3WI5A

Crystal structure of the loop 7 mutant porb from neisseria meningitidis serogroup b
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
312
structure length
312
Chain Sequence
b'DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVAKADIGNRYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major outer membrane protein P.IB
publication title Crystallographic analysis of Neisseria meningitidis PorB extracellular loops potentially implicated in TLR2 recognition.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 77
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3wi5A00
4FMSA 2OMFA 1H6S1 4FSPA 3SYBA 5DL8A 4FRTA 2XE2A 4FRXA 1HXXA 4BUMX 3EMNX 3POQA 1OSMA 2XE1A 3POUA 4D5UA 4D64A 3UPGA 8PRNA 1GFMA 4FOZA 2XG6A 1HXTA 4JFBA 5DL5A 2XE5A 3T24A 6PRNA 1PRNA 3VZTX 2ZLDA 2ZFGA 1GFOA 2PRNA 2K4TA 2PORA 3VZUX 3SYSA 2ODJA 2J1NA 3SY9A 3PORA 5DL7A 4GCSA 3POXA 4D65A 3T20A 1PHOA 2Y0KA 3PRNA 2Y2XA 2Y0HA 5FVNA 5PRNA 4GCPA 3WI5A 3VY8X 3T0SA 3VZWX 3NSGA 1HXUA 2QTKA 3O0EA 3JTYA 4LSEA 4LSIA 4LSFA 7PRNA 2Y0LA 3SZDA 2J4UP 4KRAA 3SY7A 3UU2A 3WI4A 5DL6A 3HWBA 2O4VA 3FYXA 1MPFA 2FGRA 4AUIA 2XE3A 1OPFA 1E54A 3HW9A 3K19A 3A2SX 4FT6A 4KR8A 1GFPA 4GCQA 1BT9A 2FGQX 1GFQA 1GFNA 4RJWA 4FSOA 3SZVA 3VY9X 1BH3A 4RJXA 4KR4A 4LSHA 4C69X 5JDPA
chains in the Genus database with same CATH superfamily
2R4NA 3PQSA 4FQEA 2AXTO 4FMSA 3NJTA 1ZHTA 4O49A 3VE1A 4AFKA 2OMFA 1H6S1 4FSPA 5G3AA 5DL8A 4FRTA 2XE2A 4FRXA 1HXXA 4JCHA 1QJPA 4BUMX 3EMNX 4C4VB 3POQA 5EE2A 4F4BA 1OSMA 3KZIO 2XE1A 3POUA 3AAEA 4D5UA 3DA3A 4PR7A 1T16A 3LK3B 3LK2A 4D64A 3LK42 5H2FO 3UPGA 8PRNA 2W80C 1GFMA 4FOZA 2R89A 2XG6A 2N2MA 1HXTA 3BS0A 4JFBA 3HOLA 4N58A 5DL5A 2X9KA 2XE5A 2MHLA 3GP6A 3JCUO 4O4UA 5IYUA 3UAQA 3VE2A 3T24A 1P4TA 3AA7A 1ZHXA 6PRNA 2XMXA 4AYMC 1PRNA 3VZTX 1S5LO 2R8AA 2ZLDA 2ZFGA 1QJ8A 4RLBA 2JQYA 5E79O 3RBHA 4FZMA 1GFOA 5G38A 4UB6O 2KDYA 2PRNA 4Z3TA 4RL9A 2K4TA 5AFUK 3AA0A 3C5OA 1ZHYA 3DA4A 1YS5A 2LHFA 2PORA 2F1TA 2X27X 3A0BO 3A0HO 3SYSA 3VZUX 1G90A 2N2LA 4K3BA 2ODJA 5B66O 3PGSA 2J1NA 3SY9A 3AA6B 3QRAA 2KZ7A 4CTDA 3PORA 2KXPA 4E1TA 2F1CX 2JMMA 5DL7A 2R4PA 2YNKA 4GCSA 4K3CA 3SYBA 5G26A 3POXA 4FESA 2IWVA 4O3XB 1ZHZA 5T5FA 2GE4A 2R4OA 3DZMA 2WJRA 3QRCA 2R88A 4D65A 4N74A 3T20A 5ADXK 3G7GA 3AA1A 1PHOA 4AKRA 2XTRA 1BXWA 2YPVA 3AAEB 4GF4A 4QQ1A 2Y0KA 4U9CA 2XTQA 4IL6O 3PRNA 1IZNA 2Y2XA 3LK2B 5KAIO 4GHBA 5GV0A 4FZLA 2Y0HA 5FVNA 3LK41 5PRNA 4E1SA 4GCPA 5GTHO 4N59A 2R4LA 3WI5A 3VY8X 2M07A 3T0SA 3VZWX 3NSGA 1HXUA 3AA7B 4AZLA 2QTKA 3O0EA 5GTIO 4C4VA 3JTYA 4LSEA 4UB8O 5D5DA 1ZHWA 4LSIA 4LSFA 3V8UA 5B5EO 1MM5A 3PGRA 1Q9GA 4AYEC 2KC0A 3LK3A 3AAAB 7PRNA 2Y0LA 1QJ9A 2Y7SA 3SZDA 5ADXL 4RLCA 4KRAA 3SY7A 3UU2A 3WI4A 2J4UP 3AA0B 3BRZA 3DWNA 3PQUA 2ERVA 4FUVA 4O4XA 5DL6A 2IWWA 5AFUL 1ORMA 5KAFO 3HWBA 2W81C 2O4VA 3FYXA 1MPFA 4B61A 4C00A 2FGRA 1MM4A 3BRYA 4FZNA 3TZGA 4AUIA 2XE3A 2MNHA 2KZ7B 2LFUA 4AYNA 3WU2O 3KVDD 1OPFA 1Q9FA 2KXPB 1E54A 5G39A 2WJQA 3DWOX 4N75A 3HW9A 4G75A 4XNLA 3K19A 2WVPA 3A2SX 4AYID 5TISO 1T1LA 4FT6A 4KR8A 1GFPA 4O3YA 4GCQA 3HOEA 4O3ZA 1BT9A 2FGQX 3PF1A 4PUXA 2F1VA 1GFQA 3AA1B 1GFNA 4RJWA 3AA6A 4AKRB 4FSOA 2M06A 4AKMA 3SZVA 1IZNB 3VY9X 1BH3A 1THQA 4G76A 2K0LA 4RJXA 4KR4A 4LSHA 4C69X 4PJ0O 3PGUA 3AAAA 4XNKA 5JDPA 4AYDC 4O3WA
chains in the Genus database with same CATH topology
3PQSA 4FMSA 4O49A 1ZHTA 3VE1A 4AFKA 2OMFA 1H6S1 4FSPA 3SYBA 5DL8A 4FRTA 2XE2A 4FRXA 1HXXA 4JCHA 1QJPA 4BUMX 3EMNX 3POQA 5EE2A 4F4BA 1OSMA 2XE1A 3POUA 3AAEA 4D5UA 3DA3A 3LK3B 3LK2A 4D64A 3LK42 3UPGA 8PRNA 2W80C 1GFMA 4FOZA 2XG6A 2N2MA 1HXTA 4JFBA 4N58A 3HOLA 5DL5A 2XE5A 2MHLA 3GP6A 4O4UA 5IYUA 3UAQA 3VE2A 3T24A 1P4TA 3AA7A 1ZHXA 6PRNA 2XMXA 4AYMC 1PRNA 3VZTX 2ZLDA 2ZFGA 1QJ8A 4RLBA 3RBHA 4FZMA 1GFOA 2KDYA 2PRNA 4Z3TA 4RL9A 2K4TA 5AFUK 3AA0A 3C5OA 1ZHYA 3DA4A 1YS5A 2LHFA 2PORA 2F1TA 2X27X 3SYSA 3VZUX 1G90A 2N2LA 2ODJA 2J1NA 3SY9A 3AA6B 3QRAA 2KZ7A 3PORA 2KXPA 4E1TA 2JMMA 5DL7A 2YNKA 4GCSA 5G26A 3POXA 4FESA 4O3XB 1ZHZA 5T5FA 2GE4A 3QRCA 4D65A 3T20A 5ADXK 3G7GA 3AA1A 1PHOA 4AKRA 2XTRA 1BXWA 2YPVA 3AAEB 4GF4A 4QQ1A 2Y0KA 4U9CA 2XTQA 3PRNA 1IZNA 2Y2XA 3LK2B 4GHBA 5GV0A 4FZLA 2Y0HA 5FVNA 3LK41 5PRNA 4E1SA 4GCPA 4N59A 3WI5A 3VY8X 2M07A 3T0SA 3VZWX 3NSGA 1HXUA 3AA7B 4AZLA 2QTKA 3O0EA 3JTYA 4LSEA 5D5DA 3V8UA 1ZHWA 4LSIA 4LSFA 1MM5A 1Q9GA 4AYEC 2KC0A 3LK3A 3AAAB 7PRNA 2Y0LA 1QJ9A 2Y7SA 3SZDA 5ADXL 4RLCA 4KRAA 3SY7A 3UU2A 3WI4A 2J4UP 3AA0B 3PQUA 2ERVA 4FUVA 4O4XA 5DL6A 5AFUL 1ORMA 3HWBA 2W81C 2O4VA 3FYXA 1MPFA 4B61A 2FGRA 1MM4A 4AUIA 4FZNA 3TZGA 2XE3A 2MNHA 2KZ7B 2LFUA 4AYNA 3KVDD 1OPFA 1Q9FA 2KXPB 1E54A 3HW9A 4G75A 4XNLA 3K19A 3A2SX 4AYID 4FT6A 4KR8A 1GFPA 4O3YA 4GCQA 3HOEA 4O3ZA 1BT9A 2FGQX 4PUXA 2F1VA 1GFQA 3AA1B 1GFNA 4RJWA 3AA6A 4AKRB 4FSOA 2M06A 4AKMA 3SZVA 1IZNB 3VY9X 1BH3A 1THQA 4G76A 2K0LA 4RJXA 4KR4A 4LSHA 4C69X 3AAAA 4XNKA 5JDPA 4AYDC 4O3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMS A;  2OMF A;  1H6S 1;  4FSP A;  3SYB A;  5DL8 A;  4FRT A;  2XE2 A;  4FRX A;  1HXX A;  4BUM X;  3EMN X;  3POQ A;  1OSM A;  2XE1 A;  3POU A;  4D5U A;  4D64 A;  3UPG A;  8PRN A;  1GFM A;  4FOZ A;  2XG6 A;  1HXT A;  4JFB A;  5DL5 A;  2XE5 A;  3T24 A;  6PRN A;  1PRN A;  3VZT X;  2ZLD A;  2ZFG A;  1GFO A;  2PRN A;  2K4T A;  2POR A;  3VZU X;  3SYS A;  2ODJ A;  2J1N A;  3SY9 A;  3POR A;  5DL7 A;  4GCS A;  3POX A;  4D65 A;  3T20 A;  1PHO A;  2Y0K A;  3PRN A;  2Y2X A;  2Y0H A;  5FVN A;  5PRN A;  4GCP A;  3WI5 A;  3VY8 X;  3T0S A;  3VZW X;  3NSG A;  1HXU A;  2QTK A;  3O0E A;  3JTY A;  4LSE A;  4LSI A;  4LSF A;  7PRN A;  2Y0L A;  3SZD A;  2J4U P;  4KRA A;  3SY7 A;  3UU2 A;  3WI4 A;  5DL6 A;  3HWB A;  2O4V A;  3FYX A;  1MPF A;  2FGR A;  4AUI A;  2XE3 A;  1OPF A;  1E54 A;  3HW9 A;  3K19 A;  3A2S X;  4FT6 A;  4KR8 A;  1GFP A;  4GCQ A;  1BT9 A;  2FGQ X;  1GFQ A;  1GFN A;  4RJW A;  4FSO A;  3SZV A;  3VY9 X;  1BH3 A;  4RJX A;  4KR4 A;  4LSH A;  4C69 X;  5JDP A; 
#chains in the Genus database with same CATH topology
 2R4N A;  3PQS A;  4FQE A;  2AXT O;  4FMS A;  3NJT A;  1ZHT A;  4O49 A;  3VE1 A;  4AFK A;  2OMF A;  1H6S 1;  4FSP A;  5G3A A;  5DL8 A;  4FRT A;  2XE2 A;  4FRX A;  1HXX A;  4JCH A;  1QJP A;  4BUM X;  3EMN X;  4C4V B;  3POQ A;  5EE2 A;  4F4B A;  1OSM A;  3KZI O;  2XE1 A;  3POU A;  3AAE A;  4D5U A;  3DA3 A;  4PR7 A;  1T16 A;  3LK3 B;  3LK2 A;  4D64 A;  3LK4 2;  5H2F O;  3UPG A;  8PRN A;  2W80 C;  1GFM A;  4FOZ A;  2R89 A;  2XG6 A;  2N2M A;  1HXT A;  3BS0 A;  4JFB A;  3HOL A;  4N58 A;  5DL5 A;  2X9K A;  2XE5 A;  2MHL A;  3GP6 A;  3JCU O;  4O4U A;  5IYU A;  3UAQ A;  3VE2 A;  3T24 A;  1P4T A;  3AA7 A;  1ZHX A;  6PRN A;  2XMX A;  4AYM C;  1PRN A;  3VZT X;  1S5L O;  2R8A A;  2ZLD A;  2ZFG A;  1QJ8 A;  4RLB A;  2JQY A;  5E79 O;  3RBH A;  4FZM A;  1GFO A;  5G38 A;  4UB6 O;  2KDY A;  2PRN A;  4Z3T A;  4RL9 A;  2K4T A;  5AFU K;  3AA0 A;  3C5O A;  1ZHY A;  3DA4 A;  1YS5 A;  2LHF A;  2POR A;  2F1T A;  2X27 X;  3A0B O;  3A0H O;  3SYS A;  3VZU X;  1G90 A;  2N2L A;  4K3B A;  2ODJ A;  5B66 O;  3PGS A;  2J1N A;  3SY9 A;  3AA6 B;  3QRA A;  2KZ7 A;  4CTD A;  3POR A;  2KXP A;  4E1T A;  2F1C X;  2JMM A;  5DL7 A;  2R4P A;  2YNK A;  4GCS A;  4K3C A;  3SYB A;  5G26 A;  3POX A;  4FES A;  2IWV A;  4O3X B;  1ZHZ A;  5T5F A;  2GE4 A;  2R4O A;  3DZM A;  2WJR A;  3QRC A;  2R88 A;  4D65 A;  4N74 A;  3T20 A;  5ADX K;  3G7G A;  3AA1 A;  1PHO A;  4AKR A;  2XTR A;  1BXW A;  2YPV A;  3AAE B;  4GF4 A;  4QQ1 A;  2Y0K A;  4U9C A;  2XTQ A;  4IL6 O;  3PRN A;  1IZN A;  2Y2X A;  3LK2 B;  5KAI O;  4GHB A;  5GV0 A;  4FZL A;  2Y0H A;  5FVN A;  3LK4 1;  5PRN A;  4E1S A;  4GCP A;  5GTH O;  4N59 A;  2R4L A;  3WI5 A;  3VY8 X;  2M07 A;  3T0S A;  3VZW X;  3NSG A;  1HXU A;  3AA7 B;  4AZL A;  2QTK A;  3O0E A;  5GTI O;  4C4V A;  3JTY A;  4LSE A;  4UB8 O;  5D5D A;  1ZHW A;  4LSI A;  4LSF A;  3V8U A;  5B5E O;  1MM5 A;  3PGR A;  1Q9G A;  4AYE C;  2KC0 A;  3LK3 A;  3AAA B;  7PRN A;  2Y0L A;  1QJ9 A;  2Y7S A;  3SZD A;  5ADX L;  4RLC A;  4KRA A;  3SY7 A;  3UU2 A;  3WI4 A;  2J4U P;  3AA0 B;  3BRZ A;  3DWN A;  3PQU A;  2ERV A;  4FUV A;  4O4X A;  5DL6 A;  2IWW A;  5AFU L;  1ORM A;  5KAF O;  3HWB A;  2W81 C;  2O4V A;  3FYX A;  1MPF A;  4B61 A;  4C00 A;  2FGR A;  1MM4 A;  3BRY A;  4FZN A;  3TZG A;  4AUI A;  2XE3 A;  2MNH A;  2KZ7 B;  2LFU A;  4AYN A;  3WU2 O;  3KVD D;  1OPF A;  1Q9F A;  2KXP B;  1E54 A;  5G39 A;  2WJQ A;  3DWO X;  4N75 A;  3HW9 A;  4G75 A;  4XNL A;  3K19 A;  2WVP A;  3A2S X;  4AYI D;  5TIS O;  1T1L A;  4FT6 A;  4KR8 A;  1GFP A;  4O3Y A;  4GCQ A;  3HOE A;  4O3Z A;  1BT9 A;  2FGQ X;  3PF1 A;  4PUX A;  2F1V A;  1GFQ A;  3AA1 B;  1GFN A;  4RJW A;  3AA6 A;  4AKR B;  4FSO A;  2M06 A;  4AKM A;  3SZV A;  1IZN B;  3VY9 X;  1BH3 A;  1THQ A;  4G76 A;  2K0L A;  4RJX A;  4KR4 A;  4LSH A;  4C69 X;  4PJ0 O;  3PGU A;  3AAA A;  4XNK A;  5JDP A;  4AYD C;  4O3W A; 
#chains in the Genus database with same CATH homology
 3PQS A;  4FMS A;  4O49 A;  1ZHT A;  3VE1 A;  4AFK A;  2OMF A;  1H6S 1;  4FSP A;  3SYB A;  5DL8 A;  4FRT A;  2XE2 A;  4FRX A;  1HXX A;  4JCH A;  1QJP A;  4BUM X;  3EMN X;  3POQ A;  5EE2 A;  4F4B A;  1OSM A;  2XE1 A;  3POU A;  3AAE A;  4D5U A;  3DA3 A;  3LK3 B;  3LK2 A;  4D64 A;  3LK4 2;  3UPG A;  8PRN A;  2W80 C;  1GFM A;  4FOZ A;  2XG6 A;  2N2M A;  1HXT A;  4JFB A;  4N58 A;  3HOL A;  5DL5 A;  2XE5 A;  2MHL A;  3GP6 A;  4O4U A;  5IYU A;  3UAQ A;  3VE2 A;  3T24 A;  1P4T A;  3AA7 A;  1ZHX A;  6PRN A;  2XMX A;  4AYM C;  1PRN A;  3VZT X;  2ZLD A;  2ZFG A;  1QJ8 A;  4RLB A;  3RBH A;  4FZM A;  1GFO A;  2KDY A;  2PRN A;  4Z3T A;  4RL9 A;  2K4T A;  5AFU K;  3AA0 A;  3C5O A;  1ZHY A;  3DA4 A;  1YS5 A;  2LHF A;  2POR A;  2F1T A;  2X27 X;  3SYS A;  3VZU X;  1G90 A;  2N2L A;  2ODJ A;  2J1N A;  3SY9 A;  3AA6 B;  3QRA A;  2KZ7 A;  3POR A;  2KXP A;  4E1T A;  2JMM A;  5DL7 A;  2YNK A;  4GCS A;  5G26 A;  3POX A;  4FES A;  4O3X B;  1ZHZ A;  5T5F A;  2GE4 A;  3QRC A;  4D65 A;  3T20 A;  5ADX K;  3G7G A;  3AA1 A;  1PHO A;  4AKR A;  2XTR A;  1BXW A;  2YPV A;  3AAE B;  4GF4 A;  4QQ1 A;  2Y0K A;  4U9C A;  2XTQ A;  3PRN A;  1IZN A;  2Y2X A;  3LK2 B;  4GHB A;  5GV0 A;  4FZL A;  2Y0H A;  5FVN A;  3LK4 1;  5PRN A;  4E1S A;  4GCP A;  4N59 A;  3WI5 A;  3VY8 X;  2M07 A;  3T0S A;  3VZW X;  3NSG A;  1HXU A;  3AA7 B;  4AZL A;  2QTK A;  3O0E A;  3JTY A;  4LSE A;  5D5D A;  3V8U A;  1ZHW A;  4LSI A;  4LSF A;  1MM5 A;  1Q9G A;  4AYE C;  2KC0 A;  3LK3 A;  3AAA B;  7PRN A;  2Y0L A;  1QJ9 A;  2Y7S A;  3SZD A;  5ADX L;  4RLC A;  4KRA A;  3SY7 A;  3UU2 A;  3WI4 A;  2J4U P;  3AA0 B;  3PQU A;  2ERV A;  4FUV A;  4O4X A;  5DL6 A;  5AFU L;  1ORM A;  3HWB A;  2W81 C;  2O4V A;  3FYX A;  1MPF A;  4B61 A;  2FGR A;  1MM4 A;  4AUI A;  4FZN A;  3TZG A;  2XE3 A;  2MNH A;  2KZ7 B;  2LFU A;  4AYN A;  3KVD D;  1OPF A;  1Q9F A;  2KXP B;  1E54 A;  3HW9 A;  4G75 A;  4XNL A;  3K19 A;  3A2S X;  4AYI D;  4FT6 A;  4KR8 A;  1GFP A;  4O3Y A;  4GCQ A;  3HOE A;  4O3Z A;  1BT9 A;  2FGQ X;  4PUX A;  2F1V A;  1GFQ A;  3AA1 B;  1GFN A;  4RJW A;  3AA6 A;  4AKR B;  4FSO A;  2M06 A;  4AKM A;  3SZV A;  1IZN B;  3VY9 X;  1BH3 A;  1THQ A;  4G76 A;  2K0L A;  4RJX A;  4KR4 A;  4LSH A;  4C69 X;  3AAA A;  4XNK A;  5JDP A;  4AYD C;  4O3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...