3WI9A

Crystal structure of copper nitrite reductase from geobacillus kaustophilus
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
303
Chain Sequence
TQQSAANMLAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural and functional characterization of the Geobacillus copper nitrite reductase: involvement of the unique N-terminal region in the interprotein electron transfer with its redox partner
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Oxidoreductase
total genus 94
structure length 303
sequence length 303
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wi9A00
3CDZB 2VW4A 1L9RA 3IN2A 2TSBA 5I5JA 3TA4D 2DV6A 1AG0A 2AZUA 4YSEA 3H4FA 2PP7A 4G7SB 2N0MA 5FC9A 3PAZA 3FS9A 2IWFA 1KDJA 2I7SA 3SBQA 4KOCA 1AANA 4E9WA 1AS7A 3RYMA 1GS7A 3U25A 3S8FB 1CURA 2IH9A 1NIFA 4PCYA 3JTBA 3V9EA 3FU9A 1BQRA 3NJLA 1UATA 1AIZA 1MZYA 3ABKB 2EIMB 3FSVA 5D4JA 4NAJA 3X1FA 1RCYA 2ZWNA 3C75A 3ABLB 3OQRA 1GY1A 1X9UA 2AZAA 2FT6A 2Y69B 3FSWA 4G70B 2IDSA 3FU7B 2QT6A 1L9PA 4CSPA 4E9QA 1ILSA 2QDWA 4AZUA 2PCYA 2R7EA 3FQ1A 1RZQA 4DP1X 3PAUA 2B08A 1NDTA 1ZPUA 5B7MA 2GSMB 1R1CA 5F7AA 4BWUA 4N4YB 3X1GA 3FYEB 1NINA 1N68A 2IAAC 1AACA 3QJUB 2RACA 4YSOA 2OJ1A 2ZOOA 3ABGA 1BXUA 3GXUB 4G7QB 4HCGA 4AI7A 5A7EA 2UX6A 1J9QA 2XUWA 2MTAA 4GP8B 3IBOA 1L9QA 2VM4A 4DPCX 2OCCB 4KNUA 1PMYA 3NYKA 4WTQA 1RZPA 3NJMA 4EF3A 4ZK8A 2XXGA 1FWXA 1OF0A 2XVBA 3NSCA 1NWPA 4K9JA 1NIEA 4A68A 3IE9A 2GC4C 1SDDA 4HIPA 3ZDWA 5B7EA 1MZZA 2IDQA 4BWWA 2H5UA 2VN3A 1HFUA 4DP5X 4JKNA 2PP9A 1AR1B 3SQRA 2HLEB 1SFDA 2JKWA 5TK2A 4A2HA 2TSAA 1GSKA 1WS7A 5TK4A 3L45A 1MDAA 2FNWA 1AS8A 2FQFA 3QPKA 1V54B 5E9NA 2EIKB 4HHWA 3KW8A 3UADA 2AFNA 3G5WA 3WKQA 3CZUB 2XV0A 1NPNA 1QHQA 3HEIB 4M4RB 1ET8A 2HRHA 4KO5A 1A8ZA 3DTUB 3UACA 1L9SA 4YVNA 4DP9X 5AKRA 2A3TA 3WG7B 3D12B 4YSPA 1AZNA 2XX1A 4BK5C 4NERA 4W1TA 3NJGA 3IN0A 1ZIBA 3GDCA 2CAKA 2YAFA 1PNCA 4GP5B 1SHWA 2BWIA 2YAOA 3N55A 1XMEB 3S3DB 2J57A 4DPAX 4HCIA 3CVBA 6PAZA 2J56A 3H4HA 3ASNB 4F7KA 1CC3A 1WA2X 1FFTB 2PPFA 3NSDA 4HAKA 5I5MA 3GYRA 4ENZA 2GBAA 1X9RA 3FPYA 3DKHA 3N2JA 3OD3A 3PPSA 3ZIYA 4DP0X 2QDVA 4A2GA 3CG8A 2FWLB 4HALA 4KO9A 4E9VA 4FAAB 3TBCA 1AZBA 4YSRA 2VSMB 1OE1A 4BDVB 2GC7C 1CYWA 5I6KA 1BAWA 1W6LA 4QKTA 5I6MA 5B1BB 2MRYA 2PCFA 2VW7A 1OCZB 3WIAA 2BP0B 1YLBB 2XYBA 2H3XC 3T6VA 2OV0A 3WI9A 3ZBMA 2FT7A 2YAHA 2HX7A 1IC0A 3AG2B 1PLAA 2PP8A 4KNTA 1JOIA 2IDFA 2P80A 1OE3A 3UAAA 4AKPA 3PXLA 1AAJA 1M9WA 2BWDA 1IKOP 2FTAA 5PAZA 2HX9A 1E65A 3AG4B 4GYBA 4Q89A 4UF7C 5ANHA 2BP8B 1PZBA 1PCSA 1OCCB 2UXGA 3FU8A 1SFHA 1KYAA 1JVOA 2YAPA 4P5SA 2FQDA 3NJKA 4UANA 4W9ZA 2LLNA 4G7RB 3PLYA 2BZ7A 3WKPA 2UX7A 2E86A 2W88A 1NWOA 2JFCA 1SJMA 2XV2A 1ADWA 1N70A 2EIJB 2PPEA 1BYPA 1GY2A 5D4IA 4A2DA 2XLLA 3QJRB 2HXAA 1E67A 3ABMB 1ASOA 3UAEA 5AFAA 2UXTA 1PLCA 1J5CA 2IDUA 1XB8A 2B3IA 2WO3B 1RKRA 1EHKB 5I5IA 1OCOB 4G72B 3V9CA 1TKWA 3HB3B 3EH4B 1HAWA 2QPDB 2PPCA 3SBPA 3ASOB 3H56A 1A4AA 1V10A 2YARA 1GW0A 2YXWA 2XXFA 4L0PB 2GI0A 1JZIA 1M57B 3PAVA 4YSAA 1L9OA 2BO0A 1JXFA 2VM3A 3NJIA 4JHUA 4X4KA 4E9TA 4KOBA 4TXVB 1WAEA 2I7OA 2IWKA 2YAMA 2GHZA 1JZFA 2W8CA 2R7EB 3CDZA 3AW5A 3DIVA 4A2FA 2I85A 2BW5A 4E9RA 1ILUA 1WS8A 2YAEA 1NZRA 4YVUA 4AX3A 1ASQA 1TEFA 4KNSA 4YL4A 3BVDB 4WKXA 1GYCA 3KW7A 1KBVA 1ZIAA 5B1JA 3NJHA 3ZX1A 5I6LA 3FSAA 1J9SA 1IBYA 2J55A 5B1KA 3S3CB 1QNIA 3NSFA 2HZHA 4DP4X 2CALA 1KBWA 3CVCA 2DWTA 2HX8A 5B1AB 3QJVB 2UXVA 1CUOA 1PF3A 2AVFA 2FT8A 2XU9A 1JXGA 1SF3A 2DY2A 3T71A 1OV8A 2FJSA 1IBZA 2CBPA 1DZ0A 2Q9OA 1NICA 4PAZA 3NSYA 3FU7A 2VW6A 1BXAA 3QJSB 3AG3B 1SDDB 1JZJA 2VMJA 5F7BA 4HCFA 4G71B 1EZLA 1PY0A 1PZAA 1SF5A 2DYRB 2DYSB 1AZUA 5I26A 1BXVA 1AOZA 8PAZA 2HRGA 1AZCA 3NJJA 2JXMA 2FQGA 4HZ1A 4UAHA 1JZGA 5I6NA 2FQEA 1A65A 3FPXA 3T6XA 3FSZA 3QJTB 1BQ5A 3FQ2A 3S8GB 2QPEB 2BHFA 4F2FA 1ZDSA 1PAZA 1CYXA 1V55B 1AS6A 3QQXA 1NIAA 1JVLA 1AG6A 1ASPA 3ERXA 2ZONA 2DWSA 3QJQB 3EH5B 4BXSV 3NT0A 1NIDA 1PNDA 2PPAA 1E30A 1OE2A 1URIA 3OM3B 4DP8X 3X1EA 4YSSA 5PCYA 1QLEB 3UGEA 2GB2A 2X87A 2XV3A 4YSQA 3SBRA 2WO2B 4AKOA 4GP4B 1A4BA 2YXVA 4YSCA 3BQVA 4AKQA 1KDIA 2BW4A 3FYIB 4A66A 4KO6A 4DP2X 4Q8BA 4JHVA 3AG1B 5LDUA 1E5ZA 1NPJA 1PZCA 1J5DA 3X2QB 1B3IA 1XB3A 4YSUA 1ET5A 3T9WA 4N8UA 1WA0X 3WNIA 1BEXA 1E5YA 3JT2A 2X88A 4BWTA 1JZHA 1KCBA 3NP3A 3CVDA 4DPBX 2AANA 3TBBA 1ID2A 3TASA 1W6WA 1JERA 4KO7A 2CJ3A 2WSDA 2VSKB 2EILB 4DP7X 2J5WA 1A4CA 5IY5B 2PLTA 4YSDA 3EF4A 3TU6A 2NRDA 3S3BB 1L9TA 1I53A 2Q5BA 4QLWA 4GY4A 2H47C 5AZUA 1XB6A 1M56B 3UABA 4RH4A 2ZXWB 1AQ8A 1ETJA 4BXVA 1SNRA 4YSTA 3PCYA 3OMAB 3T6ZA 1MG3C 4A2EA 1NTDA 2IH8A 6PCYA 1WA1X 4E9XA 3OMNB 1T5KA 3NJFA 2YAQA 3EHBB 1BQKA 5I28A 1ET7A 1KCWA 1GR7A 2GIMA 2UXFA 4DP6X 1SHXA 4BDVA 1JZEA 3FQYA 2IDTA 3IEAA 4GXFA 4E9YA 1ZV2A 1OOWA 2BP0A 1NIBA 2Y1AA 2PPDA 4HHGA 2BZCA 4M3HA 4A67A 5B7FA 3X1NA 3MBWB 1W8EA 1FA4A 2IWEA 5D4HA 4CSZA 3NP4A 1MG2C 4MFHA 1JXDA 3AY2A 2XWZA 1A3ZA 1BYOA 1J9TA 1VLXA 2XX0A 4FA7B 2P80D 3NJNA 1TEGA 7PCYA 1HAUA 2CCWA 5I6PA 1AZRA 1GS6X 1DYZA 1F56A 9PCYA 5B3SB 1KV7A 7PAZA 1OCRB 3OMIB 1J9RA 2CUAA 2BP8A 3MX0B 1ZDQA 5EHFA 1KGYE 2EINB 4P5RA 4F2EA 5B1JC 1GS8A 3T6WA 5I6OA 1IUZA 3AZUA 3EH3B 1TU2A 4NB7A 2YQBA 3X1BA 4E9SA 3WNJA 3FT0A 1PLBA
chains in the Genus database with same CATH superfamily
5KVDH 5C2UB 5IBTH 1NEZG 4FTDA 4CVUA 2TSBA 3D4YA 4RA3A 4FQXC 1R19A 3QWOB 3L4ZA 3QO0A 4HHAA 4C4KO 5EU7E 1IEBA 5BRZA 5LCVL 5ADOL 3F85A 4YFDB 2GK2A 1CICC 1MSPA 2QKIC 4R0LB 3PAZA 4HLZH 3VSQA 2X6MA 4HUVB 4N5EC 1AS7A 4Z7OB 2GEEA 3MBED 2X05A 3GMLA 4PCYA 3ZE1E 3HNSH 2VLRB 4F5CA 2MQCA 1VFMA 3Q7JA 3MODH 1PKQB 4U0QB 2P5EB 2F6AA 5CSGA 1SM3H 2IAND 4ZMXA 1BJ1J 3IDMA 4KHXH 1A7PL 5JNYB 4HJSA 2PF6A 5HI4C 2NUPB 3VFGH 4NGHH 4MXWH 4HQQL 7CGTA 1KEML 3INUL 1H8OA 2GTWB 2PO6B 2XY1A 4BZYA 3EJTA 4PJ8D 4HPYL 4XPGL 5BRQA 4ORGB 2DMCA 4OAWB 2LOEA 2ROXA 3M1OA 5IJVB 1EAJA 3SPVA 2FT6A 4OF5A 1ITCA 2IPTH 3ESPA 4G70B 1IGTA 3C5XA 4TNGA 5C07B 1CLZL 1IM3B 3BT2H 4OF7A 5IHBA 3CLEL 4UUJB 2GUOB 4OTXL 4BWUA 4U3SB 2W9EL 5FAAA 3QORD 4LPCA 3QDJE 4U1JB 1XSJA 2DI8A 4QRRE 2J3SA 4BIKA 4ZX4A 3WJLA 2ED9A 4PRID 3JVFC 3ABGA 4X9GA 5C7ZA 1QWNA 1YEEL 4UTBH 4BCYA 1TTRA 3QDAA 1BIHA 3L3JA 1F8TH 4I0PD 4XMWA 1MCLA 4OD3H 3NIFB 3V7AE 1VKXA 3U1QA 2O6FA 3B3IB 3R18A 3O2DL 4GQ9L 3LV3A 4F2MB 2EDEA 3J8F7 4LE8A 4X99A 2CR6A 1J8HA 4EF3A 3KEHA 4YLCA 5J89A 1BZ8A 1YEGH 2IGFL 4ONHB 3C60A 4YE4H 3IFPA 3S34H 2WVTA 3GXNA 3WS3A 4XI5C 5L8JB 3L54A 4KROB 1BMZA 2XC8A 2Y5EA 1OKEA 2AQQA 1DQDL 2DF3A 2VZ3A 4EAEA 5IFHH 5AWNH 4N1EA 3VQLA 1JYXA 1KSRA 5HGGS 2QHRH 2ZOLA 3SDXB 4O51B 3NOIA 1IGIH 4GUPA 3N40P 3D4ZA 3FFCD 2V5YA 3KPNB 1OT4A 1IC4L 4DP5X 3BQUA 3MRGB 5DJYA 1M53A 1N2RA 3RL1A 4JUSA 4NNPL 4XRCB 3GUFA 4XCNA 4LRIC 3UTSD 2WLNA 3EGSB 3QDGA 2RFXA 2UY6A 5DMYA 2HG0A 2J8OA 4HF5H 3VFRA 3IU3B 1N8OE 5CINL 4F7EA 1MAMH 2DYPA 4GAYA 1QSFB 2Z93B 1A8ZA 3L5JA 1SEQH 1OOAA 1FZJA 2A77L 2CDFA 1TPXC 4YVNA 2ZOUA 4ZO8A 1R3HA 1HI6B 2YSSA 4OCSH 2XKNA 1J5OH 2AK4D 3VFOA 4Y5VA 1I1AC 3PPEA 5D2NE 2EIDA 2GPZA 4JDTH 3ZUCA 3L3HB 3KL3A 3WNOA 3US9A 2OP4H 3OG4B 4GP5B 3KLHD 4LHUD 2Z92B 2XWBA 1QA9A 2ICWJ 3OC5A 3S3SA 4M5ZH 5FO9B 2WBJD 2J56A 3MNZB 4M6OH 1KBPA 3EDJA 4PB0L 4DTGL 5AL0A 1R5VA 1RPKA 4LCIL 5J7CC 1N6QH 1WIPA 4HIHB 1HXYB 5CBEA 1XTLA 2VH5H 1TZIB 4L8CB 1PQZA 2O5XH 3RVWD 4ZX6A 5L4FA 3BX7C 4PJAF 3OB8A 1HL8A 1II4E 2EE2A 4NQED 4FAAB 2AGJH 2DJSA 1AZBA 4JRXB 4MAUH 5IW1B 1U41A 3FCGA 4X0KA 3S7GA 4WWKA 1M7IA 4POZD 3W0WD 1TSRA 1XGRB 5JW5B 3GSVB 1WTGT 3ZRSA 3CPLA 3U2IA 4ZUVA 4NN5B 5AYUH 3BAXA 1MELA 3NCYS 5DMKB 1YMMB 4D9LH 3G6JF 4PJ5D 1NLDH 3V4PB 4OGZA 2A9MH 2CR0A 1ERNA 2BERA 2IDFA 4P5TA 4YDMA 2L8AA 4K55A 2YN3A 3Q43A 4ENED 3QPQC 5JIIA 1HHIA 5ELIA 5G5DA 1CR9H 3LEYL 1F42A 1YAZA 3RBGA 1DN0B 2HT4D 3RBSA 1X9QA 3FUFA 3F65A 4CDHA 2VMDA 2VDLB 3FFDB 1RZFH 4AIEA 4JN1L 1BF5A 5EUKB 3FHAA 4LP8A 3RTQD 3RWCA 1M6OB 1ECZA 2UX7A 3KYKL 3SY0A 3FUEA 2OL3A 2JFCA 5ISZA 3EOTH 5D4IA 4G6JL 1LO4H 2DQUH 5F7DB 1K6QH 4OV6F 2WCPA 3QG7H 4NKDB 4IMKC 3OB0H 4NFDA 1PD1A 4XBEL 3GS7A 3MV9E 5ICYA 1OTTD 3DBXA 3F7VB 3RGVB 1G7MA 3OAWA 4H13C 3S4SG 4GG8A 1MFVA 3WHXA 1E6OH 3P4MA 2I9TB 2OMTB 2B2XL 1V3KA 2B5IC 2K6ZA 1GIGH 1TQTA 3BEVA 4UIKH 4HU2A 4PW4A 3ASOB 2YXWA 5L4MA 3OJDB 2NDFA 3O2WL 4HUNB 2DLHA 1CDYA 3NG5A 3DX6B 2XFGB 1RV6X 1RFDL 1R34A 3OAUL 2J88H 4QD2E 1PSKH 4X4KA 4KOBA 3E9UA 2W92A 3EIFA 1JZ6A 2GFBB 1DTUA 4W9GC 1T22B 2VLMD 3X11A 4XGZB 2DQMA 3ARXA 4I8DA 4ELKA 4LQFH 4J12A 4L8DA 4CNIB 5GZNC 4N8VA 1XR9B 4AX3A 1OWWA 1ASQA 1QEXA 3UJIL 1NJ9A 2P5WD 4ZAKC 5IFAL 1GGBL 2J6EL 4LSRH 1JPSH 3KW7A 4F8PA 4KKBC 4RSYA 3UZEA 3OPUA 2V0AA 2DQJH 3GK8H 4G6KL 3ZE2B 1GJUA 3GZOA 4IBLT 5DEJA 4D0CA 2I60L 1QNZH 4YZWA 3GS4A 3O11A 4IJTA 5GGSY 1R3KB 4S1SL 1FF5A 5GRXG 5T1KB 4LARH 5KVFE 1LK3H 4OI8A 1I3VA 2AVFA 4MMYB 1SYSB 3OSVA 3LIZA 4PJIF 2DZEA 1MCFA 2ZXBA 1CFSB 2DY2A 4JY5L 4HJ0C 4ZS7H 5IQ7H 3I9PA 5CZVH 3NTCL 2WWKT 5FA3B 3NSYA 3DVIA 5EOCL 3D85A 1JZJA 3P0GB 3F84A 5JDSA 4BFFA 4ZMLA 2XQYA 4F9LA 5C0RH 1S9WB 4YXKL 4GAAA 1D5BB 2HTLD 5I26A 4B0MM 1IEHA 3QEUA 1M05B 3D2UB 3IU4L 4GW5A 3QIWD 5LNEA 8PAZA 2FVNA 1FCGA 2H8PA 1I85A 3IPEA 1GOGA 4QRQB 4YHYB 1FG2B 2KC0A 3QNZB 4AVKA 3HI1A 4W9IC 1IIIA 1K4DA 1L6PA 3Q5YA 4NRXA 2DICA 1TLKA 3NGBB 4ODSH 5ITBL 2DQTL 4TYUA 4TVPH 3BPOC 4Y5XC 4LCCB 4O2CB 2AQRA 2B59B 1YJDL 1HH6B 5FK9B 1B9ZA 4HKZB 3LH2L 1NC4D 3WKMH 4FJZA 4LSQL 5GRVL 3KYNB 3V4VH 2P46B 2H1PL 4FLHA 3MTXA 5I2IA 5I66A 3RY4A 1NIDA 4MD4B 1CLYH 3GMOB 4FEIA 2CQVA 1D9KA 3LPOA 1I8LA 4FA8A 1ONQB 4I4WA 2IWGA 4O2FB 3LD8B 5ICZA 3NUKA 4NS0A 3IJ9A 1ZVHA 4YSCA 1RZ8A 2I07A 2DQHL 4KJYA 2Y6TE 5D7EA 4X6FA 4HS6A 2P52A 1N64H 3TA3B 3BP4A 1C1EH 1JGLH 5CIPB 3KPTA 1IBGL 4N8CH 2OXGB 5ESQA 4NWTL 4Q6KA 3D0LA 5HI5D 4O5LL 4Z1PA 1YNTB 1QSED 1LVEA 3L2MA 2O4EA 1GTFA 4Z9KB 1TCRB 3DUSB 3MRDA 4LEBA 2W65A 4N8UA 5EZJB 4PG2C 1OGTA 3D51A 3FRPA 3EO1B 5BUAA 2J5LC 3OF6D 4A7UA 1CDCA 2MOQA 1O7DC 4H5SA 3P2DA 1ACYL 2EEXA 1R3JA 2IPUK 4AWJC 1KCBA 4KROC 1XCTA 3OZLA 2Z6FA 5HPMA 2X38A 4XVTH 4M5TA 1G6RA 5AKVA 5JQIB 3K4AA 4WGVB 2G5BB 2FJFA 4EJ1C 1FJ1B 3AT8A 4AYBA 3LRMA 1JYNA 3WS6A 4IRSD 2GY5A 1RJLA 2HAZA 4P2RD 2EDDA 1HL4A 3DARA 5D7HA 4PWGA 3P3RA 4WNQB 1VAHA 4MA1B 2EDLA 2JB6A 2A83B 3ZTCC 2AEOA 3KEDA 2BRRH 5D1XD 3NN8B 3O3DB 4LCWE 5E6ZA 4MVBC 5DLML 5AZUA 5HGHB 2NY0D 3UTPE 1D6EB 4PCSA 5I17B 2Z34A 4R2GB 1PG7L 3DXAB 4AMKL 4ATWA 1K8IA 2G9HB 2XWTB 5D71H 3QFJB 4MZ2A 4S1QH 4ZMZA 4M7JH 1HCVA 5A6MA 5T3XD 4ICWA 4PS7A 2YAQA 3K91A 3RFZC 5IGXL 2AK1H 4TQPA 3FT4B 3X3GH 4PLJC 1SUJA 5JHDB 1E8ZA 2KERA 4AM0A 3CFEA 1UJ3B 3RFRA 4Z7QE 5KN5A 4JHAL 1AYOA 4RGND 3HS8A 3MBWB 3MRQA 1FYTA 4YGAB 1MG2C 4BQ8A 4XCFH 2X9ZA 2GAZB 1FZMA 3Q2CA 2EYTB 2B4CL 3VFVA 3HHSA 4A38A 4FXGC 3UG4A 2QV4A 5CN1A 4ZOEA 5F96L 4IBSA 4POUB 4MCZA 5DJ6B 4MB4A 4NHUB 1MVFA 1J9RA 2CIKB 2CUAA 3C08L 1INEL 4HH9B 3WY1A 3I50H 1NCCL 1JUFB 2EINB 3LXAA 2VR3A 2F9BT 4G6MH 4B9YA 1GS8A 3T6WA 3VU1A 4EN3B 5KTEL 5FKPA 3QAQA 2EXYC 4JQIH 2EC9U 2PXYC 3FT0A 1EHAA 1AFVL 5JPMC 5CSZA 3SKMA 2WZAA 2XQBL 1XO8A 4KRMB 3OLEA 4UT9H 4YSEA 1BM3L 3IMTA 5L2KA 1A21A 3C5SA 4NLHA 2BHYA 2PCPB 1A1MA 1RULH 2E9BA 3S8FB 3IGFA 3SYPA 1FRGH 2LU4A 4TPRL 1S78C 3MA7A 4HIEB 4Y4KD 3V9EA 3VU2A 4X9IA 2GITB 1BQRA 3SZ6A 1A7RH 3H7BA 1MZYA 4YHKH 5IROD 5GRJH 4HVBA 3APCA 3DOIA 5CBAA 2NY5H 2EKJA 2ZWNA 5D7JC 5BVJB 2J6WA 4AK1A 4B9ZA 1R33A 3ML9A 1YO4A 1F4HA 5FIEA 5HHOA 1GY1A 1A3RH 4DHLA 3NSXA 4ODWA 1P7QB 1HZLA 2OAAA 2P7TA 5D4QA 2WQWA 1QQDB 2ED6A 5C0GA 5J0BA 1DEDA 3KDMB 3EXLA 3EYSL 1KENL 4YAQA 3U2SB 1UQSA 3RKDC 5CD3A 1CGSL 3F2LA 4HGWB 4QXWA 3S2AA 5AEAA 4NQDE 5SV3A 1YN6A 1OARH 2F08A 1XIWD 2WTOA 3E8VA 2EAEA 4WHYG 3E6HB 4GT0A 1A2YA 3H9HB 3JV0A 4YO0B 1I8MB 2Q87A 1ZT4B 2VWEC 4QWWC 1IGJB 3DYMA 3TIEA 3WNNA 3HZKB 1XF2A 2DIJA 2OJZL 3VXSE 3BZEA 3DWTA 1G1OA 4GSXA 4ZDHA 2J4WL 3HE7A 1KN4H 5T5FH 5JYLA 1AXIB 2VM4A 1EMTH 3AU1A 3MBEA 4NUGL 4KTEL 5SWQA 3KWWB 3M1BB 5DJ0B 5EZOH 1Z9LA 1AQDA 1RZPA 4IEFB 2HLFC 2HYMA 1GXEA 1EXUA 2CDEB 2YC1B 4AM0Q 4Z7UF 3GTNA 1HSAB 4L1LA 3W39A 5CEZE 1FL5A 1FNEA 3UBHA 2EDFA 2DB8A 3PWVB 2LW3A 5F6HI 2WINA 3JQOB 4A68A 4PGDB 4LOEA 4DN3H 3CU7A 3VGHA 5B7EA 3RVXD 4XO9A 1YA5A 3Q8FA 4PJ8A 2L7EA 2YWZA 3ATDA 3BGAA 3L5WA 3MRNB 3OC8A 1HXMA 5I8KL 4WI4A 1JHKH 2A73A 5DGRA 3OAZH 4K3EH 4UNUA 1A6TA 4RMRA 5TF0A 1PDKA 4YOKA 4N86A 2WXJA 2H2SC 1RUMH 2B1AH 1EEZB 3STZB 12E8H 3U0PB 1YAIA 3V52H 1MDAA 2VXQA 3QPKA 1V54B 2AJUL 3P3UA 4PLKD 4EBQL 1E2WA 1U42A 4FQ1L 4NQCE 1LJMA 3TBYB 3VXTA 3WKQA 2X7LB 5E8DL 5DO2C 2PNDA 3QE5A 4N2FA 4JM0A 2O61A 4PRIA 3KR3H 1EV2E 3MV8D 4KO5A 2V3DA 1BP3B 3WLWC 4UV7L 3HLKA 3DI3B 1YUHB 3AXLA 5BS0B 2R69H 1ORSA 3ZDYB 2JIXD 3GC3A 4PUBL 4W9HC 5IHZA 1GJIA 1DQML 3CFIC 1AZNA 3ZTEA 4HV8A 1ECYA 3CX5K 3WTUA 5J6GB 2F19H 3I6LD 3OXSB 3RVTC 2X2JA 1Q1JL 1BVNT 4TUOA 4XMPH 1ZLWK 3MGOB 3S36L 3O6LH 1XF5B 3HG2A 3R06A 4PJFE 4R2GD 4OZHE 1HEHC 4QAWA 4HC1L 4P46D 5AW3B 1Q1PA 3EYOB 3O9WC 5EU3B 1A25A 4FZ8H 1AKJB 3WTXA 4JREC 5JR1H 2DW5A 1QSVA 3FAWA 4IOFC 1D6VL 3BPCA 2ZE0A 1JFQL 2FIKB 3CSGA 3NSDA 4HXAH 4KK5D 4PJEA 4LPWA 3EFDH 4QHLB 2X3BA 1KGCD 1OM3H 3HN5A 4AG4H 3DKHA 5IEHA 1T1YA 2OZ4A 3BXNB 1MWAL 2YRBA 1DDTA 3TBCA 2Z91A 3FH5A 3BZFA 1JTOA 4RA0C 2BIIA 4YDJB 5AW0B 2YKKA 2FJHB 4WV1C 5E6IA 2CO6A 3SQOH 2DQIL 5L7XL 1L0YA 3MXVH 4NLAA 5AZ2L 1YLBB 1TTCA 3MJ8B 1U8MA 5AZEL 1VSCA 1DBBH 3WN5C 3ZZLA 4M00A 1ACXA 3N1FC 2EDBA 3ZBMA 3MOAH 2Y7QB 2TAAA 2JB5H 3A6CH 1JOIA 2GBTA 5LXGL 5IIEA 3W9EB 4HA1A 5GJSL 3EG9B 4JLRB 1J0YA 3KCPA 2CRIA 3NFPB 3AG4B 1JWUB 2JJSA 3JWOC 4XCCL 4XO4A 3VI3F 1UM6H 1XT5A 2EXWC 2J43A 5SWZA 1J0KA 4U2ZA 4UAOB 1KN2L 1PZ3A 3U9PH 3IBEA 3BHBB 3DPBB 2ITFA 5GGRA 4PP1D 3QZMA 2IO5A 3FT2A 2F58H 4P4RA 4Z7WA 1ADWA 1RK1B 2YZ8A 2C1PB 1GY2A 1WBYA 2A6KB 3DLQR 4XMLH 5I76A 2UZYA 5EZIL 3PWPA 1M71B 4OLVL 3LZLA 3W38A 3RIFF 3SKNB 3DA0A 4FX5A 1A4JA 4KQ3L 4X8JB 1XVSA 3W11C 5AOJA 1AP2B 1DQQA 4DFIA 2VDML 4YHMH 3G5ZA 4F27A 4XP4H 1M2OA 2BVTA 2Y07H 3HRZA 3O81A 2Z7WA 1DVTA 3CVIL 4U1GB 3POCA 5JORA 2Y6SD 5F3BA 2YARA 2KDYA 3MKGA 4M1GL 3OVUB 5AOLA 4NYLA 2OI9B 3U36A 3C9NA 2R51A 4IJ3B 2OX5B 5HDOA 3DO7B 2Y5TA 5EO0B 3L3DA 1E3ZA 3BUYB 4DVBB 4R96B 1TQBB 5IMKA 4KQ0A 2NYZA 3L3GA 5JXEC 1DANU 1D2PA 2BOCB 4FP8L 5CEXA 1H3UA 5GRVK 2BS71 1O9ZA 1BHGA 2B15A 2GCYA 3LQAH 1OGAD 4OGAD 1A02N 3HI5L 4K7PY 4CC4A 4TULL 3U4KA 5C0BB 3AW5A 5FUOL 3KYOB 2VNCA 2Y24A 3QWOA 5B38G 2CRYA 2YHGA 4JPVL 4R90L 1PCXA 2E56A 1FORH 1NGXB 4PJGB 4R0LA 4UNTA 4MMZC 2XBDA 3CMOH 5IB2B 4HUVA 3TEUA 3NCXA 5AAPA 4PBXA 2Z7ZA 1CQYA 3BUIA 3ULUD 3OG6B 3PWUB 3OXRB 1BVNP 2VLRA 3L3OB 3HBPA 1ANUA 3G5YB 1U8KB 2OR8A 2CJSA 2P5EA 1F6FB 1MFCL 2QPSA 4DKEL 9CGTA 2R8SH 5JNYA 2FATL 5B39G 2AXWA 2G3XA 2NUPA 3D48R 1NGQL 1P5VB 5AVWB 2R0LL 4BRJA 1WBZB 4F15C 2K7QA 1YY9C 2GTWA 2PO6A 5KJRH 1IAKB 4OT1H 3QJZA 2NY4D 4ORGA 4IM8A 4OAWA 5ESVB 5IJVA 2XTJD 4ZXBD 1DZ0A 1RUAH 3U82B 3FO1B 2WM0A 1ZPLA 5C07A 4QIRA 4BSWB 4LSVH 5F70A 5EPMB 4HOZA 3E80A 4TNFA 1IM3A 1JGEB 1TJIL 4ODHL 4UUJA 1WCQA 2GUOA 5MEQB 4M02A 4X6BB 5HDQH 4ALAL 4U3SA 1Q0YH 1YPZE 3QR0A 1EBPA 2CGYA 3E1F1 4U1JA 5TFSH 2JELH 4GUCA 4M43H 5I71B 4ODTH 3S9DB 4TUJB 2WP3O 3DX3A 1AJ7H 5C2BH 4N20A 2EE3A 3MNVA 3UZQB 2AJ3B 2ZNWA 4N1HB 4OUUB 3QJTB 2XZAL 4EIGB 4F2FA 4Z7QF 2J72A 3B3IA 4F2MA 3NAAL 2ZONA 5F93C 1UXLA 1NCBL 3A6OA 3O8XB 4ONHA 3VGDA 3MV7D 4N2AA 5D7SH 1VPOL 4PG9B 4MMXB 3PL6C 3GIZH 1WV7T 2XV3A 4AKOA 5IZ7A 3SDXA 3DTXB 4O51A 2YXVA 3D4GA 3A6BH 1HINH 4J6IA 3TH2T 3MLVL 3VFWB 1SPDA 4F91B 3WLBB 3KPNA 3WD5H 3LQMA 4AOFA 3MRGA 4U3CA 4TKWA 2F7IA 3S37L 1GAFL 4XRCA 4Z0BH 4Q9QH 1A1NB 1S7WB 1J5IA 5T8IA 3EGSA 1DVYA 2BNQE 4CSSA 4DK5A 2D3NA 4XR8C 1U6AH 2XN0A 5ILTH 1YYCA 2QADB 1BVOA 4H0GA 3SDYH 3IU3A 5DYFA 5H4ZA 1XZWA 2NY2D 5GS1B 2FYVA 3QUYD 4DERA 2IQ9H 4GKSB 1QSFA 2Z93A 3HN3A 4G9FB 4G8GE 1CF8H 1TITA 2CXGA 1HI6A 3VXMB 2BCKB 1XL4A 1F4WH 1U91B 4TLSA 3T0EC 1JP5A 1RK7A 5DVOA 3AWFA 1YC7A 2JQAA 3L3HA 4J1UB 5CGTA 5JZ7C 4UM9D 3IMUA 3GGWB 4YHOH 2D9CA 4KTDH 3G9AB 4O2EB 4OGYL 3SDCB 4F92B 2Z92A 4GINA 4TQEL 3VW3L 3ARBD 2GIXA 3CE1A 4XAKE 2CGRH 1BBDH 1KBBA 4PJCE 5FO9A 1XB6A 2HFEB 1RUKL 3MNZA 3QW9A 1MCPL 4HIHA 1HXYA 4PVNA 1EJOH 5EN2B 1TZIA 1X44A 4L8CA 4Q6IB 1I9EA 4PY8I 4EOWH 1OT1A 3OBAA 1PIFA 2CCVA 4UDTB 1F13A 3IDYB 4B53A 4LSPL 5I28A 1GR7A 4JRXA 1RP8A 5IW1A 4R7LA 3D0VB 3SCMB 1E6JL 4Y16D 1XGRA 5JW5A 2VMCA 3GSVA 4YDKH 4ZFZB 3CFNA 3BKCL 3NCWA 3T2LA 3L16A 5H2BB 1Q72L 4JKKA 5DHDA 2Z8RA 4K3GA 1YMMA 5DMKA 2IADB 5GQBA 3V4PA 5AG8A 4KKAD 4HUCA 3A22A 4U6XB 4R5VA 1IAMA 2BFVH 3BIKB 3OQ3B 3DHPA 3TESA 2AW2A 2CCWA 4WUKH 4NC0B 3ETTA 4N2DA 4HDIB 4WUUD 2PWHA 4N2EA 5BZDB 4DGUA 5C0FB 2IAMC 4OZGF 2D2OA 1OZUA 5AOKA 3TFBA 3WELA 1DN0A 2W1NA 3B2UD 1QZ1A 3DIDA 3FFDA 4M9PA 2G30A 5EUKA 3VMOA 1Q90A 2H1XA 3N1MC 4MZIA 3EH3B 2PTVA 4BUQA 3DMMC 3WNJA 1M6OA 1LDPH 1SDAB 3VDAA 4YX2H 1OW0C 3NCCB 4L48A 4NKIH 4XPFL 5F7DA 3U7YL 1AO7D 3FN3A 3LDBC 3QEQE 4NKDA 5FCUH 4BFGA 2GSGB 4D9RD 1ID5I 3B43A 3CZEA 4KOCA 1QUPA 5I1AB 4KPHH 4QTFA 5I0XA 4EKXA 4M4PA 2NCMA 3F7VA 3RGVA 2ZSVB 4CA4A 3DUUB 2V5SA 3DPDA 2I9TA 2OMTA 5E03A 3RB5A 5IEKB 1RIUL 2K8QA 1MCSA 3BH9B 3D05A 1YCSA 2NXZB 1HZHH 4X5RA 1NAML 4UINL 4DVRH 4BQ9A 3OJDA 2UUDK 1CVSC 1EUTA 3D3VD 4K8RH 2ZYHA 3DX6A 2B3RA 1XMWA 4PJFF 3LS4H 2WANA 4G43B 4OZHF 2VDOH 3F6IA 5FUZH 3TF7C 4MQSB 3WGUB 2PKDA 2WOBA 4J28A 4WEBH 1EO7A 5HD8D 2GFBA 2JE8A 1T22A 4XGZA 4ODVH 3LJ3A 5C09D 1MJ8L 4AZUA 4ZMTA 5I16B 3HC4L 5D2LE 1PD6A 5ALCH 5DWUL 1NDTA 2DM4A 3IT8D 2F1EA 4CNIA 1XR9A 5E8OB 3EYQC 4KXDA 1QW9A 5L9DH 2ZUTA 4ZUWB 3V55A 1SEBB 4OI9A 5D70H 1N68A 1SGKA 3O4LB 3BE1L 2A6JB 3EJPA 4DFHA 4WRLA 3WKNA 2P8PB 3CFDB 4TQ8A 3WJMB 1FNSL 1UWEL 2CUIA 2VISB 1GHFL 3LNGA 4WVRA 1RIVH 1R3KA 2CK0L 5T1KA 4FKHA 4DGIH 3BWAB 4BZ2L 4L3AA 3QCVH 4PBWD 3SKUD 3HMXH 4OV5B 4MMYA 1SYSA 5I73C 3FTUA 1AI1H 1WBXB 4GRWE 3C5ZC 5E1IA 1CFSA 4ZUTB 5HDWA 3L3IB 1AQMA 2K6YA 1AQKH 4I2XE 5HYSB 1P4BH 4HUKB 1Z7JA 5FA3A 4QT5B 5K9JL 3KM2A 3LZOA 1M1SA 3IE9A 4YLBA 3ZDWA 3TJPA 1L9NA 1Z6JT 4PJAB 1S9WA 1SDYA 1SOQA 1D5BA 3NMEA 3S3JA 5JQ6H 4XBPB 2EDTA 2WYHA 4GIPD 1M05A 3D2UA 3QAZB 3RIKA 2IVFC 4H8PA 5D1QE 1PW3A 5A2LH 4QRQA 3WKYA 4P2QB 5C0JB 1FG2A 4G9FD 1B88A 3QNZA 1WRFA 1Q0XL 3G6JB 5HGBB 1RUPL 5IMMB 2XV0A 3QIUD 1RSFA 4K3DH 4B9CA 4WFED 5CJ5A 4M4RB 3RG1C 1DVUA 1O6VA 3HNVH 4LCCA 4O2CA 2B59A 3OLIA 1AD9B 1HH6A 1FNGB 5FK9A 4HKZA 3AAZB 2CM5A 3KYNA 2A3TA 1N7ML 4BK5C 4OQ1A 4W1TA 4ELMB 4MD4A 5A2FA 3GMOA 1OAZH 3NEXA 4KU1A 1AHWB 3MLRL 3ZQ9A 1ONQA 2DQGL 4O2FA 2NY1D 3V0AC 1IJ9A 3MJ6A 2IGLA 1KC5H 3K5RA 3QHZH 1MJ7H 3MA9L 3GXPA 1ZOXA 1BWMA 1DR9A 3GPEA 3H4HA 2HT3D 5BMFH 1CC3A 5MI0B 3NBNA 2HG5B 2QQKH 3QUXC 2QZ5A 4NHCH 5HHVL 3TA3A 3US0A 2BVPB 2KZ1B 1D2OA 2OXHB 1S7QB 3MGAA 4H8WC 2JLPA 5CIPA 4FLSA 2OXGA 1UJTA 1MW2A 4MQTB 5F9WB 5HYEA 4LSUL 3CV5A 1YNTA 1TCRA 3DUSA 3MBXH 4XPTH 4E9VA 5EZJA 2Q8AH 3EO1A 4DAGH 4JY4B 3QDMB 1A9BB 4ES8A 3QJOA 2MRYA 2N7AA 4R84A 1ZVYA 3C12A 2G5BA 4M7KL 4TTDC 1SLXA 4N2IA 1FJ1A 1WHPA 3UL4A 1IC0A 3AG2B 2ODHA 2VDPH 2WQUA 4WNQA 2X3CA 2O26U 2WBXA 2A83A 3TPUB 3DX8B 2WNKA 3NZHL 4Q6YA 3I74A 3NN8A 3O3DA 4WI6A 4PWKA 5HGHA 5DZAA 5KOMC 5FYJE 1D6EA 3HPJB 1AE6L 5I17A 4TNWK 3BKJH 3DXAA 4WFHD 4WEUD 2G9HA 2XWTA 3TVMB 3QFJA 4EVNB 3KG5A 4W9ZA 2NX5B 4IOIB 4OQTL 3A4DA 5J1AB 5CXPA 1LO2H 1WHOA 1YPZF 1SJMA 2A9BA 2XJKA 3CN4A 4I85A 4P23C 3MRKB 5E4IA 1CLOL 3FT4A 2ZKWA 1U0QA 2CJTA 2B77A 3DJ9A 5KVFH 1SJXA 3DX7B 1P1ZB 3O6FB 5JHDA 4XWOD 2H32H 1EEUA 2AJYL 3AC0A 2ADYA 3KBFA 1UJ3A 5CJXA 4DZBB 2YKLL 2X9XA 3MBWA 1ZANL 4MJID 3PDDA 1RVFH 3WFZA 3CVHB 2MQ3A 5EFIB 2ZKXA 1DL7H 2KYIA 4QRPB 2GAZA 1FYHB 1FSKC 2EYTA 2Z31C 3ARDB 3QIBC 1BF2A 3ZTNL 3PIQB 2I26N 2F54D 3SDDB 1IBDA 3OGOE 5DJ6A 3G04B 1L9OA 2CIKA 4NHUA 3KDPB 3UCQA 2LVCA 1RPUA 4HH9A 1JUFA 4BFRA 4EN3A 2VXVH 4JRYD 3WIFB 4IGBB 4L2YA 4LU5L 4YDIH 5KSUB 1WUZA 3WO4B 3NPZB 1SJHB 4KVPA 3ZKXB 3DHMA 4K71B 3BLKA 3WE6B 2MQ0A 4XX5A 4YZFE 4WW2C 1K3IA 4Y5YB 1BAGA 2PCPA 3FQ4A 3L3KB 4BD4A 3BSZH 2N1TE 2GKIA 5KSAD 4XN5A 3PU7A 1CMOA 3WXVL 3DX1A 3UAJA 4YXLL 4PRPB 4HIEA 5C3LD 5GS2H 2W59A 1IEAB 4KDTC 3RA7H 2GITA 2ZXQA 3CVCA 4K7PL 2QV2A 2X40A 2AMGA 1B90A 1B2WH 3HUJE 4HUUB 5BVJA 3MCLL 2EADA 2Q76B 3SJVE 1CUOA 3HHRB 3QPXL 1RI8A 1JZ8A 5DUPL 2FT8A 3GMMB 5IBUG 5AVRB 4CBZA 1JV5B 5F7KC 5HY9B 2VDNL 1P7QA 3TCXA 3U9UB 5I8CB 3OKOB 3RVUD 4OB5H 4PJCF 1QQDA 1QTPA 3AG3B 3TV8A 3RDTD 2ZXEB 3KDMA 2J73A 4I3SL 3LXBA 4FNLH 4XNYH 3TYFB 3U2SA 2JTYA 4HGWA 1FLRL 1IC7L 1XSOA 3L7FB 1LO0L 3DJRA 3ZXAC 3ZE1B 4P2CG 3E6HA 2AS5M 3H9HA 1I8MA 4YO0A 1HHKB 1KLUB 5IOPB 1ZT4A 4UAHA 1EK3A 1JZGA 1IGJA 3FPXA 4U7KA 3FSZA 2NT1A 3HZKA 2R39A 3N0AA 1U3NA 5J3HD 1CJYA 4LASH 2WXOA 4NCC1 2BHFA 5AL8A 3IFOB 2X4NB 3BIBX 4Z7VF 1EWHA 1AS6A 3Q01A 3LB6D 2FZ3B 4WWPA 2VL5B 1ZSDB 3KWWA 3M1BA 5CZXD 5DJ0A 5LJYH 4IEFA 1ZMYA 2O5ZL 3VMNA 2CDEA 2YC1A 3VQ2C 1HSAA 2YPKB 4MQ7B 3KLSA 5GGVY 5PCYA 1F4YL 1RURH 3PWVA 1YYLH 5FS5A 2X87A 4PGDA 3IGAB 1VEOA 5HVGB 3MRNA 3QDJB 2XWXA 2PWDA 2ICEC 1JE6A 1IGFH 4QRRB 1JYVA 1CFVH 1QI3A 5CLZA 1CDUA 1J0ZA 1F58L 3KLKA 1P7BA 3ZRFC 3CNKA 5LDUA 2ESVE 2XYCA 4PD4J 3VD5A 1PZCA 1EEZA 3ARFC 3STZA 2BHUA 4X8CA 1EEYB 1HC1A 2V33A 1BD2D 1B3IA 1BECA 5DFVD 3U0PA 5ID1B 4R4FH 1ET5A 3CAFA 3RZCB 1H9DA 3FRUB 3TBYA 2X7LA 1P4IL 4XHJD 5SV4A 3EAKA 1UTDA 2R15A 3BPLB 3H9SD 3L8QA 1LWHA 5F6HJ 2W94A 5E2WH 1TJHL 1YUHA 4OJYA 5BS0A 4GRMB 4HLJA 1E27B 4I0KA 4OM1H 4YFLF 3TBBA 2YLHA 5E4EC 3ARED 3ZL4L 1CE6B 4HJTA 4N90D 4MS8C 4KO7A 5J6GA 3OXSA 2MKLC 3MGOA 4URTB 4DP7X 3HG4A 4HT1L 1XF5A 3ESMA 1AD0B 3H3KA 5IY5B 2PTUA 2MKWA 3EYOA 5EU3A 3U1SL 3VGAB 1AKJA 2ZAHA 5KW9L 4PP2B 1G7LB 3FQWB 2B0SL 2FIKA 1NCTA 2N01B 4HJIA 4QHLA 5D2LF 2WZ0A 1WP6A 6PCYA 3GSNL 1A14H 3FTWA 3THMH 3BXNA 1MCKA 4LVHB 3EHBB 2ZX9A 3CK0L 3QC6X 1G0YR 4G1MB 3GXDA 1KGWA 3M6DA 3L2LA 2YZ1A 2YD1A 4Y2DB 4YDJA 3QNYB 5DEGB 2FJHA 3OKDB 5E00B 5D2NB 4JFFD 5JOPE 3LZRA 4ZMNA 3MJ8A 2VC2H 3SO5A 1G9HA 4XOBA 3GNMH 4Y9BA 3DVGB 3KXFE 5E6UB 3B34A 3TEWA 1QKZH 1NMAH 2Y7QA 3HRPA 4GXVL 3TN0B 4XXWA 1VFBB 1XQ4A 4RCAA 5I0YA 1BYOA 2DWDB 3IKKA 3W9EA 4OU3A 3EG9A 4JLRA 3WTWA 3KHQA 3QORC 5JPNC 1WD9A 3BKYL 4XOAA 3NFPA 3UTTE 1JWUA 1K5WA 3D1MC 3A24A 4APQD 1H3TA 3PE9A 2VN7A 2G3ZA 5DD5L 2F7RA 4AIOA 4JM2D 3VWJB 1UFGA 2VDRL 4I0PC 3ISYA 3BHBA 4K9EC 3DPBA 4AW7A 3V10A 2HKHL 4JO4H 4KJQD 1RK1A 2C1PA 3GTTA 2A6KA 4PVMA 5TPWL 1MNUL 1JGDB 1M71A 4IHBA 4YDNA 3AQXA 4FQCL 3K0WA 3SKNA 3P73B 1XGYL 2N0MA 5FC9A 4PIRF 4X8JA 5CU5A 3VGFA 1AP2A 3T04D 2A0LD 5CEZH 4JBSA 4PSRA 5MEND 1Z32X 4Z7UB 1OM9A 5ALBH 2XRAH 1KTJA 5LWYH 4LSDA 2I25N 3HMWH 5IT2H 2G0KA 1C5CH 4FQLH 1RCYA 3WMQA 3C6LD 1AQHA 3ZGIA 2KL6A 4IBTA 2M8XA 1SVBA 4A63A 3G5XB 2OX5A 3DO7A 5LBSH 5FLUA 5EO0A 4OFQA 2A9DA 3OJMB 4Y4FD 1XF4B 3BUYA 3GRGA 4DVBA 4R96A 1G5GA 4A6YH 1RJZB 2BOCA 3U4AA 1Q9LB 4L4TD 1MHEB 2X2IA 5LN8A 5DO8A 1QLFB 3PDGA 5C0BA 2QGDA 4KXZH 3KYOA 1A6ZB 3PAUA 3E38A 4G5AA 4PGZA 5KVEL 1KBGH 4YDLB 3QI9D 3MV9B 4GKZB 3GBMH 1NGXA 2APVA 3OZ9H 2J2ZB 1CD1B 1W91A 3FYEB 4PJGA 3ZKND 3NCJL 2BOLA 4C56D 5IB2A 2QVFB 1CBVL 4AI7A 1T1ZB 4GRLD 2N3JA 4J3UA 4XVSL 3PWUA 3KLHC 1IC1A 3OXRA 2OZNA 1OEZW 3L3OA 3K8KA 5I0ZA 1LEIB 1TQCC 3G5YA 1U8KA 4MHHI 1Q9WB 2CZNA 2RGSA 2H2PD 3WEOA 2WBJC 4PWHA 2E9IA 1W0WB 2DLFH 3MLUL 1P5VA 4WTQA 4GIOA 1WBZA 3L4UA 2CR3A 3QUGA 2VR5A 1UA3A 1IAKA 2FHCA 2WV3A 3NIDE 4HIIB 3MZGB 4OJDH 3RVWC 1FWXA 2VDPB 4RWYH 5ESVA 1G1KA 3CXHJ 1YNLH 5C0IB 1YMHB 3GMPB 3FO1A 1PTZA 2OK0H 1NIEA 2DLGA 2JNZA 4BSWA 3RX5A 2XN9E 2APXA 5EPMA 5CKAA 4AY0A 2NY6B 1YZZA 1X5AA 4KK9D 4Q0XL 1EBAA 2BSED 1JGEA 4L4VD 5MEQA 4X6BA 1SFDA 1F02I 4YNYB 4K5NA 1OXYA 4A7VA 2KHAA 4TUJA 2JKLA 1NMCC 4GG6E 3V79C 5E9NA 2BVYA 4NN7C 3UZQA 4ENEC 2AJ3A 2QGCA 4R7VA 1XCWA 5JIQA 1T7VA 3D52A 2JV6A 4OUUA 1NPNA 2FECL 2DI9A 4PGBB 5K9QI 4Z3EA 3D33A 3L6FB 4ODXB 5DYOB 2H32B 2ZUSA 4AQ1B 1AH1A 1IVLA 2DTMH 3O8XA 3RTQC 1A6AB 4U7SA 4K8RD 3G5VB 1O75A 4M7ZC 3AM8A 3DVNB 4PG9A 1VDGA 4XP9L 2MNWA 3V6OC 1DANT 3TO4D 4ZW6A 1WAAE 2E0PA 1UACL 3DTXA 3VFWA 3GI9L 3WLBA 4Z6AT 1RD6A 3CVBA 2ITDB 2X1WL 2P8LB 3ASNB 4QPEA 3ZL1A 4WO4B 1OTTC 2DH3A 4MGXA 4YQXL 3QO1B 4AYSA 2G2RB 3KH3A 5BV7C 4WTZG 1UD8A 4JQIA 1A1NA 1S7WA 4X9BA 2X6UA 3I6SA 1K5NB 4YZFF 4AW4A 1YQVL 1IZKA 4FHJA 1UKTA 1V3JA 3O45B 3RX9A 4UT9A 1EZUA 4I48B 2A6DB 2ZUQB 4M5SA 5GS1A 3LRLA 1YEFL 4P4KD 3BN3B 4GKSA 1BAWA 2WCSA 3SYQA 4G9FA 1V7MH 1OCZB 1UC6A 2D8KA 5DD0H 1W9XA 3VXMA 2BCKA 1EZVX 1U91A 4AMXA 3KJ4B 3WAJA 3HUJF 1T2XA 2PP8A 4J1UA 4KXZI 3CQFA 2VLKB 2Q7NA 1KYOJ 3GGWA 3Q0HA 3SDCA 1KB5L 1CXFA 4O2EA 1BLIA 4BZ1H 4KK8D 5BO1L 2FTAA 3ZR5A 2PYFB 4NZRH 5E2VH 1HILB 5AVSB 2HFEA 1ZXKA 4ACTA 4I3RL 5EBWB 2BJML 5C6TH 5A2JH 4P5SA 2UYLB 3N1GC 4M56A 5EN2A 2HVKB 3VXUE 1TU2B 3ZKMD 4ZFFB 4ZQKB 4Q6IA 5E2UL 3UAFA 2VABB 4FYSA 2XV2A 4UDTA 4G1EB 4QO1B 1E67A 1KELH 3BD5A 1CI3M 3D0VA 4GW4B 3SCMA 1NCWH 2QPFA 1PLCA 3GINA 4FXKC 4ZFZA 1QX1A 3HHMA 3LKSB 3KNBB 1EHKB 5H2BA 3V9CA 3MGTB 3EZJB 3FN0H 4H20L 4X5QA 2APFA 2IADA 1FFRA 1NGYB 4U6XA 5T5FA 3VE0B 3BIKA 4C55A 1GW0A 4LCWB 2HTLC 4QOKD 2MQGA 2E9JA 1H3VA 3QHTC 4HDIA 4PYGA 3QIWC 2XACC 1Q94B 5C0FA 1MW1A 4LHUG 4Y1SA 2AQ1A 2WQXA 3JWDH 2CKNA 2IFFL 4E68A 1NPUA 4JHUA 3C2AH 4AYGA 5I1HH 3KLAB 4P8QA 4JM4H 5AAWA 1WAEA 1ZS8B 2YPLD 4R26L 2QMKA 4MB5A 1A6VL 3MOBL 2WN3A 3V0IA 1BV8A 4NX0A 4P3CL 4A2FA 3VD2A 1JG9A 4P9MH 4M5YH 3Q8CA 1PLGH 5KZCB 4R97B 2R4SL 2XJLA 3AT9A 2GSGA 4Z7QB 5I18H 5DFAA 3BVDB 3VFNB 3D9AH 5ERWB 4LLYB 1GYCA 1DJIA 5CSBA 2VR9A 5I1AA 1NM4A 2CNYA 3IS0X 3DYPA 4LGSB 1T89C 2ZSVA 1UB5B 1ADQH 1YNKH 3DUUA 2NTSP 5FW6A 4NUJB 4PREB 1IAIH 2CALA 5IEKA 2DWTA 2NNCA 3BH9A 4IKKA 3LHPH 4I1RA 2A2QT 1QHPA 2N4IA 3LZFL 3QRGH 3B7YA 2YUWA 2R69A 5IOKA 2D7OA 4Y2NA 1KACB 4AL8C 1GKEA 5C1MB 2FB4L 2XU9A 4FERA 3MNDA 4G43A 1XGQB 1MXGA 1LO5B 5HI5C 3T71A 2P5PA 1DQLL 2CBPA 1A7OL 2BC4B 2EDHA 4OLYL 2JI1A 3BPNC 3HZVB 4F8QA 2F53D 4K73A 4JFQB 5I16A 5D5ME 5L88H 4FTVE 4WI5A 3QRLA 1SXZA 1TYJA 1IE4A 5E8OA 1KEMH 1VB9A 1RQ5A 3INUH 4M8VA 1AOZA 2E7BA 5MEOB 4ZUWA 1PEWA 1SEBA 2RB8A 4HPYH 4KXBA 2WB7A 3O4LA 5CKGA 2A6JA 1AZCA 4IRSC 3NJJA 1TJXA 4I5BB 3MUY1 3TV3H 3LCYA 2P8PA 3CFDA 3WJMA 2AQSA 2PMZA 5DRWB 1RMFH 2FQEA 3GKZA 2VISA 3T6XA 2UZXB 3K72B 3CFCH 3PAYA 5D1XC 3S8GB 3VMPA 3DECA 3CLEH 1SBBA 1ZDSA 35C8L 4OTXH 2NY0C 1CYXA 1V55B 1JHLH 4JDVB 3TWCH 3BWAA 3ERXA 4W70A 2VC2B 4LL9A 4OV5A 3AROA 4L5FL 2Z1KA 5T1MB 4AQ8A 2YQ3A 1WBXA 5F0JB 3ZE0E 4UQ2B 5HYSA 4ZUTA 3L3IA 2NY7H 4LLUB 4LLQB 4ZW7A 4D8OA 3DBSA 4QT5A 3VD7A 3ZUNC 4AYFB 1A4BA 3IGUA 1J1OH 3FUKA 5HHQB 4NQDB 4PJAA 2BWQA 4XB3A 3RZWA 4Q8BA 4JHVA 4XBPA 2P9RA 3WN6A 1P6WA 1NPJA 3X2QB 3T1WA 4EZLA 5I9QB 4P2QA 5AQ0A 5C0JA 4YN3A 4MXVE 3VXSB 1AY1H 4YSUA 5IMOB 4JO2H 2I32A 3G6JA 4XN7A 5HGBA 4B9GA 5IMMA 4M4RA 1IC4H 2QGEA 2X12A 4N0YH 5I15H 3BGFC 3S0PA 4FLRA 3BAJA 5F1OB 1AD9A 1ZHLB 1FNGA 1RJCA 3AAZA 4RGMB 1N4XH 1VERA 3U83A 3QEHB 4ELMA 1MJJB 2R29L 2ZCHL 4JY6B 4MYPA 4J3WA 1JZ7A 1AHWA 2MNUA 2PLTA 3KD4A 1UH4A 3NEOA 4UQBA 2YJQA 5FW8A 4GY4A 1CGWA 2DDQH 2H47C 1INDL 3WIHA 4DKFL 4J3XA 4PM1A 3W5NA 2HG5A 1JF5A 6FABH 2ADJB 2E59A 2IGTA 1SJVA 4Y4KC 2BVPA 3MRLB 1LGVA 5DZPA 1TQVA 2OXHA 1S7QA 1IAII 2DKUA 3D07A 3TJEL 3ZU8A 4NQCB 5IROC 3I75B 4TSCH 2B1OA 3EKCA 5TGBB 4QY8B 4HIXH 1JV2B 1NSNL 2Y22A 2WQRA 4JY4A 2JKSA 3QDMA 1A9BA 1ITBB 3FQYA 4IRJB 4PB0H 4DTGH 2VN5A 1ZV2A 5E8EB 4F58L 2ZYSA 2EH7L 2OTPA 3IB4A 2YGOA 1OP4A 4M3HA 4RBPK 2Q1EA 4FMFA 4NM4L 1W8EA 4MAYD 4PJFB 4HUMB 4OZHB 3HBGA 4UT6H 3BLPX 5FO2A 4MFHA 5CZKA 3WAKA 1HXKA 3H9ZA 5JW4M 4C58B 2R83A 4FYRA 3HC3H 1WG3A 3NIDF 3TPUA 3PREA 3DX8A 4NM8H 1DYZA 4B6ZA 1MRDL 3RNQB 1XIWC 3IFNL 4FFYL 1MCRA 2DWYA 4NN6B 4AGNA 3HPJA 4RFNC 3MJ7B 2HJLB 5LNGA 1CU4L 1KCVL 3TVMA 2QQQA 1HJBC 4EVNA 3JWNC 2NX5A 4IOIA 4NB7A 1DVFD 2IXQB 5J1AA 3QRBA 4H8WL 3CDZB 1SN5A 2DMHA 2OSLB 2RIKA 3IN2A 5I5JA 4ERSH 2YMXH 2R56H 1E8WA 3P3YA 1WPCA 3MRKA 2BSTB 1AG0A 1IM9D 1HCZA 3CLFH 5JHLH 3LEYH 3K4DA 4LPXA 3DOHA 3GHBH 1XV8A 3H4FA 4ZNEE 3DX7A 1P1ZA 2D4FA 3O6FA 4L1SA 1FP5A 4KMTL 1I9JH 3H1ZA 4E9WA 4JN1H 4GRWH 3D4CA 3MKKA 3P0VL 4DZBA 4M6AA 4NP4L 5I5RA 1UZ6E 3NDYE 3DI2B 3RVXC 2X6VA 3CVHA 5EFIA 4H88H 2YJLA 4QRPA 2Q8BH 1AIZA 4G6JH 3V6ZB 1ZT1B 3ABKB 5DT1L 1JI1A 1JFHA 2V9RA 3ARDA 4NAJA 3C75A 4MA7H 2H6OA 1CL7L 3PIQA 5EORL 5JW4N 5IB5B 1KYDA 3SDDA 3G04A 5GS0H 4W9FC 4JPKH 2R0KH 2VLRE 2XHNA 1IFRA 1WAAF 3GI8L 4PLKC 1MCNA 4AC2A 2IG2L 3VXNB 2P5EE 3WIFA 5FCSH 1I1CA 4IGBA 1MREL 1ILSA 5KSUA 4BELD 2NZ1A 4EXPX 1CK0L 2LLGA 1SJHA 5A6IA 3KPOB 3NH7H 2RA1A 5T33L 3WE6A 4U1LB 4BM7A 4Y5YA 4F7CB 3CHXA 1AACA 2YRLA 4QLRA 2Y7LA 3L3KA 4X6DE 4TLTA 3NQKA 2OMZB 2JXMB 1CD0A 3GXUB 4TNWF 2V2WB 2X53A 1ZAGA 1G9MH 4P46C 4XAWH 3FQRB 3FF7A 4PRPA 5E6SB 5I6XC 1V5JA 1IEAA 5DC2A 3WXWH 4FULA 5LDSA 1HH9B 1XSIA 5HYJD 3NJVA 4MNQB 4HUUA 3UJIH 4KK5C 1L7IH 2Y36L 2Q76A 2RHEA 3L7EB 1KYUA 2LU3A 3MNMA 3O4OC 4NKQB 1GGBH 4DW2L 3GMMA 1PZ5B 2IV8A 4ZK8A 4OCNC 4G6KH 4G5ZH 4CSTA 1JV5A 5HY9A 1WD8A 1J1XL 3U9UA 3BH8B 1Z3RA 5I8CA 3OKOA 3SE8L 4K0OA 1NLBH 2UZIH 2NXYD 1I3GL 5DJXB 4ZW8A 3BMVA 3R7RA 3CXDL 4HJUA 4HWBA 3B1TA 3TYFA 4U1NB 1NCOA 1HFUA 3K2UH 1JWSB 4BGLA 1X7SA 1YEHH 1O7DE 3SGKA 2VQ1B 3L7FA 4DUWA 1QTYT 4WEEA 3VH8B 2HUEA 2P24B 1UM4L 2QFRA 1HHKA 1KLUA 5IF0B 5IOPA 1RZJH 4G6FD 1TETH 2L7JA 3T0BA 2G60L 1MQKL 4GH7B 1SJEB 5FWQA 3IFOA 2X4NA 2WQAA 4EDWL 5TQ2L 2FZ3A 1DQKA 3TEXA 2VL5A 1ZSDA 5FM4A 2YK1H 5FYJH 2H9GB 1U3HD 4F7PB 4K94L 4BRVA 1E5UI 4YSPA 2OLDA 2K78A 2W81C 4OD1H 4PP1C 4L0ZA 2YPKA 3LKQB 2CKBH 4MQ7A 4R4BB 1QI5A 5IG7B 2ZAIA 4FQIH 2QSTA 2Y7MA 3B5GA 3L5HA 5ITBH 3IGAA 2F61A 1I9IH 3ZT7A 5E08H 2YD0A 4KI1A 1YPZB 3T4AB 3QDJA 1YJDH 4ONGL 2Q86B 4JFXB 4QRRA 4LSQH 5D6DC 1CLVA 2PPFA 1BEYH 4HBCH 1MRFH 1QRNE 5E99L 4LVNB 2A4CA 1EEYA 3QCTH 1SY6L 3PJNA 2Y6SC 5ID1A 2MPVA 1WJ3A 4U6VH 4DP0X 2R0WH 1AHMA 1KXVA 3RZCA 5D70L 2P1YA 3FRUA 5TDOB 5DSCB 2Y5QA 3H53A 2GJRA 4YSRA 1OE1A 4YHPB 5TE4H 3ZT5A 4E5XG 4DEUA 3FOMB 4F80A 5B1BB 4Q4EA 2BNRE 3T8VA 4B96A 4Y1AD 2DL9A 4P04A 1QG3A 2VRKA 4GRMA 1E27A 4HW6A 3AITA 2C9SA 1JDDA 1CE6A 5FM8A 4OGAC 4OGXL 1QWUA 2YAHA 5GJTL 3WY3A 4O5LH 3W56A 2ITCB 3VD4A 2I5YL 1AD0A 4GS7B 4FL4C 4LPYA 2PR4L 4GIAA 1U8JB 5TF1L 2WCGA 5CZRA 3PQYD 4KI5D 5SX4H 4ZW3A 4NXKA 4PP2A 2WBWB 2UXGA 3FH8A 3ULUC 1IJNA 1G7LA 1LNUB 3FQWA 4FJ6A 4P0DA 2BNQB 4D3CL 4L18A 5D5MF 1X5HA 3RP1A 3V0WL 4R5TA 3SN6N 2WNWA 3VFMB 2XSKA 4PJBF 1UD4A 4X5WB 3MXWH 2HTKD 5CF3A 4ZMWA 4G1MA 4YHLH 3T65B 2BIMA 2HH0L 1R3IH 2A74B 4GKOA 1ASOA 4G8GB 5DLMH 1VCBC 4GT7A 5DK2B 1K4CB 4Y2DA 3QNYA 1FI8C 5DEGA 2NY4C 1MCHA 2A7BA 1UVQB 3OKDA 3QHFL 5E00A 5D2NA 2XTJC 3FUHA 4AENB 4AMKH 4M7LL 3EJUA 2ZD0A 1GMIA 3AWGA 5JXAL 4IU2B 3L1GA 3DVGA 4I1NB 3CFQA 3HB3B 4XXDB 3EH4B 3TN0A 4M7LT 3IGKA 4AV5A 1VFBA 2OM5A 4IBYA 3TT3H 4A7GA 2YUZA 2DWDA 5SWSE 2IBBA 4PJCB 3ILDA 3FTGB 3CGTA 3ZE0F 4AYDC 3CSPA 3HMXA 3D09A 3TBSB 1F4XL 2OR9H 4IKJA 2BO0A 4JHAH 5D7LE 4Z3HA 1JF6A 1I9RH 4JCWA 1FBIL 1NUDA 2HJKB 4E9TA 4KDWA 3LPGA 3PHAA 3VWJA 3POHA 4KJPD 4QGYA 2B4CH 4CILA 1JZFA 1RZIB 2GJ6D 3QYCA 4N2KA 2P49B 1UWGL 4RMBA 4U2YA 5E7FA 2VWEE 3ZGHA 2WXLA 5FKAB 1M7UA 2W0LA 3UCRA 1ILUA 1JGDA 1QRKA 4XZUB 2CRZA 1X5FA 3BDYH 3ILPB 3P73A 3LEVL 1C7SA 1NCCH 2K1MA 3IPBA 1P5UC 4XVOA 5FO8B 5KTEH 2HVBA 5I74B 1BZDA 4Z7UA 3FBQA 1OZTG 4ZFGH 5CP3A 5E1GA 4B3VA 4DKAA 1QO3B 1T83C 3FCBA 4J4PD 3SE3C 4V2CB 1QFUL 2VLLB 2C26A 3SDAB 4Q74A 3G5XA 3ZDYE 4FJYA 1U3YA 5JHBA 3VI4E 4P2AA 4X42A 4HWEL 2ZCLL 3P3SA 1XF4A 2FGWH 2FJSA 5DRNB 4ZMAT 4XMUA 4CN4A 3MU3A 1RJZA 4FNTA 1Q9LA 2W80C 2E46A 3HG1D 1MHEA 4YL9A 2NY2C 2MWCA 2OMVB 4JG1L 5IVOA 3VXRE 5BNXD 5JO5B 1QLFA 4K9EL 3QUYC 4RFOH 1ETB1 1Z0NA 3QEQB 5C08D 5EEUA 1A6ZA 2MH4A 2DYRB 3TIDB 1AZUA 2ZG2A 3MV9A 1HQRB 4GKZA 4XP6L 1F1AA 2MIZA 2J2ZA 1CD1A 3MSPA 3QQ9D 4ZD3L 4PJ7F 4KVNL 3T2NL 2FGZA 2D0GA 1W16A 1T1ZA 4BSJA 4JO3L 3FUMA 1LEIA 1CYGA 3ARBC 1KLFB 3B3BA 2QELA 1Q9WA 3N91A 4RMUA 5SX4I 5FGBC 2X2YA 1H6TA 4NNYB 4P2OB 3UGXA 3QVAA 1W0WA 3HC0B 5I19L 5A43C 2ATKB 4ZYKB 1BX2B 2DIBA 2NW3B 3E0GA 3QJQB 4O02H 3X13B 3ZMRA 3HLAB 3TEYA 4BXSV 4L9DA 5E6RB 4NCDA 5DD1L 4HIIA 2E76C 1K9TA 3AY4C 5CEYB 1Q9KB 3M45A 1DSFH 1URIA 4DP8X 2P43B 3QWNA 5C0IA 1TZAA 1YMHA 3GMPA 3UGEA 4M61B 2CO7B 4O58H 5D2LB 2GB2A 4M3KB 2ZXAA 2J4WH 4Y16C 2EKSB 4A2LA 3SGDH 1F1GA 5GGVH 3A4AA 3BQVA 2QQLL 4NUGH 4X9FA 5DVKA 5JA8B 1RPQA 5DD6B 4X6EB 1FH5L 3DVFA 4HEME 1Y1UA 4DP2X 25C8L 1BIIB 3QFDB 4PD4K 3QARA 2B9BA 4YNYA 2FX9L 3HC2A 3NABH 4YH6A 4KKAC 3UBFA 1MCWM 1LO3H 2OL3H 4NAQA 5CHNB 4GQQA 4PCKA 3W5MA 4TOYH 4IOSD 1G9NC 4S0SD 4IDJH 4YBLC 3NK3A 4JFEE 3MLXH 4PGBA 3K8MA 3L6FA 4ODXA 5DYOA 1UZ6F 4BWTA 2H32A 4ICXA 4M1CD 3B2UC 4AQ1A 1KCUL 4MLIA 4GRWB 3UJJH 1BJ1H 2E3VA 3K5SA 4I2XB 1M42A 4QI3A 3ZQXA 3VI3A 4E42B 1SN2A 15C8L 4WI8A 1FQ9C 4EI6B 1A6AA 3G5VA 2AJUH 2FBJL 2UUDH 3DVNA 5E24E 2G9KA 3X3FL 2L0DA 3N1QC 5F3FA 5KVEE 2XPZA 1L9TA 1KY7A 4UV7H 5D7IE 5DHEA 2BVOB 2ITDA 2P8LA 4RH4A 5D1QB 4KFZC 1YEIL 4WO4A 1UGKA 1DQMH 3QO1A 2G2RA 2NNAB 1SNRA 2V8MA 4PU2A 4YE0A 5HGDB 2FLBT 3VRJB 3RAJH 2XBTA 2EH8L 3BVTA 4E9LA 1GW6A 1K5NA 1X5GA 2OCFD 2NY3C 2ZCKL 4RDQF 3O45A 5AVUB 4EI5B 2BVEA 3K2IA 4E5XA 4X6DF 4I48A 2A6DA 4HZAA 4LLDB 3C8KB 3G6DH 1JFQH 4JNXA 3BSZA 4XAKD 1HESA 1OLLA 4OVUA 5HVHB 5I82A 5HD8C 4LEXH 4G8FB 2ZWLT 1TKWB 2LTQC 5D4HA 4PBDA 2OSXA 4OCXL 5F89B 3AY2A 3BAEL 2VLKA 1DQIA 1GRWA 2D0HA 1NMBL 2XX0A 5HHMD 7PCYA 5K5YA 1U95B 2XTLA 1UASA 1EGJL 3LH9A 4YXHH 3TH3T 3GUTB 5F71A 4HPOL 2B7DT 2PYFA 4OCMC 2EABA 4RFEB 3RU8L 4FS0A 1OCRB 1MCCA 5L7XH 1HILA 1GGIL 2GQHA 1KLGB 1SRDA 2DQEL 5EBWA 4JE0A 1MIEH 1MCQA 4KRLB 2HMIC 1AYRA 2C3GA 2WUCL 4DJMA 1KTRL 2UYLA 4EUPG 2B39A 2HVKA 1TU2A 2VDQL 3B9KB 4B41A 3VWKD 3X1BA 3ARGB 4ZFFA 1PLBA 4ZQKA 2Y72A 2VABA 1SUHA 4WJ5B 3N6YA 2DV6A 4G1EA 5K69A 4QO1A 1NBZB 2QBWA 4GW4A 2EZ0D 2PP7A 1GL4B 3HJEA 2IMMA 2I7SA 3QZWB 4RAVB 3U25A 1KN2H 3LKSA 5BZZA 3KNBA 4FG6D 3MGTA 3DJSA 1A8JH 4Y19D 5C7XL 3OAYH 3SGDI 1XEDA 4RX4D 1MDTA 3MLZL 5FYKH 1NGYA 1KGUA 3VE0A 4DCQB 1A22B 2CO2A 5I1IL 2MOGA 4LCWA 2YD3A 3KPSE 4PN6A 1V05A 1MI5E 1ZGLB 5TQ0H 1Q94A 4NKMB 3ZSSA 5F7HA 3VXOB 4FG0A 3Q5OA 3QXTA 2L7QA 1FE8L 1GGCL 3V5KB 3RURA 1N3NB 4XPAH 5IMLB 4NI3A 3KLAA 1OCWL 3ZY7A 3KPPB 2DJ4A 1ZS8A 1IAOB 4AV4A 3QIUC 3JZ7A 2DMKA 5C9KA 1S7SB 3P0YL 5EC1B 3WTTA 1RZQA 4J3BA 4RGOH 1JXKA 4S1RL 1JJUA 3N5AA 3SOBL 4OLWL 2NY5C 3K46A 3C5JB 3IM1A 1P9MA 1MOEA 2IAAC 4NFBA 4R7NB 3VFNA 5ERWA 4LLYA 4WCYH 4G7QB 3QULB 1OL0A 1E8YA 2NY1C 1UB5A 3B5HA 3IRZA 4NUJA 4PREA 5KYYB 5JIHA 1UM5H 5E9DE 1DEEB 5GGTA 3SO3C 1XF1A 2PYEE 2HT3C 4XCEB 3FK3A 3S37X 3MUUA 3RY5A 1BQLL 3SPGA 4EDXB 5IR1B 4G9DB 3T8XB 4IYKA 1YQ2A 5FFLA 4DT2A 3TJHD 1XGQA 3CXHK 1OP9A 1LO5A 2I27N 2VAJA 2H0JA 1S2EA 5B8CC 3BWZA 2BC4A 2DQCH 2X9YA 2DEYX 3JXAA 4JPWH 5EA0H 4J3TA 1NL0H 1BA9A 3TZVD 2KLRA 3HZVA 1I82A 3FMGL 2JKJA 1KPUB 4JFQA 5H37G 3B4NA 1KV3A 1NGQH 3HCVB 1AR1B 3SQRA 5MEOA 1NCHA 1B4RA 4NJ9L 1YYML 1GSKA 4PV8B 5DS2A 2FH6A 3EJYD 4I5BA 5C0CE 4X7DC 4XN9A 1W72H 3VH8G 3T0EE 5DRWA 3ATAA 3REWB 3UX9B 1NCAL 2UZXA 3K72A 5BPPA 3HUJB 3SYAA 4YHNB 4FQ2H 3SJVB 3EJJX 4NO0B 5JHMA 4JDVA 1J0IA 4PVLA 3AGVA 4OCRH 4DP9X 5I0WA 4U1MB 2E6QA 2MSPA 4BFJA 5T1MA 2ZICA 2Y3AA 3QR1A 1GYWA 4UQ2A 4ELDA 4RAHA 5KVGH 1YG9A 4LLUA 1GZHA 1NOAA 4WEMB 1B0GB 1I8KB 4LLQA 4WU5B 5EU6E 3L13A 4XNZC 3WFDL 3Q6FB 1UKSA 5INCB 3QUZD 4GMSH 1PKOA 5E51A 4AYFA 5AVYB 2MOVA 4BUHA 4Z8FL 1PU0A 2VR8A 4DPAX 4XWOC 2WWMD 3HVNA 5HHQA 3V4PL 3NAAH 4NQDA 6PAZA 5EF3A 2Z3FA 1NCBH 1IILE 3BISA 3QC5X 1FO0H 1HYRC 2QPUA 1VPOH 1NCDL 5DRZB 3RNKB 3HE6D 1UYWH 2QMJA 1IKNA 3VXSA 4X4ZA 3CQQA 5IMOA 3UDWC 4CKVX 4UZGA 4ACPA 2AI0L 2NUTB 2ICCA 1SOKA 2BHZA 2VDLL 2CBMA 1RHFA 1ZLEA 2VSMB 3EUUA 3LY6A 1CYWA 1W6LA 2ICWI 1IX2A 1XSKA 1ZHLA 4HG4J 1IGMH 4QTHB 4HCRL 5FHBH 3SKOB 1UOKA 3T6VA 2VUYA 3QEHA 4MKTA 2LV4A 3FULA 4KQ4L 1MJJA 4JY6A 4N0CD 2IF7A 3L9EA 4KVCL 4E41E 4HAFA 3LPWA 2EDYA 1UCBL 4XNQB 1ZE3C 5MP6H 4DGVH 3PJLA 4JKPH 3PXLA 3VI4F 1H3GA 5EEXA 2L4OA 3TLRA 1WH0A 4FGMA 3OHXC 3RI5K 5DS1A 1E65A 3DHUA 3I2CL 4WWOA 5LBSA 1IC5L 2R0ZL 4Q89A 4Y7MA 2ESVB 3MYZA 3GXMA 4OJFH 3O0RL 2DKMA 3FU8A 5EO1B 1P84K 1TXKA 3DC0A 4DEPB 5KSAC 3VD1A 3HNTH 4MZRA 1KXQE 2ADJA 1A7NL 5T1LB 3MRLA 1Z5LB 2FQDA 4U33A 3SBWC 1Z2KA 4N22A 4MYWB 4NQCA 3I75A 4KKRA 3QQ4B 3BFQG 4FNPA 5TGBA 4G80B 2X89D 1X7QB 4QY8A 4TQEH 4JO1H 1JV2A 4KRPB 4WZ9A 1C5BL 4FRWA 4PJ9D 1MCPH 4IRJA 4L5FE 2Q6WB 5E8EA 4XMTA 5FEBA 4TL4A 2HFGH 4EPSA 1KIRB 3EW3B 5EF1A 3LN9A 3J7HA 1S5IL 3RVUC 1OCOB 3SPJA 5IJKC 1F3DJ 2PN5A 2ADGB 3KPRE 1BVLB 4OZHA 4PJFA 3RDTC 4AVIA 4F37K 1F1DA 2WQVA 2ORBH 3O2VL 2AXHA 5DJAB 2DOCA 4GAFB 5D72L 4FNUA 4O02B 3UIZA 2XIDA 4XOEA 4YSAA 3RNQA 2RCSL 3I9IA 2GHWB 4LMQE 4X80L 3C09C 4KTGA 1L0PA 2ZUVA 2HJLA 3MJ7A 1UXSB 2D7MA 4H40A 3RGHA 4M48L 2JJTC 3RHWK 5J3HC 2IXQA 3OGCB 3CDZA 5GIRB 2OSLA 4JFZL 2EVIA 3LB6C 3GJFK 3LNDA 2BSTA 5CZXC 1WS8A 2YAEA 4OI7A 4NBXB 5BRZD 4ZZKA 5I8OL 1OF2B 5F0LB 2W5PA 1TQWA 1LE9B 2VXQH 2YQGA 2PWFA 2NNRA 3K6FA 3KXFB 4LCUB 4LQ1A 5GRZA 3T77B 3H6AA 1A6UH 1UHVA 4ISVB 5CUSL 1A1OB 3Q1SL 5KANG 1EZSA 1ORQB 4Y4HB 3V6ZA 1Y1DA 1ZT1A 4X4ME 5F6IB 3UTTB 5HHXL 5B1AB 3D39E 1MCEA 4FFZL 2UXVA 5IB5A 3E8UL 4TRPL 2A9NH 4MLSA 3L4VA 5IUSA 1LMIA 5DFVC 4YK4B 1SF3A 4DK3A 4UTAA 3STLB 3VXNA 5D7IF 1RIUH 4XHJC 1SDDB 5DLLA 3T4YB 3U30C 1NAMH 3LNFA 1PY0A 4UINH 4L3EE 4Q58C 2J71A 4RMTA 3KPOA 5F72S 2J1XA 1TTFA 5GGQH 4U1LA 4XN1A 3AREC 1F2XK 4F7CA 2BZDA 1T0MB 1NEZB 4OLUH 4R83A 3K6IA 2OMZA 1S3RA 2JXMA 2FQGA 2OZ4H 5AW1B 2V2WA 3N9GL 5KWYC 1KY6A 3FQRA 1MPAL 4NFCA 3HC4H 3DSNB 3II3A 1VFUA 2CG9X 5DWUH 5LG1A 1HH9A 4OZIE 3T3PE 4J7RA 5T3ZE 5FPIA 1UH3A 4MA3B 1R5IB 4PMFA 1JVLA 4MNQA 5KVDL 5IBTL 4KKNA 1KGXA 3L7EA 3F7KA 3BE1H 4TSBH 1BAFH 2DLIA 1AR2A 1PZ5A 1TTAA 3IF1B 4M1DL 4WSKA 1J8HD 1FLTX 1E7VA 3CN3A 3ZLQC 1E30A 1MWAB 3C60D 3OM3B 4YSSA 3X1EA 4IKLA 3BH8A 1GHFH 3FB8B 1G7QB 2CK0H 5H37A 5DJXA 4GP4B 4WF7A 5BOZG 3HNSL 4CMHC 2RR3A 4BZ2H 1U8PA 2F1AA 4U1NA 3MRFB 3MODL 4KO6A 4IKIA 1SM3L 1JWSA 5D1ZB 2J1KA 4KHXL 3BQUD 4JFHD 1E5ZA 3KBPA 2VQ1A 1EH9A 3VH8A 2VSDA 4XO3A 2P24A 2J1ZA 4NGHL 4MXWL 4OFYA 3EUDA 2CHXA 3VSUA 1G7HB 3QDGD 5IF0A 1E40A 4FQPA 4Y2LA 1ZLSL 1WA0X 5I8EB 2PABA 1SJEA 3GLDA 3RWHB 2WMPB 4F24A 3JT2A 1BYNA 3ARZA 1X5MA 2Y4SA 2DYPD 4LPUA 5AKSA 4APQC 2UY7B 1QFHA 4J6RH 3NIDB 2VRAA 4JDEB 2H9GA 1V3LA 3BT2L 4F7PA 4JM2C 3SY6A 2V37A 4R4BA 2CJ3A 3LKQA 2YD7A 4M93B 2XN9B 3FCSB 5IG7A 3VTTA 1CGVA 4L3CB 4EN2A 1G7PB 3TU6A 1GYVA 2WPGA 3Q06A 4PS3A 2Z35B 4UTBL 3RWIB 1YPZA 3T4AA 4HZLB 1F8TL 2Q86A 1RP9A 1M56B 4JFXA 2ICWB 3K1KC 2L3BA 1WT5C 2VDMB 4OD3L 2A0LC 5EEZA 1H9VA 1N7MH 4QXUL 5BZWB 2N0KA 4GG6B 4H0HB 4MX7B 2E74C 4LVOC 1DLFL 2OULB 1ZEAH 3MLRH 5D96C 2Y25A 1X5JA 4YE4L 3Q44A 3S34L 4Y1TA 3C6LC 2GEQA 4P5KB 4P59H 2WKGA 5TDOA 5DSCA 4YHPA 1QBML 5IFHL 5AWNL 2Y0SA 3IEAA 3FOMA 4JZJC 2VTFA 2LU7A 3MREB 3AQZA 2GK0B 4Y4FC 1TF4A 5HHVH 1IGIL 4V1DE 4FD0A 4ZMOA 1HYSD 4HHGA 1ADQA 1FPTL 4LPVA 3VGEA 2EEFA 4LSUH 5MHSE 2HWZH 2W38A 3APMA 3ARQA 2XWZA 3IVKB 2ITCA 4P5TD 5LCVA 2XXMB 3QI9C 1AZRA 4MJ6B 1U8JA 1AMYA 1WK0A 2WHVA 3D08A 4NUQA 3PNWB 4YR6B 3ZQWA 4HF5L 5AW5B 5L0QC 4K3HA 3EZ8A 1DBJH 1SLVA 4GRLC 3K2KA 1LNUA 2P48B 1PFOA 4FQJH 4M7KH 3QFGA 2BNQA 3LZNA 5AALA 1ACZA 4HJJH 1SEQL 1GPOH 1WAPA 3STBA 1X5ZA 4GBXB 4JJ5B 4OCSL 3VFMA 2H2PC 2XXGA 5FWRA 4HXBH 2AC0A 3GXFA 4TM9A 1L9RA 1NANH 4X5WA 4ZZFA 1IO4C 4JDTL 5ISZD 3T65A 3GF8A 4L8SB 4D9QE 2A74A 4JVUA 3VG0H 4G8GA 4WHYH 1T2QH 2OP4L 3FH7A 3FUDA 3Q3GB 4JJHA 5DK2A 1K4CA 2DN7A 1UVQA 4I18B 2EO9A 1W72B 2FIRT 4AENA 3L4WA 1SXNA 4M5ZL 3UTTD 2QSCL 4IU2A 2UVEA 4XXDA 4UB0L 2ATPB 2CJUL 1N6QL 5EO9B 1AIFB 1SMAA 3NJLA 4F33B 1XGTB 4KK9C 5DHMC 1CLOH 1KPRB 3FSVA 1U8HB 1R17A 3DV4B 3ESOA 4FQXB 1IZJA 1RZ7L 3JUYA 4PJCA 2O5XL 4LT7A 3FTGA 3H9YA 3CFMA 1NFIB 1XZ0B 1CICB 2QKIB 4LCYB 4NAMA 3TBSA 2ATAA 5DJCB 1CBJA 2AGJL 2GVYA 4MAUL 3BVNB 3VXUB 5E9AA 2RH0A 3KBEA 3SSGA 1JPFB 1ZANH 2HJKA 1XD1A 5E95B 3V4UH 1KJ2H 2D7QA 5BW7A 2NYKA 5HVFB 5EU4B 4E9QA 1G6VK 1RZIA 4TNVK 3ZTNH 1ZV9A 5FKAA 1R1CA 4XZUA 2DH2A 1FO0B 2F74B 4YC2C 3GRWH 3ILPA 4AT6B 5AOZA 2ZUWA 1GGYA 3QBTB 1QEWB 1CR9L 4Y8DC 1BXUA 4HGMA 5FO8A 1NCJA 4DGYH 2WW8A 2WSKA 2KLSA 3SZKC 4BJLA 2ENPA 2MTAA 3QZPA 3TO4C 2KQNA 5CJ8A 3NACH 4Q7DA 5EOCJ 1QO3A 2G2PA 5FHAH 2PUQT 2APBA 3S4SB 3M17B 1JNLH 2VLLA 3NYKA 3SDAA 3BLBA 4G83A 3EOTL 5J12C 2DQUL 1B2YA 3QG7L 2VE6B 3WXVH 3DJTA 4YXLH 5DRNA 4Y8AA 2J1WA 3L9RB 2H3NB 3EDDA 3W2DH 5TE7H 5FB8A 3QCUL 5HHPB 2OMVA 3VGBA 3D85D 1A3QA 5JO5A 2E7LA 4A7QA 4P4KC 1JTTA 1YEJL 3QEQA 4AITA 4C54A 1XHHA 2J7LA 2OA9A 1E6OL 1HWGB 3QPXH 4PGCB 1NC2B 3TIDA 3TCLB 4Q4IA 3AADB 4UIKL 2DM7A 1HQRA 2MCAA 4RRPG 1PZ2A 4OZFG 3GKWL 4K5MA 1DJHA 2VDNH 3L45A 1Z0MA 4WI9A 4WFGD 5F6IC 1S7TB 4HH8A 2FQFA 2GJJA 1FGVH 1NH6A 4PWIA 3KW8A 4KK8C 2H3KA 1KLFA 1PSKL 2KZWA 2Y7OA 2FR4B 1PVHA 5DZ9A 3HEIB 4NQTA 1HL5A 4OFKA 4P2OA 4NNYA 5FYKD 4TLUA 1FLRH 3HC0A 1NDMB 2ATKA 3X13A 1BX2A 4ZYKA 2NW3A 4Y88A 1E42A 3HLAA 3ZKMC 2EXTA 4UT7H 5A2CA 4NERA 4JQXC 4UT6A 5CEYA 3ZO0A 5BJTB 1Q9KA 3GDCA 2YO3A 1NANI 3LKPB 3WV0A 5D5MB 4M61A 2CO7A 1D9KD 3U1PA 5D2LA 4FTVB 1CD9B 2IANE 1FZKB 3Q8BA 5E1HB 1LL1A 2DQJL 2EKSA 4PJBB 5B22A 4M03A 4JS7A 5DD6A 2ZP8A 1TEYA 4X6EA 1C7TA 1VACB 5CJOH 4YHIB 1TPXB 3MR9B 1BIIA 3QFDA 3FN9A 4I1PA 4H0LC 4W9EC 4XC3H 5E2JA 4LARL 3V2AR 2GBAA 1I1AB 4ZUUB 2GG1A 1LM8V 5ANME 4PLOB 3WFBH 4GSDH 5DF0A 1EFXB 1RSYA 5CHNA 3HTLX 1R0AH 2CLRB 2QDVA 4ZS7L 4J8RB 5IQ7L 2XWDA 5AAMA 4AV0A 5CAYB 3LHAA 3FQUB 3VJ6B 2COVD 3FQNB 3ML8A 3ZE0B 3IMVA 4QXVA 2BP0B 5C0RL 3MJGX 5DMIH 3FDWA 4