4DFHA 2YN5A 1OAXL 5SWQA 4HH9B 5FCUL 4HD9A 4L8SC 1FNSH 3EYVA 4JAMB 2OTPA 2H32A 2VB5A 4HX1B 4U1SA 3BHBA 5BOPA 4D0BB 3QNZB 1JNHB 1IQWH 2H26B 2EEAA 1H3VA 4JY6B 4LCCB 1KCSH 3MZGB 5DC0A 4R4NC 4QRRD 4LHQB 5EWIL 3F12A 3E2HB 4FQCL 2X1QA 1P4LA 2VISB 3VH8B 3QUKA 2HWZL 2X1PA 4XPFH 3ROOB 1AE6L 2XQBL 2HVJB 2OQJA 5DD1L 4ONGH 3STLB 4IRJA 4QTHA 3RWDA 5B39G 4PTUA 3V8OA 2D7OA 2FYYB 4QRTA 1JGEB 3LN4B 3RTQA 2HT4C 4FQ2H 1LNUA 4HIHA 3RUGA 1WSST 3MO1B 4OZGF 2BOBB 3WDIA 4YXKL 5L6YH 1I7TB 2M8XA 4GLRI 4Y5XB 4XCFH 2AXHA 2H6PB 1NFDA 4DGIL 1OAKL 2ZCLH 3EOBB 3MYJB 3BGMA 3MROA 5BV7L 3F62A 3MRLA 4I9WD 5F3HB 3QUXB 1B0RB 2XN9A 4G9FA 1NLBL 3G5YA 3MODL 3MUY1 4JFFA 2FX8H 4YPGA 3QQ4A 4Y2DC 5DYOA 1AKJB 1LEGA 4A6YL 5CGYD 1ZHBA 1I1YB 5GZOC 3BP6B 4XVTH 5IJKA 4WVRA 3OHXB 4RRPG 5D7JD 4EDWH 1BQUA 4HPOH 2OJEB 3QDMA 2VXTH 3WD5H 1AXSA 3SE4C 5HI3D 1QVOA 2DQDL 3MRIA 5CBEA 4N0UB 2LTQB 3U0TB 2IBBA 5DJZA 4Q9QH 4HXAH 4XMPL 2B5IB 2EXYD 3DROA 3GBMH 3VFMA 4IRSD 5D1QD 3JVGA 5DRNA 2A73A 4KDVA 5C09A 1RUPL 1WZ1H 4YEEA 4O58L 1CI5A 1HWHB 2NW3A 3QULA 1EEZA 3ZTNH 4DQOH 4S1DD 5I1KL 4ETQA 1SYSA 2Q20A 2DLHA 3K1KC 4G8GA 1QA9B 3RWHB 2Y23A 2H2PC 3HMXL 4ACPA 3CVIL 4NO2B 4GT7A 4J3WA 5IFJA 3DVFA 2CDGB 2CGRH 1ZXQA 1A14L 3D39D 1RK1A 3EYQC 3MYJA 4I8DA 5E00A 3CFKB 1JNLL 3QIBD 2O61B 5IKCA 5DEGB 4DVBA 1MFAH 4QXGL 4WI3A 5I8KH 2HH0H 5CD5D 2Y4SA 4FXKA 2R0ZH 4G9FB 3G5YB 4N5UA 3N1GC 3VXUE 4YR6A 1ZHBB 3FQRA 4WWKC 2VUYA 5FYJD 5KTEL 4LLAA 2IEPA 5EU3B 4XNMB 3SKJH 4NHCL 3HR6A 4MNQE 3UO1L 2QSVA 3JV6B 3LMJH 2NXZC 1VKXB 1BWMA 5CEZE 3EHBD 3IFPB 5DJ8A 4PJ8B 4JG0L 1CFSA 3TZVC 3AREB 1MQ8A 3I75B 3O3AB 2P8LB 5GS0H 2AW2A 1Z6JT 3RBGA 5GGVL 4LHUA 2FD6L 2CUMA 3CSGA 4ZXBB 4Z0XA 1JRHH 5HDLA 1BFTA 3HE6C 4H5SA 5A16B 1TVBB 4OLWL 2O5ZH 4EI5A 1U3HA 2HG5B 4R7NA 3WIIH 5CJQH 4M62L 3BDBA 4I5BA 5DJ0B 1GZQA 3TN0B 2G60H 3FO9A 4NNXB 3I02A 3IJHB 4XCCH 2AXFA 3QULB 4HFWA 4PRHE 5IROA 4EQ3A 4XCYA 5C0CB 5B8CC 3IDIA 1N2RB 1WIOA 4MWFA 3ZDXF 4Y19D 3KYOA 3MRNB 3BJ91 4QRSB 3CC5B 3PHOB 3OB0K 2Q6WB 2AJZA 1JVKA 3E2HC 2XXCB 5D6DC 4R0LA 3OKEA 4J6RL 4YBHA 1OHQA 4XAWL 4ONFH 4IRZL 3KPRD 2F8OA 3TNNA 1I1AB 2D03H 2OXGA 4OLUH 3PNWA 4LPCA 4TSAH 4FQ2L 3V8CA 3DV4A 5CJBA 1FIGH 1RU9H 3PQYA 2H9GA 4UB0H 2VXVH 4AL8H 4LSSH 4G43B 3BZFA 3DX6A 3D2UA 1DBJH 3ISWA 1CU4L 4LMQI 3BH9A 5DJAB 2GTZA 5DFTA 5GRVL 2OJZL 3OJ2C 2EC9U 3PDOA 1IM9A 4PJEB 5FM8A 3QUKB 3S36X 5KSBA 2CDEB 4YE4H 3IFPA 3D25B 1NL0L 3O4LD 4FQIH 3QCVH 1CDUA 4M5ZL 1WBYB 3MJ6A 1A2YA 1IKFL 3NPSB 1UKSA 4UI2A 3TBYA 4G6FD 3AROA 4FQXB 5EZJA 3UC0L 1Q0YH 1OAXH 4X4YB 5JW4N 1TCMA 3D39A 1A8JH 1LNUB 4Q9BA 3SOBH 2XTJB 3WKNA 3CXDL 4EI5B 2GY7B 2VC2L 5EUKB 4RSVA 4LNVA 2ZKHH 3C2AL 1J5OH 2J5LC 2H6PA 4X80H 1KIQA 4HK0B 1HXYA 5C0EA 1PG7X 2XXMB 5C0JA 4AQOA 1Q9OB 2ESVE 2GJZB 1MI5D 3ZKMC 4CVZA 4QRSA 3TIEA 3TBTB 1CXEA 4P2RB 3DX9A 4PJGA 4Y4KD 1OSPL 4Z7NF 4YAQA 3Q5OA 1I1AA 3QIUD 5D1XD 3CFJA 3N50A 2ED7A 2AGJH 5CEXB 5CBEB 1F3RB 1V7NH 3E3QE 1TITA 5BV7H 2JEL