3WI9A

Crystal structure of copper nitrite reductase from geobacillus kaustophilus
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
303
Chain Sequence
b'TQQSAANMLAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural and functional characterization of the Geobacillus copper nitrite reductase: involvement of the unique N-terminal region in the interprotein electron transfer with its redox partner
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Oxidoreductase
total genus 94
structure length 303
sequence length 303
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wi9A00
4DP0X 3NJNA 3IEAA 1NPNA 1J5DA 2EILB 2CJ3A 2W88A 3TBBA 7PCYA 2ZONA 2UX7A 2WSDA 2GHZA 3X1EA 2IH9A 1J9SA 3FU9A 1V55B 4BK5C 3ASOB 1A8ZA 3T6VA 1KDJA 4P5RA 2DWTA 1PF3A 1EZLA 3FSVA 1A3ZA 2JXMA 3FU7B 3HEIB 1HAUA 3OM3B 4K9JA 1OOWA 1IUZA 3QJSB 4BWWA 3NJKA 1GYCA 2XXGA 2CALA 3NJHA 4KO5A 3IN0A 4YSEA 2PPDA 1PLBA 1ASOA 1SFDA 1GS6X 2XLLA 3CG8A 1BYOA 2CCWA 5A7EA 3N2JA 2BW4A 2YXWA 4G7RB 3AG2B 2HRHA 4KOCA 3T6WA 2VMJA 4BXSV 3H56A 1WS7A 3PCYA 1GY2A 1RZQA 2XU9A 1SDDA 4JHUA 1BYPA 4HALA 3T6ZA 1L9SA 4KNTA 3QJTB 1X9RA 2BHFA 1AS6A 1KYAA 2R7EA 3UGEA 3DIVA 2Y69B 4W1TA 1ZIAA 2XWZA 4M3HA 2GC4C 1IKOP 2UX6A 1OV8A 2IDFA 3GXUB 2OCCB 2HLEB 2XX0A 3QJQB 2TSAA 2JFCA 4ZK8A 2ZWNA 2AVFA 5B1BB 1L9QA 2IAAC 4Q89A 1XB8A 1J9QA 1M9WA 3MBWB 1SHWA 2RACA 1AG6A 3NJGA 1BAWA 1QHQA 3TU6A 6PAZA 3S3CB 2OJ1A 4E9WA 3ERXA 2FWLB 4AI7A 1NICA 3FT0A 1TEGA 3NSYA 2GBAA 3EH5B 3FQ1A 5B1JA 3FSWA 3EF4A 4BWUA 1I53A 1JOIA 2MRYA 1AZRA 2EIKB 2VM3A 5AZUA 3KW8A 2HRGA 3ABGA 5I5IA 1NIBA 2WO2B 1TKWA 1TEFA 1GR7A 3AG3B 2FQGA 3SBRA 1N68A 1L9TA 1J9TA 1NZRA 1KGYE 1RCYA 1FFTB 2UXFA 1KCWA 1NIFA 2GB2A 2H5UA 3C75A 3CVBA 5EHFA 1NWOA 1YLBB 5FC9A 3S8GB 3T71A 3PLYA 3MX0B 1AZUA 1NINA 2B08A 1OE2A 2YAMA 2P80A 4WTQA 4AKOA 3NJLA 2Y1AA 3NP3A 1PNCA 1V54B 2X88A 2BWDA 4GP5B 2E86A 3L45A 4HCGA 3FSZA 1PLCA 1QLEB 2YXVA 3PPSA 1ZDSA 1PAZA 3QJVB 4X4KA 4F7KA 1FWXA 3UAEA 2AANA 4HCFA 4E9SA 4Q8BA 1BXAA 1AACA 3TBCA 3GDCA 8PAZA 4AX3A 1JXDA 1T5KA 3PAZA 1KBWA 1OE3A 4UF7C 2IDSA 3ASNB 3BQVA 4MFHA 1PY0A 3S3DB 1JZHA 2BWIA 3ABLB 3NSFA 2PPEA 5B7FA 1SDDB 1J5CA 1AS7A 3NT0A 2IDQA 2WO3B 1JZEA 1RZPA 3SBPA 1ETJA 2VN3A 2YARA 2R7EB 4P5SA 2GC7C 1E67A 4YSPA 1VLXA 4YVUA 4G70B 4KNSA 2ZXWB 5B3SB 2QPDB 3NJIA 3NSCA 4E9QA 1OE1A 5I5MA 4DP5X 1L9PA 2DYSB 1MZYA 4AZUA 1OF0A 2YAPA 4YSTA 2NRDA 2BZ7A 4G7SB 5I6OA 3QQXA 3QJUB 3SBQA 2QT6A 1NIDA 3OQRA 2IDUA 2XV3A 2XV0A 1B3IA 2UXVA 2GSMB 1AS8A 2IH8A 3NJMA 1URIA 1E30A 1JZFA 3BVDB 4KO6A 1HFUA 4YSOA 1WA1X 1W6WA 5I6NA 1ZV2A 1MZZA 2I7SA 3AY2A 3PXLA 4FA7B 2IDTA 6PCYA 1J9RA 4A66A 1GSKA 1MG3C 1TU2A 2MTAA 5D4IA 2YAHA 2PPAA 5ANHA 1NWPA 1GW0A 3X1NA 1WA2X 4QKTA 4FAAB 1M56B 4JKNA 3UAAA 1E5YA 4A2FA 1PMYA 1JZGA 4G71B 4PAZA 3CVDA 2XV2A 3NSDA 3X2QB 5E9NA 1JERA 4BWTA 2LLNA 2I85A 3FQYA 1AOZA 1NTDA 4WKXA 4W9ZA 2YQBA 4UANA 3IE9A 5B1AB 3UABA 1ET7A 3EH4B 1A4AA 3UACA 3WKPA 2PLTA 4RH4A 1BQ5A 5D4JA 1CYWA 4DP1X 4E9XA 2PCYA 4E9RA 4YSQA 5F7AA 1ILUA 3OMNB 2HX7A 2PP7A 4NAJA 3X1BA 2DYRB 3T9WA 3V9EA 3S3BB 2P80D 1SJMA 2XYBA 2I7OA 2HX8A 2CBPA 1A4CA 5TK4A 4A2DA 1CUOA 3FPYA 3FPXA 4BDVA 5IY5B 1ILSA 1NIEA 1ZPUA 2FQDA 4ENZA 4A2GA 2PPCA 4YSCA 5TK2A 1V10A 3OMAB 1KDIA 2YAOA 1A65A 4AKQA 1JVLA 3PAVA 2Q5BA 5PCYA 2BP8A 4YSRA 4E9VA 5LDUA 4DP2X 3IN2A 1OCOB 4CSPA 1SFHA 1SNRA 2XX1A 1X9UA 5B1KA 1CC3A 5I28A 1OCZB 2J56A 1DZ0A 1N70A 2X87A 3CDZB 2IWKA 4E9YA 4GXFA 3WNJA 4DP8X 1EHKB 4G72B 5AFAA 4HCIA 1E65A 1AG0A 1ASPA 5D4HA 1WA0X 1KV7A 4A2EA 2J55A 3ABKB 4GP8B 3JTBA 2FQEA 2FT7A 4DP4X 2W8CA 1UATA 1KBVA 1JVOA 4UAHA 1IBZA 2QPEB 1RKRA 2XVBA 3EH3B 9PCYA 3FSAA 2B3IA 1PCSA 1L9OA 1KCBA 2BP0A 2EIMB 3G5WA 3OMIB 3WG7B 2PP9A 3NP4A 4HZ1A 1PZBA 1SF3A 4L0PB 2EINB 4HIPA 4N8UA 1BXVA 4YSDA 1SHXA 1NDTA 3CDZA 2J57A 3H4FA 3ZDWA 3ZIYA 3KW7A 1AR1B 2IWEA 1ET8A 2ZOOA 1AZNA 1CYXA 4YSAA 2QDVA 1AZCA 4DP7X 2DV6A 4GP4B 1ASQA 2VW4A 1PLAA 4E9TA 1M57B 1JZIA 1ADWA 1OCRB 2HXAA 3TASA 3OD3A 1XB6A 3V9CA 2CUAA 2UXGA 1PNDA 2H3XC 2EIJB 3IBOA 2PPFA 4AKPA 1ZIBA 2VSKB 5F7BA 2BW5A 2FJSA 4M4RB 2AZUA 3H4HA 2BZCA 3JT2A 5AKRA 2GI0A 4BXVA 2BO0A 3FS9A 4NB7A 3WI9A 3EHBB 4YL4A 1A4BA 2FT6A 1BQRA 2H47C 4G7QB 1ET5A 4BDVB 7PAZA 2IWFA 2CAKA 5I6PA 2FTAA 5I6MA 3SQRA 4A2HA 4HHWA 2BP8B 1JXFA 4KNUA 5B7MA 4F2FA 3HB3B 3FU7A 2N0MA 3ZBMA 1E5ZA 2HZHA 1GS8A 1F56A 2DWSA 3DTUB 4A67A 2FQFA 4HHGA 4PCYA 3ABMB 3NYKA 5B7EA 2XUWA 4YSUA 1QNIA 1IBYA 4KO7A 3QPKA 3AW5A 4DPBX 3N55A 1XMEB 3AG4B 4GY4A 1GY1A 2AFNA 2YAQA 3FYIB 3DKHA 4JHVA 4DPCX 3RYMA 2XXFA 2GIMA 3ZX1A 1XB3A 2DY2A 2AZAA 3QJRB 2J5WA 1AQ8A 1AZBA 2VW7A 1ID2A 2VSMB 5I26A 1R1CA 3CVCA 1DYZA 1PZAA 2BP0B 2VW6A 1MG2C 4EF3A 3FU8A 2YAFA 2TSBA 4QLWA 5B1JC 3PAUA 1BXUA 2FNWA 4KO9A 1BQKA 3FQ2A 4NERA 4KOBA 4A68A 1GS7A 4F2EA 2QDWA 1AAJA 1FA4A 5PAZA 1JZJA 4TXVB 4DP6X 4YVNA 2PP8A 3NJFA 1AIZA 3AZUA 1PZCA 3AG1B 3WNIA 4YSSA 3WKQA 4DPAX 3GYRA 3S8FB 2HX9A 1HAWA 1BEXA 3NJJA 2YAEA 1WS8A 5I6KA 4GYBA 1CURA 1WAEA 1W8EA 3TA4D 1MDAA 3UADA 4HAKA 1OCCB 1L9RA 2Q9OA 2UXTA 3T6XA 2FT8A 2OV0A 2JKWA 3X1FA 1JXGA 1SF5A 3CZUB 5I5JA 1NPJA 4DP9X 1AANA 5I6LA 2PCFA 3D12B 1IC0A 1W6LA 3U25A 3WIAA 1ZDQA 2VM4A 3FYEB 3X1GA 4CSZA 2A3TA 1NIAA 4N4YB
chains in the Genus database with same CATH superfamily
4PV9A 5D7IE 5GJTL 1OZUA 1NL0H 1NDGA 2YFNA 3D2UB 4NQVB 1QR1A 4WO4A 4TPRH 3ATEA 1HS6A 4RFEB 3LXBA 3P4MA 1KN4L 4P23D 4FFVD 4F37K 1CFQA 1IGFL 4M7LH 3D25A 5EC1A 3IU3A 5FKAB 1AIFA 4X99A 4W9EC 5F0LB 4HS6A 1BZ9B 2PYFA 4OIIH 5EB9A 4QXGL 2HN7B 3BRFA 3UEZA 5GZOA 2BRRL 3PWPE 3LKQA 4UTAL 4R83A 2WXNA 4IRJC 1KN2L 1GYCA 3NZ8B 4JFTA 1KB9J 3T8MA 3T1WA 1W2KT 3AXHA 1CIDA 4WFGD 1OKEA 5HHME 5HPMB 2WINB 1I1YA 1FH2A 1KULA 1OLLA 4JPSA 2YXWA 3EJTA 4MS8D 4LVEA 3NIFF 4GSRA 5F1IB 3ZZLA 1JGLL 1UWYA 1X7QB 3BW9A 4ELKA 3QAZB 5IBUG 1RP9A 1ZVSA 5AB1A 4D8PB 1GC1L 3DX0A 2YBRB 3O4LB 3P2TA 4TMPA 3O2VH 2WXIA 4Y1SA 5SV4A 5DZ9A 3L3IA 2WUCL 3D3VD 3QULA 4Y2DA 4KFZC 2WN3A 1OAYH 1FCGA 3FQUB 2H32H 3UGEA 2K6ZA 1GYVA 3L3DB 1G6RH 1JF6A 1E9QB 3QEQA 1QSVA 5FGRA 1JYNA 1LP9E 4JHWL 2QQLL 3CD4A 4NPKA 3TEWA 3GBMH 2TSAA 5DVOA 5F9DC 3LD8C 3MU3A 2K78A 1YUKB 2C7FA 2IAAC 1FYTB 2WWOA 4GUPA 4KH9A 1GPOH 4Q89A 4UTBA 4HKJB 5CLZA 3WTUA 3BKYL 4MD0B 3VD9A 1AG6A 1JVKA 1UWXK 3NJGA 4OLWH 1L7IH 3MREA 3TU6A 4KJQC 3CHPA 3NEXA 1N2RA 3S7GA 3SDAB 1F4YH 1OQXA 1A7PL 2QV4A 4PRAA 3NSYA 4WW2F 5E08L 3MUY1 1EUTA 2D7TL 4LSUL 4C83A 3T65A 5MI0B 5GS2D 2XKNA 2DBLH 5EEXA 1ZT7B 2IEPA 2HG0A 1UENA 3OKMA 3R06A 1BF8A 4Y4FB 1KZQA 2HRGA 4ZFOA 3ZE1E 5DO2D 2ZKHL 1ERNA 2ZTBA 3PDOB 4N2CA 4QRPB 4XC1L 1TVDA 4Y9GA 2NY0D 2VR3A 4HMEA 4F37F 1MAJA 4FULA 4LCCB 4FKHA 3GSRB 4B27A 3K91A 5IQ9A 3SBWC 5AYUH 3L1GA 3WKMH 2YK1H 4LCVA 1NINA 4HJ0D 4G8FB 5IB2A 3FAWA 5F7YC 1CO1A 3CU1A 2VQ4A 3D4CA 1GYUA 3MLYH 3DMMA 4LHUB 2IWGA 3WFEL 3QHTC 2X1XR 3T1FA 1D5XA 3QRFM 3F7QA 4PW4A 3PNRB 3RE0A 4YWGL 3FSZA 4KKLC 3VI3B 2NNRA 3Q05A 4NWUH 4LE8A 3P4NB 5TDOB 3EYOA 2ENJA 5KYUB 2Q20A 1X5KA 2QKSA 2JJTA 3QDGA 3JWDH 2E59A 3LKSB 4C47A 2ZAGA 1P0SE 5J13C 1FRGH 1RJZA 1TZOA 2DDQH 4KPHH 4U31A 1BWMA 4QWWC 2NOYA 4EJ1C 1QHOA 2D7PA 3BQVA 2VR4A 2VDQB 1LO4L 4QHLB 4W9FC 1YECH 3LHAA 3OLGA 1AS7A 1U3ZA 4UV7L 4MTMA 1J0YA 1G0XA 4Y4HD 3PS6A 3J2PA 5GGVH 4RGMB 3QZWB 5KUKA 2X41A 2Q86A 2WLKA 4NYLA 2CNZA 1VKXB 4X7CC 4LLWB 3KPRB 3QUZB 2ZXWB 3QQ3A 4U6XA 1SN2A 4O5LL 4XNQB 4DERA 3ZSTA 2NX5B 3HN3A 4P2OC 2F5BH 3WJJA 4NC2B 2Z0BA 4NDMB 2R0LL 5JHBA 3QNYA 2YPVA 4LKXB 4RA0C 3II1A 4UDTB 1ESOA 2WNXA 2CBQA 4L4TE 3RWDA 3V6FB 3FN3A 3GM0A 1I3UA 3OF6D 4KO6A 4ENED 3LEVH 3QG7L 3UH8A 1JPTL 2R1XA 3WFHB 4QT5B 2I7SA 2NW2B 3BT2H 4TNEA 4R9HA 4NI3A 3IE4A 4ZD3L 2EE2A 3PL6B 4MWFA 4WI6A 5DS2A 3MRIB 3VWKA 3DOSA 3IKCA 3PDGA 3U82B 4OGAD 1TKWB 3WEAA 1HXYB 5D71L 4XNXH 2Z7YA 3I3DA 4NQQA 4HH9B 3ARGC 3OXRA 2G5BA 2O5YH 1NUNB 3CVDA 4JB9L 1U4FA 1XO8A 2PW1B 1WWWX 2ARWA 4J1UA 1MWAA 3FFCA 1H3VA 1HILB 3CH1A 5EZOL 4W9ZA 3DSNB 3GRGA 4Z5RA 3BUPA 3FCUB 4Z3IA 3DJTA 2P3YA 5J1AA 3TV8A 3NIDB 3WN6A 1YMMB 3L7FB 4ECNA 2BZDA 2FNBA 1CYWA 1IE4A 3UTSB 2KUTA 2XNAA 1S7SB 5FV1L 4EN3B 2ORBL 4HLEA 4CAGA 3O4OB 3B2XA 5I66B 2XI9A 3QNZA 3U0WL 4N2FA 4G6ML 4OCSL 4GLRI 2CLRA 4AIZA 5ABZA 4HMDA 1FJ1A 2ED9A 2A9AA 1ZLEA 4G2AA 3OWRA 5KSBE 5EBGA 4J6RL 3QUXA 1WE5A 1KGCE 5J3HC 4W4OC 1UM4H 5ADOH 5LN8A 3UTZA 4XPHH 3OG6B 3GPSA 5CLXA 4FHJA 4YUEL 3CSYA 3MRHA 2FEDC 5GZNC 1LP9B 2VCOA 3ZTNL 4O51B 1WGOA 3L4WA 1S3KH 3UP6A 4IGBC 2FAUA 3TT3H 3HRZB 4ODHH 3UBFA 5FO7A 2MNJB 3RJOA 3WUZA 1N70A 1CDIA 2X87A 1WF5A 1T6VN 5CCJA 1U3HC 3LPFA 3GSNA 4A39A 2CHWA 4MXQC 4OY9A 3QWQB 5JHLA 1TJGH 1JHTB 1WA0X 4IKLA 3LRKA 1E8ZA 2J55A 5DD5L 1NCDL 1A6AB 5E4AA 3DECA 4P46A 4Y1AD 3EFOA 5L7XL 1UATA 3HNTH 2PN5A 3RWHA 5JIHA 5JDJA 1YAIA 3VXNA 3IDNB 5IMMA 1U92B 4YDJB 9PCYA 4V1DA 2UYLB 4NM4L 2BP0A 4BZ1L 4Z7NB 1FAIL 4MZIA 4JRYA 2ENQA 3SIKA 1GJIA 4L9DA 2VJ8A 4LVNC 3ZRCC 3DO7A 1XHHA 2HB0A 1MVUA 1N59A 3MBED 4KTYA 1EBAA 3WUWG 4U1MA 5IVXB 1BLIA 3TBTB 5CGYC 4CC1A 1RZJL 2A99A 3WNKA 2HMIC 4JKKA 2Z8RA 5CGBA 2VGLM 1I7UB 3TBYB 1RLWA 3KW7A 3PQYB 3UTQA 3MRRB 4HW6A 2B14A 3CZLA 3CHSA 4NZJA 5D1QE 3MACH 3S34L 1HHGA 4JDTL 4XPTH 1S9WA 1WFNA 2PO6D 3ZE0E 3B2DC 1AGBA 1EIBA 4WTXA 1CMOA 2A77H 2B1HH 2L0DA 4OZ4B 4M8QA 2WLZA 5F3HA 3RX5A 3UAJA 1UEYA 3CMGA 3QWRA 4OSUH 4MCZA 1EZVX 4PRPD 4YO0A 1IGMH 3VUAA 4C55A 2TRYA 4XNBA 4KKZA 4IMKC 2XVGA 3MCYA 1CGVA 4M5TA 4FZ8H 3RGVC 1A2YB 2X3AA 2EIJB 5F88B 2WW8A 3DVNB 3E9UA 2V8MA 2N7AA 4MZ2A 2ZCHH 2QPSA 4WLCA 1JYXA 4GS7C 2FJSA 1P5UC 5IOPB 3TVMC 5I75B 5AOKA 4X6DF 4HWEL 1A4JA 3MLSL 5GSRA 4K3EL 3RQ3A 3U9PL 3RVTC 3CFDB 5IUCA 2WWKO 3DBSA 4YLCA 3FXIC 1Q4NX 3L17A 3SDCC 3IYLW 3MCKB 1P2CA 4S1SH 4LIQH 4WW1B 1O7VA 4PRIE 3CXDL 2C7UA 4F2FA 3O9WA 2HJKA 4BUHA 3MZGB 4PY7A 5H37H 3I9GH 2AQSA 1S9VB 3TH2T 4K4KA 2HTKC 3AT9A 4LSTL 1HEZA 1X5IA 2ADIA 1HWGB 2DWEA 4AQAB 1I8KA 2JKNA 3SYOA 5I8CA 1AHWA 3HC3L 3D18A 4KV5E 1AI1H 2Z91A 3RNQA 2OP4L 4C56A 1DEEA 3JVGC 4ZJ9A 4A7GF 5BUAA 1ZLVK 4KRNA 3IVKB 1L6XA 1ZGLP 3V0FA 3E6FA 2GIMA 3ZX1A 1D5ZB 3UC0H 3VD0A 4PPTA 4JVWA 3CHOA 1OTUC 4QKXB 2PNDA 4IDJH 5EZIL 2GYSA 1GZQA 5CLYA 5ID0A 5IHHA 2ZF8A 5C0AE 4UV4L 4NBXB 1BXUA 4P9HL 3BMWA 1BAFL 5AD0A 2Q2LA 1UA6L 2YD0A 5D2LB 4HWZB 4FNQA 1MNUH 4QCIA 1RAMA 2VXVH 1GS7A 3O41A 1AAJA 3QIWD 3GLZA 4RA3A 5MEQB 4G9FA 5D7LE 3L3JA 5TQ2L 3HG3A 1RULL 3UPCA 3RY4A 1DBML 4FQXC 3DUHA 2QL1A 3AZUA 3GSWB 1J8HE 2SEBB 4XNMB 1SY6L 1X6NA 5I1CH 3IB4A 1OGAE 2ZZUT 2VQUA 4M7KL 2XWDA 1FPTH 1XZ0A 2HX9A 2NTFA 2CDGB 1FL3B 4DVRL 5ADPL 3DROB 5TPWL 5FDYA 4IIZA 3KNBA 1OXYA 4DJMA 4JDEB 1U0QA 2OQJB 2ITDA 1Q1PA 4PJHF 1AO7A 3UADA 4W9DC 4Q56A 3WTTA 4XMVA 5KSBB 3U7WH 1YN6B 3IMWA 5DUML 2QQKL 5L2JB 5E1HB 3KXFA 1F2QA 5IIEA 1NEZG 4H0IA 4GI6A 4ZFZB 4MMZB 3RZCC 5L2KA 3FYEB 1E9PB 3SDDD 4GKNA 2H0JA 2I9LA 4JHZA 4ZQTA 3ZE2F 4PB0H 3K4ZA 5L88L 5EIIB 5H37G 1MJ8L 3RB7A 2Y1YA 1GTFA 1F8TL 3BZ4B 2J71A 5J4MA 3D87B 3TCLB 1E9OB 4NWTL 5F96H 3ETTA 3QH3A 3ARSA 4GRWB 4ZS7L 4BK5C 2AHIA 3VXOA 3I6KA 5IHLB 4AEHL 4PSPA 1W8OA 2WNWA 4JO2L 5DEJA 3IDIB 1YCSA 2BNQA 3HEIB 2FYYA 2NSQA 4RISL 2OKMA 1CDUA 2G75B 5D93C 4XB3A 3GIZL 2BCKA 4WHDA 2W9EL 5C0GB 5I15H 1I9IL 4TRPH 4OLVL 5B38A 3EOAA 4CADA 6TAAA 2PCXA 1EZVY 3IMBA 1CFVL 4LO9A 4CSTA 2R1YB 3SHSA 5BS0D 5HJGA 2XSKA 1CGUA 4JO4L 2VRQA 1AC0A 3BKJH 3RAJL 5FM5O 4MAYB 4XPFH 2X7LB 2A5UA 3K4DA 3NIGE 3SOTA 1KNOA 4FQHA 4HC1L 2Y25A 4OZHB 2IGLA 4KUZL 1E28A 5L4MA 4J8RB 1G7HA 3LKRA 5F1OB 1TQWA 1CYGA 2WBJD 3RP1A 3F7YA 4BZYA 3BUDA 1N8ZA 5ID1A 1W0VB 1CZ8H 4Q4IA 4LIQE 1CLYL 1DVXA 3VD1A 1T21B 1KEGL 1QBMH 2X1WL 3QRBA 5I1JL 4UINL 1XFPA 5F7DB 4MCYA 1HQRA 2CBTA 1UXSA 3QEUA 2RMNA 1JS4A 2JFCA 2R0ZL 4KJWC 2NY3B 4PJXF 1E2VA 3QYCA 4PJBF 1SEQH 1CFSB 3B2VH 1J9QA 2BH0A 2XRAH 3HC4H 4W9IC 1I9RH 4DEUA 2D2OA 2L4OA 1ONQB 1N64H 6PAZA 4OFYA 4YHML 3MTXA 4FFYL 1U33A 4OV5B 5KVEH 1G1OA 1R3IL 3V4PL 2BHYA 2BY2A 2FB4L 3C6LC 3MODL 5HDBF 4KK8C 3W2DH 1AKPA 1XF3A 3VM7A 5DSCB 5LAPA 1KXQE 2NW3A 1WTGT 2QKIB 3D5OF 3HRPA 2ZOWA 3T8XB 6FABH 2HVKB 3G6JE 4XCFH 1KG0A 3DUSB 1V5JA 3S97C 1IAOB 2BMKB 3EJYC 4QY8A 1AZZC 1N0LA 4XE0A 1RPUA 3F8UB 5D1ZB 1MIEH 3H2QA 2EKSA 2YUZA 1R5IA 1KGYE 5KSAA 3S5ZA 5EEVA 2GB2A 2H5UA 3SYQA 4ZO6A 1FZJB 2MOGA 2K1MA 1UB5B 3BZDA 1UFUA 4HS3B 4PJ7B 2MNWA 3IK2A 5B8CA 3W0WB 3T4AB 1U8MA 4YXKL 1HJBC 3UAFA 4XX1E 2XA8L 4D0CB 2VR6A 2AQRA 1H5BC 4IHOA 3SDXB 4N8VB 1MLCB 1W80A 3TXAA 4OD1H 4M7ZC 5CS7A 3QCUH 4B9IA 3BH4A 1AD0B 2DQTL 4N5UA 4MJIB 2X4PA 35C8L 1B9ZA 2BC4B 3CPLA 1TTBA 3ZYOA 2H1LM 2JI1A 1PQZB 3SO5A 5HDWA 3AM8C 5E6SB 1A0QL 1EWHA 1FAKT 2EXWD 2F61A 3TBVB 1JWMB 5E9AA 2VN5A 2FATH 4HYTB 1FZMB 3SJVA 2O93L 2NCEA 5HI4D 4OJDH 4ABUA 5AB2A 3GHEH 3RDTA 2WXGA 3ZL4H 3HE6C 1XIWA 3UERA 4ZTPL 2G5UA 1C12A 3RVXC 3B9KB 1GVIA 5JUEH 5HY9A 3F58H 3IJEA 2AEIT 4NT6A 4W9HC 1UTDA 4K8RH 1RZKC 1SDDB 1J5CA 1P5VA 5IEHB 5LNEA 1R5VB 5FECB 1YEEH 3G5YB 3CH8A 4UM9B 3MFGB 4F9LA 4WY7H 3RPIB 3FO0L 1NSNL 3ZRFC 3WEXA 1NFDE 1TQCC 3QR0A 1Q9LB 2EDLA 2F08A 2I07B 5I76A 2B20A 1RSYA 4MZRA 4WU5A 1H9VA 3CFBB 3EBIA 4DP5X 3WFCL 3W5MA 5ISZE 4YSTA 1G0DA 2NRDA 4POZC 1YYLH 1AZVA 5FGCB 7TAAA 4PJ8B 3FRUA 4M93B 4XCYB 4UQBA 4M62L 1HEHC 4NM8H 2IH3B 2OMVA 4W70A 1MHHB 4HXBL 2R4RL 3QPXL 2Y7LA 2DMBA 1RK0B 4NZTL 2XACC 5FPIA 1J8KA 4ZMOA 1G7LA 3LMJL 1Q1JH 4P23C 4FFVC 2FWOA 3HE7B 3Q6GL 2G60L 4OCMC 1ETB1 4G6JL 1H6UA 3ISRA 4PLNC 5KTEH 4PTUB 5JXAH 1FBIL 4RWYL 4OZGF 1T1ZB 1H3PL 1YPZE 5CKAA 2BP5M 5G4NA 4X7EC 4APQB 1LDPH 2FGWL 4A2FA 3SPVA 5FYJD 5IJKC 4NOBA 2MPAL 4K7FB 1SXZA 4PJEA 2WGNB 4I3GA 5I16B 5E8EB 3L3GB 3MV9A 1RUKL 4UANA 4DEPC 1NGZB 4P0DA 2BVPA 4WW2C 2XN9B 5C6TH 3Q9QA 1N19A 1U8IB 3TJEH 1PBYA 2IXQB 4FFZA 3NPZB 4MS8C 4RH4A 5KVEE 1CDGA 4O2FA 4XO3A 1YUHA 1D7FA 5BV7C 3WTSA 2HLAA 2NY4B 2DEWX 1PD1A 4DZBA 1QPXA 2CIIA 1C16A 4Y8DC 3S4SA 4DVBB 4NGHH 3V9EA 4M4RA 4XR8C 4HSCX 4NKQB 4WSGA 1T22B 2CBPA 1UHVA 1E4XH 2Y6TE 4N9GB 2E6PA 3TEXA 2J4WH 3Q2CA 4MD5A 2GSGA 1NQBA 1ZEAH 5H4ZA 1OM3H 3IRPX 1ZPUA 3OKLA 4RMRA 5ABDE 2Q8AL 3LEXA 4YSCA 4XMXA 1HHJA 2VL5B 5FYKH 1A65A 2R2EB 2G2NA 4AJYV 3K74B 1SBSL 5MERA 3CN0A 1SNRA 4O9HL 1U8HA 4XAKE 2W80C 1HKLH 3BCFA 1HIMH 2MH4A 2Y7MA 2J56A 4OFPA 1J10A 3RVVC 4JFHD 1FYHB 1CLZH 1OM9A 3KZ8A 2RTTA 3FUFA 4L3EE 3N42F 1EO8L 4F57H 5I1EH 1JAEA 4ZAKC 9CGTA 3B7TA 1BG1A 2V6HA 4L18A 1YEKH 2WWKT 5C0CE 1KGIA 3SYAA 2X6VA 1ASPA 2EDQA 4MJ6B 5HGAB 4CDGC 3FQRB 3FO1A 3GD1C 3VX0A 4M6NL 4MXWL 3MA7A 4PV8B 4NPYB 2FQEA 5GRJH 1JF5A 1E4XI 4QYOB 3EOTL 4BFIB 5HVWA 3MOQA 5DO2C 4B95C 1KPUB 3G6JB 2P49B 1ZHBA 2W8CA 3RRQA 4HDIB 2KDGA 3EH3B 5HI3C 3DX7A 3H54A 3DJRA 4YLBA 1FVEA 1KPRA 5ENWA 1G87A 1KCBA 3OMIB 2ESVB 2P5EA 2PP9A 3W38A 3NP4A 1LEKA 5IEKA 5FEBA 3DX1A 5JPMB 1RUAL 3K8MA 1BXVA 2ENPA 2W0LA 4YSDA 1HL4A 4LAQL 3VFVA 1DQIA 1DDTA 4K9EL 5IJBC 1OLZA 3LVTA 4HWUA 4XP4L 2EDWA 1TENA 3N1FC 1GRWA 4HWBA 1T4KA 4JM2A 4ZSOB 4LPWA 2DQHL 1C1EH 1W72L 2C1OA 4S1RH 1C7TA 1AZNA 1RIUL 3I02B 4J3OD 2EVIA 2RIKA 3L4TA 1NMCC 2AABH 1JE6A 3BPOB 5FHAL 4JREC 1RH8A 3M8OH 4N0UB 3BSZH 4N0YL 5GGQH 2JCCA 2BSCA 3QUZD 1A7RH 3IDUA 1P4UA 3CZGA 5E6IA 1KCVL 3QIBA 4HIHA 3C08H 1NM9A 2IJ0C 2V37A 4NLHA 4RX4D 1WCBB 4PJDB 5JPNC 5FGBC 3EO9L 3WJMA 2VSKB 3SKMB 4AC2A 3SKJL 2CKBA 3IU4L 3WDHA 4Y4HC 3JT2A 4KHXH 3L16A 1IGJA 5DLML 4KC3B 2YSSA 3MGTB 1SXCA 3BUTA 2PWEA 4K5OA 1BQRA 4ZBJA 4LHQB 1YEIH 3RWGB 1BZ7B 5F44A 5IT2L 4JZNA 3VO0A 5JNYB 4LNRB 3SQRA 4A2HA 3MR9A 2JMRA 4JPVH 4WV1A 3LDBC 5B7MA 1R3KA 5FWRA 2GJ6B 1W9XA 3A6CH 4FXGB 2DWXA 2QHRL 4J3OF 2CWRA 3IXTB 5FIEA 3SKNB 3VD2A 1L5GB 5EUOB 1PKOA 4HPOL 1S9YA 2WB7A 4NLAA 4KRPD 4I1NB 3IDGA 1XDTT 4HUUA 2V7HB 3PWPD 3IDXL 4BM7A 1QSEB 2UVFA 2BM3A 2VXUH 4ORZC 4Y16B 1NFKA 2EICA 5TE7L 2V5YA 3WBDA 4M5YL 2OMYB 4RBPH 43CAA 5HHMD 2N1TE 4HKZA 3CHXA 2Y5EA 1NBVH 3PGDB 2R29L 4I8DA 1L7TL 4EUPB 2RHEA 1XB3A 2VLKE 5TQ0H 3HOGA 1WCQA 3S37H 4GSUA 2ZSWB 4IHBA 4YAQA 2J5LB 4ICWA 4JANB 2LU4A 5FYKE 2E7LC 1GCFA 4HG4K 4LP4A 4Z3GA 4E41E 3FQTA 1YYML 5FUZL 1F1GA 2X4OB 4WWKA 1G7IA 1UH2A 1KTJA 2V5TA 4LRNH 1ODAA 4TXVB 4Y5XA 4XN1A 4XO4A 4HHAB 1XH2A 4JVPA 2IPKB 4L8DB 3V0HA 4G6KH 1FDLH 4UOJA 4DGWC 2J1YA 1JK8A 4NHUB 4TNVK 4UM8B 2F5AH 5GS1B 2IMNA 3QUMB 5EO1B 5BVPH 1N8OE 3HR5A 3PY9A 4LKCB 3VW3H 3BPCB 1IAIH 3KPTA 2DMGA 4X6CA 4XP9H 5EORL 2O61B 2NDGA 2F1AA 3CVHH 3LZRA 1CWVA 3PWVB 3B3IB 3HVDA 4N3TA 4MDIB 2APFA 2Z7WA 2JQAA 1MXGA 3NIDF 1NGXB 4I5BA 4ZUWB 3OGOE 1TZAA 3C60C 2H9GA 4Z7IA 4F7EA 1BZEA 5KAQF 1NL0L 1ROWA 1CICB 1RMFL 2X4SB 3T5WA 3QQDA 1YJDH 1JGDB 2H4EA 2Y1ZA 3L9RA 4NXKA 4Y4KD 3K6OA 5JLZA 2QVTA 3ARVA 2PW2B 4U1SA 4ZW5A 4URTB 1SLWA 2V7NB 4WI9A 4OJFL 3N6YA 5CBEB 2UX7A 3UJTH 1QX1A 1M53A 1S7VB 4AQ1A 2IH9A 4L3CA 3UYOD 3WELA 4U1NB 1SPDA 3BQUD 3FU9A 2ZWYA 2DLFH 2QFPA 2K0RA 1LP9F 3RVUD 5C0ND 4WK4B 1WGVA 1IRAY 4EZMA 1EZLA 5DHVH 2FLMA 3MNVB 2E6JA 4HETA 3QDJE 4ODSL 4OU3A 4NQTA 1INQB 3JV0A 3PWLA 5D9SB 3QJSB 2FHBA 3KL5A 1U8PB 1FV1A 3ZHFA 2OMNA 1Y7VA 5INCB 5DJ8A 1AKJB 2H3NA 3CSPA 4QYAA 1RUPH 2HFFB 2YO3A 4IOIB 3I74A 5JQHC 2HVBA 3O2VL 4KXAA 4Z8FL 5AOIA 2VABA 5LXVA 3B37A 1OAYL 3UBHA 1U8JB 2XOTA 2H1PH 3CMOH 1LE9B 5KSVA 4UQAA 4Q58C 2Q7YA 2V5MA 4IIQA 4G8IA 1G6RL 5T1LB 4Q2ZB 3Q48A 3WLBA 5DHYB 4JHUA 5DJZB 3DVGA 1Q9OA 5E8OB 4PU2A 2IALA 4TNGA 3WN5A 4PJFE 5EU6B 2B16A 5ERWB 1XR9B 2VZ3A 1MCOL 3P0VH 2GHWB 4W1TA 4XGZA 4XMKH 2GC4C 4HGKC 2WZ0A 4N26A 1OV8A 3KLLA 4X50A 4ZW7A 5LCVA 2HLEB 2ODHA 1I8LC 1O9ZA 2QSCL 5C0BE 4TNVF 4KVCL 4ZK8A 4DO5A 4QO1A 3C6SA 1PLGH 4WF7A 2WTOA 4YHOL 1OY3B 2VDPH 1CD0A 2O1AA 3IFOB 2WMPB 4I9XA 1AGEB 5F7LB 3GPEA 1NC2B 1YMHB 1CBVH 4R2GB 1BQUA 1VERA 3D6GA 1IBHA 4L4TD 5EZJA 5EA0H 4B96A 4XCCH 2BOBB 4ACPA 4HUMB 1F2XK 1F86A 4GAGH 3SCMD 4N2DA 3SGEI 4HULB 2NY2B 1DJGA 1Q0XH 4OJEH 1FCCA 1F6AA 3ABGA 4JRFA 3PNWB 1D5BA 3PWJA 5D7EA 5AYUL 3X13B 1GR7A 2FQGA 4KZDL 2C4FU 5EF3A 4X7SL 1FFTB 2Z8WC 1AYOA 3D9AH 3QG6A 5EFIB 4BFGA 1QQDA 2ICEA 4HUKB 1RZIA 3MJ9L 2IO5A 4QHKI 5D7HA 1ADQA 1FL6B 4UUJB 3BH8B 2YKKA 4K07A 4Z77A 1T1YA 3LN4A 5BOZG 3NP3A 1DBKL 3MLTB 3CLEL 4EE2A 1UJ3A 3P77A 3QC6X 4H44C 4MNGA 3ZLQC 3OC8A 2JXMB 1IEAB 2ZX8A 3FMGL 3P3SA 4IBWA 4MJ2A 1BX2A 1QTSA 4ALAC 5C0IA 2E86A 3OLEA 3GM8A 4K55A 3GSOA 4NRYA 1RK1B 1SXNA 1PVHA 1TZGH 2C9UA 1OAQL 1CXKA 3DVIA 4PG2C 5C7XL 2YUXA 3NSJA 2BERA 2A83A 3A0OA 3UAEA 4F7KA 5J8OA 3ULUH 4DAGL 5IB5B 4IBTA 1E43A 2C5DC 1EHXA 5BZWA 3UTTE 4PLOB 3QIWC 1A9EA 1MFAH 5IW6A 2W65A 3O3EB 1CS6A 4G3YL 4GMSL 1KGCD 1TPXB 1NFAA 2VR8A 3QIUD 2IDSA 1ZHKA 1QBLL 2B4CL 5B7FA 1EBPA 3OGCA 5ALBL 4IKNA 3QXWA 3PRZA 1EERB 1BP3B 3QFJE 3GIVB 3ULVL 1J9CT 4JHAH 3V0IA 2R0KL 1UZ8A 4YSPA 4L8CA 3G5VB 5CMAA 3MLRH 4AM0B 2C4FT 3IMTA 1JZ7A 1A7QL 5I5MA 2AITA 1F4AA 5E5MA 5IM7B 1MW0A 2YGVA 1S7WA 5DFVC 2Y36L 4NRXA 3SBQA 1FIGL 4MB1A 1PG7W 3O45A 5GISH 5CP7B 2UXVA 4AW4A 3CDGB 2EUXA 4GJTB 2JNZA 1E30A 2K4AA 5E6RB 1JZFA 3UJIL 1VACA 2FUTA 2X9WA 2F7IA 2OPCA 2VLRE 1IC4L 4PWKA 1C5BL 4L8BB 1BD2E 4QRUB 2H26A 4LARL 1RJLB 4JFDA 4ODBD 4XVJL 5KSBF 1JZ3A 2FJUB 1HZLA 2ZKYA 2W9DH 4L29A 3CZSA 3BDYL 4RZCB 4AMKL 5CGTA 4DZ8B 4G8GA 1BW8A 2BFGA 1XF5B 1L9MA 4ODUB 4YPGB 1JZ8A 4RMBA 2EP6A 2OZ4H 4JKNA 1A6WH 5FLUA 1NAMA 1P4BL 3V52L 2AXGB 4G71B 3RWIB 1TTRA 1AJ7H 5GGUA 5BZDB 1QKZL 4FMVA 4Y88A 5TF1H 1DJYA 5D1QD 1PY9A 4WTWA 1DVTA 2ADFL 4GH7B 5FW7A 1Z5LB 5C09E 4ZUUA 3CSFA 5EEYA 4K3JH 4X5PA 4WI0B 1AMYA 1PZUB 3HZMB 3T3PB 4GBXB 3LXCA 4AITA 2E9IA 5DRNB 1KFAH 5H2BA 4BFKA 1CTMA 5CKGA 1OB0A 3VDBA 2XC8A 4JUTA 5JOFB 2WBJC 3E2HC 4YNYA 3BZEA 1HZKA 2L04A 4KDTC 4ZO9A 3ZU8A 4PJ9D 4LCUA 1X5FA 4RAHA 2LTQB 3MRCB 4BZ2A 4PJFB 2G2RB 1RURL 2GJZB 2OTWA 1A1NB 2Z6FA 1ILSA 1H3WM 1BQHB 1DQLH 1XVSA 3MV8E 4MNQA 2ICWI 2Z31D 3SBWA 1RU9H 1XGPA 2GITA 3QHZH 1K4CA 5CIPH 4YSRA 1I1AC 2F54E 4DP2X 1IAIM 4QRSB 4Z7AA 1OCOB 4AV4A 1TNMA 2Y23A 1QFPA 3PG2A 1Z9SA 4PRID 4RGOH 4U7MA 2OMUB 3WFBL 2NXZB 4IMLA 3ZL2A 1T83A 2NY7L 4LCWE 1AE6H 3C5SB 3K6SA 3THMH 5DZNA 12E8H 2VB5A 4F7CB 2WWMC 5IZ7A 3O3BB 5TGBA 4G8AC 3IGLA 4UT9A 3NOIA 4I4WA 1QFUL 3MRDA 1CU4L 3WJLA 4OD2A 3O6FD 2AXWA 5E2WL 5ACZA 3ULUE 2C9VA 2DKSA 3Q0HA 4PRHE 5DJDA 4ZUTB 3K1DA 1PZ5A 4M7JH 4PGCB 3WCYA 5I8OH 1PYWB 1XD0A 3MBXH 3G5WA 5B22A 2GSIA 4H8WH 5T1MB 2AK4E 3X11B 3QA3B 3N9GH 5HHXL 1A9BB 1PDKB 5C0AD 2D0GA 1EHLH 4L0PB 4U49A 4U7SA 3SYCA 4N0CC 4HX1B 5DJAA 3C6EA 3ZUCA 4JG1H 1GCYA 1AFVH 4C59B 2PYEE 5CP3H 3WNOA 1WRFA 4XBGA 1YEWA 1U36A 4NO2A 5D7LD 3U7YH 2YRPA 3NPSC 1MNNA 1DVUA 1WIPA 4IRSB 4MQXD 4P2OA 4JZOA 4OSUL 1LD9B 2ZXAA 1J8HD 5INDA 3IRCA 3S88H 5DUBB 3EYSH 4FLHA 1JV5A 3FB6B 3LRMA 3WHE1 1R19A 3FQXB 2QGBA 4PJ7F 1CTNA 4M4PA 5HI4C 2QADD 3ATFA 4WGKA 3VYOA 4NJAL 4BQ6A 4UYQA 5DWUH 3ISWA 3QI9B 4PJ5B 4HUWA 4IOFC 4EVNB 3JWOL 1YEDA 2CCLA 1GZHA 5IW1B 4OM0H 3TT1L 2P7TB 2H3XC 2Q8BH 1F3RB 3O3DA 4AUUA 4K5NA 3BZFA 2GT9B 3VFMA 5JTWA 1Y1UA 4Z0BL 5JXED 2J3SA 3HLKA 3EJZD 5DD1L 4WWID 3FB7A 3P2DA 4A7SA 3L7EA 2Q3ZA 1P7KA 3JTTB 3PAYA 3UPRB 3N43B 3ARGA 3IAQA 5JA9A 2IWFA 4K3GA 1HH9A 2GUOB 3FTWA 3LZPA 4I0PD 4X8XA 2XQBL 2WCGA 3KYNB 1JXFA 4JDVB 4R97B 3T2NL 1KJVB 1X5YA 4XC3L 1L6ZA 1OANA 4HJGB 5BZZA 3D4GA 3GZPA 3U36B 5ILTL 4ZFFB 3EFFB 3RPBA 2WJ5A 5GGRY 3EGSB 4L4VE 5IBTL 3VXPB 1J1XL 2D7NA 4HSAC 3ABMB 4IM8A 5ESAB 3PPEA 1ZTMA 1K2DB 2GW5A 4ZXBD 4ZUVA 5DJXA 4Y5YB 4B53A 3AUWB 3HB3D 4JQVA 3VVVA 1ZXKA 3KG5A 3KPQB 5GXBB 3RUGB 3IPFA 4W4OA 5F7KC 4DKFH 3WS3A 1B0RA 1KCKA 3QK0A 3QAZC 4WIQA 5I26A 2R23B 3STBA 3UJJH 3L6FA 4FJ6A 1NMAH 1MG2C 2YRLA 4U1HA 3BAYA 4EF3A 2F53E 4MDJB 5A2CA 4NBYB 2LFGA 4QRAA 5CUSL 5BUGA 1JRHH 3FTGB 4K2UL 4FQQB 1D3CA 4NO3B 5GS0L 4PRDA 5JHDB 4Q14A 5DEGB 4PUBH 2IFFH 4F2EA 2IOMA 1FPTL 1U3HA 1YEJH 5CM1A 3T4YB 1AIZA 1HCVA 1IAKA 3ILQC 3KPNB 4JPWL 4JFEE 2WQAA 3EDEA 1Z9NA 3MGAA 4L1SA 2WTRB 3F7RA 4ONFL 4FQ2L 2ZCLL 5D5MA 1D7CA 3LPOA 4MNHA 2Q10A 3G5XA 4YDVB 4P49A 1P7BA 3QRGL 2XTJE 3R0NA 3V7AG 3I6LE 4WEBH 1OEZW 2DLTA 2X6MA 3ZQ9A 1H0DB 1Q9WA 1W8EA 3SDAC 1D2OA 5D72H 4GAJL 4DTGH 1L3WA 4K73A 2W81C 3WXWH 2JTDA 4JDZB 5DK0A 3ARBD 4ZUSB 3GMPA 3VXSA 5CCGE 3GK8H 1N6QL 1F97A 1D6EA 3HUJB 4Y4FC 4UTBL 1WBZA 3U4KA 1AANA 1UM6H 1H8OA 4TUOB 4ZW8A 3SQOL 3HS9A 3NIGF 4XOBA 3EO0B 5LAXB 3GS0A 4XPGL 5DVKA 1KB5H 1LO5A 2UVEA 2EILB 5FM5M 1FNLA 1OD7A 2ZONA 5I1KH 2WSDA 4YHZH 4AG4H 3PGCB 1E4KA 3Q5OA 3X1EA 2JB6A 3SE3A 1W16A 5EIQA 1J9SA 4FQLH 1IGIH 1UACH 2JK5A 1FZOB 3LNFA 4KK9D 1DSYA 3GJFB 3CCHA 4ZFOL 4N2IA 4YDNA 2AEQH 4JNXA 1QSFE 3PREA 2NQCA 2D9QB 2R2HA 3BGFB 4U6HB 3GGWA 5C0FB 4GQ9H 2GCYA 2QFRA 2FX7H 4L0YA 1CLOL 4Q6YA 1VGEH 4K9JA 3F7VA 8FABB 4EXKA 2X4UB 3RGVA 3V0VB 3NZHL 1LE5A 2GTQA 2E27L 1M6OA 5HGHB 4UT6A 3JWNH 3R19A 2WQWA 2R8SL 4XPFL 4L5FH 1P5UA 5SX4H 1LHZA 4JL1A 3V7AE 5AVXB 1NGQH 4AEFA 3BKML 4DO6A 3TIDA 3RY6A 4XBEL 1BYOA 2JIXD 4PEEA 2WYZA 4XO9A 3BO8A 1OAXH 2VXSL 4LEXH 4HU8A 3NCBB 2RFXA 5I24A 3U6XA 4G83A 3A6BH 3AG2B 3DXAA 1HNGA 2GK2A 2VWEE 4GQZA 4KQ4L 5KJ7E 3G6JF 1W72B 2HJFB 3IDJA 4X7TA 3SDCA 1GY2A 2PYEB 1ED3A 1QUNB 3BSGA 5IJDC 4J3OC 4TTDC 3RI5K 2ZNWA 5JIPA 1IO4C 1FSKB 1KYAA 1EEZA 1E8WA 4N8CL 1CL7L 3VGAB 3MLPA 4XCNA 3BUIA 3QORA 4NQDB 1SEQL 1KTKE 3RU8H 1IKOP 3QUZC 1T1WB 4L2YA 4S1QH 4FADA 2YWZA 1RI8A 5AOLA 3Q8CA 1QWUA 3C8DA 3QBTB 1KIPB 2XX0A 4ZFQA 4ADJA 1HJCA 4F20A 1G4MA 3N85L 2D4DA 3ABZA 5IG7B 5SX4I 2HKAA 5ISZD 5LBSA 1EH9A 3RKPA 4GW5A 2ZKWA 3V0WH 3QPQD 2P8PB 4FCHA 2R39A 2IANB 4NKMB 5E4EB 1XF2B 4H0HB 5MENB 3EDJA 4LHJB 2Y2YA 5DGQA 5I74B 1PX4A 4P57B 2DWDB 5IJCC 1QASA 1RLBA 3MI6A 1MIEL 4FXKB 5F9OH 3EF4A 2DLEA 4X6BA 3VNYA 2MRYA 1TJHH 1IAMA 3ZXAC 4PJDF 1WWBX 3DIDA 5SWZB 4IU2A 4GUOA 3FONA 1IQWH 1EJ6A 3HAEB 5KVMC 1H19A 2UWEE 3KBHE 4CVWA 1RJYB 3KWWB 3MFFA 4FQXA 4MBRA 5C3TA 3OHMB 5AYTA 4KRPC 3H7LA 1ECZA 3ECUA 3TV3L 1S7UA 4B9JA 4BKLA 3KPSA 2PTVA 2GUYA 1NFDF 4Q0XH 2B08A 3V5DB 4URKA 1CG9B 3JWNG 3CZFB 5A6LA 5E8PB 1JNLL 3E8VA 5EU5B 4XNYL 4G11A 3HNSL 1V54B 3FU0A 2X88A 4OIBA 4JQIH 1EANA 1LMIA 1UGNA 4G59C 2JCWA 4N68A 2EEXA 5DJCA 5AOMA 5EO0A 1WWCA 5DXWA 1IGYB 5BVJA 3LKNB 5C8JA 5EUOF 4EN3C 3ZVVA 3O4OC 3CBRA 4OJAA 1PG7H 1SJEA 3ZKXB 2VLJE 5CEXA 2XWTB 4OGZA 4NO0B 1T7YA 1KEMH 1MWAL 2XZCL 3F58L 1KXVC 2AKRA 1I8IB 1WZAA 3PXHA 5DS1A 1BBDH 1JI1A 2E47A 1YEEL 2EABA 4JFPA 4TS6A 5J6GA 3BP5A 1OHZA 3D8MA 1FVCB 2Z1KA 4D7PA 3RI5F 2QGCA 3T0EA 1RZ8A 2X3CA 3MOAH 2L7UA 2P8MA 4LLMA 4UAOB 3RKDD 5F3BA 3EF7A 4BK5A 2YLHA 1YPZF 2F74A 3CFQA 3HRZC 2M83A 4XOCA 1FFNA 3MNZB 4Z0XA 3TLRA 2GC7C 3L3OA 4N2NA 1RZFH 2IBZX 3FRPG 1JYWA 1A22B 1TO4A 2DD8L 4H20L 4XAKD 5AOZA 4IJTA 4WWPA 5H94A 2ED8A 3TCXA 2VDMH 1IKNC 3P11L 1BFOB 4F2ME 2VDLH 4BINA 4CKVX 4L3ED 4AZUA 1MI5B 1HHHA 1E6JL 3MMEB 3CU7A 3QUYD 5C0CD 2AJUH 4HK3J 4P3CH 3OQRA 4ANXA 1WBXA 1A6TA 2OMXA 3FFDB 2M2DA 2XV0A 3FNKA 3JWNE 3CC5A 5C07B 4L5FE 1E5CA 1ZE3C 2ZYRA 3CZEA 5DMKB 1URIA 3U7AA 1NGYA 5F89A 4FNLL 1GW6A 4X9HA 5G4OA 3HG2A 5FS5A 1TCRA 2EACA 4Y4KC 3GSNL 2ZOLA 3GSVA 5JXAL 1AKJD 4W6YB 5JHLL 5EF0A 2W07A 3ENEA 3BPLB 5LXGL 3UBXB 4UWQB 1GSKA 3BQUC 2D03L 4K8RD 4YHPB 5C0NC 5JYMA 3MV7A 1KBGL 3D52A 1SMDA 2VAJA 3E3QE 1F0LA 2I60L 2CHXA 2RD0A 5L6YH 3MRGA 3QNXB 3SPIA 2XV2A 3NSDA 4QHUB 1MCPH 3U2SB 2HT3C 5F3FA 4PW3A 1QACA 2VO5A 4KROB 3TZVB 3OB8A 1A6VL 2VISA 1VFBB 3ZKND 1BXXA 3VE0A 4L37B 3LNGA 4MA7H 4FRWA 5LGJA 3H7BB 4Q7DA 1EZSA 2EXSA 4TSBH 2IGTA 2VDNL 5DMIL 4ODVH 3LV3A 2PP7A 5F0JB 1XEUA 5D6CA 4B5EA 5C0DA 4LAJH 1HHKA 2HTLC 5I75C 2IV9A 2WLIB 3A24A 2NT0A 3O6ML 5HGDA 2DQGH 1DBJL 1E5AA 1K5NA 3GO1L 4A2DA 4HK0A 1MFCH 2OSLA 4XH2B 3ZDXE 5KVFL 4BDVA 4JRXE 3BRGC 2ID5A 1VHPA 3NCCB 4NZRH 1ANUA 5KS9A 5T33L 5DJYA 5DD6B 1YY8A 1SEBA 2WXRA 4ERSL 3PIQB 3P9MA 3VRJB 1T7XA 5FA3A 1ZA6B 5E8NB 4F57L 5C7ZA 5I1EL 1U21A 2K8QA 5HVHB 1H5BA 1SFHA 2E3VA 4XMTA 5DVMA 5I28A 2DYPB 4C57C 1L0PA 1WJ3A 4XXDB 1CI3M 1CE6B 3MPCA 5DI8B 4E9YA 4XVUC 4DP8X 1FVDA 2HT4D 2OXHA 4E42B 2VSDA 3FQNB 3POHA 1A14L 3QP3A 3FU6A 5K69A 3CX2A 3ZT6A 4GP8B 1U8CB 3ZDZE 1IKFH 4NQSA 5T1KB 5IHUL 1VFAB 3VNZA 4JG0H 2XY2A 4UAHA 1GGBL 1F58L 4IYKA 3DTXA 2E9JA 1H8SA 1FLRH 2VLKD 2CJUL 4WK0B 4YXHH 3ULSA 4OFDA 3PABB 1LO3L 1PS3A 2B2XL 3M7OA 3Q3GB 4AH2A 3QXDB 1LQBC 4AWJC 3K71A 1HSBA 4M43H 3TA3D 1WZMA 5FYKD 5GRUL 4GXUN 3QT2A 2J57A 3ZDWA 4E41D 3TNMB 3VFUB 3BSZL 2H6UA 1JNNL 1MW1A 2DQ6A 4W4NA 5EV7A 1MCLA 3VQMA 5E1QA 1MVFA 4UQ9A 5DMJB 4WHCA 1E6OH 4J2XA 5L9DL 1ASQA 3QVAA 1J12A 2BNRA 1ECYA 1I8AA 4P2RB 3TS8A 3GNMH 3E8UL 3BJ91 4KY1L 4WI7A 4DGYH 5HD8C 2APTA 1NAKL 1PKQA 2X40A 3LEYH 1GJUA 3OD3A 1Y1DA 2UZIH 5F6HI 5HHPA 5I23A 3GSUB 3QZMA 1B88A 4A38A 2C3VA 4Y89A 1FO0B 1NJ9A 4P23A 5CZVL 1M1XA 2OA9A 1JTOA 2F2HA 5BQDA 5DTFA 4BHUI 1KB5B 1RV6X 4F8OA 1D9KA 1JMZA 4H8QA 3ME0B 1P4IH 4LEOB 3NCEB 4TVPH 1PX3A 3WLWD 1IEHA 4JFYA 2B15A 4PGBA 5DRZB 3FHAA 1LM8V 3NK4A 2AJYL 4P4RB 2E8YA 1MJJA 1KLUA 4QXTA 3F5WA 4YBLB 3WIHH 3L1FA 5E6YA 1GHFL 3EH1A 1ZGLA 2DQDH 4F2MB 4FEMA 4Z7QE 4PJIB 1BECA 1I3GH 2PTTB 3FU5A 5BJTA 1EDQA 3HLAB 4MA3B 3VYPA 3U6RA 1BLNA 1A7NL 4JFFE 1GS8A 1F56A 4JRWA 2XCMC 3WNPA 2HWZL 3EBGA 4R8WL 1EEYB 3SQBA 3JWDC 3QDJD 4X98B 3C87A 5F9AC 5FXCH 3KPMB 4TOYH 2AQ3A 3RL1B 4ZMZA 3RIAK 2OXGA 1J18A 1ZS8A 2ZCKL 4A6YA 5FO8A 4I9WE 3C5JA 3D3VA 1IVTA 2EDRA 3GI8L 4PI2A 3NCWA 1GY1A 1QUPA 2YAQA 3I9PA 2WQSA 4RBPK 2XXFA 4TSCL 2D0FA 4Z78B 4HA1A 3WUWB 4CKQA 2ZUXA 4MAYC 3HC0B 2V8LA 4HEPA 4JHBA 4Z7UB 4KKNA 1AC6A 3WU1A 3FQWB 4ODXB 4G5ZH 3VCLA 3ZK0A 1NCUA 3HI6H 3B6SB 2GBVA 4QHMB 1QLEL 1D5RA 2ZXQA 4OF3A 3WL9B 2WSPA 5A2AA 4JN1L 2I5YH 1DDHB 4I18A 4J4PD 5J6HB 3IF1B 5HHOE 4NZUH 1T4WA 2X6BA 1LEIA 1BOGB 5TFSL 5EBMA 4DK5A 2W1NA 4XRCA 4KOBA 4NNXB 4QXWA 1DR9A 3K7UA 4H1LH 3CSTA 5PAZA 5K9KB 4AC4A 2PCPA 4FQ1H 4PJGE 2PP8A 3H9SE 1NEUA 4LSQH 2XZQH 2VXQA 4UTAA 5KEZA 1O5PA 4HIEA 4EEEA 1IAIL 4PWHA 4U3HA 4Y19B 1BMGA 4XN5A 4XVTH 5C0BD 3GI9H 3GMNB 2YGNA 4OCWL 1DL7H 4V11A 4FD0A 4NAMA 4X80L 2X44D 1IX2A 5I1HL 4JPKH 1U8NA 3BC9A 4JO5A 1GIGH 1QTYT 2XPYA 3STLB 2CPUA 1NCAH 3APFA 1MRDH 1K6QL 4XXCC 1CURA 1U2HA 3OZKA 4N22A 1RQ5A 2XBZA 3V6ZA 6CGTA 2ZJSH 5G5DA 5E51A 2WJ7A 2OJEB 4OCRL 3T3PF 5T5FH 1YJDL 4GFTB 4EAEA 5GQBA 4LPCA 3DGGA 1JXGA 1BVNP 5CINH 4GKZB 3ARDD 5AZ2H 5DJ2A 4QNPF 3OJVC 5M95B 1WK0A 3D12B 2B5IB 1F4WH 1LDSA 3U25A 3BGAA 2J88H 3MKGA 3X1GA 3GRBA 3GWJA 4JO3H 4AEEA 3LNDA 4L8SA 4JFQA 4OT1L 3PP3H 3BPNC 3EYFA 1EGJA 2LFEA 2R4SL 3LSOA 2NTSP 2X4NB 4LLYB 4PIRF 1BF5A 4PJFF 5F7EL 2J2ZA 5DFWH 1ZVYA 1OAKH 3I6GB 4GEJA 4XP1H 4ZOBA 3T4AC 4DKEL 2ARJA 3JUZA 4KGJA 4KRLB 3MNMA 1Q9KA 1BPVA 1XR8B 3OX8B 4N87A 5TDPA 2WXMA 2VXTL 1R0AH 3L5IA 1S9KC 4YDMA 3S35H 1HAUA 4M9OA 3FCBA 5EN3A 4AQEB 3REVA 3EZ8A 2MIZA 3OKOA 3LZNA 1CK0H 1RVFH 2XXGA 3FT4A 3JTSB 2BIPA 3NJHA 4X6FB 5ANME 5FGBA 5C1MB 4KZEL 3CMOL 2OLDA 2H1PL 4Y4HA 2P9RA 4OCXL 5LGHL 3JXAA 1IGCH 1N4XL 1SFDA 2QQNL 1GS6X 2XG5B 4RMUA 4CILA 1NCHA 4KKPA 3C5ZD 1XBRA 4YHIB 3I50H 3TO4D 5TE6L 1VSCA 4TVPE 4H1LG 3MGOB 3B9KC 3UTTD 3K2IA 1HVXA 4PJAE 4PRBB 4NQCB 3PUUA 3BN9C 2ZP9A 4MQXC 3ROOA 5CF3A 1BYPA 4YMPA 4HUVA 2KDYA 4TKWA 1K72A 3OKNA 4NQVA 3HG0A 4XNDA 1RPQA 3HC2A 2Y69B 2HAZA 1PLGL 2QADC 2RBLA 2ZX6A 4LL4A 4TV3A 2F6AA 2AJXL 3QFJD 2PABA 2UX6A 4S0TD 1O7DE 3OF6A 2OMZB 4LLQA 4FI7A 3ML9A 3D39B 3MA9L 5KUMA 2ZWNA 1F4XH 1DJWA 4PJ8C 3VH8A 3O11B 1HL5A 3NFSL 5KYWB 5CZRA 1NUGA 1BVKB 2JTYA 5EEZA 1BAWA 5JXEC 4UQ3A 1Q94A 3KVQA 1MCJA 3EJZC 3SGKA 4BFFA 3LQAH 2FWLB 4GRMA 4JM0A 1SVCP 3L3HA 4AK1A 5LKNA 4R4BB 2OCJA 1AHMA 2DTML 2VLRD 1WDAA 4FA8A 2HFGH 3U83A 5DRWA 1BD2D 4HIJA 2MQ3A 2BJMH 1Z7JA 4I0PC 2E7LA 3I75A 1MF2H 4O02A 5BMFH 2H6PB 2B59B 5FF6A 1E8XA 3COOA 2VMDA 3AABA 3HPLA 1U8OA 4FLRA 2C3GA 4GPVA 1L9TA 4A37A 1VZGA 1RCYA 4CGUB 1OWRM 4PV9B 1KCWA 2BHUA 1AQKH 4KKAD 3ZYIA 4ELME 5IVZB 1NDGB 3CVBA 1QR1B 4G43A 4WO4B 4PGDA 4XHJD 4AMWA 3GXFA 1JPFA 3N43F 3P4MB 1OK8A 4ZXBC 1CFQB 3QGVA 3SPJA 3T6QC 3D25B 5EC1B 1H6TA 1WITA 1AIFB 1TQSA 2PXYB 3IU3B 1P7QD 4X99B 1TVHA 5I6XB 5M7QA 4KNQA 1NCGA 4HS6B 1QLRA 4KX7A 5C09D 4KQ3H 2PYFB 1MFEL 4F8PA 4WGVB 4XP5H 3P0YH 2BDNH 2OX5A 4PBVC 4BCYA 2QZQA 5GHWL 2OL3L 2B0SL 3LKQB 2NY4C 1UD5A 3ARFD 4AIOA 1DQQA 3E9TA 4X4KA 1Z0NA 2CQVA 4DT2A 2X2IA 4MYPA 1MUJA 5AAWC 1QI5A 3CFCL 3B1UA 3GDCA 4EI0A 1CLVA 4GAYA 4YGAB 4L0ZA 4JBSA 3F62A 4FFZL 3BLBA 1SXSA 1BFVL 5A3ID 1OE3A 5HYFA 2Y06L 3AFLA 4IU3A 3BW9B 5HJDA 4ELKB 1PY0A 5F7HA 1ZVSB 5I2IA 1BM3L 3H9HA 1T7ZA 3D4ZA 3MV8D 2QSTA 4B7IA 2R15A 2IG2L 4MVBD 3L3IB 1A6PA 1PJWA 3S5LA 3QULB 4Y2DB 3VXUE 1CD1B 3ECBA 3FZUD 4AYBA 2F54D 3LCYA 5CJXA 4Y1AA 1MELA 5I30H 1LK2A 1JD9A 1RHFA 1U30A 4N5ED 2OMWA 5GISL 2WBWB 1KCLA 1TMQA 3QEQB 4QOKE 2FUQA 1V7ML 1PIFA 3AQZA 4LCWD 5JOEA 1L9PA 4XAWH 3TN0D 4X6DA 4F8LA 4IK7A 3ARBC 3OB0H 2BS8A 3LN5B 4OUOA 3ES6A 3IMUA 4GUPB 4C4BA 4G7YH 4KRMB 1KCSL 4RIRB 3MBEA 4HJJL 3POCA 3Q8EA 2YPLE 3NJMA 4Z7WA 5GGSY 2CK0H 3MREB 1U93A 1AQHA 5DZJA 2J43A 4LSSL 3OG4B 2J8UE 2JKLA 3ULUD 1X4ZA 2NLJA 3RHWF 4DOHE 4PRAB 5EBWA 4C83B 4JCMA 3T65B 1MW3A 2XKNB 4GG6F 2YXMA 3BMVA 5JPMC 5AB0A 1J1OH 2LU7A 1A6WL 1CD9B 2PO6A 1QRNE 2AK4D 4M1GL 3OKMB 1N5YL 4QRBA 2NY5H 3K46A 2N01B 4KK9C 2EC8A 3HUJF 1TU2A 1KYOJ 4ZFOB 3O6KH 5A40E 2PPAA 2WHVA 1NWPA 4PRPA 4C58B 4LASH 1B4TA 1HL9A 1II4E 1U8QA 1OSPL 2CE6A 2V9QA 4JE4B 3NMEA 2PYED 3L81A 4K5MA 5A2FA 5DQJA 1KACB 4A7GA 3MLVH 1HOCA 1T80A 4OM1L 3VX1A 3FQYA 5IQ9B 5JZ7D 3VMPA 2BK8A 2V17H 4EI5B 1WFMA 5EBLA 2YRBA 2X05A 5IB2B 3O8XD 3ZZ1A 1NBZA 3SEPA 3LPGA 5BO1H 3GJEA 3WKPA 4HWBL 3TWCL 2FH8A 5IFJA 3L9BA 2F1BA 4DQAA 3T1FB 1D5XB 1VGKA 4BZ1A 5LDSA 4LNVA 1RSFA 3BVNA 4E9RA 3L2MA 4YSQA 5SWQA 3DGDA 2CDFA 1NM4A 3ULUF 2DYRB 4OTXL 2CR0A 1E4WL 3EYOB 3EJQA 2I7OA 4EIUA 3RG1C 3CTTA 1FUNA 2VH5L 3IAPA 5DYOA 3S36H 1ZJAA 1BFTA 3FPXA 3GRWA 1SLXA 1IBGH 3AROA 5DMGC 1OAUH 4ZMLA 4I89A 4IEFA 3TP4A 5LDUA 4ORGA 4PJHA 4QXUH 1A8JH 2CKBL 2HRPH 2XX1A 3CX5J 3QPQC 4ZMVA 5E2JA 2OR8A 4FXGC 2Q86B 5D1XE 4NYLB 4P99A 3K3QA 4HPYH 4CSSA 2DQEL 2OMTA 4GRLD 4JLRA 1TVBA 3TYGH 3WTVA 3BIBX 3QQ3B 4U6XB 2CA3A 1RHHA 4A2LA 5KJRL 4HCRA 2E0PA 2XVKA 4PG2A 3KHQA 3U46A 5D4HA 1CVSC 4AZ8B 2DOCA 2HVJA 2VR7A 4EZJA 3JTBA 1HX0A 3QNYB 5C92A 4ZT1A 3P30H 1PZ3A 3MNWA 3DVFA 2JQZA 3QIWA 1M05A 1KBVA 1NCOA 1AGCA 4GG8A 2H6OA 1IBZA 4LLAA 5IREA 2B1OA 2XQYK 3EADA 2B3IA 4UTCA 5D70L 3T3MB 1RFDL 3V4VA 1AFVL 2R1XB 2J5LC 3KH4A 3HI5L 4I77H 3MLZL 3WNLA 1UGKA 1X3DA 2F53D 5CHNB 3P4LA 4MHHI 2NUPA 4I88A 4MWFB 1SZNA 1YEFH 3VWKB 4B5ZA 1RIVL 2ZXCA 3IKCB 4U6YA 5ITBL 3FF8A 3RPKA 2QVIA 3DUUA 1HKFA 2KZ1B 1MCEA 3CLFH 3EYSL 4B3EA 3MC0A 4M48H 1UOWA 1XSOA 3OXRB 1T04B 4JFED 2G5BB 5FUOH 3TFKD 1JBJA 1KSRA 2NR6D 3VTMA 5GS1C 4X5WA 1QWHA 3BUBA 1NFIA 2D7OA 4J1UB 1MWAB 3FFCB 3ARTA 3FTZA 5A7BA 3SDDA 4Z5RB 4U4IA 3L1OH 4OQTA 4UU9A 2ERJB 3I6LD 1H9DA 4HOWA 2WPGA 5J1AB 1AR1D 5J06A 2DI7A 4QXVA 1YEGH 2UXGA 2F15A 5EUKA 3MXWH 2XNAB 2J1ZA 2WXLA 5TE4H 4E5XA 2R1WB 3QNZB 4W68A 5F7BA 3WY2A 1CICC 1E3XA 5FCUL 3RKDC 2CLRB 1QW9A 4AIZB 1FJ1B 1MKFA 1R47A 2ZG2A 3VXME 3GMOA 5KWYC 1Z2KA 4MHHG 3QUXB 3UTPE 4I7ZC 4PREA 4PCKA 4RFOH 4WFFE 3UTZB 4QRFA 2E4TA 1P9MA 2G3MA 4Y7OC 4DH2A 3CSYB 3MRHB 3FH7A 4HKBA 1F00I 4JY4A 3IMRA 3VU1A 3FTXA 3P40A 3O0RH 1CE1H 3RA7H 3V6BR 4KTDL 2OBGA 2GAZA 5DK2A 2OSWA 3CPUA 3K1KC 5FYLH 1NMBH 1B0GA 1HXKA 4KTEL 4G42A 5FO7B 1MY7A 4CVZA 1QSFD 4H8HA 2YXFA 4YFEA 5HHVH 2FQFA 2YPLB 4QHPA 2M1KA 3GSNB 1RD6A 1UOVA 1UWEL 4TLUA 43C9A 4KO7A 3HBQA 3QPKA 3TZVD 2WBJA 1DUYA 4KDTA 3WIIH 3UC2A 3UJJL 4KHTH 4L3AA 5IFAL 1LNUA 1S8DA 4MJJA 4K8RC 1ZSDA 4QRRE 3EFOB 3PDDA 5BRZE 3CV5A 4WNQA 2ZPKH 3RWHB 4ZX6A 4ZW6A 3NACL 3VXNB 5IMMB 1R1CA 2DQFA 1WV7T 4V1DB 2VSCA 2BP0B 3VQ1C 2O6PA 4NHCL 2J8OA 3NIFE 4RAUA 3LH2H 4XVSL 3UFIA 3LZQA 4JRYB 4UMSA 3DO7B 2X89D 4N86A 1MVUB 1N59B 1PZSA 3S37X 4BQ8A 4U1MB 3EFDH 1MFVA 2OTPA 1AHKA 1XSJA 3NJFA 2P8LA 3INUL 4QPEA 1XGRA 2VDNB 3AITA 2A6JA 3UTQB 4BK4A 1PZCA 1RP8A 2D0HA 2WD0A 1HHGB 4HXAH 3FCTA 1S9WB 5I0WA 1AGBB 3SGDI 4PJCA 15C8H 1BQLH 1G7QA 3KL3A 4GYBA 1Q90A 4MMXB 4M5ZH 4FTVE 3VFWA 5F3HB 2MWCA 2V9UA 2JJSA 2AQ2A 1YQ2A 4R2GC 2AV1A 4MCZB 4YO0B 1QOKA 2FSEA 3I2CL 3KE0A 4KVNL 4ABWA 5TJWK 5LCVL 2DQIL 2OV0A 3CK0H 3GB7A 1FQ9C 5B1CA 5I5JA 3DV6A 4GG6E 2UZYA 1QAWA 1TFPA 3BGMA 5CEZL 1H15A 3BVXA 3EZJB 5T1KD 1W6LA 1KY6A 2A1WH 5IB3A 1Z9OA 1A4JB 3WFDH 4FQLL 4OVVA 4YDIL 1NCWL 4N2LA 4PYGA 5D1XB 2W88A 2HT4C 3GXIA 3MX0A 3B9AA 1P2CB 1BEYL 1V55B 3WV0A 4DO4A 1SOKA 4KDWA 4W9LC 1NUFA 2C7UB 3AY4A 3O9WB 2HJKB 2F7PA 3F83A 3VYNA 2BOCA 4PY7B 3UDWC 3V4PA 4FDWA 5E1AA 4PB9L 1UOLA 3B9EA 1T1XA 3A6OA 2NY1B 2ADIB 4LEXL 3KJ4B 1G4RA 2DWEB 1I8KB 4X5XA 4M61A 2ICES 4BSWA 1ADQL 1AHWB 3BEWA 4AE0A 5I8CB 1D5IH 2VLJD 3DSFL 4P2RD 3V5KA 4NUJA 1DANT 2BVQA 1EJOL 3KPLA 3RNQB 1H3GA 2X4TA 2AGJH 3TA3C 4C56B 2R9HD 4CN4A 1FFPA 1MHPL 5C2BL 2A2QT 3HCVA 3E6FB 2CH8A 3LIZA 3HIZA 1GAFH 3N5AA 2HRHA 3NABH 4KOCA 4MKMA 3K2KA 1D7DA 3QEGH 4J3XA 1GZQB 2YQ3A 1R33A 5FKAA 4XZ4A 4NQUA 5AD0B 5E6UB 2N56A 4QCIB 5FYLE 1AY1L 2ZXDA 5DT1L 3ZDYB 4G9FB 3L3JB 3BKCL 3BFQG 1SQ2N 2APBA 3F7LA 5BQ7A 4M1DH 1QFWH 2BXYA 1EXUA 1ZLSH 2WKGA 4ABVA 4TQHA 3LAFA 4LRIC 3NH7L 4ZMAT 2Z4QA 1XZ0B 2NTFB 2TAAA 3GLAA 1FL5A 2YMOA 1KB3A 3KNBB 2F19L 3WLWC 4KMTL 2JKRM 2ITDB 4TUKH 1OSZA 1AO7B 4TQEL 4AYSA 4MB5A 4R5VA 3LZLA 4HS8L 1IQWL 2CGYA 4OW6A 2VM3A 3KXFB 5IIEB 5AZUA 3KW8A 5LHDA 1NLBL 5C08E 5I5IA 2X9ZA 3Q1SL 3UCRA 5FR3A 3GXTA 2JH2A 2K70A 3ZR5A 4GKNB 4LSVL 3SBRA 2I9LB 2DI8A 3ULVF 2I69A 3K2UL 5E8DH 2AEPH 1KJ2H 4H4NA 4PQXA 4Y5VB 1JXJA 3BEVA 3QS3A 4RAVB 1M4KA 3WE1A 2HKFH 3QH3B 4W9CC 4WTQA 2FEEL 4LSPH 3I6KB 3VXOB 2X2UA 3VQ2C 5ESVA 5FOJA 1NBQA 4PJIF 2BNQB 2NY6B 2J6EH 2FYYB 1NC4D 1A1MA 4I3SL 1SJXA 4Y19D 3CSBA 3GTVA 5EOCJ 3VI4A 1INEH 1QLEB 5GGRA 2ZP0T 5CSZA 4J4PC 5B38B 2F7QA 4CADB 2LU3A 5KOVC 5CJBA 2FBOJ 4IRZA 5K9OA 3G08A 4F3FA 2LTQC 1XTLA 3WHXA 1WEJL 4Q9QL 4AX3A 5FUCC 4Y7MA 5ALCH 3UZEC 5ACLA 4WSKA 2MOQA 3SKOA 2YD3A 4WTZG 5I8KH 4JRXD 2H3KA 4Z7UF 4F15B 1KNOB 3HNVH 3SE9H 4FQCH 4FQHB 1T5WA 3EYUH 4X8CA 4FKKA 4GXVH 4MRBA 1E28B 1G7HB 3ET9F 3LKRB 4FQIL 4G8FA 3F7YB 1OCWH 3LKOA 4U1JA 1N8ZB 4P4KD 5IKCA 4WNJA 5ID1B 4BCXA 3DX8A 3HHMA 2NXZC 2UV3A 3FL7A 2VDOL 4NN6C 2H0PA 4YVUA 5HDQH 1F41A 3UPAA 1ZJBA 4NRZA 1S5HA 4BZ2L 4MCYB 1HQRB 1QI3A 2FIKA 4AXWA 1R5WA 4BFEA 2BFVH 1UXSB 5F71A 3QEUB 5E2VH 4ONGL 1U6AH 2FD6L 3NJXA 4Y9BA 4HLZH 3ARDC 5I19L 4BFRA 2AQNA 2SODB 1B3IA 1LK3H 1DO5A 2BXZA 1V05A 4C4UA 4FQJH 4YSOA 1SMOA 1WA1X 1ZD6A 5CILH 3M07A 5K9QI 3F05A 2CO4A 1XF3B 4PW9A 1LO0H 1RK7A 2NW3B 3O6LH 5DD3H 2B9AA 5BXFB 1ZS2A 1KG0B 3CFMA 4GFXA 3DNKA 4ALAH 1MCPL 3KS0J 5D4IA 4AW7A 4QY8B 1N0LB 3GHBH 2EKSB 2C1PA 3GMMA 1R5IB 2A6KA 4I2XA 1R3HA 2WP3O 3C09B 3QO0A 5KSAB 4RX4A 4JO1H 3GXDA 2C9RA 2I85A 1UXWA 2C3HA 2DF3A 3PGFL 4J3SA 5B8CB 3W5NA 1FN4A 1U8MB 2K8MA 4TSBL 4X6EA 3NGBB 2D7MA 1AXSA 1B4JH 3L5WA 1CTOA 1X5ZA 1XCQA 3C5ZC 2ADYA 4XI5C 1BQ5A 4QT5A 3ZJAA 4FNRA 2X4PB 5D7IA 4MMYA 2CO6A 3KYKL 3EUUA 1EA9C 3V0AC 3MRIA 1NCNA 4NZRL 4EIZC 2BOLA 3PXJA 4N20A 3SJVB 2VQ1A 3FB5A 1MW2A 2X2YA 5TK4A 4XNZB 2X0VA 3FT1A 3VRIA 3K72A 3RDTB 5IY5B 2MCAA 4N2KA 4KY2A 4XPBH 1C12B 2WBXA 3PWPA 3HG1E 4ZTOH 5HY9B 2QELA 3IJEB 2A9DA 2NDFA 3DA0A 1HILA 5KJ4A 1IC5L 4HH8A 4R97C 5D6DA 1MCQA 1P5VB 2YEZA 5T1JA 1WIUA 4HLZG 3KWUA 1HZHL 1GOFA 2ZT9C 1OAZL 4LPYA 4GW4A 3FT2A 3FN9A 2N1KA 4PSRA 1KB9K 4QWWD 5D55A 5GRYA 4Z76B 4JFFD 4W93A 1S7SA 4WU5B 4G72B 5I5RA 2W91A 2EEAA 2WQUA 5DVNA 4AMXA 3BFWA 4R90H 4RFNB 3ARPA 1GYAA 2PXYD 3E1ZA 1JZDC 1KXVA 3T0BA 4I9WD 1UVQA 4FNUA 4HOMA 3V6OC 1FZKA 4K3DL 5JIIA 1FNSH 4QTIL 1VPOL 2OMVB 2R69A 5GZOD 1JVOA 4WI3A 4MAUL 5KOMC 1UB6A 4KKAC 1LP9A 3BISA 1KV3A 4Z95L 5F93C 4YXLL 4R3SA 3PJLA 5IESH 3BXNA 1CXLA 1PSKL 1CQKA 3IFPA 2FWOB 3DDFA 4ZX3A 1N67A 4U3CA 3ASWA 5CJQH 3OR7A 4OQ1A 3HS8A 4KTGA 4EBQL 5HHOD 1JNJA 4P2QE 2UUDH 4UT7L 1PTZA 3LTVA 3MLUH 3APMA 1G9HA 2EH8H 1N0XH 1UWGL 2AXFB 1KJMA 1IKNA 2XZAH 1EQWA 1OOAA 3ETBJ 4O58H 5I1GL 3FCSA 5A6IA 3M1OA 3H9SD 1JG9A 4R84A 3SPVB 1W0WA 3ZTJG 3GNML 1Z32X 2BWQA 2QDVA 4CVXA 2ZE0A 1T2JA 4PJEB 1RZ7L 1KIRA 5C0RL 3GMRA 1DVSA 3CZNA 1E4JA 3MV9B 5I0VA 4Y0GA 1XD1A 2BVPB 1IE5A 3ZHLA 1INDL 1M57B 1X5LA 2R29A 4XP6H 2UYLA 4Y4KA 4LCIH 2XJLA 2ZSVA 3B56A 1EO7A 2P47B 4TVPL 4O2FB 4AJWA 1YUHB 4NQEE 2HLAB 4BFOA 3RBSA 4DZBB 1FNGB 2CIIB 3S4SB 3ZQWA 3BQUA 2KL6A 3KDMA 4MVBC 4M4RB 3FZUC 4OZIE 3WI9A 1A4BA 1QLFA 4MQ7A 4N5EC 2YEVB 1GGCL 5IV2B 5CBAA 1XZWA 3L9EA 5IR1A 4G7QB 4MD5B 2GSGB 1QFWM 3AT8A 4CU7A 5I8EB 3OKLB 3TN0C 3ZE2E 3LEXB 4E5XG 2FJGA 4R0LC 2IF7A 4N0RA 3DX6A 4ZYKA 4PJGF 4KNUA 4M3JA 5MERB 3WGUB 1OPGH 1U8HB 3BGFC 4PFEA 3CVIH 2XWCA 1S7RA 5J3HD 3ALWA 4E0RA 4HHGA 3ULUC 5F7FA 2L8AA 4OZFH 4Q9RH 2RH0A 3KR3H 3UZVA 3DVNA 4AUYA 5SX5H 3OKYA 1IV8A 5GZND 3CQQA 3L3KA 4EI5D 1Y18A 4K7PH 1IBYA 5D2NE 4DGIH 5IOPA 1HL8A 4IGBD 1UM5H 4G5ZL 5A2BA 5BW7A 2CGRH 4PP2B 3FO1B 3FYIB 4Z7VE 3MA7B 2OYMA 2G4EA 1A9VA 3CFDA 2AEOA 5AAMC 1ZHBB 1TITA 2O5NA 4PS4L 3N1QC 3SE8H 2AZAA 3HZYA 4YHKL 5J5EA 3DX7B 3PP4L 4K5LA 2ZIDA 1FVEB 1KPRB 5ENWB 5ICYB 4JR9H 2P5EB 4TSAH 3E0GA 4TUJA 1EO5A 1LEKB 4R4FH 1N3NA 4UT6L 1JPST 3VFOA 3WD5L 5IEKB 5JZ7C 2VNCA 1IBFA 2W94A 1IFHL 3VGAC 4WHTA 3GBNH 3LXUX 5H35A 3WO4C 3VFVB 3ZMNA 2Z8SA 3DK2A 3P73A 1WG3A 1UG9A 3FBQA 1OVZA 4YN3A 1F3DJ 1ZTXH 4L4TA 4OLYH 5CZXC 4JM2B 1T4KB 4WCYH 3U6XS 1UCBH 2G9HA 1KCUL 1A3LL 3AS0A 4YDKL 1DQTA 3QDME 3SCMA 2C1OB 3M86A 2GQHA 5HYSB 4K94H 5D4QA 3BLKA 3IVKA 1NAMH 3RTQA 3MNDA 5E4EC 4PJXE 1TT6A 4PJBE 4XO8A 2JCCB 1YNKH 4GIOA 3QCVH 5CINL 5DJ0A 2XPZA 2HMID 3FTYA 2WIMA 1SXBA 3IMSA 4FXTA 2NNAA 2H32A 5E6IB 4E68A 1L9RA 3QIBB 4HIHB 1BHGA 1G6RA 3F12A 4FXKC 2FT8A 3S9DB 3WJMB 3JT0A 1NPJA 4NKOA 4HWZA 4UILL 1DJIA 2BSRA 5LBSL 2FX8H 3NSXA 1IT9L 5BS0E 2CKBB 4HIQA 4JKLA 4ZMWA 1DLHA 1YNLL 3CFJA 4PJAF 2A3TA 4P06A 2KERA 1IGJB 3ZY7A 2YSSB 4GRLC 1A6UH 2QMJA 3LS5L 4NFDA 1WZ1L 3TBBA 3PP3K 4MJHA 2J6WA 7PCYA 2X38A 4JZNB 5KVDH 1GSMA 4H13C 4S11A 2Y5QA 4OZFG 5DURB 3VSQA 1Y0LA 3CNKA 4FF9A 3VWKD 3TCTA 4B9FA 1RVFL 3MR9B 1A4KA 4NENA 4WV1B 1F11A 3V4UH 2KZWA 4DN4H 4XBPA 3CAFA 1XX9C 4UZSA 5GSVA 5KSBA 2Z1PA 2ALAA 1CLCA 2WLMA 2QTVA 2XPGA 4AEIH 1G9MH 1S9YB 2P5PA 4H7VA 3KWTA 3QIUA 1T0OA 3IDGB 5AYQA 4HUUB 1VFUA 3ZKXC 4KXBA 5IK3A 4H8UA 2W95A 4P5MA 4LSRH 1BBJA 5CN1A 1WC7A 3OAUL 1WUNT 3WMSA 2GEQA 2JB5L 1HDMA 43CAB 1XGUA 5JMRA 1OARL 1E50A 4HKZB 3WHE0 3J27A 3MSPA 4UQIM 5FV2A 3TC9A 4KJYA 4JKWA 4DUWA 1BZOA 3T3MF 4UAOC 4YAQB 3TFKC 1IQDB 5C9JA 4GSDL 3DYPA 2Z34A 2WAQA 4DN3H 1SHMA 4ELMF 3VXUD 3QUXD 4M3HA 3FQTB 4WWKB 3BDXA 1G7IB 5CN3A 1TZHA 4Y5XB 3TX4A 1EAJA 4ZPTB 2W38A 2ROXA 5JW4R 1UA7A 4AT6A 4QOKD 2IQ9L 4BUGA 1OWWA 2QGDA 5FA4A 1JK8B 4GT7A 5DHEA 4OGYH 4GMTL 2EO7A 2RACA 3BP4A 3NTCH 4H8WC 4CNIA 3HR5B 2ZYSA 1U95A 4X6CB 2VAAA 4DQOL 1A3RH 3L4XA 2YPLD 2HA1A 4YC2B 4RGNB 1CGTA 5DHDA 4F93B 1JWUA 1NGPH 4Q6IC 1RJCA 4MCMA 1UZ6E 4KZCA 4I5BB 3N44F 4QHNA 2H9GB 5D1QA 2EXYD 1KWGA 4F7EB 1XT5A 3JBG7 3N3EA 2J44A 1QRND 2IH1A 2YGPA 2XVLA 4LESA 1DBAL 4M6OL 3QQDB 4JQXC 4NUPA 5SWSE 1GKEA 1JN6A 4IKIA 3L9RB 5E94A 5HYJE 1TJIH 4EMZA 1NIFA 5JLZB 3MXVH 1ZTXE 2YEQA 4U1SB 3V9FA 4OZGE 4B9PA 4M7LT 2MEJB 3KPPA 5AW7B 1OGTA 4J7RA 5AL8A 4KROC 1AZUA 4PRNA 4L3CB 2N59A 4OBSA 1OB1A 2YAMA 3TZVC 4AQ1B 3RZCD 2ED7A 1UH4A 4XPAH 4U1GB 4FABH 1KLGA 5D2NB 4XXCA 4L1HA 4PJ9A 2VDQH 1CPUA 3MOBH 2EC9T 5AKTA 4J3OH 5A16A 1KXTA 5E23A 4HCGA 5D7KE 5F1SA 3PWLB 5I1DA 2ADGA 1MREH 2DIBA 2X4QA 2Z31A 3AJ7A 1U58A 1WAAE 2VWEC 2WP3T 4LPXA 4DK6A 3EO1A 5DQDL 3IFNL 1PAZA 4JJOA 5DJ8B 5IROA 4QUOA 2H3NB 4OV6F 1SYSA 4H88H 4PRIA 3QFDA 1E4HA 1GMIA 1PG7X 4MLSA 2VABB 4OLZL 4Q74A 3LZFL 4XMPL 4L4JA 4MD4A 2Q87A 1TSRA 5KSVB 4IBUA 2Q7YB 3U4BH 3G6DH 5I1IL 4IIQB 4G8IB 3TH3T 3WLBB 5KVDE 4PVBA 3DVGB 1Q9OB 2V9RA 5HVHC