3WHXB

Crystal structure of anti-prostaglandin e2 fab fragment pge1 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
216
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKINRVEAEDLGIYYCLQGSHVPLTFGAGTTLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mAb Fab H fragment
publication title Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2
rcsb
molecule tags Immune system
total genus 55
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whxB01
3LEVL 3P9LB 1IL1A 4PJFE 5I1AA 1OWWA 3U2SB 2HTLC 3SO5A 5T5NG 5F7LB 3MNWA 3LRGA 4OLEA 4Z8FL 4KUCF 3V5KA 1HOCB 4HS8H 5HD8D 1FNHA 3DMMC 3NCJH 1T7XA 3KYMA 1MJ7H 3QHFL 3BPNB 2AEWA 1LDSA 4LHUD 5LBSH 4XWOC 5DRXA 3TV3H 1TQCC 4EN3D 4JPVH 3QDJD 3VD7A 5EUOE 3BVNA 1IGCH 3OB0H 4NZTH 4OJFL 1FDLL 3F6LA 4NQUA 4KROB 5J11B 1RIUL 1FL5B 3PDOB 3QUYD 5DURB 3IGAA 5C86A 4G9FB 4MAYD 3NFPB 5ANMB 1KYOJ 5BJTA 2CMRL 2XA3A 4PY8I 3EO1B 4PB9L 5A1AA 4ALAH 1JZ3A 3C6LB 4NO0B 2DDQL 5DI8B 2WIIA 2BDNH 4OLZL 4TTGA 4PJGA 5IVXE 4NUJB 1S7UB 3AREC 1AGBA 3CX5K 3G6DH 5FCSH 1FPTH 4QHKJ 4G6MH 3TESA 4IM8A 4NQXB 4WFFE 3WS3A 4GBXC 2VXVL 4FMFA 2HRPH 3BKCL 4G9FA 4GRWE 1UH4A 2H6PA 4XAWL 3HPLA 3NFPA 3IVKA 5SWSB 5ANMA 2X4UB 2OR8A 3SKOB 1J1PL 4O4YH 1A6UH 1EA9C 2X1QA 1T21B 3QIBA 4P3CH 1CGWA 1S7UA 4QCIB 2XKNA 1W72A 4OCSH 1INDH 1A7OH 1BZ7B 5AYUL 1YJDL 3FRUB 3F7YA 3T1FA 1TVHA 5SWSA 4WFEE 2X4UA 4KI5C 3GSRA 2I60H 4MQTB 5KOVC 2B1AH 3MREA 4JO3H 3KAAA 1YPZB 2BRRH 2C1PB 5K9JL 3GJEA 3ARBA 2B20A 3WUWG 4Z76B 4KUZH 2GK0B 3X13A 3DARA 4E42B 4QCIA 2CKBB 3GRWL 1ZLVK 1TETL 3HB3D 5EU6E 1BZ7A 1SY6A 5JNYA 1NKOA 4JDTH 4EDWL 5F6IC 3FRUA 5JDSA 2E7HA 1KIUA 2A9NL 3LMJL 4ZOAA 5K9OB 3MBXL 3EYSH 3S3JA 5B3JF 3RGVB 5FOJA 2DQEH 3UDWC 1FIGH 4O2CA 3GSVB 5HHOD 2C1PA 5DD6A 4FQ2H 1QRND 5FB8B 1SVZA 4DUWA 2VR4A 4Y4HB 1DDHA 4PY7A 3G5YA 2Z92B 4C4KO 4OZFG 3MODH 3BP6A 2XACC 1QQDB 1PBYA 2AK4D 2EYRB 1CXEA 2EIZB 3MLRL 4H20H 5D4QA 1ZA3B 1LO4L 1C5DB 1U3HB 4GJTB 2BSSB 3RVXD 4JRXD 3DVGB 3P4LA 2APWA 1FYTE 4GKZA 1NDMA 1FO0B 3GSVA 3O8XC 1Q38A 4OGAD 5T3ZD 3B9KB 2PO6C 5DXWA 2NY5H 4P57B 2J2ZA 3LKQA 3TPUB 4PJEF 4HF5H 5E94B 3GKWL 3DO7A 1I1FB 3FKUS 2Z92A 3PGFL 3ZHKA 5ETUB 4ZFFA 2A0LD 1MVUB 4GLRI 3PXJA 2CH8A 3MA9H 3X3FL 3WIHA 1ZA3A 2P5WE 1C5DA 1BD2D 1U3HA 4R2GD 4XCYB 1BZ9A 1PGRB 1W72H 4FXKB 4JB9L 2NY2D 1S7TA 4P9MH 2XZCL 4LVHB 1FO0A 3DI3B 3UTZB 5LVEA 4NQSA 4P5KA 4JREC 1JF6A 1R0AL 4RA3A 2AXFA 1KGCD 3B9KA 1KCUL 3IJSA 3SKJL 1ORQB 5T1KD 1BAFH 3NN8B 3SPVA 2A6KA 5A2IH 3UBXG 2X4NB 3OKNA 1U36A 4PLNC 5ETUA 4WO4D 2J3SA 5E1HB 3MCKB 3RBGA 3GJFA 1FQ9C 2ICES 1JPGB 2JF1A 4Z0XB 3H9YA 1T66D 4XHJC 1NBVL 5LCVH 1SY6H 4ESKA 1A3LL 4LEXH 5KSBB 1AH1A 1DUYA 3RTQB 5A40E 1VADA 5CAYB 2F58L 5I1EH 4TVPD 3RPIA 4DGYH 4K71C 3F12A 3EFDH 1NLBH 2YR3A 5FUCC 4XWGL 3IB4A 1XF5B 2X4NA 2C7UA 2PXYC 3MCKA 3VFMB 1VGKA 2DQGH 1BM3H 4X6CA 1GGCH 5L2KE 3DYPA 5I1GH 1RIVL 2E9WA 3WEXB 3VRLF 3BD4A 4FFYH 4I18C 3LQZB 1IGIL 4N0YH 2AJ3B 2D7OA 1KXVC 5E8NA 4WI7A 3DHMA 5JXEC 4JVWA 4QGYA 1HILB 2FIRT 3RDTB 1S9KC 1XF5A 5SWQB 2W65A 5KVGH 1DTUA 4NWTL 4XVUC 3VFMA 1T0NB 4UT7L 1A6WL 2C3WA 3SE3C 3CIQA 3WEXA 2E6QA 4X5XB 5C0AB 4MXVF 1NGZB 3KLHD 3LQZA 3VD5A 2A73A 3HE6A 4U1LB 4NQCD 4IRSD 1A4JB 1TPXB 3WIHH 4JN2A 4PV8A 2D3VA 4M6ML 1HILA 2X41A 4L29A 4Y4FA 4EQ2A 1CK0L 1YUHA 1FO0H 1OWRM 4PD4K 4Y16C 1Y0LB 3RNQB 2GI7A 3U46B 2DQCH 3ULVL 1E27B 5D70H 4PJ9A 1T0NA 1YC8A 2BJMH 4G8EB 5BW7C 2NY4D 5F9OH 1KCRH 1D6VH 3RVUC 4XNXH 3QEUA 4X5XA 5C0AA 1JP5A 4M6OL 2AJUH 1R3LB 4KQ3H 4HWBH 3MRCB 1A4JA 5C08E 3UJJL 3W9DB 4DVRL 1ADQL 3OKLB 2HFEB 1WBXA 1L7TH 3BT2L 1CVRA 3D5OF 3F5WA 2GTZB 1JGLH 4JFXB 1TVBB 4Y0GA 1VFBA 4N0RA 4CNIA 1Y0LA 2LVCA 3CSYB 2J6EL 2OK0L 5CLWA 5HHVH 5KN5A 4RGMB 4YH6A 4M8QB 1ZHLA 3U48A 7CGTA 2EIBA 4F9PA 5I16B 3MV8B 2G2RB 3QDHA 1R3LA 3HR5B 5K93A 5I1CH 4HUWB 5JW4R 3HG1B 1JV5B 1FZMB 2OI9C 1YJDC 3MRCA 1YMMA 4WI6A 1UADC 2YD8A 3W2DH 3ZTNH 1P69B 1NAKH 4C56B 2Y06L 1C08A 4HK3J 3W9DA 4YDKH 3OF6A 1ZGLM 3QFJB 3OKLA 2HFEA 5D1QC 1DP0A 1KXTB 4M7JH 5DD3L 1Z5LA 1M1SA 5FKAA 2FSEB 2DM4A 2GTZA 4CN6A 5J7CC 4NJ9L 2BOBB 3BKYL 3CLFL 3CSYA 3MLZH 3RJDA 4JKLA 1TJGH 1BQHG 3QDGD 3DX8B 2C4XA 4MXQD 2QR0B 3MMEA 4ODTH 4KJWD 3B3IB 2CGRH 1WFOA 4PTTA 4IRZH 3HR5A 4LQFL 3PQYB 3QSKB 1QZ1A 1RUPH 2VUYA 4G7YL 2P46B 3QH3A 1UKTA 2VLJA 2YK1H 3QFJA 5GS0D 3OV6A 4X7EC 3W81A 4XNZB 2BNRD 3ARWA 5MEOB 1RPQA 1LMKA 2IBGA 5KBNC 4YE4L 5D72L 5FV2A 1E0OB 4P46C 3S7GA 3VXUB 1ZEAL 3R1GH 3MRRA 1TCRA 2VERN 3DX8A 1OPGH 1AQKL 5JOPE 3BUYA 2YPLA 1EEUA 4GQ9H 3MO1A 4UT6H 3RHWK 2DTML 3RUGB 1VENA 5IWLC 2YMXH 3ILQD 3LEYL 1G84A 2RHEA 1EZVX 3WNLA 1MHEB 5I8OH 1IKFL 1IAIM 3DOSA 1V7MH 4RRPA 5EZOH 1FG2B 3SGKA 2CLZA 5FCUH 3RWCB 5MEOA 1H15B 4LIQE 3QCUH 3WFCH 4G8IB 3I50L 3BPCA 5HVFB 2NCMA 4UQ3B 1MRFH 2VC2L 3VXUA 3BYYA 1DQLH 1FSKB 4HIHB 3JWNC 1FV1A 3L7EA 4XI5D 3SE4A 2IC2A 1CE1H 5F8QC 1GGIL 2CRZA 2G5BB 3WKML 3ZZ1A 3TVMB 4F8TA 4YUEH 2C3XA 3QPQD 4U1SB 4YZFE 1FG2A 3O4LA 3RWCA 1H15A 3S6CA 4G8IA 3V6ZB 2XWJB 3BJLA 1PDKA 4G5ZH 5IW3A 4UQ3A 1OQOA 4TOYH 3H0TB 4IMKA 3UTSE 4HIHA 1TJHH 4PRNB 4U6VL 3NZ8A 4TUOB 1U95B 1AXTL 4NWUH 3OKDA 3VGFA 1JNLL 2IH1A 3KPRE 3WHXB 4GSDH 3FOMB 1PYWA 4FQXB 1DQDH 1M4KA 2QHLA 3DETC 3MRGA 2NY6D 3NZHL 1E4WH 2ZG3A 4E41A 5E1AB 4TRPH 4HS6B 3O8XA 4MA8H 1AR1C 4YXLL 2DYPA 3ARDC 4JQXA 4JY4B 3RWHB 3MRJA 2XWJA 4HUNB 1MLBA 3BKML 3SE9H 2AEQH 4PRIE 5D71H 3NFSH 1MF2L 4AL8L 2X1OA 1ORSB 4JO2L 2A9ML 2L7JA 5D1ZA 3V6OE 3FOMA 1DFBL 4WFHD 2PTVA 4L8BB 1TDQA 4QEGA 3EDKA 1K85A 5GQBA 3DSNA 1X5XA 1CICC 3RWHA 1AC6A 3ARBD 3IKKA 4X7TB 3OKMB 3VE0B 4JO1H 1S78D 3SCMA 1G7LB 3O3AB 2BFVL 4A2LA 3FFDB 2AI0H 4CVUA 4NHCL 4PJBB 5A16B 2QV2A 5CINH 4HGMA 4AG4H 1AGDB 2GAZB 3SO3C 2X9YA 4MA7H 4JRYB 5ACLA 1DQTA 4BQ6A 4KJPC 1IM3B 1LO0L 2EDOA 2R56H 5EOQL 4PJDB 2BY2A 4JFFB 4XNMB 5FM4A 1WAAA 3MBEB 1BQLL 1XR9A 2A83B 5IB5A 4NRXA 3QI9A 4X7TA 5JW3H 3VE0A 1VACB 1EX0A 4NQTA 3P30H 4LARL 4NQDA 1J8KA 4Z7UB 1Q9LB 4QYOB 3ZDXF 3PWPB 5ILTH 3FFDA 3VG0H 1E4JA 4BH8A 3JUYA 5TE4H 5C0CD 3VWKB 5CILL 3BKJH 3BZ4A 2GAZA 3VMPA 1C5CH 3QHZL 5IB2A 1KC5L 1NMAH 4LLYB 5EU3B 3TT3L 1NLDH 1R3HB 5DHVA 3ULVC 3IU3A 3TH2T 1YNLH 5CEXB 4FA8A 3NGBC 4LDLB 3ZDZE 4JPKL 3BAEL 2DL2A 3HMXH 1Z3GH 3QEHB 3TCLB 4HKBB 1ED3B 5ERWA 2VQTA 4Z7UA 1PW3A 1QTYT 4D0CA 1INEH 3Q6GH 3DNKA 2W0FA 1NGPL 1H3UA 1C7SA 2Q76B 3QUYB 5INCB 4M62L 1A7BA 1DQML 4KTDH 3MRQA 2Q6WA 2D31B 1J12A 3UYRL 1I1CA 3T77A 5EU3A 2VZUA 1FNEB 3OAUH 1R3HA 1YC7A 4NKMA 1R3IH 2EH7H 5GRVK 2ZUYA 2VSCA 1XH3A 2YD2A 5J13C 5C0ND 5D2NC 5MP6H 1M6OB 4YPJA 4TSCH 3PGDA 4HKBA 3ZT7A 1BFVH 2YZ8A 5DQJB 2VMFA 2E7BA 3NIFF 4RWHA 3SGJC 5CCKL 4MD4A 5INCA 1WF5A 2OR9L 5CP3H 2X05A 3BYTA 4XPFL 5JXAL 1ETZB 4QXWA 3D87B 3HRZB 4KRMB 3MTRA 3KPLB 4TNWF 1FNEA 4X80L 2H3NB 4OIAA 4XNUL 2HFGH 1E6JH 1VPOH 5GSVB 2E7MA 4OM1H 4OD1L 4BZYA 1HH6A 2QL1A 1UGNA 3CLEH 2WUBH 2YS4A 2HT4D 1TNMA 4OIIH 1A0QH 1CGVA 1BHGA 1YECH 4Z9KB 4NP4L 2RB8A 3UTTD 1GH7A 2X89D 5F6HI 4ELME 4OD3L 4AENB 1D5BB 3LKSA 1OTTC 4Q0XL 4L4JA 5JW4M 3ARFA 4HIXL 3CXDL 4J7RA 5GJTL 5EO9B 1S5HB 4LSPL 1JYNA 5TFSL 2VWEC 5I1LA 4PJ8C 1T5XB 2ICWJ 5CSZA 1NEZB 5D5MB 4UOJA 3WS6A 4KK8C 5JR1L 3FB7B 1XIWC 3MLTA 4U3XA 5JQ6L 5C8JA 4AENA 1D5BA 4G80B 1AP2B 2DQFB 4GAFB 1N26A 1X4XA 3GRWA 5FYLD 4P2YA 5EO9A 4XMLL 3QAZB 3OGOE 3C5JB 3WN5B 2B39A 2XICA 1T5XA 2FEDD 3RWEA 1NKRA 5E8PB 5JPMA 3T3MF 1QRNB 4HWEH 4ZNCD 2VXSL 4MJ5A 1AGEB 3ALXA 4Y4FD 3IXAA 1YEGH 3FN0H 4X0KA 3NCCB 4PS4H 2IF7A 4G80A 1AP2A 3BSZH 4TTDD 1H0DB 2DBLH 1QSVA 3MLSL 1L6ZA 3CH1B 4HIEB 2A6DB 3U0PB 3VG9B 2HTLD 5FO7B 3C5JA 2R39A 1SBSH 4Z7WB 3DMMD 5E8PA 1CGSL 3T4AA 5L0QC 2E7LC 4LP5A 3DPBA 4A6YB 3QFDB 1T5WB 4OZIB 4BFIB 3OKKB 3IFNL 5LG1A 1AGEA 4MSWA 2ZPKH 4XWOD 2X4OB 4BSVA 3O81A 3HI5L 2NXZC 1IQDB 3LH2H 3SEPA 3L3HA 5BS0A 5E6ZA 3O0RH 2O5YL 2HVJB 5IT2L 4OFYA 1H0DA 2ZUQC 5M94B 5I66B 4MZ2A 4QRSB 1BD2B 2R2BB 4I0PA 3CH1A 3U0PA 1PZUB 5FO7A 4YBLC 2HYMA 3MGTB 4MWFB 4Z0BH 2XY1A 1FL3B 2GFBB 5IHUL 4F7MB 4OSUH 3NACL 2QBWA 4HMDA 3QFDA 1LE5B 1GCFA 1T5WA 1OB1B 4BFIA 5TE6H 1S5IH 5GGVH 5T1KB 4P2RD 5C71A 1KJ3L 3NIGF 4XTRC 5F21B 43CAB 3VFWB 1JWMB 4LASH 2AK1H 3ARED 1IQDA 2DM7A 2ORBL 3JTSB 2NY1B 2BMKA 1AHWB 2IAMA 1FYHB 1D5MB 4HUUA 4GBXD 1CDGA 4QRSA 5I66A 4OF7A 1OAZH 1N0LA 1UWXH 4P99A 4ODHH 3MGTA 4R7NB 3EKCA 1JNJA 4MWFA 3UTPD 3S88H 5EO0B 1FL3A 5FM8A 2Z8WC 4F7MA 2VKWA 1LE5A 1OB1A 1RZ8B 2VLJD 1PG7H 5H35B 5JUEL 4ZO8A 3VFWA 4ZFGH 4G6AC 5LXGH 1ZT7A 2EDNA 3JTSA 4Z95H 4XVJH 3V52H 1D5MA 3WLWC 3WIIH 1HQ4B 5C0BB 2ZJSH 3A6CH 4M7LL 2GY7B 4XB8A 5E4IA 1DQJB 5GRJH 2ID5A 4QLRA 3CZFB 4HX1B 2UWEB 2YPLD 3AB0C 1WFUA 4KI5D 3ILPA 2VDNL 1U91A 5I15H 4I77L 2LTQC 3KNBB 5F71A 3A67H 4P23C 3CH8A 3T0WA 1J8HA 1RZ8A 5AUMA 1OQXA 4C83A 5TPWH 4JFEA 4GAGL 4NKQB 1N6QL 3PDGA 5C0JB 3LB6C 3SQOH 1DSFH 4MHHI 2K9UA 2MPAL 3ZDYE 1S7QB 2QQKL 1JFQL 5B38G 3BGMA 4DKFL 3T0EE 1MNUH 4IMLB 3PWJB 3TN0A 1FFNA 5DDHB 3GIZL 1DQJA 4FG6D 5DZOA 1KV3A 2D7QA 3CZFA 3TBSA 2UWEA 2FHBA 2OTUA 3KNBA 3DURA 2P5EE 4IRSB 2I25N 4NQCB 1FGNL 2FX8L 5CBEA 3UPCA 3ZE1E 1IGTA 2IG2L 2UZXB 5HY9B 2FD6H 2NXYD 3D9AH 1KG0B 1QLFB 3O4LD 3X12A 4HQQL 2PUQT 2CIKB 3PV6B 2EIDA 5DUPH 4XMKH 5AYQA 4D9RE 4N8VG 5ITBH 4KHTH 5I1DB 1SVCP 5T1DL 3PWJA 2OQJB 1EFXB 4PJXB 3EZJB 1MFAH 4UILH 3SKMA 4PJGF 2VOTA 5HYJB 4H25B 4K3EH 4V1DD 3O8XD 2BNQD 3U4AA 4JY5L 2GT9A 5IB3B 3MRLA 2PO6D 2DYPD 1HEZB 1LK3H 5BMFH 5BRZE 3OQ3B 2VAJA 3LD8C 4NT6B 5FXCH 1ZXQA 5I1DA 2VDPL 2VZOA 3MROA 1EFXA 1UQSA 4YHNA 5IB1A 4TPRH 1H3WM 4IJ3C 1HHGB 3VFTB 1JRHI 3EJYC 5HYJA 1C1EL 4E5XA 3CXHJ 2CLRB 1PG7W 3C8KA 2XKSA 5I74B 3TA3A 2OR7A 1BFOB 3U4BL 4ZS7L 4YO0B 4MNGE 2WAHA 3B5HA 5IB3A 4LSTL 3JBG7 3MV9A 1HEZA 2RIKA 2R0ZH 2VN4A 4D9QE 7FABL 3RI5F 1NC2D 3SGJA 2OYPA 3SCMD 3MACH 4HZLB 2ED7A 1UH2A 1WVZA 4JHAH 1GGTA 2IPUK 5GJSH 2NW3B 1F3DJ 4HG4K 1F8TL 5DSCB 2Y9RT 1UM5H 1NMCC 2VDKH 2NW2A 2GITA 1YY8A 2CLRA 1KLGA 4OV5A 2WBJB 4FTVB 5E5MA 1B0RB 4FFWC 5CKGA 3QXAB 1U92A 5EBMB 2BNRB 3WO4B 3QI9D 5CS7A 4NBZB 4EDXA 2FLBT 1JPFB 1ACYL 1XAUA 5IFHL 1GHFL 2DM3A 1RZJL 1M05B 4C57C 2OLDA 4P2QD 3DECA 5AWNH 5HYFA 1QLEL 3GMPA 1SYSB 1YPZF 3QB7C 5DMIH 3RVWC 1RJLA 2E8YA 2PXYD 3SJVE 3TFKC 4KC3B 5JO5A 2WBWB 3DJ9A 2R1XA 5CJ8A 2WBJA 1JZ6A 1TXKA 3KR3L 4APQC 4FTVA 4Y5YC 4PJ8A 4JO4H 3M07A 4FQJH 3T8XB 3S37L 5HHMD 2EDXA 3EJJX 3WXVL 1NGQL 3LSOB 4G42B 1T1ZB 3FOLA 4QY8B 4CVZB 5JXED 1NAMB 4PG9A 3GSUA 5GXBB 3QEQA 4M93C 1M05A 3P73A 1N0XH 2AV1A 4Y2OA 4XVUD 3KWWA 1DEDA 1SYSA 1D9KA 1LK2A 4RMVA 1T6VN 4OKDA 3ZLQC 4IRJA 1IC5H 5IBUB 2ADJB 1J0ZA 3RL1B 3L5XH 4L8SB 4WY7H 3UYPA 1IBGL 1A9BB 1E4XI 1UYWL 5DJ6B 4P2CG 1NFIA 3LSOA 4G42A 5TDPB 1T1ZA 3M8OH 4QY8A 1JN6A 1KJMA 2YKLL 4HIJA 2D0HA 3BN3B 4L5FL 4YDVA 4PGBA 4Y19E 1M71B 2AABH 2CDGB 5DMGD 5GGSB 2XFXA 1EXUA 3SY0B 4AH2B 3GJFK 1V5JA 5MEND 3WFEL 4YHOH 1EV2E 4ZAKA 3T2NL 1NCNA 4G6KL 3TNNB 3RL1A 3RVUD 2VDMH 3BGFC 5C2BH 1T20B 4L8SA 3RA7L 1RMFH 4M6NH 1A9BA 2E7LA 1OT2A 1YNKL 3K80A 3DX6B 4FQCL 5MEPB 5DJ6A 1LP9E 2LE9A 1K3ZA 1PJ9A 3TP4A 1AGCB 4TN9A 5DD0H 3NCYP 1JK8B 3LS4H 3ES6A 1GPOL 1HIMH 3O11B 1JGUL 2Z0BA 3ULUH 1M71A 5GGSA 4LLWB 4MJIE 1VEPA 1I7ZB 4TUKL 1CFNA 3N06B 4EBQH 5ADOL 1QP1A 1EEYB 4DOHB 2FWOA 3TNNA 4PB0L 1P6FA 4BZ1H 1MCHA 3BN9C 3WMSA 5E8EB 1CS6A 2LU3A 5T33H 1NBZA 3NA9H 1AGCA 2EC9U 5E9DB 5D1QD 1WEJL 4X7SL 4R4FH 5T3XL 1OSPH 4FP8L 3V5HA 4F37F 1Q1JL 4KU1A 4LLUA 1CXLA 3QUMA 4AEIL 2DQUH 4NN6B 5IBTH 1L7IH 1I7ZA 1NBQA 4YFLI 1NUGA 2W38A 5GRUL 4NNYA 2ICWA 3ARPA 3CVHA 2J8UB 1B90A 1MIEL 4R97C 4S1RL 4PJHB 3V2AR 4DKEL 1UJ3A 4K3HA 1LVEA 4GAJH 1UM6L 2EEBA 1A6VH 4R6UA 4PLJC 4YHMH 4OI7A 3WL9B 3QUZA 3CSGA 1LD9B 3QCTH 4LVOB 1YEEL 3GMLB 3I02A 5BVJB 4P46D 1RUKH 2F53A 3QPXL 2VABA 3BPOB 2C5DC 4M61B 5CJOH 4HD9A 1QFUH 4D2NA 5IEHA 4U1NA 1QKZL 4I0KA 5BZDA 4KDTA 2P47B 3D2UA 1CL7H 3P77B 1S7WB 1OP3H 4M8VA 1ZT4B 3G5VA 2MOVA 4HKJB 3BEVB 1L9MA 3WD5L 4IOSD 2ADGB 5LWYH 3WL9A 1BFTA 1HCFX 1J1XH 4GG6E 25C8H 3RAJL 4FOMA 4I3SL 1LD9A 4P9HH 4X98A 1IM9D 3MRPB 1F4YL 1U8NB 4PPTA 5DD1H 5EOCL 1KB9J 1F2QA 1W2KT 5BS0D 1Q8MA 1EPFA 4M61A 5FK9A 4J3WA 5IP4A 1J0YA 4K94H 3SDXB 1K8IB 4I0PD 3P77A 4M1GH 1S7WA 5L7XL 4X4ZA 3V4UH 2AJYL 1XR8A 1MJ8L 4PJ7B 1BF2A 5FECA 5GGRB 3S3SA 4WW1B 1A7QH 3AY4C 4ZO6A 1ZHKB 1MHHB 1CD8A 3OAZH 1FH5H 2ZUVA 1YYMH 1T3FA 1V8HA 5FYJE 2I26N 4DN3L 5IMLA 4JVUA 3GMMA 3V4PH 2IAMD 1T22B 3TJEH 5BOZG 1FFPA 2XTJE 4ZUTB 3ARUA 5LKNA 5KAQF 3O4OB 5IB4B 2BZDA 1H8SA 4MQ7B 1ZKAA 3QUMH 1JYVA 1QFHA 3DETD 1K9TA 4PJIA 1IMHC 3JV6B 3AU1B 2Y23A 1AKJB 1ZHKA 4TSAL 3SBWA 2VH5H 4Y1AB 3ARDD 5FF6A 1OSZB 4PJAB 5E70A 1CFBA 5D1XB 1HI6A 3U36B 3UTTB 1T6WA 3R0NA 4I3RL 4Z7OF 1EJOL 1LEKA 4O02H 3FB5A 1LNUB 5CFHA 3C8DA 3CFIC 1YYLL 4EI6B 1KNOB 4JFDE 3S5LB 4LCIH 2CDFA 4ZUTA 2P49B 1J05B 1KCVL 5IB4A 3VXMB 5L2JA 5EOTA 2H41A 1NSNL 4MQ7A 4U49A 1WCBB 2Z35B 5EB9A 2PYFB 1RZJC 4JHWL 3LEXB 2BOCB 1HXYB 4HUKB 4ETQB 1S9WB 3BMWA 3QIWA 5DUBA 1AKJA 2DQJL 3K8KA 2ZG1A 1FNGB 4Y1AA 1J8HD 2O5ZL 4KGLA 1OSZA 4PJAA 3HMWL 4JFED 5D1XA 5I9QC 1BJ8A 5DLML 5CHNB 4ENED 3IDJB 3EHBC 5CSGA 4DZ8B 5ABDE 2I9LB 3TC9A 3S5LA 3S36H 1MFEL 4ZOEA 4KTYA 3B83A 4ODVH 1WCBA 4XXCA 2R15A 1AFVH 2EDEA 1WCQA 2PYFA 4GKNA 1QBLH 4KJPD 2R4RL 2BOCA 3LEXA 1HXYA 1AQDA 4ETQA 4AZ8A 2YPVL 3UPRB 4O2FA 2X40A 4UTBH 4M7ZB 2IBZY 3PXHA 3VWJB 1PEWA 3SKNA 1N6VA 2ED9A 4M48H 3D3VD 5KS9B 3ROLB 3RUGF 5IF0A 5CHNA 2DD8L 4NN7C 1A6ZA 1KYOK 4LDEB 4DZ8A 4EIGB 3RY6A 2PCPA 1KIQA 1KN2H 4XP6H 2Y72A 5CEZL 4XPBH 5A2JH 5KOMC 1HWHB 2VNCA 1JHTB 3LQAL 3M45A 3RWFB 2V5YA 2EC9T 4HJJH 3ULVD 1XZ0B 5JPNA 1G6RL 1KEML 5JMRA 3UPRA 1KCSL 1F90H 1UA6L 4X6DB 5E08H 5ALBL 5EOCJ 2BVEA 3IF1B 4QHMA 3MCG1 3VWJA 4JAMA 5KS9A 2WIMA 3ROLA 3KPSE 3LRSA 2CK2A 1KF9B 5KSBE 3D18A 1R24B 3ZYIA 2YBRA 4QOKA 2HKHL 3U9UB 5FUZL 5DS8B 3E3QC 2IANA 3IT8D 5CLTA 1OLLA 5TF0A 5DJZA 2ERJC 2DIBA 5F72S 5B39B 4GO6B 5DQDH 1T03L 1XZ0A 4NOFA 3U0WH 3MCLL 1QA9B 5MERB 4PJ5E 1BVKA 1RFDL 3OTTA 1D6EB 3MUGA 2J5LC 3GK8H 2X4SB 5BO1L 4RZCB 3FFCE 3AREB 3DGGB 1I1AC 1KJ2L 4L4VB 5L9DL 3ZSTA 4F9LA 4GBXB 1O7VA 3QWRA 4XPGL 3MGOB 5IHBA 4QRPA 2GTWA 4HBCL 1DBJL 3VXRE 1WIPA 5HGAA 4AMKH 4GFTB 1NCUA 1SEBB 3O9WC 5B39A 5JHDD 4Y7MA 4BFBD 3GM0A 5IFAL 4J6RL 1QA9A 2J12B 3C60A 2R0LL 1SM3H 2X4SA 4MXWH 4RZCA 1KN4H 1YEFH 5DHXB 4L4VA 2UUDK 5FGBC 4GMSH 4JQIL 3KYNA 3L3KA 1OTTD 4ODWB 2AEIT 2MKWA 5C7XL 4I9WD 4LSVL 2ZUSA 3VFNB 4PG2A 1QSEA 1LDPL 3VI3F 2GUOA 2NY0C 4DQOH 4PJ8D 3BPLC 4JFYB 1CFSA 4U1KA 4LCWD 2YD9A 5B22A 3QCVH 3IXTB 5F89A 1OGAA 4CUCA 5FDYA 1XIWD 1N59B 1VB9A 1GAFH 3FRPA 1RZ7L 3QEQD 2E9IA 2IPTL 2NY7H 3ZKNC 1Z9LA 4CN4A 5J6HB 3NCMA 3FT4A 5C0IB 3D69B 2ESVA 4IRJD 3NCBB 4PP1C 5FOBB 1A9EB 4U6HB 4WJ5A 3QRFM 4Z7UF 4UNUA 4YHLH 5FUOH 5ID0B 4QRRD 4UV7H 1X4ZA 3CFJA 4PRPD 2VXQL 3O6KH 3WIFA 1I8LA 2P8LB 4KZEL 4FQPA 3GO1L 3ECBA 1N59A 3MV8E 1TFHA 4NKIL 4CVXB 5EA0H 1TNNA 3HG1E 4KVCL 2FZ3A 4B7LA 3PWUA 4MDIA 5HGDB 5D7IA 2YEZA 5ALCH 3HI6L 5J6HA 3ARXA 5EU4A 4YHYC 3VGAC 1RULL 3D69A 4GXUM 4K7PY 4RNRB 4OUOA 3MXWH 2JK5B 3DVIA 4DAGL 4CW1A 5FOBA 3C09C 1A9EA 3MLVL 4LKCB 1AO7E 4Y4KA 4MX7B 4V1DB 3EJZC 5ID0A 3RWDA 4KY1H 3T0DA 4IIQB 3VRIB 3TYGH 1PX4A 4I48B 2XG4A 2L7UA 3CFDA 4EKXA 1UM4H 5AD0B 4OCWL 4X7CC 2AERT 3PQYE 3VFPB 1F58H 2NXZD 1DBKH 3MLXH 3Q3GA 3OB8A 4I5BB 5C0DB 1S3KH 1OTSC 1A7NL 1OAXH 1A7RL 3UZVB 3HNVH 1NMBH 4RNRA 1EMTL 5M95B 2X4TB 2JK5A 3FMGL 2DLTA 4OLUH 4OCRH 4MCYB 2W91A 2JJUA 3HZYB 4D3CL 2CDEA 4FXGB 5I18L 2ZSVB 4RAUB 4GMTL 5EH1A 4IIQA 1FBIH 1IEAB 32C2B 2JLLA 2YRZA 4HH9B 5FYKU 4HLZH 1UWXK 4G8FB 5IGXL 4XTRD 3RUGE 3UTOA 1QYGL 4K07A 3VFPA 3WCYA 5IHLB 3N1MC 4RIRB 3L3OA 1CFTB 3MOAL 4ZOBA 3VXTA 2HG5B 3O3BB 1I9EA 4PJFA 1LE9A 5EUKA 3IDXL 12E8L 5I1HL 4ONFL 2X1PA 3PP3H 2FX9H 4L3ED 4L9LC 3MLUL 3HZYA 2JELL 4YFLF 4DN4L 3MJ9L 1OD7A 4RAUA 4M43H 1MAJA 2GQHA 3F7QA 4GAYA 4OT1L 4XC1L 5SWZE 32C2A 4HH9A 4YGVA 5J0BA 5E0QA 1UB5B 4JPIA 5EUOA 4MS8D 4G6AD 1TENA 4BZ2H 3O6FC 4PRAB 3TBYB 1CFTA 4GKSA 3VXPB 5BVPH 2VITA 4GRWB 4LL9A 4P2QB 3WLWD 4S2SB 3Q1SH 2OL3L 2HLFC 2F53D 5D5MF 1MHPH 4X4XB 4RWYH 1HDMB 4MD0B 1EHLL 4NNPL 5E2VH 1QVOB 4I18B 1SQ2N 4YWGH 4LU5H 4P23D 4HS3A 5IVXA 4XNQA 3LQAC 5I1KL 3FO1A 4LPWA 5KVEL 2XA8L 3NFNB 2B8OT 1ZWIB 5I1IH 3LB6D 1X6NA 4XMPL 3HR6A 5C6TH 4RGNC 4PRAA 3V0AC 2DIAA 4NC1E 3QNZA 3MYJA 3AROA 2V5SA 3GHEH 5KG9B 1BWWA 4DUXA 5J9PB 3L1OL 5DT1H 2YUWA 3VXNA 5AZ2L 3FCTB 3KLSA 1NGXA 2F54A 5T5FH 4YXHH 4RFNB 2VJXA 2F8OA 5MEQB 1UENA 4UT9L 2HJFB 1G7IB 2HN7B 1BP3B 1QVOA 2AEPH 1X44A 1O5DT 4GXVH 3BP7A 2NX5A 5L6YH 2AJVH 4XBEH 1KACB 3NFNA 1ZWIA 2VIRB 5C09D 4MNHB 4XVTL 1UWGL 1YEIL 3B43A 1ZGLA 2NNAB 2AGJH 4Y16B 4Z7WF 5MENB 4L3CB 4P2OA 4CDHA 5ESQB 3B9VA 3KDMA 1CD0A 5ID1B 5TE7H 1NC4A 1G7IA 3MR9A 1XGPA 3WXWH 1QFOA 4F3FB 1N64H 3MUHL 3AFLA 4PJBE 5KTEL 3JVGC 2PW2B 4N8CL 3GSXB 5EZIH 1VFMA 4JRYE 4Z78B 4Y5XC 4MNHA 4PJDE 5C07D 5EU6A 1VKXA 4JFFE 2IFGA 4M1DH 2VDLL 4ZO7A 2W9EL 1QHPA 2NNAA 4S10A 5IK3B 1YA5A 3S35L 3TIDA 3GZKA 5F88A 2E6PA 2WK2A 2C3HA 4TSBL 4Y5VB 4TNVF 4FZEL 1VFAB 4PLKC 1NCWH 5F9JB 3EJYD 2HJKA 2FIKB 3O41B 3PWPE 4PJCE 4R0LC 3MJ8A 4LBEB 2OI9B 3IS0X 4HFUL 2I9TB 4CU6A 3QUXC 1BIIB 1GIGL 1CU4H 3GSXA 2BSED 3QZWB 5DJ8A 3K8LA 5FYKL 4Z78A 1WT5C 1CT8B 2D0FA 2IWGA 5SX4H 1FVCA 1X7QB 4FABH 5HHNB 3R06B 4Y8AA 3PE9A 1NFKA 1U0QA 1S9VA 2EDYA 1TJIH 4Q6IA 1U8QA 4Y5VA 4R7DB 2Z8VC 1RUMH 1F4AA 3QDJE 3R4DA 5F9JA 4WRLA 3EFFA 1FYTA 5KAQG 3INUH 4JLRB 4DEPC 4GRWH 1FE8H 4FFWD 2Z4QB 3H42H 4BSWB 4RFOL 5I17A 1LO3L 6FABH 3MLWH 5DHYA 3OMZA 3VU2A 1K8DB 4PRHD 2OP4L 2UWEF 5HDQL 4Z7VE 1ZT1A 3UZEA 3D0LB 4C55A 2P5WA 4NDMA 2JCCB 4LKXB 3RVWD 5SV4A 5C1MB 3CCHB 3TFKD 1KENL 2OZ4L 1BFSA 1RZKL 2ZUWA 5FM5M 1MCLA 4JLRA 3QHFH 1ZHBA 1CBVL 4YR6B 4APQD 2GSGB 4X6BB 4LHJB 4QXUH 1PKQE 1JGVL 2AJZA 5DFTA 1BQSA 1HNFA 4P4KC 4F7PB 3QO0B 1K8DA 1RIUH 4UTAH 1IM9B 1KLUA 3P9MB 5LGHL 1BEYH 1T83C 2XZQL 3QBTB 3TO2A 1MUJB 3D0LA 2NMSA 3LKPB 4U33A 1FFOA 4K2UH 3VFGL 1RHFA 2DI9A 1Z0MA 4PP2B 4NUGL 3BX7C 2OJEA 3QWOB 4G3YH 5IG7B 4AEEA 1H3PL 1A3RL 1YDPB 5DYOB 3STZB 1A6PA 5D7KD 5I0ZA 1OAYH 2J4WL 1FNSH 5E00B 1BPVA 3L9RB 2FGWH 3CK0L 3HC0B 1H3XA 1T7YA 4W6YB 1MUJA 1QD0A 3GBML 1FCCA 3VGHA 3T4YB 4XAWH 3LKPA 5DD5L 5D5ME 5L2KA 4OLVL 4F58L 4XC3H 4WNQA 4OGZA 2UY7A 1JWSA 1OCWL 1J1PH 1OAKL 5F1SA 1V05A 3LZFH 5HHXL 5J12C 3VD4A 3QWOA 1Y18A 1EAJA 1YDPA 2XRAL 5IJKA 2BHUA 3C60D 1QO3B 1J87A 5EU7C 2QSCL 1CXKA 3G6JE 4DVBA 1IGFL 2HFFB 5J3HC 4XXDB 5FKPB 1A5FH 4JG1H 1QRNE 3ULUF 1UEMA 4AEHL 4R26H 1S7VB 4N0FA 1FLRL 3U7WH 3KS0J 4ORGB 2CUIA 2ZSWB 3PP4H 3BN9D 5C08B 4G6FB 4XZUB 1H5BB 3DRQA 2AK4E 3TBWB 5HVGB 3VRJB 4CKVX 1TETH 1CICB 4TYUA 4RFEB 1I3VA 1UXSB 4JY6B 1QSFD 4GUPB 1KB5L 4JRXE 4K7FA 3RWIB 4J1UB 1U2CA 1OGAD 4UUJB 2BXZA 2YUZA 4OQTL 4U31A 5B8CC 4OB5L 4Z7WE 2HFFA 4XXDA 1B4RA 5FKPA 4EOWH 3EIFA 1E28A 2YN5A 1A6AA 5T3ZE 3B2VH 1BBDL 4OZIE 4NNXA 1U8JA 1RUQL 4Z7QF 1RZIA 1NCBH 1IAMA 2ESVD 3F7PC 2WMPA 2BK8A 5C08A 4Q9RL 1KTDB 1H5BA 5DEFA 5E7BA 2DLFL 3TBWA 4PLJD 4ERSL 3DXAD 3VRJA 5DEZA 5I19H 5I1JL 1BD2E 2B7DT 1S9XB 4JY6A 4P3WA 4RGOH 2ADIB 1HHKB 2Y6SC 4FQIL 4UUJA 4KZDH 1ITBB 4X4YA 1G9NL 4LK4A 1J0JA 1WFTA 1UACH 1MPAH 4HEME 3EBAA 3UZQA 1KGCE 3P4MB 1OM3L 2B0SL 1KBGH 1P9MC 3GSWB 2Q87A 3VA2C 1NDGA 4H1LA 3QEGH 2K3TA 4YQXL 3RIAF 1NGYA 1KTDA 2JB5L 4ZFOL 4LCUA 1V7NL 1U8MA 4C58B 2F9BT 5EORL 4CJ1A 3NGBB 4U0RB 1J1OH 4G43B 1GYAA 5CP7A 1G7PB 2ADIA 5I8CB 1HHKA 3FB6B 2BXYA 3VI4F 1CFQB 2APVA 4KJYB 2PTTA 1WK0A 2FEEL 3DRTB 4HS8L 3NCJL 2VLRD 3IDGB 4TVPE 3OAZK 3C6SB 4JFQA 2VZVA 2QLVB 1MJ7L 4WWKC 3GSWA 4WW2B 2OX5A 5LBSL 3TV3L 5C0EA 1R0AH 5E8OA 4JPVL 4NZTL 5HDBF 2GJ6D 2R23B 4G43A 3SDDC 1FN4A 4PIRF 1NFDE 1PQZA 5D2NB 4XX1G 5A3IC 5ELIA 1MIMH 2D9QB 4FQHB 2UVFA 2C3VB 1SJXA 4QHKI 1CFQA 2XZAL 4O9HH 5TH2A 3DV6B 3DRTA 4WI8A 1RK1A 4S1SH 4OD2A 4ALAL 1NBVH 2YSSB 4YLQT 4WW2A 1MCBA 5JHDB 2F58H 4YAQA 2W9LA 3R8BB 3G6DL 1FPTL 3V9FA 4UV4H 1A14H 5FV1L 4DK3A 5EFIB 5I8KH 2HRPL 2C3VA 1GOGA 4U1MB 3HPJA 1FAIL 3DV6A 4NQCE 2XN9D 4ODUA 4X9IA 5DVNA 4ZFZB 4BQBA 3FAXA 3KPRB 3V8CA 4O4YL 2VE6B 2YSSA 4Z7NE 1A6UL 5HDOA 4URTB 1YQVH 4O51B 1L0YA 2R2CA 3DX7B 5FYJU 4P3CL 3OJMB 1JI2A 1IEHA 4R4BA 4JZJA 1GGBH 3B2UC 4OCSL 1IAOA 5I73C 3F8UB 1INDL 1A7OL 3RKDC 5EFIA 1RZKC 1AGFB 4PJXE 4UINH 4ZPTA 4HCRA 1N2RA 3HC4H 2BVOB 4H1LH 4NWTH 8CGTA 2J8UF 4ZS6C 4U1MA 5DR5H 4YK4B 2YPKB 1B0GB 4KVNH 3UTSA 4ZSOB 2HVKA 2IQ9H 4WDIB 5TJWK 2I60L 1A6WH 3EHBD 3HI1B 3QIUB 5EBGA 2B1AL 3KPRA 3T3PE 4JO3L 3LCYA 4LHQB 2BRRL 5JIHA 4XCNA 3EOBA 4MB4A 2F54D 2GY5A 4KUZL 4QTHA 1OT1A 3BW9B 1V3KA 3KXFD 4QRRB 3O3EA 2DIJA 2VL4A 1CK0H 5FFLA 1P2CB 4XGZB 4WEMB 4JDTL 4NFCA 4CMMB 2NX5D 2R0KH 4QF1B 3V7AG 2FATH 3IFOA 4HKZB 4LSRH 4UMGA 4PRIA 3EYSL 2KPNA 3HI1A 3RU8H 5IMOB 4GRMB 2DQEL 2VB5A 3QRGH 2R1YA 3IYLW 1AIFA 1IGMH 1S9YB 2NPLX 1NC4D 3UJJH 1U8PA 3BW9A 1TTUA 1NANI 4QHLB 1F00I 1UFUA 4WWID 3QDGE 5BXFA 1P2CA 1A21A 4XGZA 4CMMA 5LQBH 3EO0A 4QF1A 3SDXF 4H20L 2P48B 5DJ2B 3LIZH 3D6GA 4HC1A 1HZHL 4NC0B 5IMOA 4GRMA 4LIQH 4PJ7F 2VTFA 3RBSA 1KTLB 5BV7L 2BNRE 3H3KA 4LLDB 2B2XH 3BRDA 3O6LH 4YBLB 2NY5L 3MRBA 1LWRA 2V2XB 3QXUA 4HF5L 2RFXB 2VSDA 4LFHG 5DFWH 3SDCB 2BNUA 5HGHB 3Q0HA 5IFJA 5E56A 5FO8B 4NJ9H 1WFNA 4M4RA 5DRNA 4KRPC 2AAVA 2QHRH 3MA9L 4YX2H 3U6RB 3CU7A 5DJ2A 5SV3A 2DJ4A 4PV9B 4IS6B 2WSKA 4JANB 4X6FB 1W72L 3WFHB 4P49A 3AM8C 4GW5B 4POUB 4P9ML 3KPOA 5T3XD 4U1GB 4LQFH 1MH5B 2FL5B 1F4WH 4PJAF 1S7RA 4HFWB 5ENWB 2VLKD 1BAFL 2XT1B 2ED8A 5C9JB 3O9WD 2R69L 3S4SA 2WANA 4E0RB 4ZXBA 3W5MA 2Y07H 2XQBH 2RFXA 3VFUA 3SDCA 4LAQL 2G75A 5FO8A 4YE4H 2APTA 2IALB 3VFOA 3U6RA 4X5LA 3BRGC 3VI4E 3FT2B 4PV9A 4IS6A 4JANA 3EYUH 4YBQC 1EK3A 1SY6L 4RMRA 5LCVL 3ZL4L 1FGVH 4LEXL 1WLHA 3KVQA 4RBPH 3QQ3A 1A2YB 2FL5A 4QTIH 1CD9B 1WICA 3RY5A 5I1EL 5ENWA 3R0MA 4DGYL 3V6FB 3SGDH 3EFDL 1EEZB 3AB0B 4LCCA 1NLBL 1G9NC 4CMHB 5HDBE 1J0HA 2NY0D 2VZTA 1DE4B 4LF3B 4P23B 3BZFA 3S96B 5JORA 1AXIB 1DVFA 5EU5A 2DQGL 1BM3L 4P5TC 4ELMB 1CE6A 1GGCL 1P6AB 5I1GL 1MJJB 2ZP0T 2CLVB 4KI1A 1ES0B 4FFYL 4WTZG 3ZKND 1GGIH 1BQUA 2MNUA 4N0YL 4RAVA 3WKMH 15C8H 3V6FA 4KUCD 1CG9B 4PP1D 1EEZA 1EO8H 4HC1H 4XBGA 5JHLH 5KS9F 2YXFA 1MREH 3E6HB 4L9DA 5KVGL 3EDDA 3NCEB 1SJEA 1BVLB 3H2WA 4DOHE 2MHAA 4WFHE 5C09B 2RCSH 1IFHH 4ELMA 3DIFB 1J5OH 3CXHK 1MJJA 3CUPA 4CJ0A 2MQCA 2CLVA 2F5BH 4BQ9A 1OVZA 3C5SB 4IHOA 4ZQKB 3MC0A 1P4LA 3GSNA 4KHXH 2DRUA 3ESVF 5T1LB 3FZUC 4X6DF 3WIHL 5L2KD 4XRCB 1CG9A 2Y25A 3AXLB 3LOWA 5GIRA 5E6IB 5CD3B 1J11A 3E6HA 5TDNB 1T1XB 3EJZD 3UC0H 1FO0L 4HV8B 2DQCL 3VD9A 5D70L 3BKMH 1S7XB 4BFGA 4EI5A 4OBSA 4PJHE 1ZK9A 4ZDHB 5F9OL 3DIFA 4EQ3A 1KCRL 4XNXL 2EICA 1P53A 1KCKA 4GS7B 2AJUL 5JMOC 3WE6B 3MXVH 1ZVSB 1SJVA 4WI3A 4NQED 2X4QB 3IAGC 3V6BR 3BP4B 4XRCA 3RIFF 4PBWD 1MCDA 3AXLA 2YD7A 5E5RB 5E6IA 5CD3A 3L3DB 4J12A 3H8NA 5C0CE 1EHNA 4J2XA 3GIVB 5TDNA 1JGLL 3KJ4B 2PF6A 2V9RA 3FQRB 3B6SB 1XGRA 1L0QA 5D6CA 5LGJB 2ATPA 4HV8A 2XWBB 1CF8H 4KV5F 5F9DC 5C0FB 1Q72H 2WINB 5EDXA 5INDB 2EC8A 1IC1A 4WHTB 3ARGC 1U9KA 3W2DL 1LO0H 3ZTNL 1NAKL 4YDKL 2A6IA 5F1IB 2EDFA 4M7JL 4JPWH 1BQLH 3GIVA 3SDAC 3VXOB 3QXDA 1R5IB 2FLRT 2F15A 4JM2B 5LGJA 2XWBA 3FTGA 3RKPA 2NLJB 4OZGB 1FL6B 1CCZA 3JTTB 3MLZL 1C8PA 3SDXE 1G7HB 1ZE3C 3N1FC 1TJGL 3ILQC 1U58B 1ZS8A 3H7BB 4LOUC 4ODTL 4BSJA 2Z31A 4WHTA 3MV7D 3NVQA 3TO4B 2CGRL 3O6FD 5FHBH 2PYED 4IRZL 2W0KA 2EEDA 2DWDB 1IC4H 1RUPL 2HLFD 4S1QH 4MA3A 2YK1L 3GHBH 1KSRA 4APQB 5KVFH 3VXOA 3IRPX 1R5IA 4JM2A 3QQ4A 1WWAX 2Q1EA 2BERA 3GSNH 4Q58C 1AY1H 4HT1H 4P0DA 5CEZD 3R1GL 4IDJH 1CXIA 1G7HA 3G5XA 2LU7A 1OPGL 1U58A 2H9GB 3HC3L 4M62H 3DHJA 3TO4A 1F02I 4RGND 4GQ9L 4M93B 5F93C 3VJ6A 4HDIB 2YMXL 3W11C 3BPNC 3ABZA 3I9GH 5E95B 4HKXB 5I8OL 2VDRH 1V7ML 5EZOL 3GMRA 1VHPA 4NO3A 3UTTE 5FCUL 3S34H 4JR9H 5J11C 3QCUL 3WFCL 4XP9L 1B3JA 2KQNA 4WI9A 4ZMAT 1HQRB 3PL6B 4MLSA 5BV7C 1MRFL 2OSLB 4WFGD 4YIQB 1DQLL 1EVTC 1EBPA 3LPWA 2NY6C 3VXME 1P7HL 2NY5C 2YN3A 5FHAL 1G9MH 5JXAH 1AI1H 4R8WH 2FH6A 5K59F 2D9CA 5SX5K 2V2TA 2I27N 1N5AB 5JIPA 4TQEH 3QIBC 4I8DA 1CD1A 1K3IA 1NUDA 4NCC2 3NCYS 3BIKB 1TZHA 2B5IC 3BGFB 1BGXH 4G5ZL 2UZYB 3PL6A 2OSLA 2V9QA 1Q0XH 4TOYL 1HNGA 5FYLE 4ORZC 3A6BH 1TJHL 2Q3ZA 4OD3H 4N8PA 1UCBH 4NWUL 4LVNB 3BIAX 4GSDL 4FRWA 5IBUG 5KSAB 3T0EA 1DQDL 3M1BA 3CFKA 4TRPL 4B53A 4Y2DB 3GGWA 1N5AA 1IQWH 4UU9B 2IH3A 1HH9B 2IGFH 3TBTA 2FBOJ 1YEJL 4PLKD 2H2PC 1RAMA 2P5EA 2Y4SA 4WHCA 4WU7A 4HUXA 1KPRB 4LRIC 1EUTA 3L5WA 1XCTA 3KHOA 3SE9L 2EE9A 3QUXD 3EYFB 3FQUB 5D71L 3WFBL 4BH7B 4L8DB 1FC2D 1QSFB 5BRZB 2JIXA 5KSAA 4J4PA 5HGBA 1IEBA 2X9WA 4Y2DA 4XMLH 1KB5A 5IW6A 4X6DE 5IIEB 3N50A 1HH9A 5DFVC 5EC1A 1QBMH 4R97B 1ZSDB 5DC0A 2H26A 3QWQB 4S0SD 2KQMA 4JO1L 5IKCA 2FNBA 2FR4A 1FAKT 3MRNB 4GRWF 3CGTA 4BKLA 1KB9K 1QHOA 2AI0L 3EYFA 3FQUA 1WIUA 2E6JA 4NFDA 4L8DA 5BRZA 4AG4L 2QJDA 3O3DB 4UDUB 1YNTB 4MA7L 3UJIH 1CQKA 2IPKB 1FVDA 4WUKH 2R56L 5IEKA 4MMXC 2M26A 5ACMA 2ZCLL 5IIEA 5TQ2L 3OR6A 4P2RE 1XGQA 3SGDI 5GS2H 1U8IB 1ZSDA 5JW3L 4GRLB 3P30L 4YJZL 4MNGA 4K3DH 1NGWB 5ILTL 4X9HA 3VG0L 1JUFB 4GLRH 3IDNB 4JVPA 5TE4L 2EYTA 3UBXB 1JF1A 1U3HC 2Q7YA 3BKJL 3C2AH 3BESR 3O3DA 2WLYA 1EHXA 1UEYA 1G0DA 3GMOB 4P4KD 3HNTH 1YNTA 1C5CL 3UTPE 3KPNB 2CUMA 1NMAL 5CZVH 1EH9A 4S0TD 2XQYG 1MRDH 1RHHB 3UP1A 4UIMA 1NLDL 2VLRB 1D5XA 5HPMB 3B9KC 3ZYJA 2VLJE 1YNLL 4ODSH 3VCLA 1ZA6B 4FNLH 3NACH 3HMXL 1Z3GL 3JWDH 2NY3B 4BYHA 3I3BA 3AAZA 3E6FA 3QQNA 3Q6FB 5HYQA 1INEL 3Q6GL 1JUFA 1PKOA 2P24B 4NZRH 1Y6MR 4R90L 2EDDA 1J0IA 4UQ2B 4X6EB 4KTDL 1I7RA 3P4NA 5CMAA 4KI5E 5KSUB 3KPNA 1G9EA 4O58H 3T2QA 4NSKA 1RHHA 3OAUL 3SJVA 1R3IL 2EH7L 5HPMA 5IHZA 5D2LE 1WJ3A 2UZIH 1NJ9A 3DYMA 2H32B 2X70B 1ZA6A 3K1KC 1TTGA 4UNVA 1GVIA 4TSCL 5C92A 3GBNH 4AT6A 3STBA 1HHHB 2NZ9C 1BFVL 1F45A 3Q6FA 1CGUA 5IMKA 1NH6A 4YPGB 3PNWA 3GI9H 3BQUA 1CFVH 4H0IA 2X10A 4X9FA 1GC1H 3PHOA 3OZ9H 2XN9B 2OTPA 3VMNA 3BRFA 1DLFL 5DUMH 1E6JL 3EGSB 1D3CA 4OM1L 3PWVA 3L95A 3CLEL 2WUBL 2VDNH 1BOYA 4I77H 5DF0A 3O4LE 2DLIA 2ZUUA 1PVHA 1T2QH 2L4OA 3GMQB 4OIIL 1ULVA 1A0QL 1YECL 4JJ5A 4U7SA 1LP9B 1Q9KA 3KYKL 3U30C 1I1YB 4QXTA 4YPGA 3WNNA 2EDQA 2MPAH 4KJQC 4WV1B 5F3BB 1M7IB 5I9QB 4Y19A 3PWLA 4NRZB 3HE6C 4XT1C 2IADB 4V1DE 5K59E 4XPHH 2EDTA 1VEMA 2ZOLA 2BNQE 1BOGA 3G04A 4Y4FC 1O7SA 2XPGB 3L3JB 5E03A 5TDOB 1FGNH 5CUSH 4G6JH 2P7TB 4XP5L 4X99B 3KXFB 3O6ML 2IG2H 2OS7A 4PJ9C 1XCQB 1HSAB 4L4TD 3JZ7A 1I1YA 2JCCF 3W0WD 2WV3A 1F4HA 5F3BA 4OLXH 3S5LG 4OQ1A 3VFRB 3LVEA 1MQ8A 5C6PB 4XCFH 2FO4B 2Y6SD 1JE6A 2KDGA 4MJIA 4NRZA 3LY6A 3I75B 4KRLB 1EGJH 1TPXC 4HW6A 3GSQA 2Z91A 2HJLB 3C5ZB 1OARH 1CIUA 4JHZA 2DMKA 4BM7A 2ITCB 2D7TH 1F4XH 5JA8B 3P9LA 3CVIH 1XCQA 4WU5B 1YEGL 3FN0L 4PS4L 1WGOA 4D94A 3U2SA 2MTPA 3BSZL 4F9PC 1FJ1B 3VFRA 4XVSH 2DBLL 1HOCA 2FO4A 3PUCA 4TUJB 4EI5D 3RY4A 2X4PB 1CYGA 1G7QB 1MQKH 2EXWC 3KJ6H 4N9OB 1SBSL 3PGCB 2DLHA 4XPAH 2HJLA 1F6FB 5CJXA 3C5ZA 4WWKD 5FUCE 3U4BH 5GRWA 2ERJB 2ZPKL 4HPOH 4QHUB 1FL5A 3PDOA 3PHSA 4LSTH 4P2QE 1PZ5B 3LH2L 3ESUF 1SYVB 4NRYB 3UX9B 4GG6B 2CD0A 5EO1B 1KPVB 7FABH 2F5AL 3O0RL 3SDDD 5F7UA 1P4BH 1RU9L 1H3GA 5A3ID 1RJYB 3EO1A 2X4PA 3KG5A 1I1AB 2M2DA 2BVPB 3C6LA 2ZNXA 3QDMD 4NO0A 5DI8A 2VAAB 4Z0BL 2H45A 5HHME 5F7EH 3PGCA 4ZYKB 4OSUL 4NUJA 5FYKD 5HI4D 1U8OB 4AIZB 4Q97A 4X8JB 5TE6L 1S5IL 3K2UH 5GGVL 2VLKB 4NQXA 1OAQH 4YDJB 4F2MB 4QHUA 1NCDH 4LASL 2AK1L 2IQAB 1NCTA 1PZ5A 1CDYA 1MCJA 5ISZD 4GG6A 4ZPVB 5EO1A 4JM4H 1ACYH 3P0VH 2QQQA 1RZJH 3SKOA 2RR3A 1RJYA 2EKJA 1OAZL 1FIEA 4MAUH 4MA1B 1CTNA 4PTUB 2BVPA 3VFVB 3BDXA 2L0DA 4ODHL 1RZGB 3S88L 5B39G 2XTJB 1T21A 4D0BB 4XNZC 4ZYKA 3SGKC 4AIZA 1U8OA 4FFVC 4X8JA 1K5NB 1PG7L 4ONGH 2HLAB 3VXSD 5DJXB 4F2MA 1DQQB 4LRIA 4ZFGL 4UB0H 2JE8A 5MENE 3BPLB 4FG6C 3B2UD 4ZPVA 4Z95L 3V52L 4HUVB 3SE4C 3RKDD 3WIIL 4YBHA 4ZUVB 2X09A 1BBJB 2ZJSL 3A6CL 1XFPA 2XZZA 4ZS6D 2V7NB 3T2PA 4CAGA 3OAYH 5GRJL 4PTUA 3VFVA 3ARQA 4AEFA 1YPZA 5HDLA 4HLZG 2V5RA 4MNQB 3HE7B 1A6TB 4JFDB 4HIIB 2HAZA 4Z76A 2GK0A 2K1MA 5I15L 2N7BA 2NXYC 3IETB 4U6TA 2Q8BH 4LLAA 3WDHA 4E42A 2APBA 4N0UB 2CKBA 3A67L 4NM8H 3ZE2E 2D4DA 4U05A 1IBGH 2P45B 2ZCKH 5TPWL 1FZKB 5DJXA 1DQQA 4NO5B 3Q5YA 1Z6JT 3SQOL 1DSFL 1FSKC 4IMKC 4ZD3H 3BO8B 4ODBD 5CWSB 3FRPG 2XNAB 1ZGLP 5K9OA 1MNUL 5F96H 1BBJA 3RGVA 1N3NB 1MI5D 2V7NA 3C9NB 1R3KB 4JFDA 1A6TA 3G9VA 3TLRA 5FB8A 4OCMC 1SEQH 3QULB 3IETA 5DVMA 3R8QA 4JQXC 3LDBC 4Y4HA 5GZOC 3RA7H 1SJHB 4PGCB 1FZKA 4JN1H 2DM2A 2VDQH 4NO5A 2FD6L 3D9AL 1QQDA 1KULA 2EYRA 2EIZA 5DUPL 4XMKL 1MELA 2XNAA 1YN6B 8FABB 4ZTPH 4KDVA 2BSSA 4JQVA 5D1ZC 4YHZL 5ITBL 1MSPA 4KHTL 3QHTC 3DVGA 4WW2F 5IW1B 2H8PB 3E1F1 4PGEB 4N5EC 4UILL 4MMZC 4HWZB 3T0ED 4K3EL 3QULA 5EWIH 1XF2B 4P57A 3TPUA 4NQVB 5E94A 1SJHA 5A2LH 3IFLH 3SCMC 1I1FA 3BH8B 1K2DB 1OP5H 1MVUA 1LK3L 5BMFL 4HWBA 4X7SH 1YN6A 2JCCE 4XCYA 4HZAA 3OBAA 2V6HA 4FXKA 5EN2B 1W8OA 4QRQB 5TGBB 2BCKB 4KRPD 3KPSB 5IW1A 4TPRL 1B6DA 1T7VA 2R1WB 3UTZA 2EYSB 1XGTB 1V3LA 2JIXD 4LLMB 5GRUH 2E5EA 4WUUD 4KKBC 5CBAB 4QNPE 3KPQB 4DW2H 1CXHA 1G0XA 4YZFF 1I3RB 1XF2A 1ORQA 3N9GH 3ARRA 2VR9A 3QI9C 2OMBA 1CLCA 3NN8A 4NQVA 5FYJH 2LV4A 3DO3A 3D85D 1K2DA 1LEGB 3E8UH 3QT2A 1IT9L 4J3OC 1N7MH 3HUJB 3HS0B 3H7LA 4PJ5B 5BS0E 3BUTA 5KW9L 1RIHH 4UNTA 2Z93B 2LAGB 2CKBH 3MACL 4H8WH 1JPGA 4POZC 5ESVB 4Z0XA 2Q86B 3W5NA 3FFCB 4HPYH 1CDUA 4JHAL 4QRUB 3U9PL 5GJSL 2R1WA 1WITA 5KSBA 3OKOB 1I1RA 3MBEC 1XGTA 5D7LD 3RTQA 2VDKL 4DGVL 5CBAA 4YBQD 2JB6B 2YRLA 1I3RA 1PSKL 2DI7A 3HKFA 3WHE0 4PREB 3VXRB 3B5GA 1ZHNB 4N9GB 2FDBP 5F97E 4S1DD 2C1OB 4HXAH 1AR2A 3HS0A 4PJ5A 4M3JA 5DO2D 1M7XA 5ESVA 1IC7H 3IDMB 5AWNL 5DMIL 4QRUA 3H9ZA 4KKAC 3EO9H 4P5TD 1G6RB 3OG6B 5I8EB 2AJ3A 2JB6A 3IJHB 4RMWA 1MEXH 3TZVB 3RDTA 3VXRA 3KYOB 5SWQA 1KCLA 2WUCH 3I6GB 3I2CH 5DMGC 4PRBB 3LKNB 1CR9H 3HZVB 4O2EB 5D6DA 4HSQA 1JNHB 1N0XL 1P7QB 4R96B 2CIIB 2FX7H 1NGZA 3GBLA 1IC5L 3RZWA 2RJMA 4U1LA 2D03H 3UTQB 3UBXI 2CK0H 4NN5C 1HHJB 3D39D 3L5XL 3SJVD 3TZVA 4EIZC 1J8HE 2P1YA 4X8XA 3FZUD 1KJ2B 3RNQA 2G60L 4PRBA 3M8OL 3U46A 5HYSB 1E27A 1OW0A 4P4RB 2C26A 3MZGB 2H2SC 3FL7A 3VXQB 5DA4A 4G8EA 3RWGB 3FO0H 4IBLT 5LGKA 1P7QA 3K3QA 4R96A 5DRWB 1B0WA 5IQ7H 2AABL 3ARFC 5JTWA 3MV01 5FGCE 5D7JB 4Y5XB 3PF2A 4YHOL 3UTQA 3RZCB 2XTLA 2VDML 5CEYB 1HHJA 5C2BL 1KCVH 4M5ZH 5KZCD 3ZDZF 4J3SA 1RMFL 4M6NL 3WS6C 4JHWH 1TZIB 4BFEA 1VESA 4M1CC 1IGJB 2HH0L 4JFXA 5K33A 1TVBA 3D3VE 4HAFA 1AO7B 5DD0L 1T89A 5HYSA 3LS4L 1OGTB 4R0LB 4RMTA 1HIML 4M8QA 3RWGA 2QSQA 2A77H 3ULUL 2D7PA 2VDOH 1X5ZA 3MV8A 4NCDA 5ESAB 5I16A 2G2RA 5D7JA 2UYLB 4EBQL 2CXGA 2R2EB 1XGUB 3HG1A 1JV5A 1FZMA 3CAFA 4HUWA 4L8CB 3RZCA 2R0WH 4C56A 3ULVE 4BZ1L 3ARGD 2FSEA 2R4RH 3QA3B 5T33L 5E2UH 3NA9L 2BOBA 3OHXB 4W6WB 4OFDA 3H9SD 1U93B 1OSPL 2YPVH 1OGTA 4DEPB 5J8OA 3KYAA 4G8GD 3SDAD 1A47A 2DQUL 2QR0A 4OAWB 1ZV5A 5IBTL 4M5YH 1L7IL 3B3IA 4YDLC 4M00A 3N1PC 3PQYA 3L5HA 5DTFB 1ZLVH 4L8CA 3HNSH 4M3KB 4J8RB 1ZANL 4LOUD 5DK0B 4G9DB 2DOCA 5KVDH 4GAJL 3F7VB 3H3PH 3MRHB 2A74B 1A6VL 3I6KB 3QA3A 4YHIB 3QDAA 3RVVC 5D96C 5D2NE 2CQVA 1MFDH 3LPFA 1KUMA 2DWEB 1MCPH 4ELMF 3QCTL 5E8DH 5ALBH 3SOBL 3C87A 5SWZB 5J6GB 1EDQA 1HKLH 3THMH 4OAWA 2X7LB 3U7YH 4AM0B 1RUKL 1T0MB 4I0PC 3RUGA 2Q8AH 4P4KB 4KK9C 5DTFA 1QFUL 5JHDE 1RUAH 2MMXA 5BQ7B 5DK0A 1MHEA 4G9DA 1CL7L 5I2IB 3W11D 2A74A 1J0KA 4YHIA 4C59B 2E8ZA 1I8KB 1Y6NR 2X44D 2EIEA 5F7NC 2DWEA 3K1DA 3LN4B 4OFKA 2AP2A 4ONHB 2VLLB 5LWYL 4X4ME 1CLYH 1J1XL 25C8L 2WM0A 4OLYH 4LSUL 2IAMC 4P9HL 5SWZA 5J6GA 2JTDA 5DURD 1RURH 2HTKC 4RISH 2A2QT 2X7LA 4G9FD 5K9KB 4AM0A 4KK6C 4I9WE 1T0MA 3HMXA 5DD1L 1D5IL 4MJ4A 1KJ2H 2G5BA 5L9DH 3QP3A 1IGYB 2OJZH 3TVMA 4YFEA 4K94L 1WISA 1D7FA 2D2OA 1ND0B 2VWEE 4U1SA 4M1GL 5I2IA 5MI0C 2XV6B 3C6LD 1CWVA 2DI8A 4LCWE 3V4UL 2AXGB 3V6ZA 3QIBD 1A7QL 3IFPB 4NJAH 1A1OB 2VLLA 5IV2B 1FH5L 4J6RH 3H0TA 4MD5B 4N1HB 2NY1C 1YYML 4ZSOE 5J12B 3EW3B 2VYRE 4PRNA 5EPMB 3TWCH 4TUOA 3WHXA 1U95A 1HXMB 4FQXA 1FZJB 1P1ZB 3TJEL 5SWSD 4OZHB 5E1AA 4HMCA 3MRDB 2RBLA 4HS6A 2OTWB 1B2WH 1F3JB 2Y36L 1ND0A 1F42A 3P4OB 4W4NA 1KIRB 3QUML 5C7XH 2HRLA 1A3QA 1YN7B 4QRRE 1TZGH 5CP3A 3FHAA 4JY4A 4PRPE 2AXGA 1UC6A 5AZEH 1FFQA 2MKLC 1RVFH 4ENEC 2VH5L 3LS5H 2ARJQ 3CVHL 1U6AL 3K74B 3DUSB 4YXKH 2H2PD 1ORSA 5EPMA 3TN0C 4JDZB 3VFSB 4D0DB 1FZJA 1P1ZA 1KELH 4KTEL 4L8BA 4LCIL 3ZTJH 4N8VB 4Z6AT 2OTWA 3REVB 4LRNH 3P4OA 1I7TB 1RD6A 2XG5A 1YN7A 5B8CB 2FCBA 5HHQB 4CU8A 4LLQB 4JM2F 2CRMA 3OKMA 1ZLWH 4OZGF 3OGCB 1C12B 1F11B 5DFVD 4B41A 3K4ZA 1G7LA 2R2HB 3O3AA 4K8RH 1X5FA 4PJCB 2FJFB 3DUSA 4PJBA 1IILE 1KT2B 5A16A 4K23H 1XMWA 1X5GA 1AGDA 4X9BA 2J88H 5F9WB 4L4TB 3F62A 4JRYA 3F58H 1IM3A 4DFHA 4PJDA 3S36L 4YDIL 5FA3B 2ILLA 4JFFA 4XNMA 5FGSA 1T04B 3REVA 3MBEA 3FQTB 4ODVL 3EOYG 2A38A 1AFVL 3HI6H 4YHPB 1QBLL 5DK2B 2EDBA 2A83A 4LLQA 1ZTXH 4LHUB 2X6MA 4PGDB 4NKDB 1VACA 4EN3B 4DWHA 1C5BH 1F11A 3QDJB 5EBLB 1ZLUK 1Q9LA 4QYOA 4UTBL 3PWPA 5FDWB 2FJFA 4KDWA 4JRWA 3VWKA 5GGQL 1ZLSH 4M48L 2YHGA 4LSDA 4MAYB 1QNZH 4LLYA 1U3HD 2GIYA 4L3EE 5FA3A 1KN2L 4XP6L 1JRHH 4KGJA 3V0WH 3FQTA 4W68A 4XPBL 3MOBH 1P7KB 4Z7VB 1A7RH 3TA3C 4YHPA 5CEXA 5DK2A 3MA7B 4TNWK 4LHUA 3WSQH 4H1LG 3QEHA 3FMGH 2D7NA 5EZJB 4LGSB 3TCLA 4EN3A 3QDJA 3B9KD 3MLPA 1ED3A 5E08L 4MZ3A 3ZDYF 4M02A 4Z5RB 4N5UA 2Q76A 3QUYA 1PKQB 1D5ZB 4MAYA 2D31A 3ET9F 3O2DA 3SDDB 4P59L 3T0BA 4N1EA 2EKSB 2ATKB 4CDGC 4Z7VA 3IDXH 3QDMB 3MA7A 3ULUC 5CJ5A 1MY5A 5DQDL 3ZE1F 3WV0A 1JZ4A 1M6OA 1B4JH 3U0WL 5M7QA 1EEQA 1C16B 3MJ9H 1W0VB 5DQJA 2YD3A 2NYYC 1JTOA 3GK8L 4XC1H 3X14B 1PKQA 2LVEA 4ZNEE 4OTXH 2EE3A 1I8IB 2NZ9D 4XNYH 1ETZA 3HRZA 2CO6B 4D8PB 2W59A 3KPLA 3V5DB 35C8H 3KGRA 2EDHA 2H3NA 5I0DA 1UVQB 5GSVA 3VDBA 2WBJC 2ATKA 1EFQA 3RTQD 2AKRB 3RWJB 3NABH 4WCYH 3WO4C 5C09E 2Y1VA 3EYOB 3CPLB 1SM3L 3N1QC 4MXWL 6CGTA 1KN4L 4LEOB 4OF6A 5K9QG 1YEFL 2A6JB 3MRFB 4CN1A 1I8IA 2V9TA 1D9KC 3QUKB 1AJ7H 4XMPH 4IRJC 5I73B 4D8PA 4GMSL 3LRHA 3FN9A 1S5HA 3FN3A 1UVQA 2JJTA 4KJQD 3G6JB 2N1KA 4NKOB 2MCPH 5HHOB 4HHAB 1NEZA 3HE6D 1JHKL 5D5MA 1E4XH 4DJMA 5F70A 2H1PH 3FB7A 4UT9H 1HHIB 4DQOL 2AW2A 2GW5A 5C07E 4X9GA 4Q9QL 4Q2ZB 3QCVL 1JZ7A 4U1HB 4LEOA 2AK4B 2DQFA 1GAFL 5TF1H 3QUKA 5EZLB 1T80A 4PJ9D 4JZNB 3T65B 3KPPB 3OB0K 4JRXB 4ZAKC 2NY7L 3WN5A 2PW1B 3G6JA 3S8WA 2GSIB 1AC0A 4P9HC 5C0AD 4L8SC 4HHAA 3AS1A 1QRNA 1JHLH 2RGSA 3O2DH 1BJ1J 5ACZB 3LN5B 4YHLL 3TPKA 2APXA 3ZKXB 3ROOB 1N4XH 3ZE0F 3HZMB 4UV7L 1M7DB 4K94C 3O6KL 2YC1B 2ZOKB 4Q2ZA 3J8F7 3TJHC 2AK4A 1QEWB 3QO1B 4JZNA 4R2GB 3KPPA 1MOEA 4NYLB 4HIEA 2A6DA 4JRXA 4ONOA 5ALCL 1A02N 2NY2B 1F6AB 4Z7WA 3RL2B 1EERB 3CFCH 1YMMD 4A6YA 3S3PA 4OZIA 3OKKA 5ACZA 3LN5A 3QG7H 5DMKB 1ZAGA 3OF6D 2EXWD 3P40A 4OZGE 3ROOA 5HJ3B 2X4OA 3HZMA 3L6FB 4KY1L 1YEHH 1M7DA 2E9BA 1OTUC 2YC1A 4PBVC 2ZOKA 4PRHE 3TYGL 2KZ1B 1AD9B 3GEWB 2HVJA 4WO4B 1UM4L 5HI3C 3W9EB 1AXSB 1QEWA 1F58L 1BD2A 1DBKL 2R2BA 3MLXL 3RFZC 1CDJA 5BZWB 4GH7B 1S3KL 4IOFC 2O61B 2CJUH 3HNVL 1F6AA 5A2FA 1UJ3C 3Q5TA 1NMBL 2GFBA 5L88H 1BECA 2W0PA 2DQHH 1CLZH 3UAJC 3O2VH 4C56D 5T1KA 3QFJD 3DVFA 3OX8B 3TH3T 3L6FA 5DQ9B 43CAA 3QUZC 4MS8C 1JWMA 5C0RH 1VGEH 1FBIL 1R5WB 1DUZB 1AHWA 4F7TB 3C08L 4NN6C 4WO4A 1JPTH 4KKCC 1MCCA 3U1SH 1OY3B 1NFDB 5BZWA 2O61A 2DJSA 1MAMH 4KDTC 4WTXA 1WBYB 4R7NA 5EO0A 2OM5A 4U1JB 5D7SH 4LSSH 4WTZA 2YD4A 5D7LB 2FX9L 4B0MM 5ICXB 4XPTH 4MJ6B 1LP9F 2QKIB 3DV4B 2HT2C 4M43L 3S4SG 5IR1B 4ZUWB 5H35A 5D7KE 1JGDB 4FFVD 2AXJA 1E4KA 1R5WA 4LLVB 4OZ4B 3T0XA 5JW4N 1R5VB 1QFWH 3IDIB 3T04D 2GYSA 4U7MA 1HQ4A 3VXUD 3W39B 4JFPB 5C0BA 1UKQA 4MDJB 1G6VK 4BZ2L 4KPHH 5BVPL 1Q94B 3UCRA 4LPXA 4HX1A 1WBYA 3Q1SL 2XZQH 5DJYB 1MHPL 1RV6X 2QQNL 4ZFOB 1X5IA 2Z8RA 2DTSA 4M7KH 5E2VL 3VFGH 4KQ4L 3MLYL 2OMNA 3TT1H 3FQNB 4ZUWA 5C0JA 2HT3C 1JGDA 4LU5L 1CTOA 2FRGP 1S7QA 3IDIA 2VL5B 5GRYA 4A6YH 5I1IL 1H3PH 5T3ZH 4IMLA 3W39A 5C6TL 4MDJA 2QEJA 1J9CT 3B9DA 2J4WH 5DDHA 2NY4B 1DL7H 4HWUA 3GHEL 1QPPA 1UWEH 2SEBB 3MNVB 2WLZA 4Q7DA 5DT1L 1O0VA 4BQCA 4E41D 4NQCA 4IRSA 5T5FL 3V7MA 1S7SB 1IVLA 3MRMB 5GS1B 4NIKB 1FCGA 2E3VA 5CGMA 5EIVA 3SBWC 43C9B 5HY9A 2AEPL 3FQNA 1KG0A 1QLFA 1PLGH 4GXVL 1QSFE 2CIKA 3PV6A 5GZOD 3HFMH 1CLOH 2AJVL 1OGAE 4XBEL 1LQSR 3VW3H 2OQJA 4PJXA 3RI5K 2BY1A 3O45B 2DJUA 1R3JB 2AGJL 5T1MB 3I3DA 5D1ZD 2SEBA 4H25A 4OLWH 3IDUA 5DA0B 2B4CL 3RP1A 5TE7L 4N5ED 3MRMA 3QIWC 4RMQA 3WXWL 1U3ZA 3MJ7B 43C9A 1K6QH 1N64L 3DXAE 1MFBH 4K7PH 3FQXB 4PLOB 3BE1H 4GG6F 3HN3A 5D1XC 5E2WH 3G9AB 3G6AB 3BI9X 4H0HB 5EZIL 4XAKD 3UJTH 4NT6A 1EIBA 1FZOB 4TVPH 5HYIA 4UIKL 1G7MB 4M1DL 1J10A 3CSPA 3QDGB 3UO1H 1HHGA 3VFTA 2NZIA 2VZSA 4XXCC 3J7HA 1Q0YH 4K3JH 4M6AA 5TQ0H 4XCCH 1DN2A 1V3MA 4N68A 1LO2H 1BFOA 2F19H 3RJQB 1BBDH 1NCWL 4YO0A 1II4E 3ARGB 5DVLA 3BOVA 2AJXH 4KKBD 3MJ7A 1AD0B 2R4SL 2VXTH 3ZE0E 3BH9B 4XP1H 5ITFB 1F5WA 1CU4L 3G6AA 2V17H 2EZ0C 3JWOH 3MNZB 4NQDD 3PHQB 1FZOA 4HZLA 4JJHA 2YA2A 5DJCB 3RY6C 1QR1B 1G7MA 3BIBX 4FABL 3SDAB 3L3IB 2NW3A 4LNVA 4ZODA 2VLRE 1MWAB 5ADPH 5DSCA 1QRKA 4POZD 5I1AB 2X1XR 4JRYD 2XYCA 4J23A 4GW4B 1JJUA 3MNWB 1TJIL 4OBRA 1B0RA 3V5KB 1RUML 3MBED 3QXAA 3INUL 1ODAA 1P4IH 1YEKH 2GJ6E 1AD0A 4M7ZC 5EBMA 2BNRA 1FE8L 3H42L 3NH7H 3VWJC 2K7PA 3BH9A 3MFGB 5DRXB 5ITFA 1OP9A 5J89A 1JPFA 1IKNA 3MNZA 4WI4A 4HWNA 6FABL 3MLWL 3CJJA 2IBBA 4ZO9A 1MWAA 1OF2B 3IGAB 3QG6B 1BLNB 3ELAT 1HYSC 4H26B 1VA9A 3CNKA 3MOQA 4GW4A 2FBJH 3ZKMD 4KKAD 3KLDA 4JFZL 2GK2A 5BJTB 1CGTA 3T8XA 2JJSA 4KK5D 3EYQC 2ADFH 5FGRA 1MCSA 4CVZA 2WIIB 4QXUL 5JIKA 1NAMA 1UB6B 4PJGB 2AJSL 3K2MC 1I9RL 1AGBB 3BZEB 1WSST 5EC2B 4HAGA 4UTAL 2XN9E 3WS3B 2GKIA 4QKXB 4F9LC 2CXKA 3UROR 1BEYL 4OGXL 1OF2A 1MRCH 2I5YH 3QG6A 4FQQB 5BV7B 2H6PB 2ADJA 3TNMB 1BLNA 4H26A 2EO9A 3HPLB 2NY6B 2Y7QB 2EDWA 3RQ3A 3RNKB 2P8PB 2XZAH 5CZXC 3IVKB 3AS2A 1X5YA 1QG3A 3P0YH 4K2UL 4KXZH 2B1HH 3SE8H 3C60C 5TDPA 5IESH 4G3YL 1UB6A 2HKFH 3QIBB 5AAWA 2XKNB 3BZEA 5EC2A 4OCYH 1W72B 2B5IB 2CDGA 3OPZH 1OAYL 3SY0A 1FNSL 4AH2A 2FGWL 4F37K 4DK6A 5KJRL 1EJ6A 2H2SD 3QJHB 4FQQA 3TNMA 4U3CA 3F7YB 3T1FB 1TVHB 2Y7QA 3ARFD 1FAIH 4PG2C 2P8PA 3RNKA 1T20A 2F54E 3GSRB 4FQ1H 5FIEA 4I2XE 4O5LH 4XC3L 1JMXA 2X9XA 3MREB 3DX6A 3KXFE 2EH8L 5MEPA 4X83A 5F9AC 1IAIL 3LZFL 1DR9A 4NGHH 3GJEB 2KUTA 3ARBB 1JK8A 3WFZA 4FZ8H 3X13B 2NX5E 3WUZA 4M1CD 4LQ1A 3O11A 4FXLA 4LLWA 5GS0H 5KSBF 4BQ8A 4AIXA 5JNYB 3QJHA 1EEYA 3P0GB 5JDSB 1A5FL 4JG1L 4R26L 2W07A 1WZ1H 5E8EA 4RX4A 1WIOA 3QR2A 4WHYH 3U7WL 5DK3A 4O2CB 1MWAH 3PP4L 3HUJF 5CJQH 4UDTB 5DD6B 3VDCA 5E9DA 1I8LC 4GKOA 4DTGL 1DN0B 1EUUA 1ONQB 1DDHB 4PY7B 3DSFH 1KPUB 5C0CB 3G5YB 3V0VB 3BP6B 1U41A 2IJ0C 1NAMH 2J8UA 4EOWL 3E3QE 4PJHA 4UBDC 5L8JB 1HSBB 2ARWA 4OCXH 3SDYL 3B2VL 2VR5A 4FQLH 5HHPB 2DL9A 4Y4KC 4GKZB 1NDMB 1UZ6E 1DBMH 1NCBL 4UDTA 4QHNB 1MCRA 1DN0A 1ONQA 2KZWA 1QFWI 3LKQB 3RVVD 5I19L 3GMLA 3VGDA 1KPUA 4LFHD 5BVJA 5C0CA 3DO7B 3IKCB 3V0VA 4RGOL 5EIQA 4M9PA 4ZFFB 1C7TA 1UZ8B 4OFYD 4KZDL 5T3XE 5C6WH 2AV7B 1HSBA 1UACL 1MPAL 1BZ9B 1HZHH 2VLKE 5HHPA 2CRYA 4KK9D 1KBGL 1ZT4A 4HKJA 1S7TB 3BEVA 1X5LA 5BV7H 4NQSB 2ADGA 3L5IA 4P5KB 4IIQC 3QEGL 4P48A 4QHNA 1VCAA 2AXFB 4U0QB 4JG0H 3IJSB 2B4CC 1J1OL 2EECA 2A6KB 1SBBA 3SPVB 3MRPA 1DBAH 1U8NA 3IKCA 4KAQH 3OKNB 4KH2A 4MB3A 1I75A 3OSKA 3B8YA 1UZ8A 4LGPB 3BDYH 1NL0H 2HTKD 3SDXA 1W0WB 5HSFA 3GJFB 5IVNA 1K8IA 1RJZB 2AV7A 4KK6D 4MQSB 3H9HB 4K9EH 4PJ7A 4XP4H 5GGRA 4KRNA 4WW1A 1DUYB 1VADB 1MHHA 4YC2B 4BK4A 1A7PH 2GJZB 4JE4B 3RPIB 3F12B 2R69H 3ZSSA 3CFBB 2J7LA 5E2TH 1OL0A 1MIML 2NY1D 4LAQH 1T22A 4MNQE 2EE6A 3BISA 2C7UB 1VGKB 4O9HL 1W0WA 1KFAH 4X6CB 4X7DC 1RJZA 4N0UE 3H9HA 4S1SL 3GSOB 2O26U 2UY6A 5D93B 5DGQA 3ZL4H 3JV6A 3AU1A 2FECL 5E99H 4KKLC 5GGTA 2GJZA 2VKXA 5E8NB 3U36A 3UTTA 1IARB 2X89A 4UV4L 1T0PB 3CFBA 1A14L 4ACPA 2DQIL 1MCIA 4MCZB 5I8KL 1LNUA 3CDGB 3EOTH 4WENB 2W65B 4UZGA 4EI6A 1KNOA 1I3GH 3IRZA 1J05A 1ZLWK 5C0BD 5I76B 3TN0D 4FFZH 3VXMA 3U30B 4AIOA 2Z35A 3P9WB 1HYRC 3GSOA 3S37X 1S9WA 1KIPB 1E6OH 4YHKL 5GRXG 2A73B 3HE6B 1BVZA 1YQVL 3NIDF 3UYOD 1FNGA 3NAAH 4JN2B 4PV8B 1GGBL 1BJ1H 3NTCH 1WZKA 5AAMA 2VN7A 4U1IB 2N7AA 4L29B 4Y4FB 4UINL 3IDJA 4MCZA 3CDGA 4WEBH 1FORH 1YUHB 3UEZA 4R4NC 3HC4L 5GISH 2I9LA 3B5TA 5DR5L 4FHBD 3CZJA 4KVNL 4PJ9B 4P2OC 5IQ9B 2IQ9L 3NCFB 5I76A 5I30H 4NQEE 4RFNC 4TULH 2FB4H 3L3GB 3QEUB 1N5YH 2BP3A 1KIPA 3DMMB 5I6XC 2QADC 3GNMH 3S98A 2P42B 1X5AA 3EDEA 4CVWA 1TQCB 1WBXB 4U1IA 3F5WB 1K4CB 5E24E 1VFBB 2R0KL 1KLFA 2X1WL 2FATL 4CNIB 4IEFB 4LSRL 3ZHDA 1NCAH 3B8SA 5IQ9A 3HAEB 5KN5B 2RQ8A 5CGYC 1MCOL 1ZHLB 1EFXD 4LMQI 5DVKA 3RU8L 5L8LB 1JHTA 3CU1A 3L3GA 2FEEI 3WHE1 3QRGL 3RWFA 5LAXB 5HYJD 4L1DA 3DMMA 1IGML 1JZ2A 4EZMA 3HUJE 1DJSA 1YMMB 3TA3D 4DUVA 5DWUH 1C08B 4X6DA 3GJFH 4R3SB 3IF1A 4P2RB 3IU4H 4HXBH 1Z5LB 1L9NA 5FKAB 3MV9D 4U2YA 1DBBH 2ZCHH 1K4CA 1RZFH 1I4FB 1QBAA 5LQBL 3MV7E 1R24A 2PYEE 3LIZL 5GGTH 2YUVA 3U9UA 2DQDH 3HAEA 5DS8A 1JTPA 4JKPH 4MYWB 4Q6IC 3I6LD 4Y5VC 4OI8A 3CC5B 1MJUH 3MMEB 1JNNL 4LIQL 5B3NA 4OF3A 4KXZI 5B3JE 2EDRA 4PTTB 5LAXA 2WQRA 2B2XL 2ICEB 3O6LL 2C4FU 5MERA 1KJVB 4W81A 3QH3B 3ULUD 4R3SA 2VLJB 3E2HC 4P2RA 1D6EA 4OF8A 5CEZE 3N85H 3AREA 4F57H 2EDLA 3DGGA 4OZHF 1I4FA 1FNFA 2BX5A 4RGNE 2QHRL 4YX2L 2DB8A 2NYYD 4GBXA 3N1GC 3MRRB 1TCRB 1U2HA 3MGOA 3MSPA 3CC5A 3G5ZB 1SEBA 3BUYB 2YPLB 2I07B 3MO1B 4HCRL 2WBJD 1F4WL 2ICEA 4FTVD 1KJVA 4PJBF 3AVEA 5FYLH 5CSBA 5GHWH 1QOKA 4WFGE 3MRIB 1KEGH 2Y07L 5D2LB 2XQBL 3TYFB 2VXUL 2CLZB 4HULB 5BCAA 4PJEE 3L7FB 5J57B 4OM0L 4PJDF 3BPCB 1HKFA 5FEBA 4ODWA 3AC0A 5IBLC 3EYUL 5F6IB 1D9KD 2WWMD 1FV1B 2HWZH 1CZ8H 3VFNA 3L7EB 3G5ZA 3HC3H