3WI4A

Crystal structure of wild-type porb from neisseria meningitidis serogroup b
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
312
structure length
309
Chain Sequence
DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of Neisseria meningitidis PorB extracellular loops potentially implicated in TLR2 recognition.
pubmed doi rcsb
molecule keywords Major outer membrane protein P.IB
molecule tags Membrane protein
source organism Neisseria meningitidis
total genus 63
structure length 309
sequence length 312
ec nomenclature
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3wi4A00
1E54A 2XE2A 2PRNA 3JTYA 4LSIA 3POXA 1GFQA 4KR4A 3PORA 3WI5A 2K4TA 5DL5A 2XE1A 3T20A 2Y0LA 2QTKA 5JDPA 4D64A 2Y0HA 1HXTA 3HWBA 3NSGA 4FMSA 3UPGA 2ZLDA 1GFOA 2J4UP 2OMFA 1BT9A 4FOZA 4KR8A 3PRNA 3SY9A 1HXUA 3HW9A 3K19A 3SYBA 3VY8X 4GCSA 4GCPA 4FRTA 8PRNA 2XG6A 3POQA 1GFMA 2Y0KA 3VY9X 4AUIA 2J1NA 3VZUX 1PHOA 4LSEA 1H6S1 2XE3A 2ZFGA 4FSOA 5DL6A 1MPFA 5DL8A 2PORA 4RJWA 3SYSA 1OPFA 1GFPA 3SZDA 2FGQX 3T0SA 2XE5A 1BH3A 3SY7A 3FYXA 4D5UA 4LSHA 4FT6A 4BUMX 4RJXA 2FGRA 2ODJA 1PRNA 2Y2XA 4FRXA 4GCQA 3A2SX 3UU2A 4FSPA 2O4VA 1GFNA 4C69X 3SZVA 7PRNA 3EMNX 4LSFA 6PRNA 3VZTX 5FVNA 5PRNA 3POUA 3O0EA 4D65A 4KRAA 3VZWX 3T24A 1HXXA 1OSMA 4JFBA 3WI4A 5DL7A
chains in the Genus database with same CATH superfamily
3AA0B 4FQEA 2XTQA 1E54A 1ZHTA 2XE2A 3DA4A 3HOEA 2PRNA 3DWNA 4U9CA 3JTYA 3A0BO 4LSIA 5G39A 2F1TA 2KDYA 3POXA 3DWOX 1GFQA 5G3AA 4KR4A 2KXPA 3RBHA 3PORA 3WI5A 2WJRA 2K4TA 3LK3A 2X9KA 5DL5A 4FZNA 4O3WA 2XE1A 4AFKA 3AAAB 1Q9FA 3T20A 2Y0LA 3QRCA 2MHLA 2QTKA 2R4OA 4AKRA 3NJTA 4XNLA 5JDPA 4D64A 4RLBA 4F4BA 4AYEC 4O3ZA 1S5LO 5ADXL 2Y0HA 1HXTA 5IYUA 3HWBA 2W80C 2WJQA 3NSGA 4O49A 2KZ7A 4O3YA 2MNHA 2KXPB 1IZNB 2ZLDA 1GFOA 4FMSA 2OMFA 4O3XB 1BT9A 4FOZA 1YS5A 4KR8A 4N59A 4E1SA 2IWVA 4UB8O 3AA6A 4UB6O 5GTHO 2YNKA 3PRNA 1G90A 3BRZA 3SY9A 1HXUA 3TZGA 3LK41 2AXTO 2KC0A 3HW9A 2WVPA 1MM5A 4N74A 5AFUL 4G76A 1T1LA 3A0HO 4QQ1A 3K19A 4FUVA 3SYBA 4AYID 2JMMA 3VY8X 3PGUA 4AYNA 2M06A 2GE4A 4FZMA 5KAFO 4N58A 4GCSA 1P4TA 2LFUA 4GCPA 3JCUO 4PJ0O 4FRTA 8PRNA 2XG6A 3AA7A 3QRAA 4K3BA 3POQA 3VE1A 1GFMA 2K0LA 4O4UA 2Y0KA 4FESA 3VY9X 4AUIA 4E1TA 1BXWA 1ZHZA 3AA1A 2XTRA 1THQA 2R4NA 4AYMC 2J1NA 3G7GA 2R89A 3VZUX 4PR7A 4O4XA 1PHOA 1H6S1 1MM4A 4GHBA 4LSEA 4G75A 2W81C 2XMXA 4C4VA 2XE3A 3UPGA 3LK2A 4Z3TA 3LK3B 5GTIO 5T5FA 2ZFGA 2R88A 3AAEA 4FSOA 4RL9A 5DL6A 1MPFA 1T16A 5DL8A 5E79O 1ZHYA 2PORA 4RJWA 5G38A 3SYSA 2R4PA 2IWWA 4IL6O 5DL7A 3AA7B 3HOLA 3KZIO 4AZLA 3DZMA 1OPFA 1GFPA 2F1CX 3LK42 4JCHA 3SZDA 4AKRB 3PF1A 4C00A 3PGSA 3AA1B 2FGQX 3T0SA 2J4UP 3VE2A 1BH3A 3SY7A 1Q9GA 3UAQA 3FYXA 2R8AA 2KZ7B 2LHFA 4D5UA 4LSHA 4FT6A 4BUMX 5B66O 5ADXK 5KAIO 3AAAA 5D5DA 1QJPA 2N2MA 3PQSA 4RJXA 4XNKA 5GV0A 3AA6B 2FGRA 3AAEB 2JQYA 2ODJA 3WU2O 5EE2A 1PRNA 3BRYA 3PQUA 2N2LA 2YPVA 2Y2XA 4FRXA 4GCQA 3A2SX 4PUXA 4FSPA 3UU2A 2F1VA 4AKMA 2O4VA 4B61A 1GFNA 2Y7SA 4C69X 5TISO 5H2FO 4RLCA 1ZHXA 3SZVA 3PGRA 3V8UA 1IZNA 3EMNX 4LSFA 5AFUK 7PRNA 2X27X 6PRNA 3VZTX 1ORMA 4K3CA 5FVNA 3AA0A 5PRNA 3C5OA 5B5EO 3POUA 2M07A 2ERVA 4CTDA 1QJ9A 1QJ8A 2R4LA 4AYDC 3O0EA 4GF4A 3KVDD 5G26A 4N75A 4D65A 4C4VB 3LK2B 3GP6A 3BS0A 4KRAA 3VZWX 3T24A 1HXXA 1OSMA 1ZHWA 4JFBA 3WI4A 2XE5A 4FZLA 3DA3A
chains in the Genus database with same CATH topology
3AA0B 2XTQA 1E54A 1ZHTA 2XE2A 3DA4A 3HOEA 2PRNA 4U9CA 3JTYA 4LSIA 2F1TA 2KDYA 3POXA 1GFQA 4KR4A 2KXPA 3RBHA 3PORA 3WI5A 2K4TA 3LK3A 5DL5A 4FZNA 4O3WA 2XE1A 4AFKA 3AAAB 1Q9FA 3T20A 2Y0LA 3QRCA 2MHLA 2QTKA 4AKRA 4XNLA 5JDPA 4D64A 4RLBA 4AYEC 4O3ZA 5ADXL 2Y0HA 1HXTA 5IYUA 3HWBA 2W80C 3NSGA 4O49A 4O3YA 2KZ7A 2MNHA 2KXPB 1IZNB 2ZLDA 1GFOA 4FMSA 2OMFA 4O3XB 1BT9A 4FOZA 1YS5A 4KR8A 4N59A 4E1SA 3AA6A 2YNKA 3PRNA 1G90A 3SY9A 1HXUA 3TZGA 3LK41 2KC0A 3HW9A 1MM5A 5AFUL 4G76A 4QQ1A 3K19A 4FUVA 3SYBA 4AYID 2JMMA 3VY8X 4AYNA 2M06A 2GE4A 4FZMA 4N58A 4GCSA 1P4TA 2LFUA 4GCPA 4FRTA 8PRNA 2XG6A 3AA7A 3QRAA 3POQA 3VE1A 1GFMA 2K0LA 4O4UA 2Y0KA 4FESA 3VY9X 4AUIA 4E1TA 1BXWA 1ZHZA 3AA1A 2XTRA 1THQA 4AYMC 2J1NA 3G7GA 3VZUX 4O4XA 1PHOA 1H6S1 1MM4A 4GHBA 4LSEA 4G75A 2W81C 2XMXA 2XE3A 3UPGA 3LK2A 4Z3TA 3LK3B 5T5FA 4F4BA 2ZFGA 3AAEA 4RL9A 4FSOA 5DL6A 1MPFA 5DL8A 1ZHYA 2PORA 4RJWA 3SYSA 5DL7A 3AA7B 3HOLA 4AZLA 1OPFA 1GFPA 4JCHA 3LK42 4AKRB 3SZDA 3AA1B 2FGQX 3T0SA 2J4UP 3VE2A 1BH3A 3SY7A 1Q9GA 3UAQA 3FYXA 2KZ7B 2LHFA 4D5UA 4LSHA 4FT6A 4BUMX 5ADXK 3AAAA 5D5DA 1QJPA 2N2MA 3PQSA 4RJXA 4XNKA 5GV0A 3AA6B 2FGRA 3AAEB 2ODJA 5EE2A 1PRNA 3PQUA 2N2LA 2YPVA 2Y2XA 4FRXA 4GCQA 3A2SX 4PUXA 4FSPA 3UU2A 2F1VA 4AKMA 2O4VA 4B61A 1GFNA 2Y7SA 4C69X 4RLCA 1ZHXA 3SZVA 3V8UA 1IZNA 3EMNX 4LSFA 5AFUK 7PRNA 2X27X 6PRNA 3VZTX 1ORMA 5FVNA 3AA0A 5PRNA 3C5OA 3POUA 2M07A 2ERVA 1QJ9A 1QJ8A 4AYDC 3O0EA 4GF4A 3KVDD 5G26A 4D65A 3LK2B 3GP6A 4KRAA 3VZWX 3T24A 1HXXA 1OSMA 1ZHWA 4JFBA 3WI4A 2XE5A 4FZLA 3DA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E54 A;  2XE2 A;  2PRN A;  3JTY A;  4LSI A;  3POX A;  1GFQ A;  4KR4 A;  3POR A;  3WI5 A;  2K4T A;  5DL5 A;  2XE1 A;  3T20 A;  2Y0L A;  2QTK A;  5JDP A;  4D64 A;  2Y0H A;  1HXT A;  3HWB A;  3NSG A;  4FMS A;  3UPG A;  2ZLD A;  1GFO A;  2J4U P;  2OMF A;  1BT9 A;  4FOZ A;  4KR8 A;  3PRN A;  3SY9 A;  1HXU A;  3HW9 A;  3K19 A;  3SYB A;  3VY8 X;  4GCS A;  4GCP A;  4FRT A;  8PRN A;  2XG6 A;  3POQ A;  1GFM A;  2Y0K A;  3VY9 X;  4AUI A;  2J1N A;  3VZU X;  1PHO A;  4LSE A;  1H6S 1;  2XE3 A;  2ZFG A;  4FSO A;  5DL6 A;  1MPF A;  5DL8 A;  2POR A;  4RJW A;  3SYS A;  1OPF A;  1GFP A;  3SZD A;  2FGQ X;  3T0S A;  2XE5 A;  1BH3 A;  3SY7 A;  3FYX A;  4D5U A;  4LSH A;  4FT6 A;  4BUM X;  4RJX A;  2FGR A;  2ODJ A;  1PRN A;  2Y2X A;  4FRX A;  4GCQ A;  3A2S X;  3UU2 A;  4FSP A;  2O4V A;  1GFN A;  4C69 X;  3SZV A;  7PRN A;  3EMN X;  4LSF A;  6PRN A;  3VZT X;  5FVN A;  5PRN A;  3POU A;  3O0E A;  4D65 A;  4KRA A;  3VZW X;  3T24 A;  1HXX A;  1OSM A;  4JFB A;  3WI4 A;  5DL7 A; 
#chains in the Genus database with same CATH topology
 3AA0 B;  4FQE A;  2XTQ A;  1E54 A;  1ZHT A;  2XE2 A;  3DA4 A;  3HOE A;  2PRN A;  3DWN A;  4U9C A;  3JTY A;  3A0B O;  4LSI A;  5G39 A;  2F1T A;  2KDY A;  3POX A;  3DWO X;  1GFQ A;  5G3A A;  4KR4 A;  2KXP A;  3RBH A;  3POR A;  3WI5 A;  2WJR A;  2K4T A;  3LK3 A;  2X9K A;  5DL5 A;  4FZN A;  4O3W A;  2XE1 A;  4AFK A;  3AAA B;  1Q9F A;  3T20 A;  2Y0L A;  3QRC A;  2MHL A;  2QTK A;  2R4O A;  4AKR A;  3NJT A;  4XNL A;  5JDP A;  4D64 A;  4RLB A;  4F4B A;  4AYE C;  4O3Z A;  1S5L O;  5ADX L;  2Y0H A;  1HXT A;  5IYU A;  3HWB A;  2W80 C;  2WJQ A;  3NSG A;  4O49 A;  2KZ7 A;  4O3Y A;  2MNH A;  2KXP B;  1IZN B;  2ZLD A;  1GFO A;  4FMS A;  2OMF A;  4O3X B;  1BT9 A;  4FOZ A;  1YS5 A;  4KR8 A;  4N59 A;  4E1S A;  2IWV A;  4UB8 O;  3AA6 A;  4UB6 O;  5GTH O;  2YNK A;  3PRN A;  1G90 A;  3BRZ A;  3SY9 A;  1HXU A;  3TZG A;  3LK4 1;  2AXT O;  2KC0 A;  3HW9 A;  2WVP A;  1MM5 A;  4N74 A;  5AFU L;  4G76 A;  1T1L A;  3A0H O;  4QQ1 A;  3K19 A;  4FUV A;  3SYB A;  4AYI D;  2JMM A;  3VY8 X;  3PGU A;  4AYN A;  2M06 A;  2GE4 A;  4FZM A;  5KAF O;  4N58 A;  4GCS A;  1P4T A;  2LFU A;  4GCP A;  3JCU O;  4PJ0 O;  4FRT A;  8PRN A;  2XG6 A;  3AA7 A;  3QRA A;  4K3B A;  3POQ A;  3VE1 A;  1GFM A;  2K0L A;  4O4U A;  2Y0K A;  4FES A;  3VY9 X;  4AUI A;  4E1T A;  1BXW A;  1ZHZ A;  3AA1 A;  2XTR A;  1THQ A;  2R4N A;  4AYM C;  2J1N A;  3G7G A;  2R89 A;  3VZU X;  4PR7 A;  4O4X A;  1PHO A;  1H6S 1;  1MM4 A;  4GHB A;  4LSE A;  4G75 A;  2W81 C;  2XMX A;  4C4V A;  2XE3 A;  3UPG A;  3LK2 A;  4Z3T A;  3LK3 B;  5GTI O;  5T5F A;  2ZFG A;  2R88 A;  3AAE A;  4FSO A;  4RL9 A;  5DL6 A;  1MPF A;  1T16 A;  5DL8 A;  5E79 O;  1ZHY A;  2POR A;  4RJW A;  5G38 A;  3SYS A;  2R4P A;  2IWW A;  4IL6 O;  5DL7 A;  3AA7 B;  3HOL A;  3KZI O;  4AZL A;  3DZM A;  1OPF A;  1GFP A;  2F1C X;  3LK4 2;  4JCH A;  3SZD A;  4AKR B;  3PF1 A;  4C00 A;  3PGS A;  3AA1 B;  2FGQ X;  3T0S A;  2J4U P;  3VE2 A;  1BH3 A;  3SY7 A;  1Q9G A;  3UAQ A;  3FYX A;  2R8A A;  2KZ7 B;  2LHF A;  4D5U A;  4LSH A;  4FT6 A;  4BUM X;  5B66 O;  5ADX K;  5KAI O;  3AAA A;  5D5D A;  1QJP A;  2N2M A;  3PQS A;  4RJX A;  4XNK A;  5GV0 A;  3AA6 B;  2FGR A;  3AAE B;  2JQY A;  2ODJ A;  3WU2 O;  5EE2 A;  1PRN A;  3BRY A;  3PQU A;  2N2L A;  2YPV A;  2Y2X A;  4FRX A;  4GCQ A;  3A2S X;  4PUX A;  4FSP A;  3UU2 A;  2F1V A;  4AKM A;  2O4V A;  4B61 A;  1GFN A;  2Y7S A;  4C69 X;  5TIS O;  5H2F O;  4RLC A;  1ZHX A;  3SZV A;  3PGR A;  3V8U A;  1IZN A;  3EMN X;  4LSF A;  5AFU K;  7PRN A;  2X27 X;  6PRN A;  3VZT X;  1ORM A;  4K3C A;  5FVN A;  3AA0 A;  5PRN A;  3C5O A;  5B5E O;  3POU A;  2M07 A;  2ERV A;  4CTD A;  1QJ9 A;  1QJ8 A;  2R4L A;  4AYD C;  3O0E A;  4GF4 A;  3KVD D;  5G26 A;  4N75 A;  4D65 A;  4C4V B;  3LK2 B;  3GP6 A;  3BS0 A;  4KRA A;  3VZW X;  3T24 A;  1HXX A;  1OSM A;  1ZHW A;  4JFB A;  3WI4 A;  2XE5 A;  4FZL A;  3DA3 A; 
#chains in the Genus database with same CATH homology
 3AA0 B;  2XTQ A;  1E54 A;  1ZHT A;  2XE2 A;  3DA4 A;  3HOE A;  2PRN A;  4U9C A;  3JTY A;  4LSI A;  2F1T A;  2KDY A;  3POX A;  1GFQ A;  4KR4 A;  2KXP A;  3RBH A;  3POR A;  3WI5 A;  2K4T A;  3LK3 A;  5DL5 A;  4FZN A;  4O3W A;  2XE1 A;  4AFK A;  3AAA B;  1Q9F A;  3T20 A;  2Y0L A;  3QRC A;  2MHL A;  2QTK A;  4AKR A;  4XNL A;  5JDP A;  4D64 A;  4RLB A;  4AYE C;  4O3Z A;  5ADX L;  2Y0H A;  1HXT A;  5IYU A;  3HWB A;  2W80 C;  3NSG A;  4O49 A;  4O3Y A;  2KZ7 A;  2MNH A;  2KXP B;  1IZN B;  2ZLD A;  1GFO A;  4FMS A;  2OMF A;  4O3X B;  1BT9 A;  4FOZ A;  1YS5 A;  4KR8 A;  4N59 A;  4E1S A;  3AA6 A;  2YNK A;  3PRN A;  1G90 A;  3SY9 A;  1HXU A;  3TZG A;  3LK4 1;  2KC0 A;  3HW9 A;  1MM5 A;  5AFU L;  4G76 A;  4QQ1 A;  3K19 A;  4FUV A;  3SYB A;  4AYI D;  2JMM A;  3VY8 X;  4AYN A;  2M06 A;  2GE4 A;  4FZM A;  4N58 A;  4GCS A;  1P4T A;  2LFU A;  4GCP A;  4FRT A;  8PRN A;  2XG6 A;  3AA7 A;  3QRA A;  3POQ A;  3VE1 A;  1GFM A;  2K0L A;  4O4U A;  2Y0K A;  4FES A;  3VY9 X;  4AUI A;  4E1T A;  1BXW A;  1ZHZ A;  3AA1 A;  2XTR A;  1THQ A;  4AYM C;  2J1N A;  3G7G A;  3VZU X;  4O4X A;  1PHO A;  1H6S 1;  1MM4 A;  4GHB A;  4LSE A;  4G75 A;  2W81 C;  2XMX A;  2XE3 A;  3UPG A;  3LK2 A;  4Z3T A;  3LK3 B;  5T5F A;  4F4B A;  2ZFG A;  3AAE A;  4RL9 A;  4FSO A;  5DL6 A;  1MPF A;  5DL8 A;  1ZHY A;  2POR A;  4RJW A;  3SYS A;  5DL7 A;  3AA7 B;  3HOL A;  4AZL A;  1OPF A;  1GFP A;  4JCH A;  3LK4 2;  4AKR B;  3SZD A;  3AA1 B;  2FGQ X;  3T0S A;  2J4U P;  3VE2 A;  1BH3 A;  3SY7 A;  1Q9G A;  3UAQ A;  3FYX A;  2KZ7 B;  2LHF A;  4D5U A;  4LSH A;  4FT6 A;  4BUM X;  5ADX K;  3AAA A;  5D5D A;  1QJP A;  2N2M A;  3PQS A;  4RJX A;  4XNK A;  5GV0 A;  3AA6 B;  2FGR A;  3AAE B;  2ODJ A;  5EE2 A;  1PRN A;  3PQU A;  2N2L A;  2YPV A;  2Y2X A;  4FRX A;  4GCQ A;  3A2S X;  4PUX A;  4FSP A;  3UU2 A;  2F1V A;  4AKM A;  2O4V A;  4B61 A;  1GFN A;  2Y7S A;  4C69 X;  4RLC A;  1ZHX A;  3SZV A;  3V8U A;  1IZN A;  3EMN X;  4LSF A;  5AFU K;  7PRN A;  2X27 X;  6PRN A;  3VZT X;  1ORM A;  5FVN A;  3AA0 A;  5PRN A;  3C5O A;  3POU A;  2M07 A;  2ERV A;  1QJ9 A;  1QJ8 A;  4AYD C;  3O0E A;  4GF4 A;  3KVD D;  5G26 A;  4D65 A;  3LK2 B;  3GP6 A;  4KRA A;  3VZW X;  3T24 A;  1HXX A;  1OSM A;  1ZHW A;  4JFB A;  3WI4 A;  2XE5 A;  4FZL A;  3DA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...