3WIHH

Crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKLSHGKSLEWIGDIVPNNGDTTYNQNFRGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARFSNYVYPFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAILQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Roundabout homolog 1
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 219
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihH02
1AGFB 1KBGL 5HGBB 1FRGL 3FQTA 4XHJD 4FFWC 1IGFH 4O4YL 3UO1H 2AERT 1EERB 2UZIL 5LG1A 4EN3D 4IMLA 2Q7YB 1NLBH 1ACYL 5FM8A 4IDJL 4R4BA 3IRPX 3S98A 2FX7L 4OF8A 3BSZH 3QEUB 5D7IA 5JA8B 3KPMA 2AJYH 4N9OB 4LPVA 1A5FL 4ODUB 5C86A 3MCG1 4FNLL 2LU7A 4XVTL 1QQDA 3KPRB 1JWMB 1QACA 4LFHD 3OKDA 2I5YH 3ECBA 4Q6YA 5D93B 1YMMA 1N59B 4LBEB 4OUUB 4LHJB 4H26A 1ZT1B 4P0DA 5JMRA 2J4WH 4F7CA 4PJ7B 4PJAA 3MUHL 1UXSB 4XCYB 3C8DA 4P9MH 3KNBA 5EO9A 1QBML 3P4NB 4MA1B 4FQHA 2HLFC 3QEQD 5IVOA 4TTGA 5EO1B 1TCRB 5C3LD 4N5EC 4HWNA 3MLWH 1FZJB 2DQCL 2RB8A 3BE1H 1ZLVH 2AS5M 4KKBD 2FYYB 2EIBA 3CLFH 3UPCA 4ELMA 4NN5C 1RMFL 1TQBC 1LP9F 4J3XA 5DJDA 4OCXL 5ISZE 4W6WB 4X8XA 2JIXB 3LKNA 5DTFB 4IMKA 2H3NB 5INDA 4BZ1H 3BPNB 1BMGA 4HKZA 5B39B 2LQRA 5E6IB 1CICA 1CGYA 3LN4B 3WD5L 4L4VB 3U36B 1KC5H 1URLA 3B2VL 4J1UB 1EK3A 2G2RA 2CR6A 2ID5A 4NHCL 2UWEA 3EYQC 3E3QC 3I6GB 5ETUA 3BD3A 3TVMA 3CSBA 4WFHE 5AZEL 3LQAC 3T1FA 1OVZA 3LEYL 1ZGLA 3MLZL 1KF9B 4NHUB 1OF2A 4KVNL 1U3ZA 3I3EA 4ZFOB 5F88A 1IAII 4S1SL 4JM2A 3O8XA 4P4RA 1CXFA 5L0QC 3FQTB 3IFOA 1NL0L 3X14A 3AAZA 4PTTA 1KGCD 4IMLB 4WNQA 5TF0A 1ACZA 3TLRA 1KN4L 4PFEA 3SQOL 2C4FU 4R4BB 4UOW1 2NY7L 4HWUA 2AV7A 3RIFK 4KI1A 4PY7A 3TEUA 3U7WH 2VDRL 4GQ9H 5D7IB 2OTWA 3AS2A 1TZIA 3KPMB 4FQJH 4HUKB 5AAMA 2VLKE 4R3SA 1V7MH 2BDNL 1OCWH 4QTIL 4N9GA 4NT6A 1LO3L 1A0QL 4K3DL 1QQDB 4NFBA 4DTGH 2DIAA 2CSPA 5TPWH 1MCEA 2IH3A 3QIBD 2XIDA 1MREH 5B3JF 3D9AH 3OKDB 3DRQA 3ECBB 1XCQA 1YMMB 1IFHL 2APTA 2NNAA 5DQ9A 5E00A 3PXHA 4H26B 5GSVA 1VGKA 1N3NA 4YHZL 4YDLB 2ZKHL 4F7CB 5A43C 4Z8FL 4S11A 4PJAB 3S88H 3EZ8A 2X89D 3R8QA 4L5FH 3KNBB 4XBGA 5EO9B 5I8OH 4HUNB 2W65A 4FQHB 3BRGC 2YD9A 4RAVA 1JPSH 3IFNL 2DM3A 4KZDL 5EU7E 1WWBX 1QG3A 1QTYT 1J12A 4ELMB 4JDZA 3ARSA 4XPBH 3TT3H 1G6RL 3QIWA 4WWKA 2P43B 4WI9A 4KQ3L 1K85A 5DJDB 1FYTD 5FUZL 5D1XD 3LKNB 1BHGA 4AMKL 4QTHA 2YD8A 1K8DA 5INDB 4HKZB 4D9QE 4JO2H 1CICB 4NQTA 4OCYL 2IAMD 3DUHA 2WUCL 2H8PA 3IDJA 2O5XH 2HYMA 4KJQC 1W0VA 2UWEB 2GJJA 5ETUB 3TVMB 3C5JA 5DJ2A 3RIAK 3T1FB 4KMTL 2DQJL 4OFYD 3UZVB 4LARH 2ZCHL 2YPLA 2E8ZA 3JUYA 2NZ9D 1HINH 2Q86A 4G9DA 3FJTA 1EGJA 1OF2B 4OGXH 5J13B 4MA8L 5F88B 1AE6H 1QD0A 3O8XB 2IQ9H 4P4RB 4OIIL 4MAYA 1IKNA 5FYJL 3GNMH 1NCAH 3PDGA 3IFOB 1KIPA 5DC0A 3X14B 2AK4D 4HDIA 3AAZB 4PTTB 4FOMA 3LB6C 4WNQB 4I4WA 4FFVD 3OAUL 1F42A 3U83A 2AV7B 3FO0H 5EU7C 4K3JH 4PY7B 3SKMB 1P7HL 2OTWB 3QXDA 1TZIB 4XVUC 3WDJA 4R3SB 3MOBH 2EICA 5CINH 3MBEA 1NC4D 1NGXA 4N9GB 2J6EA 2Y06H 5K9OA 4NT6B 3H2WA 1CLCA 3WJLC 3QWRA 3BEWA 5L9DH 2JELH 3P3YA 4WEBH 4CN1A 2IH3B 1JHLH 1RZGA 5FK9A 4LQFL 3FQRA 4G6FD 4BQ6A 4Y0GA 5IT2L 3DRQB 4NKMA 5FCUL 5CP3H 3ZDYF 2NNAB 2UUDH 5DQ9B 1AR1D 5E00B 1A6UL 4H0IA 1S7XA 4TVPH 5GSVB 1VGKB 5D71H 3QEGH 1N3NB 3LRSA 4U0RB 4ZS7L 1KG0A 3BH8A 1KENL 5EWIL 4M7JL 1CQKA 1RUQH 2DI9A 2WUBH 1C5BL 2HN7A 1OAKL 4XBGB 3QRGL 1F58L 4DZ8A 2H45A 5T3XL 2W65B 4X9FA 5DZLA 4JPIA 4RAVB 1QFWL 1J1OH 3VGAB 1B4RA 4OZGA 4JY6A 3NABH 1A3LL 4LCUA 1B0WA 3P4OA 4LCCC 1DE4A 3GEWB 4HXBH 4K7PL 4JDZB 2QQKH 3DYOA 3QIWB 4HFWA 4WWKB 5BO1H 5IW6A 4WUUA 4XMLL 1PX4A 3U0TA 3HZKA 3WUZA 1B90A 2ZUSA 4LMQE 1TNNA 4QTHB 5IUSA 1K8DB 3TBYA 4U1SA 2FSEA 4KPHH 1F90L 1CLOH 3DX8A 1D7FA 2OI9C 4KK8D 4KJWD 4NJAH 3O2VH 2H8PB 3IDJB 4MQXD 4JY4A 3SKJL 1W0VB 3RWFA 1DANT 2JLLA 5C0ND 3C5JB 3JV6A 3JTSA 5DJ2B 5T3ZE 2BX5A 5CEZH 1RUAH 2NXZB 5DRWA 3G5YA 2CDFA 2YPLB 5ELIA 1QNZL 2NLJA 3MOAL 5I1GH 1EO8L 2Q86B 1NAML 4G9DB 5AEAA 3HNSH 4LSVH 5FDWA 4MAYB 5AYUH 3MJ9A 5MHSD 2DQTH 1KIPB 1TIUA 1DQLL 4HDIB 3EJJX 3NTCH 1NCUA 4RGMB 1X5YA 4I4WB 1T0PB 5CIPH 5HHMB 5L88L 3BN3B 3RFZC 5EH1A 5E94A 3AROA 4XC3L 2ICWB 4H25A 2NY2B 3QXDB 3BD5A 3MBEB 4RGND 3VFOA 2JCCE 4W6XB 1NGXB 3QXVA 1JPGA 2F15A 4LSQH 5K9OB 3B9KA 4WUKL 3TN0C 3BEWB 3DOSA 1ZEAH 3WN5A 3D2UA 1RZGB 5DMJB 5FK9B 4KK5D 5H94A 3FQRB 2VLJE 4WCYH 1F3RB 2DICA 4NKMB 1JRHH 1L4IA 5C70A 5T5FL 4LCWD 4LVOC 1G7LA 4B53A 1H3PL 1S7XB 3ULUD 3SDYL 1PSKH 4MZ2A 2W9DL 4PJGF 3LRSB 4R4NC 1KG0B 3IB4A 4DK3A 3BH8B 3TJHC 3GJEA 4HGMA 4RA0C 3B83A 3MFGB 2HN7B 4DZ8B 5DA4A 3IAQA 5E2UH 1ND0A 4JPIB 2WIMA 1D9KC 4OZGB 5I1CH 4JY6B 3S3PA 3KLHD 5E5RB 4Q9RH 4LCUB 3P4OB 2FIKA 4UT7H 1L0XA 3VXPA 1DE4B 2ENYA 4FFZH 5T5NG 1K3IA 1IAIL 4GRWE 1JF1A 4HQQH 4XC1H 4HFWB 5IW6B 4WUUB 5EU6A 3RBSA 3U0TB 3HZKB 5JXEC 2MFNA 3HMWL 3W2DH 3O3BA 1JMZA 3GMMA 3TBYB 4U1SB 5E56A 2FSEB 4G7VL 5ILTH 3DX8B 5KOVC 3NFSL 4CL7A 2VC2L 4JY4B 1EV2E 3RWFB 1T83C 2WWMD 3JV6B 3JTSB 3VFUA 4Y4KD 1XGYH 3G5YB 5DRWB 3WFDH 2CDFB 2A6IA 4U6VL 2NLJB 4PJ9D 3NZHH 1MWAL 1LWRA 1F6AA 1JYXA 4ZO6A 2E9JA 4KK6C 4TNWF 2VLRA 5FDWB 5I16A 4FP8L 1NQBA 2H2PD 2IF7A 3CD4A 2VDQH 2B39A 4R26H 3MLXL 3HG1A 4LU5H 3ARDD 2BNRA 5E94B 3HHRB 4H25B 1UM5L 3ET9F 4S1DD 3S36X 3UMTA 1KB5A 3GM0A 3KYNA 4M02A 2KKQA 3VFOB 3EYFA 1CI5A 1JPGB 4N0UB 1WWWX 2AABL 1Z3GL 3ESVF 5I15H 2EYRA 3MXWL 3WN5B 3D2UB 3AFLA 4LIQH 5H94B 4N8CL 3QSKB 5IHLB 5J7CC 1BOYA 1OAQH 2GTWA 2YMXH 4P3WA 1RURH 1G7LB 4YFLI 4O2EA 1XGTA 5L2KA 5DJXA 4J3TA 5K9JL 2QQNL 4Z6AT 3GJEB 5IBTL 3DWTA 1HCVA 4X80H 5JOFA 2DLIA 4ZAKC 1ND0B 5F7NC 5FYKL 1TJGH 3GI9L 3RBGA 3MJ6A 2VSCA 3ZLQC 2FIKB 4LCIL 2YZ1A 3VXPB 2Q6WA 3TA3D 5JMOC 1JF1B 3WV0A 3UJJH 4JG0H 5JDSA 1U95A 2D0HA 4L8SA 4QGYA 5BCAA 5C0DB 5EU6B 1HN1A 2YUWA 3BT2L 1EO5A 4ESKA 4JY5L 3O3BB 2DF3A 2FH6A 4X6CF 3GMMB 2J88H 4YO0A 3MGOA 4FMKA 3ARTA 4KTYA 3SBWC 1OARL 2MPAH 3VFSA 4OZHA 4UB0H 5JW4M 3Q1SL 3CX5K 4LLUA 3MV8D 2VERN 1NGWA 4TQEL 5KS9A 4DUWA 5IMOA 3VFUB 2EDTA 3B8SA 1YEHL 1RV6X 2A6IB 2QV2A 2WK2A 1F6AB 1YY9D 3QG7H 2CMRH 3EYQD 2VLRB 1F45A 5I16B 3N9GH 3V95A 1TQBB 3TZVC 3NAAH 3W9DB 4XVJH 4E9LA 4KMQA 2O5ZL 1EEQA 3JWDL 3HG1B 3OAZK 3WDIA 4M5YH 2BNRB 4R4FH 5EOCL 2R0LL 1UVQA 3OX8A 5GRXG 3U79A 2YK1L 4EJ1C 1QSFE 2ZUYA 1QO3A 4OGYL 3QAZC 4Q9CA 1HILA 2Q3ZA 3KYNB 4HBQA 1MCOL 5CEYA 3GUTA 4OT1H 2G75B 5IESL 1U3YA 2PTTA 3EYFB 3UJIL 1QSVA 4NQEE 1WIUA 5HPOA 3QUYC 1EA9C 5SX4H 2EYRB 3B6SA 5B3JE 4I3SL 5HSFA 4POYA 3RWEB 3BDXA 1U8KA 3UPAA 1CYGA 4XVSH 3IFLL 5L0QB 2GTWB 5EN2A 4Z7OF 3K4AA 4GFTB 3EDFA 2XV6B 4HUXA 1P9MA 5ISZD 4O2EB 3EZJB 1XGTB 4ZDHA 1ZLWH 1PAMA 5L2KB 5DJXB 3PV6A 2EH8L 2BCKA 5CP3A 2A6KA 4YE4H 2XZQH 5J89A 4Z7UA 1CZ8L 1PY9A 4I0KA 1P84J 4P4KC 5JOFB 2DI7A 4OD3L 3N1PC 5C8JA 3SE4A 3O4LA 3F65A 1YZZA 4WFHD 4UIKL 3OAYH 1JZ4A 1ZANH 1HQ4A 1LE9A 4PJHA 2Q6WB 3BPLC 4E41D 4GKOA 2VDKH 3SDCD 5JDSB 1U95B 4L8SB 4FZEL 3VFTA 2FBJL 3QIUC 1NBYA 4NN7C 3JWOC 4ZNEA 1JNLL 43C9A 4YO0B 3MGOB 4Z7VE 4EQ3A 4PJFA 4YK4B 4CJ1A 3TF7C 4EUPH 2BY0A 3VFSB 4NBZB 5JIIA 4OZHB 5T33L 4LLUB 1YEJH 1NGWB 2XXCB 3WFEH 5KS9B 2ZNXA 5IMOB 5F1IA 2DL2A 1JMXA 3WFCL 3OZ9H 4DAGL 2VLKD 2DQHL 4RGOH 3SDXF 1QP1A 3T0EE 2YD7A 4D0DA 1MNUH 1RZ7L 9CGTA 2I9TA 3QQNA 2F53E 1F4HA 2G5BA 4M6MH 1A3RH 4G8GE 4KKAC 2IPKA 5E1HB 4L9DA 1C8PA 1UVQB 3OX8B 4PGDA 1JYNA 1KSRA 2B4CC 1RJLA 1QO3B 5GHWL 5CIPA 4HX1A 2XTJE 2Z8RA 3GZKA 4PB0H 1HIML 3WS3B 4XPFL 3GUTB 3C2SA 1PZ5A 4K8RC 3FTGA 4DGVH 4LDLB 4KU1A 4XWGL 1N4XH 1PQZA 4I5BA 2AI0H 1E4WH 4HSQA 3B6SB 3ZHDA 1ES0A 3CMOL 4F9LC 3T77A 1U8KB 4Q97A 3FO9A 1XT5A 5EN2B 2OSLA 4HUXB 5IB3A 3I75A 4ZDHB 4CNIA 3HKFA 4YDKH 3PV6B 2GCYA 2BCKB 5DT1H 4D9QD 2I60L 2A6KB 2YD5A 4XMPL 4I48B 4Z7UB 2Y9RT 5ITBH 3T8XB 3LZFL 3RVVD 5C8JB 3MBXL 3SGDI 3O4LB 1MHPH 4QNPF 3CVIL 1HQ4B 4BSVA 4GO6B 3TN0A 5C0CA 1GGTA 4MNGA 4PJHB 1HXMA 5DD1L 1C5DA 1U3HD 4OKVB 3VFTB 1SY6H 3LQMA 1NBYB 3GSRB 1U9KA 3EYVA 43C9B 4Z7WF 1UKSA 5I1EL 3ZKXB 4DN4H 4PJFB 4DEPC 3SCMA 4ZD3L 2OL3L 2X1QA 3B5HA 3EOAA 1N26A 5KVEH 3L3HA 3VW3L 2WBJC 2YWYA 5FDYA 4DGIL 1WIPA 2R23A 4JB9L 5J9PA 5TFSH 5F1OB 4K71C 4D0DB 3NH7H 1H3VA 4DQOH 2EE2A 4XPHL 3SEPA 3TBVA 1NCWL 2I9TB 1J88A 2G5BB 3HE6D 1BQLH 3IETA 5EIQA 5IVXF 6FABL 3V52H 2IPKB 1MQKH 4YFDB 2OI9B 2XG4A 5DD3L 2Y07L 4PGDB 1OPGH 3G9VA 1RJLB 4J7RA 4HJ0C 5CIPB 4HX1B 3MLPA 1ORSA 3FOMA 3LQZA 5C0RH 1T83A 4HEME 4DGYL 5DR5H 1PZ5B 4X5XA 1V7NH 2FX8H 3FTGB 5SWSE 1FORH 5J12C 1PQZB 4I5BB 4Z9KB 5FGBC 1AY1H 2BHZA 1F6LL 2WLYA 4UDTA 1ZHNA 4I1NB 3L5WA 3T77B 3H9YA 4FQIH 4R7DA 2A77H 4XCEA 1S7UA 3FO9B 5I6XB 4XPTH 4YHML 2OSLB 2RFXA 1YEIL 3VXSA 3I75B 5IB3B 4PJGE 4CNIB 3EFFA 2GCYB 2R29H 4P23C 4NZRL 3DRTA 4JHBA 3U30C 3LKRA 3WLWC 2PXYA 3PL6C 4QRTA 4XCCH 3TV3H 5DJAA 5ICYA 4Y4FB 5T3ZD 4NDMA 4BSVB 4X4YA 1JPST 3TN0B 5C0CB 5IQ7H 4MNGB 3TPUA 4GBXD 4MNQE 5KZCD 4ZO7A 1HXMB 2YPVH 3WSQL 1C5DB 1T6VN 4RWHA 4DZBA 2FRGP 4KKLD 4LEXL 1D9KD 4DCQA 1EFQA 4NKQB 3BKYL 3EYVB 5KVFH 4J4PC 3QDJE 4JVUA 1FLRL 3QUML 5EOTB 2CKBL 1SYSA 3HAEA 1FHGA 4P2QA 5JW4R 4NQDE 5BZWA 3SCMB 2P8LA 3WFHA 5AWNH 1KEGL 2Z8SA 2XN9A 3EOAB 3L5XL 4I2XA 1RAMA 4K94L 4BK4A 3G6JF 1KTRL 2VWEE 5DFVC 3DYPA 4N1HB 2R23B 3SDDC 5GRVL 5J9PB 5E99H 1CQYA 3VXQA 3PP3K 3ABZA 3KPLA 3ARFC 3NA9H 4YHOL 4P59H 1P1ZA 1P69B 3S34L 3TBVB 5HDBE 3MRGA 2VLJD 4EIZC 3MXVH 5TE7H 1ZHLA 2FJFA 3K4ZA 1KN2H 5HHVH 3IETB 2JJWA 1OTSD 4AK1A 5KSAD 4P2OA 4TVSa 4AQOA 4NKIH 3SBWA 1PG7W 3K2UH 2ZWLT 2E27L 2GIYA 3ULVH 1ORSB 3FOMB 1I9EA 3LQZB 3LKQA 3U4BL 1T4KA 1BFSA 1H8SA 3F7PC 4X5XB 5E9DA 3UDWC 2JE8A 2GSGA 2D7QA 5SWZA 4UDTB 1ZHNB 1MVFA 4JRYA 3L5WB 5HGDA 4R7DB 5KN5A 4HIJA 4XCEB 1S7UB 5D1QA 1IKFL 1DQDH 1JVKA 4OZ4A 5ANMA 1D6VH 1N7MH 2RFXB 3V0WL 3VXSB 5C07A 1AD0A 4OLYH 1NCBL 1WITA 3EFFB 3ARBC 5CUSH 3NCFB 3DRTB 4K2UL 3KLDA 1CR9L 4NZUL 1GCFA 3LKRB 2HT4C 4N0RA 4BFEA 3EDJA 2PXYB 1LK3H 4HIHA 1IEBA 4QRTB 3VXTB 1YPZE 5DJAB 5ICYB 1RZIA 4NDMB 4JN1H 4X4YB 4ONFL 1OM3H 3QUYA 3TPUB 1U8IA 3QUXD 5I66A 1FN4A 4KAQH 1TJIL 5D2LE 3PWNA 3VWKC 3DECA 4DZBB 5LJYH 3KPNA 1KTKE 4S1QH 4DCQB 3ULUH 1P7KA 4FZ8H 5EUOA 3QFJE 4HXAL 5CJOL 2VH5H 4X6CE 4BA8A 2FHFA 2BC4A 5HHXL 4QKXB 1DZBA 1SYSB 3HAEB 4RIRA 4LPTA 1I8LA 4P2QB 1ZV5A 4JDTH 1WEJL 3L3GA 3K0WA 1CL7L 2OBGA 5BZWB 2FL5A 4AIZA 3FO1A 2P8LB 3WFHB 2B1HL 2XN9B 2UY6A 4PP1D 3TBTA 3HNTH 4XNYL 1ZA3A 3A67H 4I2XB 3UYRH 4EUPA 4RWYH 1A8JH 4Z0BH 2QTEA 5IBLC 4PY8I 3I6KA 1WCBA 1DQJA 1G0YR 2FATH 2AJUH 3VXQB 2V7HA 3KPLB 5DYOA 3HPLA 4PBWD 1P1ZB 4NUGL 3QPXH 4X7EC 3MRGB 1DBKL 3QIUA 1ZHLB 2FJFB 2Y5EA 3MC0A 5HBBA 3KVQA 4P2OB 4NYLA 4MDIA 3A6BH 2LE9A 1IT9H 1OWWA 2EE6A 5C0AE 4XTRD 3DV4A 4FHBD 3INUH 3LKQB 2GW5A 1T4KB 1S7QA 1CGXA 1I9IH 3CNKA 1JZ3A 1MIML 2P49B 3PWPE 5E9DB 2CJUH 5E2VL 2OYPA 3T1WA 2BMKA 4N0YH 2GSGB 3FO2A 5SWZB 4JRYB 5HGDB 3ZL4L 1RU9L 3N1GC 3QDME 4K3EH 5KN5B 4HIJB 2NY1C 1NEZA 5D1QB 4OZ4B 5ANMB 5MEND 4BH8A 5B3NA 5C07B 1AD0B 1DBBH 3GBNH 2BERA 3THML 4OKDA 5IB4A 3MODH 1EDQA 4D94A 3SJVE 2ZOKB 3ZKND 3ROOA 1WZ1H 5JIKA 3MV9A 4I18C 2Z8VC 4KTEL 2DDQH 4QOKE 3OGCB 1RZFH 4HIHB 1IEBB 1IZKA 2ZP0T 1WF5A 5FGCB 3F7RA 2OMNA 4DW2H 2NY5H 4XNXH 1OSPL 1RZIB 5JPMA 1RZ8A 3VH8A 3QUYB 1U8IB 4MA3A 1NAKH 5I66B 1FN4B 1MCLA 1AGBA 1Q0XH 3CXHK 4Y89A 3PWNB 4B50A 4F9LA 3KPNB 2YSSA 2VYRE 3DVGA 4PJXE 4C58B 5FYJE 1MCPH 1MFBL 5C9JA 1P7KB 5EUOB 4JM4H 3MTRA 4LHUD 4X6DA 4WI8A 4PRIE 4OI8A 4OSUH 5CSGA 4S1RL 5GGVL 2BC4B 1N0XH 3BZEA 4NCDA 2VUYA 2K3TA 1R3IH 4RIRB 5TDNA 1XFPA 1SY6A 3L3GB 4RMWA 3V8OA 4IJ3B 4AIZB 3FO1B 1F2XK 3QWOA 4M5ZL 4QWWD 1WBYA 3TBTB 4XX1E 1YEFH 1ZA3B 5DQDL 3NFNA 4EUPB 2HH0H 5IGXH 2JJUA 3I6KB 2FB4H 2KQNA 1WCBB 4EOWH 1DQJB 3H9HA 3SDXE 5IHUH 1X6LA 3E8UH 4Y4HC 2A9NL 4NQED 3BQUD 4BZ2L 1BVKA 3L3OB 1BBDH 3F12A 1SMOA 2V7HB 5DYOB 1NFDF 3HPLB 4BM7A 4UNTA 1J5OL 3GFUA 1DBJH 4CVZA 2VR4A 1KFAL 1NMBL 5HI5D 1AQKL 1TITA 2QSCH 3DHMA 4KK9D 3RDTD 4Z76B 5D1XA 1A7OL 2C3VA 4NYLB 4MDIB 2R2EB 3VWJD 2LTQC 1UACH 3QG6A 1RJYA 3VA2C 2VZVA 4FQ1L 5D6DC 4KHTH 2XICA 2ZUXA 4BFBD 1S7QB 3IJYA 3CDCA 4JZOA 2WBJA 4C4KO 1P7QD 4M7ZB 2VXVH 4OFYA 5HI4D 2BMKB 3KXFE 1S9VB 4X5LA 3FO2B 2MCPH 1QSEE 3CLEH 1C5CH 4G5ZL 4BQ8A 4P2RE 3DMMC 4NZTL 1NEZB 2P5EA 5A2LH 4MJIA 3S35H 4ZMAT 3TH2T 2ORBH 2VXTH 4BH8B 4EVNA 3JUZA 1CD9B 1ADQA 4BUHA 5IB4B 2AK4A 4K7PY 4U05A 3C08H 4WW2C 4CKVX 3FAWA 4HUUA 1UH4A 4XP6H 3ROOB 1YNLL 3MV9B 4JREB 2FDBP 2GSIA 4XWOD 4QNPE 6CGTA 4UZGA 3BN9D 5JPMB 4M93C 4LLVA 1RZ8B 3VH8B 1NKRA 4X4MA 5FGBA 3WLBA 3ARUA 4MA3B 1G9ML 4QRRE 1AGBB 1U8OA 4OLZL 2DQEH 4ZTOH 4QHUA 5EBLA 3T0WA 3O3EA 3T0ED 2YSSB 3DVGB 4UI2A 1J0YA 5C9JB 3BJLA 2OZ4L 2PN5A 4I0CC 4X6DB 5C0BE 5KVMC 1FNHA 1L7TL 3I84A 4KTDL 5TDNB 5LGHL 2NCMA 4P23A 1B2WL 1L0QA 4G8GD 3U9PL 1FV1A 1XF5A 1D5MA 3QWOB 1WBYB 1NCDL 1I7RA 5D1ZD 4HULB 3PL6A 3AMKA 3NFNB 2XTJD 3QT2A 3UTOA 3U48A 4N0CC 1LNUA 1CIDA 4GSDH 3T3MF 1XAUA 3H9HB 4F15C 1KJVA 2A6DA 1CD8A 2ARJA 1BVKB 4C56E 3C60C 3BDBA 4KDTC 1B9ZA 4CVZB 1OHQA 5JA9A 4D2NA 1JIBA 2JK5A 1IGYA 4PJEA 4JRWA 3LDBB 4M7KH 5IVXE 5DQJA 5D1XB 4H8WL 2C3VB 2BY2A 4W68A 4HJJH 2B20A 5KANG 3QG6B 4DEPB 2AJVL 4HHAA 1KELH 2P48B 5HYQA 4O02H 3VGFA 2DQFB 1KULA 3ARPA 3IJYB 4JZOB 3BIKA 2WBJB 2D4FA 1I9JH 2ICWI 3SDDA 3VFGL 5GS3A 2AEPH 5JHDA 4K71B 4WV1C 5I1KL 4YXKH 1JGVL 4NWTH 2P5EB 5F8RC 4LSRL 4MJIB 5DEGA 4EBQL 1J86A 4Y19A 3C2AL 4OCSH 4EVNB 1B0GB 4URTB 4OM1L 1VGEL 4NP4L 2X6MA 1H15A 2DQGL 3EKCA 1AXIB 3QHFH 1EHNA 2AK4B 4ODSH 2VTFA 2OS7A 4HUUB 1VADB 3BD4A 5I1LA 5JNYA 5BOPA 1S78D 1Q9LA 2XA8H 2GSIB 4XNUH 1C1EL 3VXRE 4HBCL 1RPQA 1OTTC 1AGEA 4JHAH 4LLVB 5J12B 3CFIC 3WLBB 4OF7A 1C7SA 4N8VA 3ZE2F 1HXYA 1U8OB 4KUCD 5EBLB 3TBSB 3O3EB 4JFZH 1MRCH 5DUMH 4LLWA 1U2HA 5KSBA 5IKCA 4TUKH 4G6FB 2R39A 4ZFOL 4LCWA 25C8H 1CN4A 4P23B 3ARBA 1FH5H 4IRZL 4KUZH 4P48A 1OTUD 1FV1B 4FABH 1XF5B 1D5MB 1CBVL 1I7RB 1UM6L 2A9MH 1LQSR 3PL6B 2A2QT 2SEBA 4JFXA 5B22A 2B1AH 1LNUB 2Q1EA 3GBML 1SVZA 1KJVB 2V5YA 4Z95L 2A6DB 5HY9A 4UNUA 2ARJB 1NJ9A 1BFVH 1UM4L 1FBIL 4YH6A 4JG1L 5FUOL 3IDMA 4BKLA 1G7JA 3VWKA 5D72H 3T3PE 3H3BC 2YWZA 2JK5B 3GI8L 1IGYB 1YN7B 1QHOA 4PJEB 4UT6L 3QHZL 5DQJB 2FZ3A 2WBWB 5KTEH 2YD2A 3QEHA 1CE6A 3OKOA 1IL1A 2BY3A 4HHAB 5JIPA 1FZKA 4OZIA 4PJ8D 5D7KE 4Q0XH 2Q8BH 3PIQA 3BXNA 4RMSA 2CR3A 2RCSH 1JZ6A 4ZTPL 3BIKB 4NCC1 3LMJH 2BJMH 1SJVA 4ZUVA 4FTVE 1DBML 3SDDB 3SKUD 3B5TA 3UYOD 2QQLH 2X09A 5DD6A 4PJ9A 1NFKA 5JHDB 1QKZL 3CDGA 1MCSA 5TE6H 4MNQD 3BAEH 2DIBA 2R69H 2BXZA 5DEGB 2WQ8A 4Y19B 4WTWA 5GRUL 4HG4K 4U1GB 2DMKA 2KBGA 2YZ8A 5KVGH 1H15B 1GC1H 4GAJH 4D8PA 3BPCA 3QDJD 2DLTA 4RSVA 3RNKA 2HT3C 3QHTC 5F7DA 5I1LB 3JWNC 3TESA 5JNYB 4NQDD 3P30H 5D2NC 3ILPA 2CGRL 3O45A 4PV8A 4XP4L 3M8OH 3MA9L 2GKIA 3C6LD 1AGEB 4V1DE 4NKOA 5HVWA 2X4QA 4RGNB 1A6WH 4OD1L 1EX0A 3NCJH 4JHWL 3AY4A 3NPSB 4N8VB 3EW3B 1HXYB 4OGZA 4YHYC 2VQ1A 2YR3A 3WIHH 4LLWB 5KSBB 5IKCB 1I85C 4WIQA 2B5IB 1IRAY 4LCWB 1EJ6A 3W5NA 5SV4A 4AEFA 1LDPH 3JZ7A 3NCCB 5FECA 3ARBB 2GEEA 3RVTC 2EDQA 3KPSD 4DUVA 1X5KA 1YJDH 3V79C 2JB5L 3MFFA 2ADGB 3UC0H 5T3ZH 2SEBB 4LFHG 1A14L 4JFXB 4UAOC 1K4DA 4X4XA 3C6SA 3PNWA 1J0HA 3I02A 1FAIL 4K23L 3RUGE 5HY9B 3KLSA 1DEEA 1NJ9B 2EDRA 2FECI 3DHJA 5CD5D 5HDQL 4NO5A 5BQ7A 3IDMB 1G7JB 3VWKB 3TA3A 3W82A 4R90L 2J5LB 4NZDA 4EUPG 4HFUH 2PTUA 1MF2L 1YYLL 1PW3A 5F7EL 5K9KA 5HDOA 2FZ3B 1OP3H 5CFHA 1ETZA 3QEHB 1CE6B 1WV7T 3OKOB 1U92A 1IL1B 2AJSH 3X3FL 3QXAA 5EA0L 3QCTL 1A47A 1FZKB 4OZIB 3MLUL 5FKPA 2EZ0C 2DIJA 3PIQB 3BXNB 3MV8A 4GAYA 2N1KA 4F3FB 1UCBL 2VDML 3MV7E 1REIA 4OLUH 1CS6A 4ZUVB 1R5WA 3RKDD 3MCKA 3BIBX 4S0SD 4Y4HA 3QQ4A 5DD6B 4PJ9B 3CDGB 3JWDC 5GS0C 1JGUL 2V5MA 5J56B 1KLFA 5DRXA 4UT9H 1MJUL 2I26N 5F70A 3KWWA 1WQVT 2HP4A 1KLGA 3QI9D 4D8PB 3BPCB 2BNUA 2EC8A 3RNKB 2CO6B 5F7DB 4OV6F 1K5NA 4ONGL 3HB3C 4LSSH 1RUKH 3ILPB 3TT1L 1NEZG 2VN7A 4PV8B 3S8WA 3O6KH 4QF1A 3RAJH 4DKEH 4NKOB 1EZVY 1O0VA 5DC4B 4CRPA 4UTAH 5MI0C 2ESVE 2X4QB 5JW3H 5DWUH 1BF8A 3P0VH 4GRWH 5GISH 2Q7NA 3G5XA 4TPRL 1WBZA 2W38A 4UDUA 3WUWA 2VQ1B 5CJ8A 5EU3A 2F58L 5BVJA 2EDNA 1EGJL 4TUOA 2BVEA 3U7YL 4LSTH 3VH8G 3EIFA 5D70L 2P44B 5FECB 3QDGA 3IT8D 4GG6F 3QQ9D 4OCNC 4X9BA 1LEKA 1JZ7A 1FGNH 1IARB 1W2KT 5C0AD 4O5LH 3RP1A 4G3YL 3FFDA 4GW5A 1QFWM 3MFFB 3Q6FA 3RWIA 5L8LB 3AMLA 4G6AD 4JQVA 3BMVA 5D96B 1K4DB 4WO4C 3K46A 4X4XB 3ZTNH 3RZCD 3C6SB 3PNWB 4PTUA 3I02B 4KMLB 3OB0H 3HN3A 4BQCA 1DEEB 1NFDE 2BXYA 5E4EB 2XRAH 2J6EL 4IRJD 4YHKH 5BQ7B 3TA3B 1IMHC 1OWRM 4E41A 5C08E 1QYGH 3L5JA 3QDMD 4Q74A 4JFYA 5K9KB 1DFBH 2UZYB 4U1LA 5AD0A 5ENWA 1U92B 1MJ7L 4FN0A 4CDGC 2CIKA 3C5ZC 2V9TA 3QXAB 3HUJA 3VXME 3SJVD 4RMQA 5FKPB 4B0MM 4V2BA 8CGTA 2ADFH 1X5HA 3MV8B 4QOKD 4R97B 5I0DA 1MCHA 3L3IA 1U0QA 1R5WB 4FQLH 3MCKB 2R9HC 2VLKA 4Y4HB 3REVA 3QQ4B 4P5KA 1M7IA 1A7QL 1I1AD 3D5OF 5GRJH 3LRHA 1LEGA 1GGCL 5DRXB 2GAZA 4PV9A 3D85A 1JL8A 1A7RL 4P3CH 3RKPA 7CGTA 3KWWB 1KLGB 3ARED 2CUHA 1HHKA 4XI5C 2BNUB 4WFGE 5BZDA 1RZJL 1MELA 4IRSC 3WEXA 5DJYA 5HI3C 4Y88A 1K5NB 3BWUC 4YBQD 43CAA 3L5HA 4L4TE 4QF1B 2LU4A 3S35X 5I76A 1DR9A 5BXFA 3LH2L 3MACH 4MXVF 1R5IA 3BGMA 4QRUB 1FVEA 4H0HB 4AM0B 2HKHL 3H3PH 1S5IL 2VXUL 3G5XB 5AZ2H 4WV1A 1WBZB 5JOPE 4UDUB 3WUWB 2P24A 5BVJB 5EU3B 4FFYH 4TUOB 3UJTL 5LGKA 5B38A 1EHXA 2GY7B 3UAJC 2MSPA 3LHPL 4JKWA 2F8VA 1H5BA 4O00A 5CMAA 4YEFA 3OG4B 4NQCE 3RVUC 4MA7H 3MJ9L 3QDGB 5DHVH 5BRZA 4LCYB 2Z93A 1LEKB 3S36L 2HT2D 1VDGA 2CLVA 3DXAA 3FFDB 4GW5B 3Q6FB 4M4RA 3RWIB 1IGFL 1K8IA 3UO1L 1JHKL 3T3ME 1RIVL 1X5XA 3J7HA 1QVOA 4PTUB 4M93B 1NLBL 2GJ6E 4NN6B 3L6FA 4MAUL 1JUFA 1IE5A 1YECH 3KXFD 4LGRB 3K81A 1QSED 4E41B 1FSKB 4P2RD 1U2CA 3IRZA 2AJYL 1G0DA 3UZQA 4JFYB 3AB0C 3SOBH 2QADC 4U1LB 3WNNA 5AD0B 1YNKH 5ENWB 2NXYC 2CIKB 4ZPVA 3HUJB 4LHQB 4LLDA 2I5YL 4P46C 3EJYC 2UV3A 4YC2C 4HIIA 2VZ1A 4Y2DD 4Z7QE 5CJBA 4U6HA 3TCLA 3ILQC 3L3IB 4UINL 1EH9A 3ZE0F 3N85H 4N5UA 4P9ML 2AXFA 2VLKB 3IAGC 4P5KB 1M7IB 3BFOA 1R0AH 4MJ5A 3V8CA 3KHOA 5GZOC 4OAWA 1LEGB 2GAZB 4PV9B 3D85B 4Q58C 4IIQC 1I3UA 1OQXA 3VG0H 1I9RH 3CSYA 3GBLA 1HHKB 5BZDB 3BE1L 2EDLA 2QSVA 3CLFL 4WI2A 5DJYB 5DJ6A 3WEXB 2PF6A 2FEDD 1XIWD 1TDQA 5CBEA 1VACA 3MNVA 3X12A 4OZFH 3KAAA 5I76B 5BXFB 4BZ1L 3CFKA 4NJ9L 1DN2A 3VGGA 2EDEA 1R5IB 3BGMB 1H3UA 1FVEB 1KC5L 3ZE2E 1AO7A 4M62L 3I3DA 4WV1B 2KQMA 2P24B 4C56D 1UZ6F 3ZE1E 5ADOH 5D7SH 5B38B 3VG9C 1I3GH 4OM0H 2WWKO 5GZNC 1H5BB 4PRHE 5IHBA 2UZXB 1ITCA 3GKWL 4ZYKA 4N8VG 5GRVK 5BRZB 2Z93B 3SE8H 3X3GL 2CLVB 4MJ2A 3DXAB 3KPOA 1KB9J 4NNPL 2D31A 1K8IB 1KYOK 1QVOB 1GIGH 2F54E 5DFWH 4LVEA 3L6FB 4UBDD 2X05A 3HPJA 3IDNA 4TTDD 3EO0A 1JUFB 3U7WL 5F7FA 5T1LD 3DTXA 5I17A 4FQJL 5CJQH 1DJSA 2WNGA 5KANI 1OCWL 3WNOA 2HLAA 4OFKA 1X5JA 4XBEL 4DTGL 1NMCB 2E7BA 3WJJC 5TPWL 4F33A 1R3LA 5IHZA 1X5FA 4QHMB 4K94C 1MREL 3QCUH 4ZPVB 4LLDB 4WGWB 3CXDL 4ZFFA 2WIIA 3ZSTA 5CWSB 4HIIB 3FFCA 4JJ5A 4U6HB 3TCLB 1JV5A 1OOAA 3VXRD 4HGKC 3TO4A 1DQQA 3K7UA 3TH3T 4TRPH 5I19H 2AXFB 4L5FL 3VCLA 3RVXC 4MJ5B 1RUPH 4OAWB 1G84A 3EOTH 1J1XH 4GAFB 1JPSL 4IHOA 4ONHB 3CSYB 2X42A 4X9HA 4YHPA 4XNZC 1OGAE 4G42A 2EIDA 4JM2F 5F7MC 5DJ6B 1F2QA 3ARVA 4GOSA 3D39E 3MOQA 5TQ2L 1PBYA 4Y16D 5CBEB 1A7BA 1VACB 2G60H 3MNVB 3X12B 5DMGC 2Z91A 3CFKB 3W5MA 4JO2L 5EU5A 3ZKMD 5MP6H 2E9BA 1WAAA 4TSBH 3S3SA 32C2A 4XNQA 4YWGH 5HYJE 2O5XL 4PJDE 1AO7B 4XP5H 3FCTA 4WFFD 3W0WE 3S97C 2CUMA 4ZXBC 2J8UE 4PJCE 1VERA 2M2DA 4LARL 2CDEA 1QRNE 3T04D 3BVNA 1HHIA 3U2SA 1A4KB 3BX7C 4OGXL 3RWCA 3ZHKA 3MRJA 4ZYKB 1AE6L 1AI1H 5F7KC 1T1WA 4FQXD 2IQ9L 5JW4Q 4DVBB 4JFPA 1ITBB 4GMSL 1NCAL 3KPOB 4KJPC 2D31B 2IBGA 5HHPA 5D7KD 2GK2A 3TNNA 3F6IA 3HPJB 3IDNB 5E8OA 3EO0B 1G1CA 4GLRI 4K3JL 4HS8H 3VU2A 2OM5A 5KZCB 3DTXB 5I17B 3BYYA 3MOBL 2V7NA 5CINL 4QHNA 1HNFA 4U1MA 4AEHL 2HLAB 2Y06L 4RQQA 2EKSA 1RUMH 2JELL 1MFCH 4WEBL 1R3LB 2EDWA 4F33B 5IHZB 1JHLL 5HHQA 1KPVA 5C7XH 4B7IA 5IMLA 1NMAH 2OR8A 5GJTH 1SM3H 4ZFFB 4WHYH 2WIIB 3QXUA 5E6YA 3FFCB 3RJDA 4JJ5B 3QEGL 1JV5B 1R5VA 1DQQB 3TO4B 5I30L 3JV4A 3MNWA 5IWLA 3H42H 4V1DD 4BSJA 1RUQL 4NO3A 2MWCA 1FIEA 3VCLB 3V2AR 4ERSH 2R8SH 1L7IH 3CPLA 2BRRL 2ZSVA 1BREA 1J1OL 2P46B 1NANH 4HPOH 2Y6SC 3NABL 3VE0B 3LS5L 4IHOB 4R2GC 2QSQA 3CSPA 2CXGA 4NPYB 4YHPB 5LQBH 1VA9A 4G42B 4HXBL 1BWWA 1KTDA 2QQKL 1HDMA 2A73B 5DLMH 4V2CB 2W91A 5KSAB 1F00I 4BFIB 3NIFF 1P5UA 2PYFA 5F9OH 1UA6H 4HMEA 4JHZA 3RTQC 2NY3B 2Z91B 5GGVY 4NRYA 4DKDC 4JFEE 5EU5B 5LCVH 3NIGF 1CLOL 4KY1L 3VXUA 4NJAL 32C2B 4XNQB 3O2VL 4KDWA 1OAUH 3BP5A 5J3HC 3O11A 3FCTB 4RA3A 4HWEL 1E28A 1WK0A 5CEZL 1RUAL 4O4YH 1QUNA 4GRWB 2CDEB 3EUUA 1EAPA 1LP9A 4I0PC 5MENA 3BVNB 3C8HA 1MAMH 1HHIB 3HNSL 3U2SB 3RWCB 4LSVL 2VR9A 3MRJB 4MVBC 2E9WA 1SEQL 5IBUB 1CDUA 2NQCA 1T1WB 3FZUC 3GSWA 4Y5VC 3WUWG 4JFPB 5AYUL 5TGBA 1A21A 2DQTL 4YXLL 5HHPB 4QYOA 2APBA 3NTCL 4QRPE 2A6JA 3HMXH 1A5FH 4F2MA 3PF2A 3MREA 5MI0B 3TNNB 3MV7D 1UYWH 4YGAB 2AK1H 1ZLUK 5E8OB 1NC2D 2GHWB 4U1NA 2P47B 4DOHB 2V7NB 2W0KA 2EEDA 2DM7A 4LPXA 4QHNB 4U1MB 4TNVF 4WO4D 3EOBA 2H6PA 4TSCH 4Z78A 4RQQB 2EKSB 1VHPA 2EH7H 5E6ZA 4G6JH 1SBBA 4LHUA 5FYLE 2ZG2A 5JZ7D 3O2WH 3BEVA 5GGSA 4YEEA 1CFVH 4UQ3A 5HHQB 5DVKA 1KPVB 2HTLD 5IMLB 1QBMH 1HHGA 3SGJA 4Q9QH 2QHLA 1ZT7A 4QEGA 1PSKL 3H9SE 1R5VB 3HS0A 3RGVC 3JV4B 3MNWB 2DQCH 3VRIA 2N56A 4NO3B 2APXA 2ESVD 1JZ5A 2HWZL 3H8NA 2IC2A 3CPLB 2ZSVB 3VRLF 4OCXH 2V5RA 3A6CH 4AL8H 5I8KH 2OP4L 2MJWA 4XXDA 4Q9RL 3RDTA 2F9BT 4FFZL 4ENED 3OKKA 1N6UA 1KTDB 4XC1L 1DVFC 1HDMB 4M1CD 3WO4C 3VWJA 2YXMA 2PYFB 4OLEA 4P46A 1S9XA 3W2DL 5AZEH 4R0LC 4JKPH 4OUOA 4NRYB 3MRDA 5ILTL 4IRSD 3VFWA 4YDIL 3MLZH 3VXUB 2F19H 4MQ7A 5CLTA 5HI3D 4OZFA 3BP5B 2EYTA 3O11B 5GGRA 4X0KA 4DVRL 4S1SH 4E0RA 3KPRE 1E28B 3IXAA 1X9QA 4IIQA 1XGYL 1NL0H 4RISH 5C08D 2QR0B 1I8KA 3WFDL 1EAPB 1LP9B 3LD8B 3NZHL 5MENB 5MEQA 5H2BA 5A3ID 3O6LH 2XI9A 4YGVA 4PLNC 1AP2A 3GSWB 1VEOA 2Y72A 2VN4A 2VDQL 5TGBB 4LPYA 2PO6D 1RD6A 2NZIA 3VGEA 4R26L 3VXMD 1G9MC 5DHVB 4QYOB 1T3FA 3CGTA 2A6JB 2BDNH 2W9EH 4F2MB 1T89C 2FX9L 1EVUA 3MREB 4K3DH 1YUHA 4POZC 4H1LH 2GFBA 4U1NB 1EHLH 3NIDF 4MWFA 1ZVYA 1ZOXA 4YIQA 3T0EA 1PZUB 3EOBB 3OBAA 3WKMH 2H6PB 1ZHBA 4K9EH 4Z78B 1U8HA 1HZHH 5I15L 4HCRA 4LHUB 3BEVB 4Z8FH 4OLVL 5FOBA 5GGSB 3V4UH 3WYRA 4LIQL 4WFGD 4HLZH 4PJIF 1D5ZA 1T7WA 3IU4L 1HHGB 3QBTB 5DC9B 4AZ8A 1RURL 5MERA 4L4VE 1ZT7B 1ZXQA 3WDHA 2QADD 1T2JA 1ULVA 4L4TD 3ZE0E 3HS0B 3VRIB 5JIHA 1GGBH 4X80L 1G6RH 3EJYD 5D93C 5D7LE 3HCVA 5FUZH 1TJGL 3ILQD 4P99A 1GH7A 1I75A 2BVOA 4XXDB 1HI6A 2VLME 4N68A 3AB0B 3RDTB 2H2SC 4MLSA 1Z0NA 2ADJA 5DGRA 4ZFGH 3OKKB 1EFXD 3WJJA 4NQCD 3UJJL 2YXFA 4JG0L 2XZAL 5GZOD 1FO0H 4MA1C 5IG7A 2A38A 2YRZA 3VWJB 2XTLA 2N7BA 4P46B 1S9XB 3UROR 4HLJA 4YC2B 4KMTH 4BQ9A 4D9LH 2J88L 4U1HA 3MRDB 3N1QC 1N64L 3VFWB 3F62A 3QNXA 4MQ7B 5L7XL 4S0TD 2VXSL 4ZUWA 2MPAL 4UB0L 2NMSA 2GJ6D 4MA8H 4OZFB 4YJZL 2V6HA 5CEXA 2EYTB 2Z92A 1TVBA 5GGRB 5FF6A 4E0RB 2HMID 3IXAB 4QXTA 4KFZC 4JFDA 4X98A 4IIQB 3ZKQD 3BPNC 3MRLA 3NOIA 1I8KB 5E6IC 3VXOB 2VAAA 5DK0A 3QUZD 2EDKA 5MEQB 4U2YA 5H2BB 4ZOCA 3W11D 1YMME 3QG7L 3OJVC 2CMRL 4YGVB 5TF1H 2M8XA 5L6YL 2HFGH 1U42A 4R7NA 4P57A 3N9GL 1AP2B 4JKLA 3NAAL 4PJAE 4KGLA 5GZND 1IGCH 4XVJL 1MEXL 2A0LC 1T3FB 4RMVA 1DEDA 1TTFA 2UVEA 4R4FL 2J8HA 1YUHB 4LRNH 4X7FC 2GFBB 1ZA6B 1MJJA 5F3HA 4AEEA 1AQDA 5IT2H 4MWFB 4ZXBA 3QFDA 4OT1L 4YIQB 3T0EB 4YHLH 1ZHBB 1U8HB 2VDPH 2YUZA 3ZT7A 2DMBA 5FOBB 5EWIH 1WC7A 4EXPX 4M7JH 3O3AA 5B21A 3QA3A 1IGMH 3QRGH 1F58H 2HFTA 4PBVC 4G8GB 1L0YA 4N0FA 5MERB 2HTKD 5CCKL 1HHJA 2UWEE 4RZCA 3O2DH 2X44D 1HE7A 2XZQL 2X1PA 2FGWH 2F5BH 4HWZA 4ZS6D 3RIFF 4CVXA 2X5PA 3BDYH 5JTWA 3OKYA 3HCVB 1L6ZA 2BVOB 1ZANL 4YDLC 3RA7H 2ADJB 4PRHD 3G9AB 2VR5A 2VDKL 2CPCA 2OX5A 3S37X 2H26A 1AHWA 5IG7B 2VXQH 1W0YT 2D03L 4GXVH 3TH4T 4KRPD 2DQIH 5F1KC 4U1HB 4BJLA 1QNZH 3QNXB 3MOAH 1X44A 1U58A 4ZUWB 2FH8A 4KHXH 4ONOA 4YHIA 5CEXB 2Z92B 1TVBB 3PP4H 1YEJL 3WFEL 3F8UB 4U0QB 5FF6B 4IMKC 3OZ9L 4QXTB 4JFDB 4X98B 1FP5A 3MRLB 1CICC 2VAAB 5D7JD 5DK0B 3FB6A 5CGTA 4P5TC 5L88H 1T80A 4LRIA 2ATKA 2FJHA 2WMPA 5DF0A 4R7NB 4P57B 1CXHA 3QDJA 2XWBA 4UIMA 2C4FT 5FM5M 3D6GA 4XC3H 3TVMC 1ZT4A 4G80A 2MTPA 3PGFH 3QNZA 2DQDH 2FHBA 1FNGA 4NQDA 3RTQA 3ZDXE 3EAKA 4M6ML 4UILL 2QKIA 4KZEH 4U7SA 4WUKH 5J13C 3IU3A 1QLFA 2P7TA 2WQRA 2A1WH 1MJJB 5F3HB 1MCBA 3EDKA 3HMXA 4LSPL 1FFQA 2EE3A 1AQDB 4ZXBB 1GGIH 2XKUA 3QFDB 2IPTH 4GQPH 2L7UA 4DGVL 1N4XL 3GIVA 4I0PA 3CFCL 3RVWC 1WC7B 1MOEA 3O3AB 3QA3B 1Q1JH 4HIXH 1HH6A 3D39D 4N0FB 3JV5A 4CMHC 4CVWA 3KPSA 1HHJB 4OLXH 4YDKL 3E1F1 4RZCB 2ZCKL 5DO2C 5DT1L 1KIRA 2LAGB 4HIEA 4D3CH 4K8RL 4HWZB 5ITBL 4CVXB 2YPLE 2NY6D 5HYJD 3RGHA 3I50H 5J11C 1IC4L 2NW2A 4PBXA 1RZKC 3W0WD 1MHPL 4LAJH 1G7QA 4QXGH 1IEHA 1TJHL 4FQ2H 3EDDA 1RK0A 5I1JH 3PHOB 4GRLD 1QRND 4YFEA 5KVDH 4MLIA 4YUEH 2H26B 3MRHA 3FRUA 3MLYH 1AHWB 2DWDA 5HHME 3NGBC 4AG4H 1SY6L 1EEUA 2Y6SD 1WFOA 4MB3A 4APQD 2X4UA 3MPCA 5H35B 2B2XH 3F7YA 4FQQA 2ZSWA 4DN4L 3RGVA 1U58B 4XT1C 3QIWC 2ZPKH 1QFPA 1IJ9A 1S7VA 2FJGA 4RCAA 3U7AA 5KVEL 3TJEH 1HYSD 3UTZA 4ZG1A 1B3JA 2DBJA 2NY4D 3FB6B 1MH5A 4LP4A 5E1AA 2ATKB 1S3KL 1A6VH 3NH7L 3QDJB 2XWBB 1CDGA 4UIMB 2XQYG 3KYOA 5GRZA 1UM5H 1ZT4B 4G80B 3QNZB 3DO7A 4DKFH 4OV5A 1FNGB 4NQDB 4R0LA 2WLZA 2DKMA 4GRMA 4FS0A 5C2UB 1BQLL 2QKIB 2KZWA 2R4RH 2FO1A 5F1NA 1VB9A 1MHCA 1TZHA 3IU3B 1QLFB 2P7TB 4OZGE 2YC1A 4YLQT 3T2NH 1OPGL 3PWLA 4UTBH 5I0ZA 5C0RL 4GS7B 5FXCH 5DR5L 2FX8L 4NQSA 4NUJA 1KIUA 4I0PB 4WUUE 1KACB 1AY1L 3OHXA 5C0JB 3E6FA 4B7LA 1ADQL 2MKLC 2NY2C 4H5SA 1HH6B 4CGTA 1RULH 1LE5A 2G9HA 4GW1A 4P9HH 5CBAA 4XPTL 3MBEC 5HVFB 1R6VA 3KPSB 2DJ4A 2JTDA 3GI9H 4RFOH 1YNTA 5BJTA 2QL1A 3MRCA 1KIRB 1PY4A 4LHUG 4JFED 4ZOAA 1DP0A 4LCIH 4HIEB 3RZCA 1YEKH 2APVA 1IEAA 1DQMH 3AXLA 2NW2B 5GJSH 1J05A 4P2YA 3BT2H 3TV3L 1G7QB 4O2CA 3KPTA 1RK0B 4F80A 4OFDA 1Q9KB 5F21B 5H8DA 1OAYL 1J11A 3MRHB 3FRUB 2DWDB 3Q1SH 4BQBA 4F8QA 5GS2D 1X5LA 4GMTL 1F6FB 1G0XA 5KVFL 5F7HA 2JCCF 2IFFL 2X4UB 1FO0A 1YEHH 4U1IA 4FQQB 2ZSWB 4QRPD 3RGVB 4JCLA 1DVFD 3O6FD 5AWNL 4OI7A 3B2UD 1S7VB 2E5EA 2FJGB 3DI3B 4M3JA 1RZJC 3GJFK 5DD0H 1I1AA 4XP9L 1ZLSL 2VRAA 2ZZUT 1F02I 3MLSH 1MH5B 1UQSA 3TWCL 3V6OA 5E1AB 2R0LH 3TYFA 5FYLD 4OZFG 1X4YA 4X83A 4P59L 3KYOB 3HC3H 4OGYH 3S7GA 3MLVH 3MXVL 3AM8A 3DO7B 4OV5B 1KN2L 4R0LB 3DUUA 1CVRA 4GRMB 4JFHE 5F1NB 1JPTH 2Y4SA 1MHCB 3H9SD 1TZHB 4JR9H 4NKIL 5DJ0A 4EZMA 2YC1B 4JPVL 5DRNA 3PWLB 3GK8H 3ULVL 1CXLA 3SDXA 3I6LE 3IFLH 4OCRH 2GJZA 4NQSB 1VFUA 1U41A 4TULH 2WSKA 4NUJB 4DUXA 4A6YA 1WVZA 2G5RA 3OHXB 4K7FA 1PG7H 3IS0X 4J1UA 3E6FB 1CZ8H 1JNHA 4H5SB 5FM4A 2E7HA 1LE5B 4MCZA 1DQDL 4GW1B 5CBAB 2WAHA 1FVCA 3CU1A 4OLYL 4PB9L 1WZMA 4ZUTA 1YNTB 2VE6A 5BJTB 5JHLL 3MRCB 1JFQL 4NHUA 4WEUD 5BV7H 5CUSL 4P5MA 1DLHA 1ZLVK 4TN9A 3DGGA 2GI7A 3RZCB 1TZGH 4NC1C 2VJXA 3O2DA 1IEAB 2UVFA 4JFFE 1NUFA 3AXLB 4FZEH 2IMNA 1J05B 4PUBH 3GKZA 1N2RA 2VLRE 2Y1VA 4O2CB 1W72H 5BS0A 4X7CC 4JN1L 1CTNA 4ALAL 4P2RA 1OM3L 2B0SH 2DTMH 5E95B 5CGMA 4KAQL 2VSDA 4G7YH 4NOFA 3HG1E 5CKAA 1SYVB 4S1QL 5F7UA 4JFOA 2BNRE 4FZ8L 3OR6A 4F37K 2VH5L 5F71A 2H2SD 1FO0B 1WT5A 4U1IB 4LASL 4Y2DA 3E3QE 1BQHA 2DQHH 5KG9B 2A83A 1MFDL 1X4XA 4GKZA 3BW9A 5E8NA 1SJEA 5EULV 3HNTL 3A67L 3UYRL 1GHFL 1CDJA 4RWYL 1I1AB 4Z0BL 4L8CA 4W4NA 3GRWH 2EXYD 2Z8WC 3O41A 1CDBA 1JGLH 4PREA 3QYCA 1UQSB 2FATL 2AJUL 3B43A 3TYFB 3FQXA 4Z7WA 3WS6A 4Y2OA 2JIXD 3EHBC 1F4YH 5CJXA 3WNPA 5L2KE 3FQNA 1B0RA 3QPXL 3JBG7 1F3DH 1NCCL 1XIWA 4XCNA 3DUUB 4XPFH 3WMSA 4L4VD 3GSQA 2EDXA 3FB5B 4XWGH 5D5MA 5F9AC 1IT9L 1T5WA 4WW1A 5DJ0B 1ZGLM 5ACLA 5DRNB 4G6ML 3CMOH 4PRPA 3INUL 5EFIA 3SDXB 5I18L 2A0LD 4LKXB 1FZOA 3MGAA 1I9IL 2YUXA 2GJZB 5D7LD 3S6CA 1J1PH 4C56A 1MCNA 4RRPG 1F3DJ 4MS8C 4A6YB 4X4ZA 4P5TA 4K7FB 4IOFD 4N0YL 2VLMD 2I60H 3MROA 3QPQC 5EUOF 2NR6D 4FQPA 5IVXA 3V5KA 1JNHB 3P73A 4NSKA 4MCZB 1FVCB 3W9EA 3MBXH 4OZHE 2ZG1A 4KI5E 1NBVH 1DBBL 3GBNL 4ZUTB 1QA9A 2VE6B 2EC9U 1CDIA 5KS9E 3MODL 4GXUN 3B9EA 4P5MB 1DLHB 3DGGB 1KPUA 5DD1H 1WZ1L 2XY1A 2BNQA 3OSKA 2WZPD 2BSRA 4WU5A 1RZFL 2BFVH 3KXFB 4R96A 2ILLA 2DQUH 1N2RB 3CK0L 3IKKA 2NY5L 4G43A 5BS0B 1FJ1A 4JVWA 4P2RB 5K33A 4XNMA 4WHYG 1NAKL 1JPFA 4ELKA 1Q0XL 3SKMA 1UJ3A 4JFOB 3OR6B 4JM4L 3EO1A 4OSUL 3KPQA 1N0XL 3RWGA 4DGIH 1ZTXH 3MYJA 4Y2DB 1BQHB 3CFEA 1BD2D 1CD1A 4JAMA 4HUWA 5ALBH 3S5LG 3VXNA 2A83B 3OKNA 12E8L 4L8SC 5GGTH 4LPUA 4GKZB 3BW9B 5EORH 1P5VA 1UFUA 5A2FA 5E8NB 1SJEB 2CLZA 4XPHH 4HPYH 1NCWH 5IGXL 2WP3O 1NGQL 4L8CB 2V9RA 4FG6C 2DLFL 3O41B 3O9WA 4PREB 4YK4C 3E8UL 4HZAA 5HD8C 3DI2B 4KI5C 3FQXB 4Z7WB 4UQ2A 3P9LA 1DBJL 3FQNB 1B0RB 5CGYC 1SHMA 1Q72H 1XIWB 4XCNB 4DGYH 4Z7UE 4LMQI 5E03A 1SVCP 1OD9A 2YA2A 3GSQB 2ZG3A 1P4BH 5D5MB 1T5WB 1DL7H 4WW1B 5C92A 1AJ7L 3G6JA 4XPAL 3TVMD 4KHTL 4PRPB 4IM8A 2Z31A 5C09E 5EFIB 2EIEA 4PJHE 1FZOB 3C9NA 4C56B 2UUDK 1YEIH 1CFTB 2VXVL 3I2CL 4GG8A 4P5TB 4NGHH 2Z9TA 4Z7VF 4NO2A 4JM2D 3O8XD 3O0RH 3MROB 1CTOA 5HYFA 3CLEL 5B4MD 4ZNEE 1EJOH 5IVXB 3V5KB 5JUEL 3P73B 1XZ0A 4NSKB 1Y18A 3PWUA 3S35L 1J0JA 1NLDH 2ORBL 4PJFE 4CADA 3W9EB 1QA9B 1I7ZB 1UWXK 2VZUA 3RWJA 3RVWD 1X7QA 3C08L 3MJGX 2GUOA 2ZCLL 3V7AG 3LRGA 4XP6L 1KPUB 4OB5H 1KCRH 2BNQB 3JXAA 2BSRB 4WU5B 1GZQA 4F9PA 1P9MC 5C0EA 4R96B 1PKQE 5CEZE 3BKYH 1GSMA 1L9NA 1NDMA 3GMPA 4W4OC 4DFIA 5FHAL 4G43B 1FLRH 1FJ1B 3QUMH 4XNMB 1JPFB 3H7LA 4ELKB 2DQEL 3ARGD 3DETD 4OI9A 2MHAB 2ICWA 1UJ3B 2D9CA 3SE4C 1DN0A 4JQXA 3LN5A 3EO1B 2NYYC 3DSFH 4CMHB 4MGXA 3KPQB 3RWGB 1F5WA 4WY7H 1MQ8A 3MYJB 3CFEB 1CD1B 4JAMB 4HUWB 4POUB 1CE1L 3VXNB 1E0OB 1MI5A 3OKNB 4BH7A 2F74A 3QRFM 3L3KA 4HS3A 4YHOH 2CLZB 1KJ2A 5E7FA 4HMDA 3S34H 4XRCA 2P1YA 5FUCE 5D8JH 4GSDL 3HTLX 3VI4E 3ZKXC 5ECJE 3O9WB 3QIWD 4WWKD 3V6BR 2EDJA 1T2QH 4UQ2B 4HT1H 2LV4A 3P9LB 4LLQA 1MAJA 2DMCA 3NGBB 3ZTJG 4L3ED 3U1SL 3MRBA 4YBLB 1VPOL 2MCG1 5F72S 4PG9A 1I8IA 4HJJL 3G6JB 1KELL 5DXWA 1IM9A 3P4MA 2Z31B 3UEZA 4O02L 2NXZD 3NACH 5C0CE 2YPLD 4MNGE 3C9NB 4UOJA 3RNQA 1Q9OA 4I3RH 4M1GL 3HE7D 4OGAD 4HJGA 3F6LA 4J23A 4MXWL 4LAQH 4GG8B 1QFUH 4NO2B 2AEPL 4MAYD 1OY3B 4Q2ZA 4K3GA 4G9FD 4YXKL 3DURA 1MCRA 1XZ0B 2MMXA 1Y18B 2JKXA 3PWUB 3SO3B 4OCSL 1A7NH 4CADB 4PJ5E 2XACC 4XAKE 3RWJB 1OAZL 4ODSL 1SJXA 1X7QB 2ITDA 4NBXB 5J6HA 5FUCC 4KUCF 4D0CA 3JVGC 4PLKC 2GUOB 5DZNA 3MV7A 1FIGH 5I6XC 1GZQB 5DURB 4PIRF 5C0EB 3P2TA 1NDMB 3GMPB 4HLZG 1YEGH 1P4IL 4LPWA 1JI2A 5EIIA 3V7MA 1RK1A 1CL7H 1S9YA 1W72A 1BJ8A 3VMOA 4JFZL 5DUML 1S5HA 1IC1A 2B1HH 2V2XA 4JZJA 1DN0B 4TUKL 3LN5B 1J8HD 4M43L 5DVMA 4Y4FC 1LO5A 4N0UA 4PG2A 25C8L 4WI7A 4PRBB 1FH5L 4YXHL 1S9KC 1YYMH 4KUZL 1MI5B 5FV2A 3WHE1 4BH7B 2F74B 3LCYA 3L3KB 1AC0A 4V1DB 5GRWA 4FABL 4HS3B 1RIHH 4WI5A 1KJ2B 1NGPH 2A9ML 4XRCB 1OAXH 3Q6GH 2CRIA 1VFBA 4B5EA 1MJ8H 1I3VA 3FQUA 2R0ZL 4EI5C 1UWGL 4WUUD 5DD5H 3SCMC 1X5ZA 3VXSE 3WHXA 1EVTC 1U6AH 3GRWA 4LLQB 3EO9H 5D72L 3DROA 2RAMA 1Y0LA 3SGDH 4J8RA 3MRBB 3S4SA 3CC5A 5J57B 2JJVA 5KTEL 4PG9B 1I8IB 4XB7A 5E2VH 4NM4L 3U0WH 4A2LA 2P4AB 3QDHA 3EYSL 3LPWA 4G6KH 1IM9B 3P4MB 1DBAL 4KROC 5C0DA 4Q0XL 2Q8BL 4RMRA 5JW4N 3RNQB 5J1SC 5IF0A 4KQ4L 1NFDA 2BSED 1Q9OB 2RCSL 5A1AA 1NKOA 3LMJL 2BJML 4HJGB 3WNKA 4MD0A 2VL4A 2QQLL 3WFBH 2O5YL 4OD2A 4RFEA 2DJSA 2BVTA 4Q2ZB 5TE6L 4OCLC 3BAEL 3E6HA 3DURB 3S9DB 2XPGB 4RAHA 2R69L 4OIAA 2VLLA 4P2QE 4W81A 4AEIH 5KVGL 2CK0L 1FE8H 1GC1L 3RI5K 3WBDA 1OSPH 2XN9E 2ITDB 1SBSH 5J6HB 1I1RA 3QCVH 4YR6A 5SWQA 4D0CB 4I2XE 2EYSA 1PG7X 2ZNWA 3P30L 3MV7B 3G04A 4EXKA 3W9DA 4DWHA 4HD9A 3SQBA 4NM8H 5BV7B 5HDBF 3B9KD 2NY0D 3M8OL 4XCFL 4X7SH 1IQWH 4X8JA 5I9QC 2EDOA 2Y36H 2FD6H 5EIIB 5FO7A 2EXWC 2I07A 1RK1B 3MRMA 1S9YB 1W72B 2P5WA 4FFWD 1S5HB 2PXYC 2V2XB 4JZJB 4M5ZH 5DMYA 2G75A 4H20H 1LO5B 4UV7L 1LDPL 2V2WA 4OZIF 1CK0L 4OF5A 3I9GH 2RIKA 4YDVA 3OJMB 1W0WA 2OR9H 3RWEA 4Y1AD 5E9DE 1J5OH 4XAWH 1LK2A 1KFAH 1NMBH 5T3ZL 5J11B 4QHKJ 1AQKH 2ERJB 5SWZE 3I6LD 5GGTA 5CZXC 5MEPA 1O5DT 4JRYE 2LU3A 1VFBB 3PQYD 1HEZA 1JN6A 4QHLA 1R3HA 3FQUB 4WHCA 1BQHG 1ZLUH 5ANME 1HQRA 3R4DA 3WHXB 5C07E 5GS2H 1EFXA 4FQ1H 2Y7QB 3DROB 2Q8AH 4L8BA 4YHNA 4J2XA 1TQCB 1Y0LB 1PJ9A 1KJ3H 4J8RB 1DLFL 1YPZF 3S4SB 3CC5B 2YPKA 2XZCL 5LGJA 1P84K 2BHUA 5FGCE 2HLFD 4MXQC 5D2LF 5TE4L 3BZFA 4FXKA 2D9QB 4N5ED 4RDQG 5IF0B 1NFDB 4JFFD 3RRQA 1JBJA 2K7PA 2HFEA 3U9UA 1AIFA 1RHHA 4MD0B 4OLUL 4P2OC 3EJZC 1ZLWK 3VD5A 2VLRD 3MRFA 5FYLH 2BZDA 2DBLH 4OD2B 4RFEB 5EUOE 3LSOA 1D5XA 3MX0A 3E6HB 2XWJA 1AGDA 3K3QA 1ZHKA 2L0DA 4HV8A 3HG1D 2VLLB 5E2JA 3KPPB 3BGFC 5AYQA 4MS8D 5JORA 2BNRD 2D3VA 2OK0H 2E7CA 3SDAC 3OAYK 1BQSA 4YR6B 3T65A 5SWQB 1FZMA 2EYSB 5FO8A 1IM3B 5E4IA 2HVJA 2W92A 3VJ6A 4LSSL 4LLMA 3G04B 1RUKL 1B88A 5D1QC 2DD8L 4G8FA 3O6KL 1CGTA 2CH8A 4XHJC 4DKEL 1PDKA 2OJZH 2VDNH 5GS0L 4UTAL 4FXGA 5DSCA 4X8JB 4PLOB 5JW3L 4JO4H 5DWUL 4EN3C 1AKJD 1L7TH 3BZDA 5IQ9A 5LGHH 2X4TA 3P0VL 5GISL 1A1NA 2X1WL 1BX2A 5FO7B 1JK8A 1J0ZA 2I07B 3IJSA 3MRMB 2P5WB 2PCPA 5BVPH 1W8OA 3RX5A 3WS3A 4JO3L 3O81A 5L2KD 3IVKA 3BP4A 3D3VA 4LSTL 2V2WB 5DMIH 2ATPA 4YDVB 1W0WB 5CZVL 1IVLA 5IVNA 4KV5E 1LK2B 1QPXA 3IXTA 3DUSA 2OQJA 4W4OA 1H8NA 1HKLH 5MEPB 3ZTNL 3E2HB 1HEZB 1I8LC 1JN6B 4H8WH 1R3HB 1RVFH 4QHLB 4I48A 2XRAL 4IJ3C 4JQIL 1HQRB 2LAAA 2AJVH 3ARQA 3T8XA 3WL9A 1EFXB 1N5AA 4GUPA 4ZFZA 4L8BB 4YHNB 3D69A 4FG6D 4HAFA 5SV3A 4MMZC 2BSSA 4WVRA 2YPKB 3MV9E 4KI5D 5LGJB 3VFGH 1I1CA 3Q3GA 4KKBC 4OKVA 5DJZA 5EOQH 5D6CA 5I1KH 4PJXF 5GXBB 5F97E 3BZFB 4FXKB 4EEEA 4EBQH 3GSRA 4LSRH 5EZOL 1JZ8A 1VGEH 2HFEB 3RZWA 3U9UB 1AIFB 1RHHB 3ALPA 4NP4H 1CXEA 2DQGH 3IF1A 3MRFB 4FQLL 1LVEA 2FO4A 4NWUH 4PGZA 3LSOB 2PW2A 4Y5YC 1D5XB 4X6DE 3O4OB 5GRJL 2XWJB 1GAFH 2CO7B 1AGDB 2Y23A 1ZHKB 3V5HA 5JQHC 4HV8B 2YD6A 4P3CL 4R8WH 4WW2F 5JORB 3CJJA 4HBCH 4M7ZC 5F93C 5DVLA 5I1HL 4KJQD 3TFKC 3T65B 1MFEL 1FZMB 4UOW0 3T0VA 5FO8B 4LEOA 5LXGH 2HVJB 3MA7A 3VJ6B 5E2WL 4LLMB 4UUJA 5FYJU 2X1OA 4G8FB 4MJ6A 1UKQA 3FONA 4FXGB 5DSCB 4MJ4A 3LKSA 3ZSSA 1MLBA 5IQ9B 2X4TB 3PABA 1JYVA 1A1NB 3H3PL 1BX2B 1BOGA 1JK8B 5AZ2L 4JREC 4U6TA 3IJSB 1UWEH 2PCPB 3CDFA 4FFYL 3C09C 3LB6D 4F57H 5M7QA 3IVKB 4CU7A 1NANI 1EUUA 1CG9A 1GRWA 1K9TA 5DJ8A 4H88L 3BP4B 3D3VB 3D39A 1YEEL 3GBMH 3QXWA 2ATPB 3OQ3B 1ZK9A 4Z95H 3V0VA 1KCVH 1KIQA 3JVGA 3AS1A 1V5JA 4WHDA 1TVHA 1UM4H 1NPUA 4XVUD 1WZKA 3QIBC 3VI3F 2ITCA 1NDGA 2V5SA 4XB8A 2IBZX 3IXTB 5M95B 5C09D 1ZAGA 3DUSB 2OQJB 1OP5H 5HHOA 1UB5A 4UT6H 1G9NH 1FG2B 3QHZH 4YX2H 3QUKA 1GVIA 1JNNH 5BMFH 5F6IC 2P5EE 2C3WA 2VQUA 4MJIE 4BZYA 3C5SA 2NTFA 4YZFF 1YECL 4GRLA 3WL9B 1BVZA 1N5AB 4GUPB 1MVUA 2AK4E 4ZFZB 2VISA 2P8MA 3FN9A 3D69B 5FO9A 3K8MA 3NFPA 4LLAA 4Y4FA 3HLAA 2BSSB 1BBJA 2XYCA 4KRPB 5KJRH 1YNKL 2AXGA 1ROWA 5D4QA 1FCCA 1MPAL 3Q3GB 5DJZB 1EEYA 5D6CB 4X4ME 2PYEA 3LDBC 4MMXC 4OF3A 5D1XC 3WNLA 1ORQA 5EOTA 3IF1B 1WFUA 2FO4B 3H0TA 4M48H 3V0AC 4RDQF 3DVIA 3EYUH 2PW2B 2R4SL 3F58H 1T1XA 4EI5A 2IAMC 3O6ML 3TNMA 4MX7B 1EO7A 4EDWL 3V5HB 5DA0B 2FHCA 3WCYA 1N6QL 1OW0C 1LD9A 1I9RL 1U93A 1F4AA 1UT9A 5BW7C 2NZ9C 1X5AA 1DUZA 3ZYIA 4LEOB 1P2CA 4JHWH 3MA7B 4UUJB 4L9LA 2IEPA 1JTTA 5SX5H 3RWHA 3MQIA 4NCC2 3QISA 4MJ6B 4NBYB 4CN4A 3FONB 5TQ0H 5E2TL 1DUYA 3P77A 4MNHA 3KYAA 4XPGL 4F8TA 3LEVL 3LKSB 2L4OA 1MLBB 1AFVL 3RHWK 3PABB 1UZ8A 4HZLB 1BOGB 4PJEE 4FFVC 2X7LA 4NRZA 5ADOL 5D7SL 1MRFH 3DVNA 2F5AH 4OM0L 2YOCA 4OLWH 1CG9B 5DJ8B 3UTTE 3D39B 3V0VB 3FN3A 4K23H 1FAIH 1KIQB 2X1XR 2R56H 3SE8L 1TVHB 3ZDZE 5HDQH 4JFEA 5E8DH 2ITCB 1NDGB 2ICES 3ULVE 4R90H 3PDDA 4JO1L 1GXEA 3GM8A 3TN0D 5JHDE 5C0CD 5HHOB 1UB5B 3TIEA 1AR1C 3G6DH 3QUKB 5F7EH 4HWBH 1YQVL 3NVQA 5FA4B 4Y19E 1M1SA 3C5SB 2NTFB 2V17L 4FXLA 4GRLB 3X3FH 4Z7NE 5MHSE 2AJXL 4HCRL 3QCTH 5EA0H 5CJQL 4JRXA 5T1KD 3MLUH 1MVUB 4XMKH 4GG6A 3VXTA 2VISB 2P8MB 3SO5A 2AV1A 4R4ND 5FO9B 3NFPB 3QB7C 4X5WA 5I74B 3HLAB 3TJHD 1BBJB 2BY1A 1J18A 3O3UN 4PJ5D 4WRLA 4XAKD 2AXGB 3QCUL 5INCA 3O6FA 4JGMA 1EEYB 3N1MC 1INQA 1H9VA 5DDHA 1ERNA 1FDLH 2PYEB 5FFLA 2CUIA 1ORQB 5EZIH 5IR1A 3S4SG 1N5YH 4X7TA 5I19L 4TRPL 2VKXA 3BKML 3S37L 3H0TB 1HNGA 4EI5B 2NY4B 3DGCR 1T1XB 1QFOA 4KK8C 4KJWC 5JXED 4CAGA 1RUPL 3TNMB 3V6FA 3D48R 4LCWE 2BRQA 4MQXC 3EOTL 1J1XL 3TT1H 1WFTA 1LD9B 1CGSH 5C0NC 1HYRC 3ULVC 1U93B 5IROA 5CILH 5E8PA 1DUZB 1P2CB 2C3XA 1MRDH 1T7YA 4L9LB 4U49A 3ZMRA 4KROB 3LIZL 3T3PF 2F58H 3G5ZA 3RWHB 4U1GC 1NUDA 2AXHA 2R0WH 2VZ3A 3CVHH 3SE9H 1DUYB 3P77B 4MNHB 5MP6L 1HSBA 5EDXA 4KK6D 4TSBL 2NTSP 1UZ8B 2NX5E 4XP5L 5HVHB 2X7LB 4NRZB 3VXSD 3RU8H 4OFVA 1RSFA 3MUY1 4J6RL 3DVNB 5I1IL 3R1GH 3ULSA 1CFBA 3T2OA 2E7LA 4RGNC 3SDAA 4OZIE 1NBQA 3MV01 3NPSC 1CFSA 1KCUH 3F5WA 3ZT5A 4JFEB 4HW6A 4KK5C 1JWSB 2B5IC 3L1OL 4PJBA 4RFNB 3TIEB 3MCLH 5ACMA 3ULUC 5I9QB 1U8QA 4EN3A 2XA3A 3KJ4B 1MY5A 2ZOKA 1JP5A 5IMKA 4HS8L 4JRXB 3OGCA 3IFPA 4GG6B 1EMTH 5FYKU 2AV1B 4X5WB 1RUML 2V5TA 4P2QD 2OXGA 1INDL 5IB5A 1FYHB 5LBSL 3CH8A 3PWVA 3FKUS 4ZAKD 5C7XL 5INCB 2J5LC 1NMAL 3O6FB 4PD4J 3TGXA 1A7QH 2DJUA 1INQB 1GGCH 4K3HA 2EEBA 4NC2B 5DDHB 1A7RH 2X10A 5IR1B 4X7TB 3H42L 5C0GA 4MYWB 4ERSL 2R8SL 3V6FB 1L7IL 3UTPE 4PS4L 4Q6IC 1A02N 3GHBL 4HPOL 2VB5A 2WWMC 3QEQA 3PGDA 4Y4KC 3LH2H 2AQ1A 2WBKA 3RUGF 1BIHA 4PJ9C 2N4IA 3L3OA 3O3DA 5E8PB 5FIEA 3ARRA 2HKHH 4LNRA 5F9OL 1UA6L 3G5ZB 2H2PC 4GJTB 1ZGLP 4WI3A 4O9HH 4Z76A 3GMQA 5LCVL 1HSBB 4QO1A 5SWZD 2R2EA 5D7LA 5TJWK 3CMGA 1QRKA 4JRYD 15C8H 3ARDC 3DARA 1OAUL 3EFDH 4Y5YA 3TZVD 3EBAA 5D1QD 3GJFH 5C07D 5JQ6H 3H3KA 4S1DC 2OR7A 3BGFB 3ULSB 1JHKH 4N8PA 3RL2A 1RIVH 3SDAB 1TTUA 1MAML 3PHQB 3GHEH 1S9VA 3AY4C 3MV8E 1CFSB 4KVCL 2NY5C 4OIBA 3WE6A 3F5WB 5IJVA 4MAUH 3FAXA 4YPJA 3KYMA 3MMEA 5FEBA 4C57C 3U46A 2BVUA 1NBZA 4PJBB 3QUYD 3HMXL 1S7TA 1U8QB 1UYWL 4EN3B 2AK1L 1EXUA 5IMKB 1G7HA 2KZ1B 2EECA 3IFPB 5D96C 1IGIL 4TSCL 3KLAA 2EH7L 2EDDA 4G6JL 3REWA 3CCHA 3O2WL 4WHTA 4UINH 5IB5B 2R2BA 5E4EC 1BEYH 4P4KD 1CFVL 3CU7A 3PWVB 3TA3C 3TBWB 1BP3B 4F7EA 1BECA 1BD2A 1WJ3A 3QIBA 4Q9QL 8FABA 2O26U 4M1DL 2PKDA 5IB2A 1B4JH 2HJFA 3BGAA 3NPZB 4I3GA 1IQDA 3F7VA 2YUVA 5C0GB 1FC2D 1FFRA 2X89A 3QIUD 3HFMH 3GMNA 3MJ7A 1YC8A 1QSFD 2ZUUA 3A6CL 3QDGE 4AL8L 4R97C 5I8KL 3QEQB 3PGDB 4J12A 5DVOA 4NJ9H 4AYFA 1Z9SA 5IFHH 5DMKA 3MRNA 3O3DB 3LPFA 4U3HA 1YY9C 3HC4H 4LNRB 1X5IA 4M62H 5ITFA 2MQ0A 3OXRA 1CF8H 1TXKA 3OPZH 5CHNA 4I9WE 4JKPL 1DSFH 1FYTA 1WBXA 3GMQB 4XZUA 1FPTH 3TFKD 2F19L 5D7LB 4E41E 1GPOH 5C6TL 1T0MA 3GKWH 4Y5YB 2IAMA 3BI9X 3MUZ1 5T3XE 3X3GH 1IC5L 3QO1A 2DQFA 5GGQH 3MRKA 3HI1A 4NNPH 1OW0A 3OJ2C 4RISL 4KKAD 3HUJE 4MSWA 3RL2B 2LVEA 1KB5H 3O6LL 1QBLL 4DKAA 5BW7A 3MV9D 3LQAH 5K9QG 3WE6B 5IJVB 3VI3E 2EKJA 5FOJA 1BIIA 3KYMB 3MMEB 4I8DA 4K8RD 2PR4H 2ADIA 1B0GA 3L5IA 3U46B 1NBZB 1EHAA 2W9EL 4XBEH 1S7TB 3MJ8A 3AS3A 2X4OA 4YZFE 1VADA 3OGOE 1EXUB 1EHLL 2QHRH 2DLGA 1KLUA 2VUOA 1G7HB 4ETYA 4HWBA 3ARGA 3CXDH 3C09B 4JQVC 3WKML 4K9EL 3KLAB 1HZHL 1NC4A 3REWB 3CCHB 4NN6C 4WHTB 5ADPH 1W8NA 2R2BB 3V4UL 1BF2A 1PX3A 1BLNA 3TBSA 1F4WH 4F7EB 1BD2B 3P40A 3SDCC 3QIBB 4AIXA 1FSKC 8FABB 5C71A 4YFLF 4YAQA 2X70A 5IB2B 2HJFB 5HYSA 2F53D 1IQDB 4XP1L 3F7VB 5F6IB 1GGBL 2R0KL 1K2DA 3BKJL 1X6NA 2GT9A 5TQ2H 3GMNB 3MJ7B 4KDVA 4M9OA 2H1PH 5BRZE 5EZJA 1G7PA 2XQBL 4RX4D 2YD3A 3DV6A 3DXAE 4L3EA 4ZFGL 5DMKB 3MRNB 5F6HJ 2IGFH 2G2RB 1FO0L 5CLWA 5ITFB 3OXRB 2WBJD 5CHNB 4MB4A 1GJIA 1YN7A 2VZSA 3RWDA 1FYTB 4D9LL 1WBXB 1ZGLB 4XZUB 4CDHA 3IDXL 3HE7A 1M7DA 1T0MB 3CVHA 5A2KH 3ZZ1A 5HHNA 2IAMB 2P5ED 2EDBA 4MJID 3Q0HA 5K93A 4JM2B 5EB9A 3QO1B 3VDBA 3NA4A 4GMSH 3MRKB 1XEDA 4G9FA 3HI1B 4U6XA 4Z7QF 1CT8A 4GXUM 4MSWB 1NSNH 5IJKA 4LVNC 1MCCA 1XH3A 5TF1L 1FG9C 3KDMA 4HJ0D 2HFGL 3DNKA 4L1DA 5ALCL 1BIIB 5F9WB 1GOGA 5KSUA 1QLEL 3OV6A 2A74A 1FGVH 1IGCL 2ADIB 5B8CA 1H5BC 2DM4A 4AEHH 5IEHA 2D0GA 2BVPA 3NCYP 1QOKA 4M8QA 2VABA 3MJ8B 4ZSOA 2X4OB 1OLLA 3BKCH 4LRNL 1INEL 4WJ5A 1M4KA 1CGVA 4A6YL 1KLUB 4ODVL 1MY7A 5K59E 2VZTA 3BRFA 3ARGB 1XCQB 2AEQH 1Z9OA 4YHLL 3RVVC 1WIOA 4P23D 2VDPL 5DK3A 4JJHA 2AGJH 3MRPA 2VOTA 1HKFA 5JXAH 1J8HA 1NC4B 5I30H 2CRYA 1XGPA 3WLWD 4U3XA 1BLNB 2Y25A 1IGML 2NW3A 3PL6D 2BRRH 1U3HC 1A1OA 3ZE1F 1AXSA 2DKUA 4YAQB 1FFPA 4L29A 1AO7E 2X70B 1UWXH 3H7BA 5HYSB 3LS5H 3O2DL 1D5IH 1NMCC 2ZUVA 4O58L 2FGWL 2F5BL 1K2DB 3BDYL 4ZPTA 5C6WH 2GT9B 2AXJA 2ADGA 5C3TA 4J4PD 5GS1A 3HZMA 4LSUH 2VO5A 5EZJB 1G7PB 3TYGL 2VDOL 2VKWA 3RA7L 3DV6B 3QWQB 4L3EB 5SWSD 3UTTD 4JPWH 5D2NE 3K8KA 4KY1H 4GAGL 2VXQL 4GXVL 1BZ7A 4HWEH 5DFVD 3RWDB 2DQIL 5EU4A 3N50A 3ULVD 1CGUA 3SDDD 3W81A 5JPNA 2UYLA 1WGOA 3HNVH 1J87A 1TPXC 2GTZA 3HE6C 4DN3L 5JHDD 3HE7B 4KHXL 3ARFD 1M7DB 2XKSA 5J1AA 3CVHB 1SEQH 5HHNB 5ICXA 1CFNA 2YHGA 1GC1C 3PP4L 4TSAH 4C55A 4Y19D 4JVPA 4G9FB 1AGCA 4Q6IA 4TOYL 1O7VA 2AP2A 1RFDH 4U6XB 5FYKE 4F3FA 1CT8B 4YXLH 2ZJSH 4Y4KA 4L8DA 3GJFA 1XH3B 1Z5LA 1YN6A 3M1BA 3KDMB 2OLDA 3FFCE 1WICA 1U8PA 1GZPA 5KSUB 3RPKA 1J9CT 1JF5A 4JE4B 1VFMA 2A74B 3PGFL 5FKAA 1F8TH 2DQDL 3DX6A 5B8CB 2RBLA 3VMPA 3SE3A 5ICZA 5IEHB 4Y8AA 4KZEL 2BVPB 3B9VA 4M8QB 1OP3K 1E4KA 5KW9H 2VABB 3BH9A 4ZSOB 3ARDA 3P0YH 4M7LH 1BPVA 2KDGA 2A1WL 4WJ5B 1JTOA 5F96L 4OQTH 1RIUH 1GGIL 2IPUG 2IPTL 1T03H 1OD7A 3TO2A 3ARBD 1YJDC 4L3CA 3MRPB 4G8IA 1J8HB 1MFAH 5FHBH 1PFCA 1XGPB 2HT4D 3IDYC 4X6FA 4PJDF 4GBXC 1Q1JL 3V4VH 2NW3B 4HIXL 4C54A 2HWZH 1WAAE 5LWYL 1A1OB 4KKLC 4Y1AA 2J8UF 5ESVA 1YC7A 3OKEA 1AXSB 4PJCF 2BK8A 1FFPB 1Q9WA 4L29B 3B8YA 4OLXL 3H7BB 2OP4H 1S9WA 2QSTA 3WXVH 4ODHL 5HVGB 3VWKD 3FT3A 4D3CL 2E6PA 1XGRA 3PQYA 4ZPTB 4LF3A 2NX5D 3I50L 5F44A 1DDHA 5GS1B 3HZMB 4HF5L 4PJIA 7FABH 4QXGL 1JE6A 3TO4C 4FQ2L 3ZYOA 5I1JL 4NC0B 1YA5A 3OKLA 4YDIH 1BZ9A