3WI4A

Crystal structure of wild-type porb from neisseria meningitidis serogroup b
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
312
structure length
309
Chain Sequence
DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of Neisseria meningitidis PorB extracellular loops potentially implicated in TLR2 recognition.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords Major outer membrane protein P.IB
total genus 63
structure length 309
sequence length 312
ec nomenclature
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3wi4A00
4LSHA 5DL7A 3WI5A 4FMSA 4RJWA 1HXTA 6PRNA 3SYBA 1HXXA 5PRNA 1PRNA 3FYXA 3VZWX 1BH3A 5DL5A 4FSPA 2Y2XA 4LSIA 5DL8A 2J1NA 3HW9A 3PRNA 3WI4A 3UPGA 5FVNA 3EMNX 2OMFA 4RJXA 4FSOA 3POUA 3O0EA 1OPFA 2XG6A 4D65A 2Y0KA 3K19A 2XE1A 4LSFA 3PORA 1E54A 2Y0LA 3SYSA 2XE2A 4KR8A 5JDPA 1GFPA 8PRNA 3POXA 4FRTA 5DL6A 3SY9A 2J4UP 3POQA 1GFOA 1GFMA 2K4TA 1HXUA 2ZLDA 3JTYA 3SY7A 1GFQA 3T24A 1OSMA 3T20A 2PRNA 3VZTX 2XE3A 4C69X 4LSEA 4FRXA 3VY8X 4FOZA 3SZDA 4FT6A 4GCSA 2PORA 2XE5A 2FGQX 2QTKA 1H6S1 3A2SX 2Y0HA 3SZVA 2ODJA 4D64A 2FGRA 4D5UA 4GCQA 2O4VA 3T0SA 4KRAA 4AUIA 1BT9A 3NSGA 4GCPA 4BUMX 7PRNA 3VZUX 4JFBA 1MPFA 4KR4A 3VY9X 2ZFGA 1PHOA 1GFNA 3HWBA 3UU2A
chains in the Genus database with same CATH superfamily
1IZNA 3VE1A 4LSHA 5DL7A 3WI5A 4GF4A 5IYUA 2R8AA 3WU2O 4FMSA 4RJWA 1HXTA 6PRNA 4N75A 3HOLA 3SYBA 1HXXA 1THQA 3AA6B 5PRNA 1PRNA 3FYXA 3VZWX 2X9KA 1BH3A 3DWOX 4AKRA 4N59A 1ZHYA 5DL5A 3AAEA 1MM5A 3DZMA 3BRZA 4FSPA 4AYID 2WVPA 2Y2XA 2W81C 3BS0A 4K3BA 4LSIA 3HOEA 5DL8A 5KAFO 1T1LA 5GTHO 5ADXK 5G39A 3PGRA 2J1NA 2JQYA 3DA4A 3HW9A 2LHFA 4JCHA 1S5LO 2X27X 3HWBA 5D5DA 3PRNA 1QJPA 4AKMA 4C4VA 2K0LA 3WI4A 5ADXL 4AYDC 3QRCA 4O4UA 2M07A 5FVNA 3EMNX 3UPGA 2KC0A 2ERVA 3KVDD 4FUVA 5B5EO 2F1CX 2OMFA 2Y7SA 1IZNB 3C5OA 5AFUL 5GV0A 4RJXA 2MHLA 3UAQA 3LK41 4FSOA 3TZGA 3DWNA 4AYMC 4AFKA 3POUA 3O0EA 3AA7A 3LK3B 1OPFA 3GP6A 2XG6A 3AA1A 4FESA 4RLCA 5E79O 4QQ1A 2Y0KA 5GTIO 4O3WA 4D65A 3K19A 5T5FA 3AA1B 1ZHTA 3VE2A 2XE1A 4LSFA 5TISO 3PORA 2R4OA 2AXTO 1E54A 2R4LA 4AYNA 2Y0LA 5B66O 3PQUA 1T16A 3SYSA 2YNKA 1Q9GA 4B61A 4FZMA 2XE2A 4KR8A 1Q9FA 5JDPA 1QJ8A 3PQSA 4PJ0O 1GFPA 8PRNA 3AA7B 2YPVA 2JMMA 3POXA 2KXPB 4FRTA 4FZNA 2IWVA 3LK2A 4G76A 4N58A 5DL6A 5G26A 2WJRA 1ORMA 3NJTA 3SY9A 3BRYA 2J4UP 4CTDA 4UB6O 2LFUA 2MNHA 1GFOA 1GFMA 3LK42 3POQA 2K4TA 4K3CA 4O4XA 2W80C 2KZ7B 3AA0B 2R88A 1HXUA 2XTRA 4N74A 4PR7A 4C4VB 4E1SA 3DA3A 3LK3A 3JTYA 4O49A 2R89A 3KZIO 3SY7A 1GFQA 3T24A 4E1TA 1OSMA 3T20A 2PRNA 1ZHZA 2XE3A 3AAAA 4G75A 4LSEA 2R4NA 3VZTX 4C69X 4FRXA 1ZHXA 3VY8X 4AYEC 2F1TA 3G7GA 4F4BA 1QJ9A 3A0BO 4FOZA 4Z3TA 4IL6O 4XNKA 3SZDA 3LK2B 4GHBA 4FT6A 4FZLA 3AA6A 4GCSA 1G90A 2PORA 2KXPA 4O3YA 4UB8O 4RL9A 2XE5A 4C00A 3PGUA 2KZ7A 2WJQA 3RBHA 2GE4A 4AZLA 2FGQX 2QTKA 2XMXA 1H6S1 3A2SX 4XNLA 3V8UA 2Y0HA 3AAAB 5KAIO 2ODJA 3SZVA 4D64A 2FGRA 4D5UA 4U9CA 3PF1A 2IWWA 1P4TA 1ZHWA 2O4VA 2F1VA 4GCQA 5G3AA 4AKRB 5AFUK 3T0SA 4FQEA 5H2FO 4KRAA 4AUIA 1BT9A 2R4PA 3NSGA 4GCPA 4BUMX 7PRNA 4O3XB 4JFBA 1MPFA 2N2MA 3A0HO 2N2LA 3JCUO 4RLBA 3AA0A 2XTQA 5EE2A 3VZUX 1BXWA 1MM4A 1YS5A 2M06A 3QRAA 2KDYA 3AAEB 4KR4A 4PUXA 3VY9X 2ZFGA 5G38A 3PGSA 1PHOA 1GFNA 2ZLDA 3UU2A 4O3ZA
chains in the Genus database with same CATH topology
1IZNA 3VE1A 4LSHA 5DL7A 3WI5A 4GF4A 5IYUA 4FMSA 4RJWA 1HXTA 6PRNA 3HOLA 3SYBA 1HXXA 1THQA 3AA6B 5PRNA 1PRNA 3FYXA 3VZWX 1BH3A 4AKRA 4N59A 1ZHYA 5DL5A 3AAEA 1MM5A 4FSPA 4AYID 2Y2XA 2W81C 4LSIA 3HOEA 5DL8A 5ADXK 2J1NA 3DA4A 3HW9A 2LHFA 4JCHA 2X27X 3HWBA 5D5DA 3PRNA 1QJPA 4AKMA 2K0LA 3WI4A 5ADXL 4AYDC 3QRCA 4O4UA 2M07A 5FVNA 3EMNX 3UPGA 2KC0A 2ERVA 3KVDD 4FUVA 2Y7SA 2OMFA 5AFUL 1IZNB 3C5OA 5GV0A 4RJXA 2MHLA 3LK41 4FSOA 3TZGA 4AYMC 3POUA 3O0EA 3AA7A 3LK3B 1OPFA 3GP6A 2XG6A 3AA1A 4FESA 4RLCA 4D65A 4QQ1A 2Y0KA 4O3WA 3K19A 5T5FA 3AA1B 1ZHTA 3VE2A 2XE1A 4LSFA 3PORA 1E54A 4AYNA 2Y0LA 3PQUA 3SYSA 2YNKA 1Q9GA 4B61A 4FZMA 2XE2A 4KR8A 1Q9FA 5JDPA 1QJ8A 3PQSA 1GFPA 8PRNA 3AA7B 2YPVA 2JMMA 3POXA 2KXPB 4FRTA 4FZNA 3LK2A 4G76A 4N58A 5G26A 5DL6A 3SY9A 3UAQA 1ORMA 2J4UP 2LFUA 2MNHA 1GFOA 1GFMA 3LK42 3POQA 2K4TA 4O4XA 2W80C 2KZ7B 3AA0B 1HXUA 2XTRA 4E1SA 3DA3A 3LK3A 3JTYA 4O49A 3SY7A 1GFQA 3T24A 4E1TA 1OSMA 3T20A 2PRNA 1ZHZA 2XE3A 3AAAA 4G75A 4LSEA 3VZTX 4C69X 4FRXA 1ZHXA 3VY8X 4AYEC 2F1TA 3G7GA 4F4BA 1QJ9A 4FOZA 4Z3TA 4XNKA 3SZDA 3LK2B 4GHBA 4FT6A 4FZLA 3AA6A 4GCSA 1G90A 2PORA 2KXPA 4O3YA 4RL9A 2XE5A 2KZ7A 3RBHA 2GE4A 4AZLA 2FGQX 2QTKA 2XMXA 1H6S1 3A2SX 4XNLA 3V8UA 2Y0HA 3AAAB 3SZVA 2ODJA 4D64A 2FGRA 4D5UA 4U9CA 1P4TA 1ZHWA 2O4VA 2F1VA 4GCQA 4AKRB 5AFUK 3T0SA 4KRAA 4AUIA 1BT9A 3NSGA 4GCPA 4BUMX 7PRNA 4O3XB 4JFBA 1MPFA 2N2MA 4RLBA 2N2LA 3VZUX 3AA0A 2XTQA 5EE2A 4AFKA 1BXWA 1MM4A 1YS5A 2M06A 3QRAA 2KDYA 3AAEB 4KR4A 4PUXA 3VY9X 2ZFGA 1PHOA 1GFNA 2ZLDA 3UU2A 4O3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSH A;  5DL7 A;  3WI5 A;  4FMS A;  4RJW A;  1HXT A;  6PRN A;  3SYB A;  1HXX A;  5PRN A;  1PRN A;  3FYX A;  3VZW X;  1BH3 A;  5DL5 A;  4FSP A;  2Y2X A;  4LSI A;  5DL8 A;  2J1N A;  3HW9 A;  3PRN A;  3WI4 A;  3UPG A;  5FVN A;  3EMN X;  2OMF A;  4RJX A;  4FSO A;  3POU A;  3O0E A;  1OPF A;  2XG6 A;  4D65 A;  2Y0K A;  3K19 A;  2XE1 A;  4LSF A;  3POR A;  1E54 A;  2Y0L A;  3SYS A;  2XE2 A;  4KR8 A;  5JDP A;  1GFP A;  8PRN A;  3POX A;  4FRT A;  5DL6 A;  3SY9 A;  2J4U P;  3POQ A;  1GFO A;  1GFM A;  2K4T A;  1HXU A;  2ZLD A;  3JTY A;  3SY7 A;  1GFQ A;  3T24 A;  1OSM A;  3T20 A;  2PRN A;  3VZT X;  2XE3 A;  4C69 X;  4LSE A;  4FRX A;  3VY8 X;  4FOZ A;  3SZD A;  4FT6 A;  4GCS A;  2POR A;  2XE5 A;  2FGQ X;  2QTK A;  1H6S 1;  3A2S X;  2Y0H A;  3SZV A;  2ODJ A;  4D64 A;  2FGR A;  4D5U A;  4GCQ A;  2O4V A;  3T0S A;  4KRA A;  4AUI A;  1BT9 A;  3NSG A;  4GCP A;  4BUM X;  7PRN A;  3VZU X;  4JFB A;  1MPF A;  4KR4 A;  3VY9 X;  2ZFG A;  1PHO A;  1GFN A;  3HWB A;  3UU2 A; 
#chains in the Genus database with same CATH topology
 1IZN A;  3VE1 A;  4LSH A;  5DL7 A;  3WI5 A;  4GF4 A;  5IYU A;  2R8A A;  3WU2 O;  4FMS A;  4RJW A;  1HXT A;  6PRN A;  4N75 A;  3HOL A;  3SYB A;  1HXX A;  1THQ A;  3AA6 B;  5PRN A;  1PRN A;  3FYX A;  3VZW X;  2X9K A;  1BH3 A;  3DWO X;  4AKR A;  4N59 A;  1ZHY A;  5DL5 A;  3AAE A;  1MM5 A;  3DZM A;  3BRZ A;  4FSP A;  4AYI D;  2WVP A;  2Y2X A;  2W81 C;  3BS0 A;  4K3B A;  4LSI A;  3HOE A;  5DL8 A;  5KAF O;  1T1L A;  5GTH O;  5ADX K;  5G39 A;  3PGR A;  2J1N A;  2JQY A;  3DA4 A;  3HW9 A;  2LHF A;  4JCH A;  1S5L O;  2X27 X;  3HWB A;  5D5D A;  3PRN A;  1QJP A;  4AKM A;  4C4V A;  2K0L A;  3WI4 A;  5ADX L;  4AYD C;  3QRC A;  4O4U A;  2M07 A;  5FVN A;  3EMN X;  3UPG A;  2KC0 A;  2ERV A;  3KVD D;  4FUV A;  5B5E O;  2F1C X;  2OMF A;  2Y7S A;  1IZN B;  3C5O A;  5AFU L;  5GV0 A;  4RJX A;  2MHL A;  3UAQ A;  3LK4 1;  4FSO A;  3TZG A;  3DWN A;  4AYM C;  4AFK A;  3POU A;  3O0E A;  3AA7 A;  3LK3 B;  1OPF A;  3GP6 A;  2XG6 A;  3AA1 A;  4FES A;  4RLC A;  5E79 O;  4QQ1 A;  2Y0K A;  5GTI O;  4O3W A;  4D65 A;  3K19 A;  5T5F A;  3AA1 B;  1ZHT A;  3VE2 A;  2XE1 A;  4LSF A;  5TIS O;  3POR A;  2R4O A;  2AXT O;  1E54 A;  2R4L A;  4AYN A;  2Y0L A;  5B66 O;  3PQU A;  1T16 A;  3SYS A;  2YNK A;  1Q9G A;  4B61 A;  4FZM A;  2XE2 A;  4KR8 A;  1Q9F A;  5JDP A;  1QJ8 A;  3PQS A;  4PJ0 O;  1GFP A;  8PRN A;  3AA7 B;  2YPV A;  2JMM A;  3POX A;  2KXP B;  4FRT A;  4FZN A;  2IWV A;  3LK2 A;  4G76 A;  4N58 A;  5DL6 A;  5G26 A;  2WJR A;  1ORM A;  3NJT A;  3SY9 A;  3BRY A;  2J4U P;  4CTD A;  4UB6 O;  2LFU A;  2MNH A;  1GFO A;  1GFM A;  3LK4 2;  3POQ A;  2K4T A;  4K3C A;  4O4X A;  2W80 C;  2KZ7 B;  3AA0 B;  2R88 A;  1HXU A;  2XTR A;  4N74 A;  4PR7 A;  4C4V B;  4E1S A;  3DA3 A;  3LK3 A;  3JTY A;  4O49 A;  2R89 A;  3KZI O;  3SY7 A;  1GFQ A;  3T24 A;  4E1T A;  1OSM A;  3T20 A;  2PRN A;  1ZHZ A;  2XE3 A;  3AAA A;  4G75 A;  4LSE A;  2R4N A;  3VZT X;  4C69 X;  4FRX A;  1ZHX A;  3VY8 X;  4AYE C;  2F1T A;  3G7G A;  4F4B A;  1QJ9 A;  3A0B O;  4FOZ A;  4Z3T A;  4IL6 O;  4XNK A;  3SZD A;  3LK2 B;  4GHB A;  4FT6 A;  4FZL A;  3AA6 A;  4GCS A;  1G90 A;  2POR A;  2KXP A;  4O3Y A;  4UB8 O;  4RL9 A;  2XE5 A;  4C00 A;  3PGU A;  2KZ7 A;  2WJQ A;  3RBH A;  2GE4 A;  4AZL A;  2FGQ X;  2QTK A;  2XMX A;  1H6S 1;  3A2S X;  4XNL A;  3V8U A;  2Y0H A;  3AAA B;  5KAI O;  2ODJ A;  3SZV A;  4D64 A;  2FGR A;  4D5U A;  4U9C A;  3PF1 A;  2IWW A;  1P4T A;  1ZHW A;  2O4V A;  2F1V A;  4GCQ A;  5G3A A;  4AKR B;  5AFU K;  3T0S A;  4FQE A;  5H2F O;  4KRA A;  4AUI A;  1BT9 A;  2R4P A;  3NSG A;  4GCP A;  4BUM X;  7PRN A;  4O3X B;  4JFB A;  1MPF A;  2N2M A;  3A0H O;  2N2L A;  3JCU O;  4RLB A;  3AA0 A;  2XTQ A;  5EE2 A;  3VZU X;  1BXW A;  1MM4 A;  1YS5 A;  2M06 A;  3QRA A;  2KDY A;  3AAE B;  4KR4 A;  4PUX A;  3VY9 X;  2ZFG A;  5G38 A;  3PGS A;  1PHO A;  1GFN A;  2ZLD A;  3UU2 A;  4O3Z A; 
#chains in the Genus database with same CATH homology
 1IZN A;  3VE1 A;  4LSH A;  5DL7 A;  3WI5 A;  4GF4 A;  5IYU A;  4FMS A;  4RJW A;  1HXT A;  6PRN A;  3HOL A;  3SYB A;  1HXX A;  1THQ A;  3AA6 B;  5PRN A;  1PRN A;  3FYX A;  3VZW X;  1BH3 A;  4AKR A;  4N59 A;  1ZHY A;  5DL5 A;  3AAE A;  1MM5 A;  4FSP A;  4AYI D;  2Y2X A;  2W81 C;  4LSI A;  3HOE A;  5DL8 A;  5ADX K;  2J1N A;  3DA4 A;  3HW9 A;  2LHF A;  4JCH A;  2X27 X;  3HWB A;  5D5D A;  3PRN A;  1QJP A;  4AKM A;  2K0L A;  3WI4 A;  5ADX L;  4AYD C;  3QRC A;  4O4U A;  2M07 A;  5FVN A;  3EMN X;  3UPG A;  2KC0 A;  2ERV A;  3KVD D;  4FUV A;  2Y7S A;  2OMF A;  5AFU L;  1IZN B;  3C5O A;  5GV0 A;  4RJX A;  2MHL A;  3LK4 1;  4FSO A;  3TZG A;  4AYM C;  3POU A;  3O0E A;  3AA7 A;  3LK3 B;  1OPF A;  3GP6 A;  2XG6 A;  3AA1 A;  4FES A;  4RLC A;  4D65 A;  4QQ1 A;  2Y0K A;  4O3W A;  3K19 A;  5T5F A;  3AA1 B;  1ZHT A;  3VE2 A;  2XE1 A;  4LSF A;  3POR A;  1E54 A;  4AYN A;  2Y0L A;  3PQU A;  3SYS A;  2YNK A;  1Q9G A;  4B61 A;  4FZM A;  2XE2 A;  4KR8 A;  1Q9F A;  5JDP A;  1QJ8 A;  3PQS A;  1GFP A;  8PRN A;  3AA7 B;  2YPV A;  2JMM A;  3POX A;  2KXP B;  4FRT A;  4FZN A;  3LK2 A;  4G76 A;  4N58 A;  5G26 A;  5DL6 A;  3SY9 A;  3UAQ A;  1ORM A;  2J4U P;  2LFU A;  2MNH A;  1GFO A;  1GFM A;  3LK4 2;  3POQ A;  2K4T A;  4O4X A;  2W80 C;  2KZ7 B;  3AA0 B;  1HXU A;  2XTR A;  4E1S A;  3DA3 A;  3LK3 A;  3JTY A;  4O49 A;  3SY7 A;  1GFQ A;  3T24 A;  4E1T A;  1OSM A;  3T20 A;  2PRN A;  1ZHZ A;  2XE3 A;  3AAA A;  4G75 A;  4LSE A;  3VZT X;  4C69 X;  4FRX A;  1ZHX A;  3VY8 X;  4AYE C;  2F1T A;  3G7G A;  4F4B A;  1QJ9 A;  4FOZ A;  4Z3T A;  4XNK A;  3SZD A;  3LK2 B;  4GHB A;  4FT6 A;  4FZL A;  3AA6 A;  4GCS A;  1G90 A;  2POR A;  2KXP A;  4O3Y A;  4RL9 A;  2XE5 A;  2KZ7 A;  3RBH A;  2GE4 A;  4AZL A;  2FGQ X;  2QTK A;  2XMX A;  1H6S 1;  3A2S X;  4XNL A;  3V8U A;  2Y0H A;  3AAA B;  3SZV A;  2ODJ A;  4D64 A;  2FGR A;  4D5U A;  4U9C A;  1P4T A;  1ZHW A;  2O4V A;  2F1V A;  4GCQ A;  4AKR B;  5AFU K;  3T0S A;  4KRA A;  4AUI A;  1BT9 A;  3NSG A;  4GCP A;  4BUM X;  7PRN A;  4O3X B;  4JFB A;  1MPF A;  2N2M A;  4RLB A;  2N2L A;  3VZU X;  3AA0 A;  2XTQ A;  5EE2 A;  4AFK A;  1BXW A;  1MM4 A;  1YS5 A;  2M06 A;  3QRA A;  2KDY A;  3AAE B;  4KR4 A;  4PUX A;  3VY9 X;  2ZFG A;  1PHO A;  1GFN A;  2ZLD A;  3UU2 A;  4O3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...