3WI5A

Crystal structure of the loop 7 mutant porb from neisseria meningitidis serogroup b
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
312
structure length
312
Chain Sequence
DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVAKADIGNRYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major outer membrane protein P.IB
publication title Crystallographic analysis of Neisseria meningitidis PorB extracellular loops potentially implicated in TLR2 recognition.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 77
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3wi5A00
2J1NA 4FMSA 2PRNA 3VZUX 4AUIA 4D65A 2Y0KA 3EMNX 2O4VA 4LSHA 4GCPA 4FSPA 3SYBA 4D64A 2K4TA 1HXTA 3UU2A 2ZLDA 1HXXA 3SY7A 3VZWX 4JFBA 3T24A 4RJWA 4GCQA 3WI5A 3A2SX 2PORA 3SYSA 2QTKA 3O0EA 2FGQX 5DL7A 6PRNA 4FRXA 1PRNA 3VZTX 5DL6A 1GFMA 3T20A 1MPFA 4FOZA 8PRNA 1GFOA 1E54A 2XG6A 4LSEA 1GFPA 4GCSA 3HWBA 5DL5A 3POQA 2Y0LA 3K19A 3SZVA 4BUMX 2Y2XA 2XE1A 3NSGA 1BT9A 4RJXA 5FVNA 4LSFA 4FT6A 3SY9A 2ZFGA 2Y0HA 4LSIA 2FGRA 4FRTA 1BH3A 3WI4A 4D5UA 3HW9A 3POXA 7PRNA 3PORA 4KR8A 3UPGA 3PRNA 5DL8A 1GFNA 3SZDA 1HXUA 2ODJA 1GFQA 2OMFA 2J4UP 3T0SA 1PHOA 4C69X 1H6S1 3JTYA 2XE2A 5PRNA 1OSMA 3VY8X 1OPFA 3POUA 2XE3A 5JDPA 2XE5A 3VY9X 3FYXA 4KRAA 4FSOA 4KR4A
chains in the Genus database with same CATH superfamily
1THQA 2J1NA 4FMSA 1MM4A 2W80C 5G3AA 2PRNA 1S5LO 4PJ0O 3VZUX 4AUIA 4D65A 3TZGA 2M06A 4AZLA 2Y0KA 2JMMA 3BRYA 2O4VA 3EMNX 3NJTA 4JCHA 4LSHA 4E1TA 5JDPA 2ERVA 4N74A 3VE2A 4GCPA 5G38A 4FSPA 5E79O 3SYBA 2Y7SA 3AAEA 3DZMA 5KAIO 4D64A 4N59A 1T1LA 2K4TA 1QJPA 4FZNA 4N58A 1HXTA 4O4UA 3UU2A 2ZLDA 5TISO 1HXXA 3AAEB 4C4VB 5ADXL 1G90A 3A0HO 1ORMA 3SY7A 2M07A 3VZWX 4JFBA 3T24A 3WU2O 2WJQA 2KDYA 3AA0A 4RJWA 3JCUO 2KC0A 4GCQA 4RLCA 3WI5A 4O3XB 4O3ZA 3A2SX 2PORA 2KXPA 2R4OA 3SYSA 5AFUK 5D5DA 2QTKA 3AA1A 4C00A 3QRCA 4AKMA 3O0EA 4K3BA 4N75A 2FGQX 3PGRA 4XNKA 2JQYA 2AXTO 5DL7A 3AA1B 3LK2B 3A0BO 1PRNA 4FRXA 5DL6A 3VZTX 4GF4A 4RLBA 1GFMA 3KZIO 4AKRB 1MPFA 4FOZA 3T20A 2XTRA 2LHFA 2IWVA 3AA6A 3DWNA 4O49A 1GFOA 1E54A 4RL9A 2XG6A 8PRNA 3V8UA 1QJ8A 4LSEA 4C4VA 3AA6B 4Z3TA 4PUXA 1GFPA 4GCSA 3PQUA 4O3WA 3AA7A 2R4NA 3HWBA 2MNHA 3LK3A 5DL5A 3DA3A 3POQA 4AKRA 2Y0LA 3K19A 3SZVA 3AA7B 3LK3B 1QJ9A 4BUMX 2Y2XA 1T16A 2XE1A 3NSGA 1BT9A 2R8AA 4K3CA 2F1CX 4RJXA 2F1TA 4LSFA 4UB6O 5FVNA 3LK2A 4FT6A 5G26A 3BS0A 3LK41 3SY9A 2XTQA 4UB8O 4F4BA 5AFUL 3UAQA 2ZFGA 3PGUA 4AYMC 3G7GA 1ZHXA 2Y0HA 2N2MA 1Q9GA 4LSIA 2F1VA 5T5FA 2KZ7A 5KAFO 1MM5A 2FGRA 4FRTA 3AAAB 1BH3A 5GV0A 5GTHO 3RBHA 3WI4A 5IYUA 4D5UA 3HW9A 2KZ7B 2MHLA 3KVDD 1Q9FA 3POXA 4O3YA 3VE1A 2R4LA 1ZHWA 3PORA 4FZMA 7PRNA 4B61A 4KR8A 4U9CA 3UPGA 4FUVA 5GTIO 1BXWA 3PRNA 5DL8A 2N2LA 1GFNA 4AYEC 3SZDA 1HXUA 2W81C 2R88A 4O4XA 2ODJA 2X27X 1GFQA 2OMFA 3DA4A 4CTDA 2J4UP 3T0SA 2WVPA 3QRAA 2XMXA 4AYDC 2IWWA 1PHOA 4AYID 2YNKA 4C69X 3AAAA 3PQSA 1H6S1 4FQEA 5H2FO 3JTYA 2XE2A 5PRNA 1OSMA 3VY8X 5ADXK 1OPFA 3DWOX 3LK42 4XNLA 2R89A 4QQ1A 4AFKA 4G76A 3PF1A 3POUA 2GE4A 2X9KA 2XE3A 2XE5A 3GP6A 3HOEA 4E1SA 5B5EO 3BRZA 4PR7A 3C5OA 3VY9X 3FYXA 2LFUA 4FZLA 4KRAA 1IZNA 5G39A 3HOLA 4AYNA 3PGSA 4IL6O 1ZHTA 5EE2A 4FESA 3AA0B 1ZHZA 2WJRA 2YPVA 4GHBA 1IZNB 4G75A 5B66O 4FSOA 2R4PA 1P4TA 4KR4A 2K0LA 6PRNA 2KXPB 1YS5A 1ZHYA
chains in the Genus database with same CATH topology
1THQA 2J1NA 4FMSA 1MM4A 2W80C 2PRNA 3VZUX 4AUIA 4D65A 3TZGA 2M06A 4AZLA 2Y0KA 2JMMA 3EMNX 2O4VA 4JCHA 4LSHA 4E1TA 2ERVA 3VE2A 4GCPA 4FSPA 3SYBA 2Y7SA 3AAEA 4D64A 4N59A 2K4TA 1QJPA 4FZNA 4N58A 1HXTA 4O4UA 3UU2A 2ZLDA 1HXXA 3AAEB 5ADXL 1G90A 1ORMA 3SY7A 2M07A 3VZWX 4JFBA 3T24A 3AA0A 2KDYA 4RJWA 2KC0A 4GCQA 4RLCA 3WI5A 4O3XB 4O3ZA 3A2SX 2PORA 2KXPA 5AFUK 3SYSA 5D5DA 2QTKA 3AA1A 3QRCA 4AKMA 3O0EA 2FGQX 4XNKA 5DL7A 3AA1B 3LK2B 4FRXA 1PRNA 3VZTX 5DL6A 6PRNA 4GF4A 4RLBA 1GFMA 3T20A 1MPFA 4FOZA 2XTRA 2LHFA 3AA6A 4O49A 8PRNA 1GFOA 1E54A 4RL9A 2XG6A 3V8UA 1QJ8A 4LSEA 3AA6B 4Z3TA 4PUXA 1GFPA 4GCSA 3PQUA 4O3WA 3AA7A 3HWBA 3LK3A 2MNHA 5DL5A 3DA3A 3POQA 4AKRA 2Y0LA 3K19A 3SZVA 3AA7B 3LK3B 1QJ9A 4BUMX 2Y2XA 2XE1A 3NSGA 1BT9A 4RJXA 5FVNA 4AKRB 2F1TA 4LSFA 3LK2A 4FT6A 5G26A 3LK41 3SY9A 2XTQA 4F4BA 5AFUL 3UAQA 2ZFGA 4AYMC 3G7GA 1ZHXA 2Y0HA 2N2MA 1Q9GA 4LSIA 2F1VA 5T5FA 2KZ7A 1MM5A 2FGRA 4FRTA 3AAAB 1BH3A 5GV0A 5IYUA 3RBHA 3WI4A 4D5UA 3HW9A 2KZ7B 2MHLA 3KVDD 1Q9FA 3POXA 4O3YA 3VE1A 7PRNA 1ZHWA 3PORA 4FZMA 4B61A 4KR8A 4U9CA 3UPGA 4FUVA 1BXWA 3PRNA 5DL8A 2N2LA 1GFNA 4AYEC 3SZDA 1HXUA 2W81C 4O4XA 2ODJA 2X27X 1GFQA 2OMFA 3DA4A 2J4UP 3T0SA 3QRAA 2XMXA 4AYDC 1PHOA 4AYID 2YNKA 4C69X 3AAAA 3PQSA 1H6S1 3JTYA 2XE2A 5PRNA 1OSMA 3VY8X 5ADXK 1OPFA 4XNLA 3LK42 4QQ1A 4AFKA 4G76A 3POUA 2GE4A 2XE3A 3GP6A 2XE5A 3HOEA 4E1SA 5JDPA 3C5OA 3VY9X 3FYXA 2LFUA 4FZLA 4KRAA 1IZNA 3HOLA 4AYNA 1ZHTA 5EE2A 4FESA 3AA0B 1ZHZA 4GHBA 2YPVA 1IZNB 4G75A 4FSOA 1P4TA 4KR4A 2K0LA 2KXPB 1YS5A 1ZHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1N A;  4FMS A;  2PRN A;  3VZU X;  4AUI A;  4D65 A;  2Y0K A;  3EMN X;  2O4V A;  4LSH A;  4GCP A;  4FSP A;  3SYB A;  4D64 A;  2K4T A;  1HXT A;  3UU2 A;  2ZLD A;  1HXX A;  3SY7 A;  3VZW X;  4JFB A;  3T24 A;  4RJW A;  4GCQ A;  3WI5 A;  3A2S X;  2POR A;  3SYS A;  2QTK A;  3O0E A;  2FGQ X;  5DL7 A;  6PRN A;  4FRX A;  1PRN A;  3VZT X;  5DL6 A;  1GFM A;  3T20 A;  1MPF A;  4FOZ A;  8PRN A;  1GFO A;  1E54 A;  2XG6 A;  4LSE A;  1GFP A;  4GCS A;  3HWB A;  5DL5 A;  3POQ A;  2Y0L A;  3K19 A;  3SZV A;  4BUM X;  2Y2X A;  2XE1 A;  3NSG A;  1BT9 A;  4RJX A;  5FVN A;  4LSF A;  4FT6 A;  3SY9 A;  2ZFG A;  2Y0H A;  4LSI A;  2FGR A;  4FRT A;  1BH3 A;  3WI4 A;  4D5U A;  3HW9 A;  3POX A;  7PRN A;  3POR A;  4KR8 A;  3UPG A;  3PRN A;  5DL8 A;  1GFN A;  3SZD A;  1HXU A;  2ODJ A;  1GFQ A;  2OMF A;  2J4U P;  3T0S A;  1PHO A;  4C69 X;  1H6S 1;  3JTY A;  2XE2 A;  5PRN A;  1OSM A;  3VY8 X;  1OPF A;  3POU A;  2XE3 A;  5JDP A;  2XE5 A;  3VY9 X;  3FYX A;  4KRA A;  4FSO A;  4KR4 A; 
#chains in the Genus database with same CATH topology
 1THQ A;  2J1N A;  4FMS A;  1MM4 A;  2W80 C;  5G3A A;  2PRN A;  1S5L O;  4PJ0 O;  3VZU X;  4AUI A;  4D65 A;  3TZG A;  2M06 A;  4AZL A;  2Y0K A;  2JMM A;  3BRY A;  2O4V A;  3EMN X;  3NJT A;  4JCH A;  4LSH A;  4E1T A;  5JDP A;  2ERV A;  4N74 A;  3VE2 A;  4GCP A;  5G38 A;  4FSP A;  5E79 O;  3SYB A;  2Y7S A;  3AAE A;  3DZM A;  5KAI O;  4D64 A;  4N59 A;  1T1L A;  2K4T A;  1QJP A;  4FZN A;  4N58 A;  1HXT A;  4O4U A;  3UU2 A;  2ZLD A;  5TIS O;  1HXX A;  3AAE B;  4C4V B;  5ADX L;  1G90 A;  3A0H O;  1ORM A;  3SY7 A;  2M07 A;  3VZW X;  4JFB A;  3T24 A;  3WU2 O;  2WJQ A;  2KDY A;  3AA0 A;  4RJW A;  3JCU O;  2KC0 A;  4GCQ A;  4RLC A;  3WI5 A;  4O3X B;  4O3Z A;  3A2S X;  2POR A;  2KXP A;  2R4O A;  3SYS A;  5AFU K;  5D5D A;  2QTK A;  3AA1 A;  4C00 A;  3QRC A;  4AKM A;  3O0E A;  4K3B A;  4N75 A;  2FGQ X;  3PGR A;  4XNK A;  2JQY A;  2AXT O;  5DL7 A;  3AA1 B;  3LK2 B;  3A0B O;  1PRN A;  4FRX A;  5DL6 A;  3VZT X;  4GF4 A;  4RLB A;  1GFM A;  3KZI O;  4AKR B;  1MPF A;  4FOZ A;  3T20 A;  2XTR A;  2LHF A;  2IWV A;  3AA6 A;  3DWN A;  4O49 A;  1GFO A;  1E54 A;  4RL9 A;  2XG6 A;  8PRN A;  3V8U A;  1QJ8 A;  4LSE A;  4C4V A;  3AA6 B;  4Z3T A;  4PUX A;  1GFP A;  4GCS A;  3PQU A;  4O3W A;  3AA7 A;  2R4N A;  3HWB A;  2MNH A;  3LK3 A;  5DL5 A;  3DA3 A;  3POQ A;  4AKR A;  2Y0L A;  3K19 A;  3SZV A;  3AA7 B;  3LK3 B;  1QJ9 A;  4BUM X;  2Y2X A;  1T16 A;  2XE1 A;  3NSG A;  1BT9 A;  2R8A A;  4K3C A;  2F1C X;  4RJX A;  2F1T A;  4LSF A;  4UB6 O;  5FVN A;  3LK2 A;  4FT6 A;  5G26 A;  3BS0 A;  3LK4 1;  3SY9 A;  2XTQ A;  4UB8 O;  4F4B A;  5AFU L;  3UAQ A;  2ZFG A;  3PGU A;  4AYM C;  3G7G A;  1ZHX A;  2Y0H A;  2N2M A;  1Q9G A;  4LSI A;  2F1V A;  5T5F A;  2KZ7 A;  5KAF O;  1MM5 A;  2FGR A;  4FRT A;  3AAA B;  1BH3 A;  5GV0 A;  5GTH O;  3RBH A;  3WI4 A;  5IYU A;  4D5U A;  3HW9 A;  2KZ7 B;  2MHL A;  3KVD D;  1Q9F A;  3POX A;  4O3Y A;  3VE1 A;  2R4L A;  1ZHW A;  3POR A;  4FZM A;  7PRN A;  4B61 A;  4KR8 A;  4U9C A;  3UPG A;  4FUV A;  5GTI O;  1BXW A;  3PRN A;  5DL8 A;  2N2L A;  1GFN A;  4AYE C;  3SZD A;  1HXU A;  2W81 C;  2R88 A;  4O4X A;  2ODJ A;  2X27 X;  1GFQ A;  2OMF A;  3DA4 A;  4CTD A;  2J4U P;  3T0S A;  2WVP A;  3QRA A;  2XMX A;  4AYD C;  2IWW A;  1PHO A;  4AYI D;  2YNK A;  4C69 X;  3AAA A;  3PQS A;  1H6S 1;  4FQE A;  5H2F O;  3JTY A;  2XE2 A;  5PRN A;  1OSM A;  3VY8 X;  5ADX K;  1OPF A;  3DWO X;  3LK4 2;  4XNL A;  2R89 A;  4QQ1 A;  4AFK A;  4G76 A;  3PF1 A;  3POU A;  2GE4 A;  2X9K A;  2XE3 A;  2XE5 A;  3GP6 A;  3HOE A;  4E1S A;  5B5E O;  3BRZ A;  4PR7 A;  3C5O A;  3VY9 X;  3FYX A;  2LFU A;  4FZL A;  4KRA A;  1IZN A;  5G39 A;  3HOL A;  4AYN A;  3PGS A;  4IL6 O;  1ZHT A;  5EE2 A;  4FES A;  3AA0 B;  1ZHZ A;  2WJR A;  2YPV A;  4GHB A;  1IZN B;  4G75 A;  5B66 O;  4FSO A;  2R4P A;  1P4T A;  4KR4 A;  2K0L A;  6PRN A;  2KXP B;  1YS5 A;  1ZHY A; 
#chains in the Genus database with same CATH homology
 1THQ A;  2J1N A;  4FMS A;  1MM4 A;  2W80 C;  2PRN A;  3VZU X;  4AUI A;  4D65 A;  3TZG A;  2M06 A;  4AZL A;  2Y0K A;  2JMM A;  3EMN X;  2O4V A;  4JCH A;  4LSH A;  4E1T A;  2ERV A;  3VE2 A;  4GCP A;  4FSP A;  3SYB A;  2Y7S A;  3AAE A;  4D64 A;  4N59 A;  2K4T A;  1QJP A;  4FZN A;  4N58 A;  1HXT A;  4O4U A;  3UU2 A;  2ZLD A;  1HXX A;  3AAE B;  5ADX L;  1G90 A;  1ORM A;  3SY7 A;  2M07 A;  3VZW X;  4JFB A;  3T24 A;  3AA0 A;  2KDY A;  4RJW A;  2KC0 A;  4GCQ A;  4RLC A;  3WI5 A;  4O3X B;  4O3Z A;  3A2S X;  2POR A;  2KXP A;  5AFU K;  3SYS A;  5D5D A;  2QTK A;  3AA1 A;  3QRC A;  4AKM A;  3O0E A;  2FGQ X;  4XNK A;  5DL7 A;  3AA1 B;  3LK2 B;  4FRX A;  1PRN A;  3VZT X;  5DL6 A;  6PRN A;  4GF4 A;  4RLB A;  1GFM A;  3T20 A;  1MPF A;  4FOZ A;  2XTR A;  2LHF A;  3AA6 A;  4O49 A;  8PRN A;  1GFO A;  1E54 A;  4RL9 A;  2XG6 A;  3V8U A;  1QJ8 A;  4LSE A;  3AA6 B;  4Z3T A;  4PUX A;  1GFP A;  4GCS A;  3PQU A;  4O3W A;  3AA7 A;  3HWB A;  3LK3 A;  2MNH A;  5DL5 A;  3DA3 A;  3POQ A;  4AKR A;  2Y0L A;  3K19 A;  3SZV A;  3AA7 B;  3LK3 B;  1QJ9 A;  4BUM X;  2Y2X A;  2XE1 A;  3NSG A;  1BT9 A;  4RJX A;  5FVN A;  4AKR B;  2F1T A;  4LSF A;  3LK2 A;  4FT6 A;  5G26 A;  3LK4 1;  3SY9 A;  2XTQ A;  4F4B A;  5AFU L;  3UAQ A;  2ZFG A;  4AYM C;  3G7G A;  1ZHX A;  2Y0H A;  2N2M A;  1Q9G A;  4LSI A;  2F1V A;  5T5F A;  2KZ7 A;  1MM5 A;  2FGR A;  4FRT A;  3AAA B;  1BH3 A;  5GV0 A;  5IYU A;  3RBH A;  3WI4 A;  4D5U A;  3HW9 A;  2KZ7 B;  2MHL A;  3KVD D;  1Q9F A;  3POX A;  4O3Y A;  3VE1 A;  7PRN A;  1ZHW A;  3POR A;  4FZM A;  4B61 A;  4KR8 A;  4U9C A;  3UPG A;  4FUV A;  1BXW A;  3PRN A;  5DL8 A;  2N2L A;  1GFN A;  4AYE C;  3SZD A;  1HXU A;  2W81 C;  4O4X A;  2ODJ A;  2X27 X;  1GFQ A;  2OMF A;  3DA4 A;  2J4U P;  3T0S A;  3QRA A;  2XMX A;  4AYD C;  1PHO A;  4AYI D;  2YNK A;  4C69 X;  3AAA A;  3PQS A;  1H6S 1;  3JTY A;  2XE2 A;  5PRN A;  1OSM A;  3VY8 X;  5ADX K;  1OPF A;  4XNL A;  3LK4 2;  4QQ1 A;  4AFK A;  4G76 A;  3POU A;  2GE4 A;  2XE3 A;  3GP6 A;  2XE5 A;  3HOE A;  4E1S A;  5JDP A;  3C5O A;  3VY9 X;  3FYX A;  2LFU A;  4FZL A;  4KRA A;  1IZN A;  3HOL A;  4AYN A;  1ZHT A;  5EE2 A;  4FES A;  3AA0 B;  1ZHZ A;  4GHB A;  2YPV A;  1IZN B;  4G75 A;  4FSO A;  1P4T A;  4KR4 A;  2K0L A;  2KXP B;  1YS5 A;  1ZHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...