3WIHH

Crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKLSHGKSLEWIGDIVPNNGDTTYNQNFRGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARFSNYVYPFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAILQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Roundabout homolog 1
total genus 45
structure length 219
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihH02
3SQOL 1YY8A 4G5ZH 4NN7C 5HI5C 4NBYB 4BH7A 4M7ZC 1UB5A 4P59H 4RFOL 4BJLA 5ID0A 1LEKA 1U6AH 4HKZA 2V2WB 2A83B 3MRIB 5AYQA 1YMHB 2BVQA 3G04B 1U0QA 3QDHA 1FCGA 4JM2A 3F58H 4CADB 2JJUA 4NKIL 2EDFA 5D1QA 1Q9OA 5HI4C 3W9DB 2AJXH 4JVUA 4LLDA 3SDAA 1YEJH 1A4JA 1LDPL 1TNNA 3CD4A 5BZDA 4P59L 3VA2C 5D7JA 3R8QA 1FNEB 3OPZL 2E27L 4PGDB 1RUPH 4AT6A 4NSKA 4QHUA 4JFFD 4FN0A 3VMOA 5CAYB 2EEDA 4PREB 5TDNA 4P9HH 1A7RL 1J10A 2NXZB 4HBCH 5GGQL 3PQYB 3ARYA 3I84A 1IC4H 1B6UA 5CEYA 2UWEB 5CP3H 1JHKH 1V5JA 5E99H 5FO8A 3PDGA 1EGJA 3B3IA 4IOIB 5IMMB 1FYTD 3VXRD 1JF6A 2P8MA 4XC3L 2AK1L 5IKCB 4P23B 2PXYD 4KTEH 2MQ0A 4HW6A 4A2MA 3MJ6A 1ACYH 2G9HA 3GKZA 3LEYH 4O9HL 5C1MB 4DQOL 3WFEH 5DUML 2R0LH 5J1AB 3TCLA 1YUHB 4TUJB 4X4MA 2IANE 3MV7E 2AS5M 4JZJA 2DM4A 5DFTA 3ZLQC 4H0GA 1P7QB 1T20B 1P4LB 4H1LG 4PP2A 2OZ4A 4HKBB 4X9BA 2PW2A 4AIZA 1QSED 5ISZA 3KPSB 4H26B 1XFPA 3GRWA 4U6XA 4DVRH 2P42B 4AEHH 4NQUA 1DN2A 5E9DD 3VGHA 3MFGB 4N0YH 4X99B 4NQCE 1CFVL 3B3IB 4ODTH 3TH4T 3GO1L 4JGJA 1I8KA 5EC1A 4YXHH 1WWWX 2QSCL 4LP4A 4G3YL 4X6EA 4PRPE 1HWGB 4JRXD 4UV4H 2GTZA 3QIUC 2FGWH 2V7NB 2I60H 3VFGL 3G6JE 2PW1B 5IB5A 3AY4C 3ORJA 5MP6H 4YFEA 1G9NL 4JFHD 3EOBA 1BZ9A 2YD8A 1IEBB 4EIGB 3ZT7A 4R4FL 3OXSA 3GGWA 4J3XA 3D87B 3MBEA 3RA7H 3PWPE 4D9QD 4RRPG 4P2OB 2EXWD 1A64A 1D5IL 3JSSA 2VWEC 2FYYA 3QIUD 3OKMB 4OJFL 3RUGF 4Y4HC 1C16B 2AV1A 2G60H 4N0CC 4Q74A 1HKLL 5D5MF 4OAWA 4O58L 1AD0A 2WLYA 3WJJA 2V2XA 4OQTH 5GS2D 1S7TB 3OAZH 5JLZA 4L8CB 1IAII 3RPIA 1AR2A 4NC1C 5EZLB 1AGEB 4HT1H 3RAJL 5KG9B 4WO4D 5J0BA 1AHWA 3QWOA 1KB5H 3MRRB 5GJSH 1SVCP 2WUBL 1OSPH 1YEFL 3RWGB 1I4FB 4KY1L 3TBTA 3VA6A 1I1YB 1WWAX 4C56D 3UZQA 3MMEB 4LVEA 4Y5XA 2C3XA 4RIRA 3C8KA 3EDDA 4MXVE 3OKKA 1MHPH 1UH4A 4X0KA 4M61B 2HJLA 5TQ2L 3UJTL 1BQLH 4PJ9A 4XX1E 5ENWB 5C0AD 3U6RA 1G9MH 1K9TA 2V2XB 4YHYC 5CKGA 2R0ZL 2D0HA 1LO2H 3IS0X 3Q5OA 5I0ZA 1Q9WA 2HKHH 3HC4L 4KK5D 3MBEB 4Y4KB 1E4JA 3PDOA 3WDJA 1ZA6B 1OGTA 3WXWH 3BJ91 4NQEA 3O45A 3RWDB 5MENA 1DFBH 5L9DL 2DLGA 1QBML 3IDGA 2EDQA 1JNNH 4WTWA 1RUAH 4YIQB 1CU4L 3QNZB 3LCYA 2QQNL 3GIVA 3PXHA 3RL1B 2B1AL 4ERSH 5IBLC 3T2QA 1X5IA 4QYOA 4NHUB 2AP2A 2IAMD 4R26H 4JQIH 4XCYA 3MV11 4ZFOB 1T0MA 2QEJA 3GJEA 3QCUH 1HHIA 5CGMA 1KN2H 3GMNB 4DFIA 5L0QC 4KMQA 3LY6A 4NN7B 4EI6B 4O4YL 4K3DL 3VH8B 2DD8L 5JXED 3ULVE 5IQ7H 4LDLB 2UUDK 4RGNB 2PW2B 4KKBC 4Y4KA 1CR9H 1H3VA 4ENED 1FAIH 1NKOA 3QQ9D 3BPNB 4HWUA 5T1LA 5CMAA 4KKBD 3BPOB 3RGVB 2H1PL 4N5EC 4R7DB 4IDLA 4JQVC 2PYFB 3BHBA 3BXNB 3T1FA 4ZQKB 1S7SB 1OCWH 3FO9A 3QEUB 1LVEA 1JPSL 2P5WA 4JFHE 2DI7A 3P9WB 1AC0A 3MA7B 3MREB 3DX7B 1MPAH 3CIQA 2YPKB 2Y9RT 4RISH 2BVPA 2FD6H 2PO6D 4HZLB 1O7SA 3GJFB 2Y6SD 5FO9B 4HEPG 2VMFA 3TJEL 3KPRE 4NYLB 2ZNWA 4ZUTA 1QFOA 1MFDH 2DQTH 2IJ0C 3QQ3A 2VN4A 7FABL 3TVMC 4M7JL 2P5ED 3SCMC 5CGYD 1MHCB 2IPKB 2XTJE 4UIMB 4X4YB 5FYJH 4WW2A 5GRJH 5JHDA 2A6IB 4OGXH 3SQBA 4P4KB 4GSDH 4ZTOH 4PLKD 1LO0L 4AEFA 5ESVA 2BSTB 2Q76A 2NY2D 3OKLB 3U0WL 2FJHB 3K7UA 3G04A 2X4QB 3LKOB 5B3JF 3QQ4B 4EKXA 1JWUB 1FH5L 2E5EA 1NEZG 2R2BB 1Q1JL 3FOLA 4YGAB 1N5AA 1EO5A 4G8FA 2JB5H 1AXSA 1YEIL 1JVKA 2UY7A 4JO4H 2VLMD 4X99A 3LQAH 5D7LD 1X7QA 5MENE 1YNLL 5B8CC 3MLWH 1HINH 4XNYH 4PUBH 4NM8H 3CFBA 3TVMB 1JGDA 3UTPE 3NA4A 4CU6A 2VLJB 3H0TA 3C5SB 5JW5B 3NZHL 4XZUA 4L3ED 3P0YL 3SDXF 4UINL 1QLFB 3KAAA 3O2WH 2IEPA 3TN0D 1WWBX 3QFDB 2X05A 3MC0A 4PRAB 1G9NC 2KL6A 3GSNB 1DQQB 3ROLB 2XZQH 3S36X 1U2HA 4Y0GA 4X9FA 3TO4D 4UIKL 4UNTA 1PZ5A 4NQSB 1BBDH 1KIPB 5HHQB 1FAKT 1N6VA 1XT5A 4WI6A 5F9WB 3ULVD 2F54E 2JK5B 4JKMA 4KRPD 1NFDE 1DLHA 5CWSB 4OFPA 4QRPE 3SY0A 1NGQL 4GKOA 4QRUA 1DBAL 1MWAB 5F3BA 4LSRH 4YDIH 3GJFA 4LPVA 4P2OD 4OZIF 3PABB 3QIUB 1IM9B 3QEQA 3IFNL 3L5XH 4YWGH 2BY0A 3UO1H 3ULUF 1AE6L 4N5ED 1SY6A 4ODWA 4YDLC 4H25A 4MA1C 3BOVA 4Y2DD 4TSAL 1FFOA 5BRZE 2R69L 3QDGA 2FZ3A 3WS6C 5T1KD 2R69H 2D7QA 4XVJH 3KLSA 3RKPA 1RJYB 1FYTE 1NGXA 4NHCL 5E2WL 1YA5A 5FEBA 1X5AA 3E3QC 3BIKB 1B3JA 3BEWB 3PWNA 2D03H 4JLRB 1AE6H 5TE7L 2WINB 4EDXB 3BO8A 5JPMB 1NCNA 1NL0L 5DS8A 1P7QD 3MGOB 4J3WA 5HDLA 4PJAE 4BH8B 1IKFH 1J86A 4GMSL 3ARBD 5K33A 3U1SH 2WAHA 4PJCB 4CDGC 3G6AA 2P5WB 4FG6D 3N1MC 3TT1H 4Z7NE 4BFBD 3KXFA 5DQDH 1X5KA 3P73A 4LEXH 1MCCA 5JIHA 2EDHA 3QI9C 3G9VA 2R2EA 2LFGA 3BPLB 1U3HD 4L3EB 4I3RH 4C56B 4NBXB 4J12A 4MMXC 3PWUB 2N7AA 2XTJC 3EOBB 4H20L 5JW4M 1KPVB 3NZHH 3D2UA 1F6FB 1OHQA 4J3VA 5EOQL 5C07E 1IGCL 2X41A 1AO7A 5BCAA 5LGHH 1I8KB 3EO1A 3ET9F 5FB8B 3KHQA 1ZHLB 3CCHA 4HJJL 4V1DA 3RGVD 4F2MA 1KNOA 3QSKB 4X6DF 1Z5LB 3P11L 5I76A 4PGZA 5HVFB 5EWIH 5JUEL 4FFZH 1N5AB 3T3MF 3MJ7B 2PO6A 2WLZA 3C8DA 5TH2B 2CXKA 3TPUB 3BP4A 3LHPH 2VLLA 4HC1A 3RI5K 4S10A 4RAVA 1LO0H 4R96A 5C09D 1H3XA 8CGTA 3KYAA 1B88A 1LK3H 3O4LE 4ODSH 2GY7B 4Q7DA 2BRQA 2FYYB 4KAQL 1ORSA 1SMAA 5KS9B 5IW3A 4AJ0A 3S37X 4UQ3A 5EUOB 4HIHA 4W6XB 2J8UA 1BQSA 5IVXE 4F37K 4Z7OE 4I2XB 3MR9B 5BZWB 3DGCR 4L9LC 2G5RA 1CDGA 4NQDB 3WFHA 3AROA 3MRFB 1DVFC 1FN4A 2EDXA 5ANMA 3WIIH 2AXJA 4W4OA 3SJVD 5JMRA 5TH2A 4NOFA 5J7CC 5DSCB 2A74B 3BAEH 1BD2E 3HCVB 4FNLH 4PJGB 2Z8WC 3MUGB 5ADPL 4B50A 3OGCB 5JOFA 1JWMA 5EN2B 3T04D 4X6CB 2D7TL 3BGFB 1FG9C 4IRJC 3UCRA 3SO5A 5I19H 3HI6L 3NCYP 5DMIL 5SWSB 2BHZA 3F7YB 2K7PA 4NGHL 3T3PF 1NQBA 2QSVA 1FNEA 1IGTB 4JGUA 3X17A 4PG9A 1NCAL 3QEQE 4L3CA 3CSYA 3DUSA 4HS3B 1GGCH 3L7FB 1RIVH 3RVWD 2DAVA 4JZJB 3ZDZE 3FQNB 1L0XA 3HUJA 3S34L 2VDKL 3EDFA 2DQEH 3QQ9C 1ZV5A 2Z31A 5J57B 2DN7A 1Y0LA 2W0LA 2DQFB 5C09A 1OPGL 1WCQA 4DGYH 4KKNA 2XZQL 3LKNA 4F3FA 4OM0L 4ONGH 3EYVB 1JPGA 1N0LA 2UYLA 1X5XA 2Z35B 4PJ9D 2VLRB 2EIEA 4MNGE 4GBXC 3U36A 1BX2A 1F4WH 2FSEA 1KFAL 2VITB 3RIFK 1I1RA 3RNKA 1AI1H 3SDAC 5EZIH 4CL7A 4YHPB 3S3PA 5CEXA 1A6VL 1MSPA 4PJCF 1HINL 4W70A 3QUKA 4XPAH 3EOAA 1RV6X 5ETUB 3WDIA 5EG6C 2CLZA 5CGTA 1B0RB 4HKXB 3T1WA 4BQ6A 4XVSH 1JPGB 5D6CB 2X4UB 4L4VB 4NFCA 4OD1L 3RZCB 5JHLL 2EXYC 5D1QD 1QFHA 2QJDA 3PL6B 4NRXA 5JOPD 3SE3A 5HYSG 4EIZC 4L8BA 4PRNB 4NP4L 1BBDL 2HA1A 1L7TL 3GI8H 5LAXB 5DRNB 5JORB 2YN5A 3KYKL 1NBYA 4HLZG 4AH2A 2H32A 3AXLB 4RCAA 3X13A 1UXSA 1NAKL 2VB5A 1JMXA 4TQEH 3QDME 2WWKT 2YUXA 1E4XH 4TUOB 4MDJB 1OARL 4LVNB 4FQLH 2R8SL 3RNQA 2JJWA 4WEMB 3LIZL 3ULUL 2HVJA 1ZLWH 3P0YH 3GHEH 3C5ZD 3B43A 3W5MA 1LK2B 4ZUVB 3PDDA 4C58B 2YMXH 2G5BB 3DETC 2D31B 3MV8D 4NC0B 3A67H 1V7ML 2BHUA 3S37H 3UJJH 1DANU 5DEFB 1T04A 3BEVB 4KDTC 4CGTA 1XIWB 1T22A 1JRHI 4QRRE 2OZ4H 3GSNA 3VFGH 1Z0MA 3ABZA 3UP1A 4ZMAT 1JHTB 4Y2DA 2VOTA 5IWLA 3DO7B 5EUOA 5AZEH 2OQJA 5KSBB 5I15L 1I3GL 4OI8A 5EH1A 3TVMA 3VXRA 5EO1B 1LD9A 1ZHNA 4KI5F 4NO5A 1UWEL 2DYPD 2X10A 3FT3B 2BNRA 4GXUM 1WITA 3PHOA 1T1XB 4M7JH 1DP0A 3BGFC 3N50A 3EYQD 4QT5B 2FB4L 3VGDA 1A1OA 2P5WD 1N2RA 1PW3A 5FYLH 3RP1A 4R26L 3KPNB 2FBJH 4P4RA 1EXUB 4P2RD 4X5XB 1SJEB 1H8OA 1WBYB 5I1DA 4K3EH 3NZ8B 3TEUA 1RUKH 4Y19A 5F7FA 5GRWA 4WY7H 3VFOA 1UZ6E 3F7QA 1IT9L 1KCUH 5BO1H 1FL5B 5F88A 4QOKA 3EO0A 5F97E 4LLMB 3VXSB 5D9SA 2CUHA 3EOYG 1YEHH 3THML 3U82B 1EEYB 3LN9A 2R0WH 5FUCC 4TRPL 5IMOB 2VYRE 2GJ6E 1XF3B 3O8XD 2EE6A 2WUCL 4P9HL 1QKZL 2NX5D 5TDPB 3B2UC 1XF4A 1NCDL 1N4XH 3QWQB 1RUPL 1WC7A 1ETZA 3RZWA 1CDUA 2QQQA 2CR3A 3OPZH 5EOTB 5IK3A 2C4FU 2EYTA 4UTBH 2DYPA 2RHEA 1OD9A 4ODVH 4QHMB 3KXFB 4GXVL 3RTQC 4DUVA 4NDMB 4YBHA 1N3NA 4JFFB 1G7IB 2IFGA 2ITCA 3QCUL 1BFOB 4F15C 1W0YT 5LWYL 3HZKA 5BV7C 3U4EA 2QQNH 3OKNA 1NBZB 4PJXF 3X13B 3NFPB 5D1XA 4Q58C 4NRYB 4QRTB 5JHDD 1GC1H 5GS0C 2MWCA 4XVTH 5AUMA 2OLDA 2VISA 2YHGA 1OF2A 4IJ3C 4JDVB 5SX4I 4MNQD 1DJSA 2MCPL 4JFYA 1D5IH 4OJFH 2VAAB 3QG6B 1F42A 5TF1H 1G6RA 5GGRB 5DYOB 3C60C 1S78D 3PGFH 1OP3H 1K4CB 2Y36L 3V4UL 1J0JA 4XVUD 2RFXA 4F58H 3G9AB 1X9QA 1BFOA 4BZYA 4LLYA 4PJGE 3BIBX 4HWZB 2H32H 4MHHG 4H1LH 4ZSOA 5DA0B 3NZ8A 1IKNC 3C60D 4NT6B 4PRDA 1WISA 3WNPA 4LRNL 2APFA 4OKVB 5D7KE 5GGVH 3QH3A 2JCCE 4J3UA 1EJOH 4HWEL 3T77B 3J8F7 4AMKH 5EIIB 5T3XL 2XXMB 5T1LD 3UBXA 2CIIA 5CZXD 1RUML 2BNRB 1X6LA 3SDCC 1U42A 1T7VA 5I8OH 1KJ3L 1I8MB 1AP2A 3MQIA 4LU5H 1LO5B 3BWAA 3V6OC 1OAXH 4JFPB 3MRBB 4E41E 5ABDE 1DQQA 3QXDB 2NPLX 2HT3C 2EKSA 4JRYE 1J1OL 3PGCA 4CN4A 3QPXL 5D93C 5I1DB 3O9WC 5DC9B 5D2LE 4R4FH 5E9DA 4PGEB 4P2OC 5E8OA 1BD2A 5D93B 4OLUL 3RPKA 4QRQA 5MP6L 2VERN 2XQYK 1MAMH 3E6HA 3NCBB 5CJ8A 1AD9A 3GSUB 1HNGA 1X6NA 3G5ZB 4KQ4L 3SO3C 4HLZH 3IVKB 3GMRB 2DQJL 4PRPD 1L6XA 4FABL 2AKRA 1A7RH 1HHGA 2X1QA 5J6GB 1UVQA 2IBGA 2V17H 4MB4A 1LEGA 4FTVE 4Z7WE 2E6QA 2ZSWA 2PXYA 1EGJH 4GW4B 1T4KA 4OZGB 2ZG3A 4CAGA 1SJHB 3MRHB 3K74B 1TTGA 5FUCE 4F7PB 1MFNA 1EJOL 4M48L 1AXTH 5KSBF 1FL5A 1WT5C 2R0LL 3MLTA 1R3JA 4ZO6A 4P57A 3NOIA 1S9XB 1QBLL 1WCBA 3C9NB 4I77H 4G5ZL 3MA9H 2VXUH 1UT9A 4EBQL 5DHXB 3BD4A 4YHZH 1T21B 3GBNL 1H9VA 1YJDH 1MCHA 5DC4B 4CW1A 4P9HC 5DQJB 5KZCD 4HKBA 3FO0L 1BZ7B 4AIZB 3K2UL 3PNWA 1U8MB 2BSED 5E8PA 3TJHD 5DVNA 3HPLB 2Z92B 3O3EA 3I6LD 4XAKE 2BXZA 3CVIH 4F57H 1Q94A 2EDEA 4JY6A 2BVOB 5CSBA 2NY4C 1J8HB 3P77A 1AY1L 1X5GA 3TBVA 3WO4C 4PJAF 4EI5B 1IGJA 2VXUL 4F33B 5DWUL 2V5MA 1ZVYA 3BQUB 5ITBH 5BQ7B 3F8UB 5KTEH 4O02L 2PETA 4OI9A 2J6EA 1DVFB 4QRRA 4NKIH 3MV9B 3FHQA 2DJUA 5J9PB 1N2RB 1T04B 3BEVA 4GXVH 5KSAC 3KS0H 4GKSA 5EIIA 3GHBL 1MI5B 4LSUH 5IG7A 3F6IA 5FV2A 4GG8A 1U95B 4MQ7A 1PKQB 2GW5A 4L4TE 1ZHBB 2VQTA 5BW7A 4G9FA 1HHKA 4YUEL 5E56A 1BF8A 4PGDA 3WFZA 2GUOB 5KN5B 1NFDB 4P48A 1EHLL 1QKZH 4LLYB 1GAFH 3LPGA 5J3HC 1X5FA 5IFJB 1JZ6A 5EU6B 3I3DA 1W0WB 3O4OB 1TNMA 5GGSA 5DT1H 2XWJB 2HJFA 5E0QA 1IAIM 1BQHG 2EYSA 2EEBA 3QJFB 4Y16C 4PB9L 3I3BA 5DEFA 3K8MA 2DQFA 4PJ7E 3QCVH 3QG6A 1J8HE 2HH0H 2VAAA 1CS6A 5DR5L 5GZOD 5C0DB 1S7WB 4MB3A 5C6PB 15C8H 1A7QL 1MY7A 1EEUA 1OD7A 4Y8AA 3BIKA 5D96B 4OZHE 1CLOL 1KTLA 3DRTB 1IC1A 1CT8B 1KJ3H 2HAZA 1QYGL 2OMBA 4XCNA 4IRZH 3GSNL 4PLOB 3K0WA 5DD5H 2HWZH 1IQWH 3QDMB 3X11B 3I6KA 4ENEC 4J8RB 3HZYA 4AMKL 4JFXB 3KPLA 4JDTH 5GJTL 3MXVL 5CEXB 5E9DB 5EOTA 1G7LB 5DJ2A 1HXYB 1YNTA 4E5XA 5J89A 1QO3A 3RUGE 3WO4B 1CK0H 3T0ED 3VRJA 1GCFA 4WENB 1CTNA 1WV7T 2MJWA 3U0TB 1T2JA 1KENH 5FGRA 3AREB 3JWOC 2BVTA 1CD1B 5TE4H 3AREC 4MNQE 1TITA 4YHNB 5J56B 4QOKB 2BVYA 1I1AD 3W2DH 4MD0A 4DZBA 4M93B 4GQ9H 5I17B 2X1WL 4LQFH 5IFAH 4FMKA 1U8OA 5I8KH 4S2SA 2MCPH 2K3TA 4MA7H 5HGAA 5DZNA 1WBYA 1G84A 4YPGA 35C8L 1Q38A 4LF3A 4G9FB 3MSPA 4FQLL 4JN1H 4M6OH 4XVTL 5ACZB 2DB8A 1HILB 3IDMB 3TGXA 3TBSA 4BSWA 2R4RL 1NFIA 1YDPB 4PJGF 4C56A 2NW2A 3HFML 5IGXH 4HUXB 4YDLB 1BD2D 4GRLB 1TJHH 1BEYH 2FHCA 4G8GD 4H8WC 4PJ7A 1Q0XH 1S9VA 3KPOA 4YPJA 4ZOAA 5CUSL 3SDXB 3ARUA 2AJUL 4WHDA 1X5LA 4MJ5B 2NTFB 2VDOH 5K9KA 1MFAL 1YMMB 3UTTB 1FFPA 1NMCC 2BJML 1JHTA 3PV6B 1QACA 4IRSD 1NCDH 1Q94B 3DMMA 3O4OC 5D7SL 5INDA 3FQNA 1JGVH 1NMBH 1KC5L 1BQHB 3L7FA 4P2QB 2HRPL 4UOJA 1G7IA 4KRPC 5GGVY 1IARB 4G8IA 5I16A 4OF3A 4L3EA 2VXTH 1DR9A 3RVVC 3G08B 4QHMA 3VFVA 4ZUVA 3OZ9H 3CFCL 4U6HA 1KFAH 5HYIA 4BSVA 5EOCJ 4LL9A 2EO1A 3I75A 3MNZA 4FZ8H 4ISVA 4DW2L 3QDGB 2WWMC 1YEDB 5K9JL 4R2GD 5KVDL 2DICA 4ONGL 2PUQT 4H25B 1F97A 4ZYKA 2OL3B 4MXVF 5MEOB 4NIKB 2NYYD 4PGEA 2QHRH 4ONOA 4XWGH 4QHUB 5J11B 1WK0A 5TGBA 3I6GA 5GSVA 2R2HB 4I2XA 4CRPA 5JNYB 3LV3A 3F7VA 1EEZA 2GY5A 5DO2D 5KS9E 1KCVL 3WUWB 2HP4A 4UU9B 2J5LB 5HYJD 1LEGB 2F5BL 1BVLB 2FHBA 3S34H 1CE6B 1YMME 1NGZA 1JWSB 3ULSB 1U8NA 4Z7QE 3OB0K 3TWCH 1N6QH 3HHRB 4D8PB 5KBNC 4PV8B 2OK0H 4LSPL 3HG1D 3IDJB 1BP3B 4OLWH 1O5DT 1A9BB 3T77A 5JW4Q 3GMMB 1R3HA 3L6FB 1BFVH 5F89B 2XA8H 4CDHA 5HYQA 3WHXB 3ARDA 1EO8L 4PRDB 4MAUH 4JG0L 1F3DH 3EZJB 1V7MH 1MHEA 4LDOB 1A1MB 3TV3L 3IFOA 1ZT7B 2GT9B 2L7UA 4PRHB 1DE4B 1M71B 4KHTH 4ZFOA 3ZE0F 3B8YA 1FPTL 5TQ0H 3AC0A 1NANI 2AJVH 3LIZH 1AGCA 4Z18A 1I7ZA 5E4IA 2A6JA 4BZ2L 4PJCA 1SVZA 1JJUA 4LKCB 1DBJL 1PG7L 1YYML 3KYOA 4P5TB 4HIEA 4QHLA 3A6CH 3IYLW 3BKCH 5L8JB 1EH9A 2VC2H 4KAQH 3MNWB 5J6HA 5C9JA 4N8VA 1LK3L 1KF9B 3NCFB 1CFSB 3FO1B 3CSBA 5HHXH 4I0KA 1A4KA 1KOAA 4RX4A 4GG6B 3H6JA 3BRDA 4KDTA 4Y16B 1UWXH 5CP7B 3ZE1F 4NJ9L 4APQA 4PJHE 5C0RL 1HIMH 1KYOK 1OTUD 1U3HC 5M7QA 5LCVH 5JUEH 1I7ZB 1KCSL 3DGGB 5FDWB 1OAYH 4HCRL 1FRGL 1K5NB 1RJZB 4JO3L 3GMPA 3KPSE 4P2RE 2GQHA 3GI9L 4PLKC 3TESA 1FVEA 4I13B 1IL1B 1WIPA 1U8HB 4I18B 2YD3A 5L8LB 4LRIA 1ZEAH 3QZWG 2Y06L 3R4DA 5F72S 2DS4A 4I0PC 4LSVH 2B2XH 5KSAB 1I1FB 2ATPB 4S1RL 4FQJH 4P5KB 5AZ2L 3WLBA 1C1EL 4RGND 1A7NL 2ESVD 4QRPA 1TXKA 4LNRA 1NDMB 3QJHB 3JV6B 1ZMYA 3I9GL 1HH9A 3RDTC 2YPLA 1AO7D 4LLMA 3VFWA 2FX8L 1FHGA 2HYMA 3VD7A 1BOGA 5JW3L 2F53E 2X4PA 2IMMA 5J4MA 1OQOA 1CXFA 2ESVE 4FXKB 5GGUA 4Y4KC 2F53B 3VI4F 4XVUC 4E9LA 5HYJE 1WEJL 2HFTA 1B6DA 2ZKHH 1NUDA 1Y18A 5DK3A 4JQVA 5HPOA 5ISZE 1VPOL 4IRJD 5ELIA 1BREA 2AABL 2BCKA 5I66A 5CFHA 1PG7X 1MWAA 2MNUA 2AXFB 5F3BB 1J11A 3T4AB 5HYSB 4Y1AB 1GGCL 1XF3A 3FFCD 1U8PA 3C60B 4X4ME 1BM3H 5IHZB 1F2QA 1UVQB 4LLWB 1S9VB 2L4OA 1T0NA 2A73B 4I9WE 4N0UA 4XXCC 5DVKA 2MFNA 2BMKA 3B2UD 3IJHB 5FGCB 1E6OL 2Q87A 3MODH 3GSVB 3D25A 3FFDA 4E42A 3WUZA 2XKNA 5E8EB 4AK1A 1OP9A 4OGYH 1LO3H 1EERB 4EQ3A 1SYVB 3VXME 3KPQA 3OX8A 1QRKA 4XZUB 1KJ2B 4FQIL 2DLIA 2Z8VC 4JRYA 3WD5H 2AQ2A 2NY3D 2R1XB 4QLRA 3HNTH 2V5SA 1A6UH 3OJDB 1PBYA 1RI8A 3WBDA 2A0LD 3LS5H 4NNXA 5EN2A 2YBRB 3BPOC 3SE4A 3KPRA 2IC2A 4PRBA 5IOPA 5E7FA 3CH1A 1N7ML 5L2KB 3BI9X 3DYOA 1XR8A 4ZFFA 3CPLA 3H42H 1QO3B 4NQED 1CWVA 2FJHA 1ND0A 3IFOB 3W82A 3RWIB 4KUZH 1CI5A 3TBTB 1CDBA 5C8JA 1JIBA 2VDRH 1IRAY 4H1LA 1D9KC 4O00A 3BEWA 5F1SA 4HJJH 4DCQB 4HUUB 3OJVC 4JLRA 5SWQA 4LLDB 3DXAE 1R0AH 4WHCA 5HHPB 2NY0D 1WZ1L 5JZ7D 4FQJL 4X80L 5IR1B 1KN4H 3RNQB 4AEIH 3SGEH 3TO4A 1NMAL 4N0CD 3LKQA 3MOBL 3BDYH 1T89A 2XZZA 1FGVL 4OD2A 2OJZL 3O6FA 4NO2B 1F58H 2CLRB 4XNMB 2P8LB 5E6YA 5SWSE 2GITB 3RVTC 4YR6A 2R2HA 3UTQA 2VXSH 1I4FA 4U1KB 2JB5L 3O3BB 2X4SB 2ID5A 4RWHA 2WW8A 4OT1L 1M6OB 3WKMH 3HR6A 1UXWA 5EUOF 4BK4A 2CKBB 2VTFA 5DQDL 3DIFB 5GGTA 2BNQA 1C7SA 3UPRB 3BE1H 3SKOA 3I75B 2VDQL 1H8NA 3OR7A 3H8NA 1RZIB 2AERT 2DBLH 1XCQA 5KSAD 4U6XB 3AB0C 3V5KA 1QSFE 3EOAB 1Y0LB 4AM0B 3VH8A 1G7JA 3WO3B 2X44D 7FABH 4WI9A 1K2DA 5MEPB 3BFOA 4Z77B 4NQDD 4FQIH 4LQ1A 4HIIB 4EUPA 4U2YA 4BELD 5EUOE 5I75B 5JXEC 2DTML 1R5IA 2FD6L 4M61A 3GIVB 3W9EB 3IJHA 3RVXC 3IAPA 4KK9C 4R3SA 4N1EA 4JO1H 3UYRL 1TVDA 1QP1A 3RVUD 3O3AA 2I9LA 2R9HD 3QO1A 4NKOB 5HHOE 1FV1B 3D3VA 4FTVD 5DS8B 1CL7I 4MQ7B 1NDGA 3B9KD 5E7BA 1EIBA 2GCYB 4OCXL 3M17A 1JV5B 3HI1A 2VLKD 8FABA 1S7TA 2HTLC 4HUMB 3VFNB 3RWCA 5JOEA 4JQXC 1JBJA 3D6GA 2F5BH 1CE6A 4PG2C 2AVGA 5IB3A 4K3DH 2H9GB 1TIUA 4FXKA 3GJFK 4UIMA 3V5DA 2E6PA 5JHDB 4R9HA 4UIKH 5D1QB 1RK0B 5TGBB 4HCRA 3FB5A 3BVNA 1S9YB 3QBTB 3I9GH 4RMWA 4WU5A 1CU4H 1DBBH 4QWWD 1QBMH 4L5FL 5DD1H 1M7DA 4HGWA 1DFBL 1PY4A 4IRSB 3TT3L 4PJ5E 3ZTNL 1KJVA 3EJZD 3MLXH 5ALBL 1YNLH 1DSFL 4XCFH 5BW7C 2GJZB 4TSCL 2C3VA 5H35B 3SKMA 2Q8AH 1NUFA 1TZIA 3K80A 4M4PA 4YNYB 1FNFA 1FSKB 4HEME 4F7EB 3G6JB 4GMTL 2XG5A 1TDQA 5BRZB 5CD3B 4GRMB 2LQRA 4K9EH 5L88L 3VD3A 3OXRA 4BQCA 3QDGD 5D5MA 4WW1B 5DK0A 4U1MB 5EOCH 1OT2A 3HE6C 3JXAA 4WGVB 5AYUL 1BEYL 4ODHL 4HIXH 2PYEB 4PJ7B 3LB6C 3QO1B 4W81A 3EYSH 2F8XC 3QHFH 4EOWH 4YHIA 1MCLA 3BESR 5CILH 6FABL 5C2BL 5HVHC 5ANME 2HKFH 3RTQB 5D1XC 2OTUB 3W0WE 4YHKL 1MFDL 4YEEA 2G60L 3WYRA 3DUUA 4V1DD 3MRKA 2XFXA 5TQ0L 3P30H 4HUKB 3O3BA 2NX5B 4N8CH 4U1KA 4Y1AE 4MX7B 4OZHA 2Z91B 2F74B 5IFAL 2A77L 4S1DD 5GS1B 1IE5A 1MRDH 3C09C 5HHVH 4HMEA 5HI3D 2P7TB 2BSRB 4LCWB 2ADIB 5GZND 2VXVH 2VLRA 3F5WB 4Q9BA 2IPUK 3BUYB 3GSQB 3VFPB 1S5HB 3MV9E 1ZA3B 1JPTL 2AQ1A 4KVNL 4HDIA 5BS0A 3DX6B 2QSQA 3F65A 1D6EB 2HJLB 2QSCH 3LZFH 2P8PA 4Z7UF 2O26U 3O9WD 5T1MA 1I7RB 4XNXL 2IGFH 4KVCH 5ILTH 4OCNC 4PTTA 1OAZH 1TZGH 5I18H 3UTSD 2R2CA 3LV3B 3AAZA 4R4BB 5KVEL 1T2XA 3O6LL 2WWMD 5CS7A 4PBVC 1E4WH 4EN3A 5T5FL 4O5LH 3WN5B 2ARJB 1MCQA 1P6AB 1S7VB 4KKCD 2Q3ZA 1CXHA 3L5WA 5C0FA 3FQUB 4JFEA 4HH9B 3E2HC 4MWFB 2IALA 2FL5A 1FLTX 2B0SL 5GRUL 5CWSA 4P5TC 4KDVA 1U3YA 1S5HA 4OFYA 3D18B 2VIRB 4FZ8L 4KTEL 3CLFH 1ONQB 3VRLE 4QTIL 4XP5H 5I2IA 4KKCC 4XBPA 2HLFD 4UB0H 4Z7WB 1MCWW 1AR1C 2F19H 3O6KL 4UQ2B 4UI2A 4L8SA 2FX7L 3QI9B 2WP3T 5CJBA 1XGYL 2K1MA 1PX4A 2FJGA 5EO0B 5GS0H 1P2CA 4RMVA 4NRZB 5I74C 1H3PL 1XH3A 4M43H 1MF2L 3NCYS 2AEIT 4F7MB 4FQ2L 4MJ6B 4PRHE 3EDJA 5JPNB 1FORH 1UEYA 2CKBL 1SYVA 1MRCL 5GRXG 3RAJH 1T66C 4PJ8B 1RIUH 3MUHL 4E41D 4C59B 1T83C 2R2BA 3EYUL 2ZOLA 5IROC 1N64L 3DECA 1PQZA 1EEYA 1S9KC 5EU7E 4XHJD 4C4KO 2E7CA 2VQ1B 4OCSL 5JQ6L 4S1QH 1N0XH 4FMFA 2H2PD 3VWJA 5H35A 1BVLA 1YEEL 2B4CL 3OKOA 1MJJA 4DAGL 4MA8L 4D0CB 2WV3A 1RZ7H 3KLAA 3KPSD 2EO9A 4NOBA 4U31A 4HV8A 1JN6B 2X09A 5A2FA 3BPCA 5EBMB 2F53D 4IOIA 1D3CA 3UBXB 1H5BA 3QWOB 3VRLF 1AGFB 1YECH 3WNOA 2X4TA 1K8IA 1AGEA 2B8OT 3CU7A 4DOHB 2ZJSH 4XP1L 1QVOA 3SGKC 4NO3A 1XH3B 4LBEB 4KMTL 1ROWA 4KFZC 1IGFH 4JPIB 5MERB 3PWJB 3VXRB 1F3JA 4UDUA 3UTSE 4FQ1H 4M48H 2OQJB 3U9UB 2BC4A 4J3TA 3OKDA 1FLRL 3OJ2C 4LFHG 4GRLC 5GZOC 4GRWH 2NY1B 4XMPH 1N59B 1NPUA 4HX1B 4UQ2A 3ALXA 1UB5B 1JGUH 1FL3B 4IRZL 3ARFA 3GNMH 4JAMB 1D5XB 2XA3A 2XN9D 3DROB 5LAXA 4QGTA 1FZKA 4RBPH 1FFNB 3WFEL 1G7HA 4M8QB 4O9HH 1ADQH 2NR6C 4JZJC 3VWJC 1EPFA 2N1KA 2HJKB 3LDBC 1P84K 4HDIB 5BS0B 5HD8C 1MNUH 5I1CL 4JFDE 2XWJA 4HUWA 4RZCA 4RMTA 2JLLA 1TZHA 3ARPA 1A5FH 4NHUA 3MLYH 4APQC 1QFUL 1DE4A 3OBAA 2XQYG 2X89D 2NY3C 2RR3A 1EHLH 1QEWB 5SX4H 1OWWA 2ICCA 5F44A 3QIUA 2FRGP 4KUCF 1MCOL 2E27H 4CUCA 4Z5RA 3MBED 1P53A 3KGRA 1A9BA 3NIGF 3HI5H 3FB6B 5FO7B 1I1AA 1JUFA 4WI2A 5GGVL 1EVTC 3SKOB 3BH9A 4FQ1L 3ELAT 4ZAKB 5HY9B 3DX8B 4OLYL 4RFOH 1CGXA 4FFWD 4WTZG 1T3FA 1MFBL 1F6LL 2R15A 3MMEA 2AK4B 4QO1A 1LP9B 4QTHA 1I1YA 4YHLL 3OXRB 2P5WE 3ZE2E 1PQZB 3QI9D 5E8DH 1QLRA 2X4NB 3WJLA 1KPRA 2P49B 4I1NB 4OF5A 1ORQB 3V6ZA 4F58L 5D7JB 3I6KB 1YNKH 5CZVL 2BNRD 3BJLA 2GFBA 3MGTA 2SEBB 4NC1E 5EZOL 1T5XA 4JN2A 3ZKXB 3K2UH 3MZGB 1MCJA 1JL8A 2LU3A 1QSEE 5FOJA 3ZKXC 1CGWA 4TNWK 4L4TA 3FQWA 3ARTA 1QOKA 5JA9A 3ZE1E 2ED9A 5I8CA 1JWMB 5F9JB 5LGJA 4ONFL 5HHOA 1M7DB 4HGWB 1DQDH 2X9WA 4DKEL 5K59E 1VADB 3QA3B 4P57B 5FHAL 1BFSA 2EZ0C 3MLTB 5FOBB 5LQBH 1QBLH 2AEPL 1LHZA 4GBXB 5H37G 3SEPA 5E8NB 5JR1H 4LCWE 4L8SB 3K4AA 4M1CD 5INCA 1YPZB 3FRPA 4HIJA 1H3UA 3U2SA 3UAJC 4HJGB 4M5ZL 3X12B 4ODVL 2NY5H 2B4CC 4C54A 1EMTH 4WI5A 1UM4L 2EYTB 2I5YL 4JPVL 3NTCL 4L4TB 1I8IA 3MUY1 4WO4A 3DV4B 1MJ8L 3OJDA 3QQ3B 5T3XD 5CIPH 1QSFA 4HG4K 4Q6IB 3H2WA 4Q6YA 4R2GB 1U8QB 2WUCH 1J1XL 3HI1B 3Q2CA 1FSKC 3T08A 5C6TL 1JGLL 3FAWA 2F19L 3RVVD 2XN9A 3MRPA 3W0WB 4IOFC 3TZVA 4R0LB 2BZDA 5ANMB 1LWRA 1Z5LA 1GOHA 3HZMA 3GDBA 4NFBA 1FQ9C 3QYCA 1CZ8L 3KNBA 4QTIH 4TUKL 1IT9H 1XMWA 2G9HB 2Y1VA 2LVCA 2B1HL 4XPGH 1R3IL 4U6YA 2YXMA 5IKCA 3CZFB 3DYPA 4P4KC 1D6EA 5D2NA 4JCLA 2NTSP 3QHZL 4AEEA 4LLWA 3WNMA 4Y4HD 3MRLB 1J0YA 4Z77A 1JV5A 2ZUYA 4QT5A 4K7FB 1H0DB 4Z5RB 1P4IH 3R1GH 4MSWB 3NAAH 4XP9H 1OAZL 1T89C 1UGNA 1RUQH 2IGFL 2HMID 1WAAE 3ARSA 1CQYA 1QSFD 1EFQA 4Z7UE 5C70A 3LZFL 5DZLA 1BOYA 3KLHD 4LSTL 5IV2A 3E0GA 1IAKB 4XCEA 4N90E 3FQRB 4MJ2A 5IJVA 5A16B 5F96H 4XP1H 4QXTB 1QA9A 4XWOD 4DVBB 5INCB 5J12B 1EV2E 2J6EH 3H9HA 5E1HB 2J4WH 1MCKA 5I2IB 5MEPA 3HLAB 3A67L 1JHLL 4E41A 4X7SL 4AM0A 2HFEB 3QNXB 5IIEA 3SKUD 1RK1A 2D31A 1OF2B 2QQLL 4MA8H 3NGBC 4MQSB 2GSIA 2VIRA 5GGTH 5JQ6H 4FTVB 3U46A 5JMOC 1DL7H 1BVZA 3BZEA 4ZAKD 2FBOJ 1TZIB 4OFIA 3DSFH 3L3DA 3U9PL 5BV7L 1OP5K 1XF5B 4M1GL 4JFFA 1RIUL 5DA4A 5I1GL 4JG1H 4CVZB 2W9EL 5FECA 1L6ZA 2CKBH 4H1LB 1BD2B 2YPVH 1WFUA 2DQIH 3KJ4B 1M7IB 1UCBH 4LBEA 4N0UE 1MVUA 2AI0L 5E94B 2AXGA 2BK8A 3TA3B 1HZHH 1PYWA 3L7EB 3ROOA 1CL7H 4K9EL 5F7YC 4N9GA 4KJQD 4XPHL 1E27B 1ZGLA 4JRYD 4O2EB 3TO4B 1XAUA 3RWHA 1I8LA 5C0BB 3HUJE 4TULL 1OM3H 4XVSL 3VJ6A 3TO4C 2AV1B 3IGAA 2HT2C 3ALWA 5EU6A 4XPAL 2V2TB 1CLCA 5DMJB 1ZSDB 2EDBA 4HV8B 1URLA 3O6KH 1MCIA 3KLAB 1W8OA 3DVGA 1I9IH 5FKPA 2NY7L 3IXAA 3WS3A 3KWWA 5F1NA 1F6AA 3VWKB 4ZTPL 4MX7A 5BO1L 1KEML 4HXBH 4AENB 4L5FH 1IM3A 2JCCB 3GSVA 2B5IB 4I0PB 4YXLL 4F9PA 1V7NL 4XMLH 4XP6L 5HHMB 4N0UB 4ZODA 3WS6A 1QQDB 5FO7A 1OGAB 3EYFA 2O61B 1K4CA 1EDQA 2GYSA 5FM8A 2BRRL 1BBJB 4WCYL 4JM4L 3RL2A 5IHZA 3OWEA 5I1AA 3P0GB 2ICEA 1A3RH 3REWA 4PY7A 1W72H 4DKFH 2BCKB 5I66B 2FR4B 4KVCL 1RIVL 2MQCA 4G43A 4RAUB 1EFXD 1A1NA 25C8L 2IG2H 3WIFB 4OCXH 2EIZB 4YNYA 3VGAB 1NCBH 1YN7A 4TVPH 1GSMA 4PJ8A 4K2UL 5TDOA 3BISA 1HNFA 2JELL 3H7BB 1RU9L 4U1GB 5B4MC 3NCJH 1TQBB 1ZLSL 4HUWB 2VZVA 3PWJA 4L3EE 2VABA 5E6ZA 3MLRH 2HTLD 1HHGB 5GSRB 5M95B 3ILQD 3MJGX 5JOFB 4PRHD 4I48A 4M03A 4OB5L 4FXLA 4ZUTB 1OAKH 3GB7A 4QF1B 4ZNCD 4IIQC 3FB7A 4OZFA 5LGKA 3WIHA 5MEQB 3MRCB 5DRWA 5K9QG 3QI9A 3RJQB 3N9GL 3NPZB 4P9ML 1I9JH 4JO2L 5DHVB 2O5YL 1ZGLP 4NZRH 4WHTB 4PJHF 1GJIA 4XNMA 1AFVL 3VCLA 1PGRB 4UT9H 1WFNA 3VWKC 1VESA 1U8LA 4LHUB 4WW2B 3FO9B 2BFVL 1FVCA 1RZKL 3QEUA 3VMPA 2XZAH 5BVJA 3BXNA 5EOCL 3S5LB 4DGIL 1FYTB 4JJHA 1KPUB 2V2WA 4XXDB 4TVPE 3TPUA 3WKML 1VFBB 2AEWA 3QG7L 4OD1H 3TBWA 3O2VH 4GMTH 5I30L 4HZLA 2C1PB 5EO9B 3DJ9A 4P49A 4FS0A 5IROA 5LGHL 4WNQB 1F4AA 3DI3B 4Y4FD 4B0MM 1CIUA 4LLVB 3SCMB 4R90H 1A6VH 3G6JF 4PTTB 4JB9L 1MJJB 3V7AE 4KROC 3ZTNH 4LHQB 2AQ3A 2DI8A 3LEVL 1T03H 3IXAB 3WS3B 4BYHA 1KIQB 4LCIH 1S3KL 2J8UF 3BYYA 5HGBA 3ZKNC 4CNIA 3P9MB 1KT2B 5HI5D 3ZT5A 4J6RL 4C55A 4TNWF 3DTXA 5DLML 5DFVD 4KRMB 2YKLH 3PWVB 4EQ2A 1KJ2A 1RY7B 2PYEE 5F9OL 1ZLWK 1OPGH 3OKYA 1MCEA 1MQKH 3TNNB 1R5VB 4U05A 3TO2A 2F5AL 2CDEB 4O2FB 2XKNB 2DQEL 3CVHL 5D72L 5IHUH 3QDJE 4LIQH 5KANG 4GAFB 3CMOL 4MCYB 4CVZA 4POZD 2F8OA 2AGJL 1Q0YL 4FQXA 1QSEB 4OLVH 3FN0L 4F7CB 3ECBA 4PJFA 5E2VL 5IK3B 4KTDH 2IH1A 2WBJD 5MENB 2XWTB 5FYKU 4B41A 1NBVL 3NFSL 4X8XA 1D5BA 3RRQA 5F89A 3EYOA 4QNPF 1N26A 4FNLL 3K3QA 4WU5B 4HUNB 4NM4L 32C2A 1U93B 4KJWC 1Z9LA 5F6HJ 3RWEB 2O5ZL 1QTYT 3WFHB 3IFLL 3UZVB 1FL6A 3QXAA 4NJAL 4IDJH 1WTGT 5HGHB 2H2SC 2DRUA 1TMCB 2NY3B 1YPZF 3VFTB 3VXUA 2W9LA 1Q8MA 2NY4B 2AABH 3PABA 1KCRH 3QZWB 4NO0B 3MYJB 1QBAA 3KPRB 1BECA 2NY0C 1WEJH 3WFBL 1MQKL 1HH6B 1FYHB 2V7HA 3UJIH 5H37H 1GZPB 4OT1H 3MA7A 3MREA 3VXSA 3ZHKA 4RGMB 2ZOKB 3QUMA 1ZANH 1BWWA 3BQUA 1HOCB 1KB5B 5EU5A 5CLWA 1JYWA 3FKUS 3OAZK 5DK0B 4HWBL 3HS0B 3IKCB 1IGCH 4KGJA 3FOMB 2OJZH 1FGVH 5EOQH 1QD0A 3JTSB 4KV5F 1J0HA 2B20A 3X14B 1KN4L 2WM0A 1T03L 5GGSY 3RKDC 3TZVB 3MRDA 5EBWB 1HCVA 3PNWB 1WZ1H 4WV1B 3S7GA 1AQKL 3J7HA 3VXTA 5HGDB 5F7EH 4YFLI 3MFFB 1QSFB 1ZLSH 1A22B 3VGAC 1GZPA 3JVGA 1KCSH 3IDYB 3EW3B 5C08B 4RGOL 3HCVA 1FJ1A 3VXOA 3WL9A 3PV7A 1VKXA 3WUWG 1IMHC 3WDHA 1OP3K 4PRHA 5CCKH 2ZCKL 3T0BA 3GKWH 1QUNA 3HNVL 1EO7A 4OZFG 3B9KB 4AT6B 4RFNB 5IWLC 4GW4A 4KQ3L 3WMSA 5DDHB 4D0DA 3V0VA 1F90L 3L9RB 5HGHA 4M1CC 3V5KB 3JV4A 1VENA 1GC1C 1A0QL 5JDJA 3IT8D 4OUOA 1VERA 3HMXH 3QUZB 4NJAH 5FO8B 1YMHA 1QG3A 1BIIB 2FJFB 3FB8A 2VL5B 4M5YH 2EDJA 1UH3A 1QLEL 1UKTA 3MBEC 2UUDH 3L3KB 4TSAH 4W6WB 4P23C 3LN5A 5DJ2B 4CVXA 3B9KA 5IBTL 3JWDH 1L7IH 4WTXA 2I9LB 5DJ8A 4X9IA 2FX9H 2AK4A 1U58A 3SBWA 4Z0XA 1YY9D 4R0LC 4NNPH 2P8PB 3FN0H 1BGXH 2X6MA 2Z93B 3HZVB 3V8OA 3CZJA 3TWCL 4TULH 2GUOA 4BSVB 5KN5A 1VPOH 4HIIA 3HMXA 4DTGL 1C5DA 1YQVH 2PO6C 2DQHH 1R3KB 2ESVA 2DD8H 4HMCA 4GFTB 4MNQB 3D1MC 1WICA 3IU3A 5TPWL 4DK6A 1W2KT 2R2EB 1KN2L 5F9OH 3IU4L 2YD4A 4IRJB 3T65B 2BOBA 4DUXA 3QIWD 3O3AB 3FO2B 4JFZL 3MXWH 4P3DA 5K9JH 4J6RH 3U36B 2OTUA 4X5LA 5EU3A 5E9DE 3D9AH 4YDVA 5E00B 4ZPTB 5T1DH 3IDUA 1NH6A 3HAEB 3OZ9L 2VLKE 3F7YA 4PJIA 3WXWL 4ODBD 5D1QC 2DQUL 4BH8A 1N8ZA 2BSSA 5JOPE 4X7SH 5D7IA 4R90L 1P84J 1QHPA 3KPSA 2MMXA 3AMLA 4Z8FH 4OD2B 1CDHA 1P7QA 1T20A 1NMBL 1JMZA 3ZDXE 3MBXH 3RU8L 3GI9H 3VXPB 3O6FD 3TBYB 2ZPKH 5EA0L 1DDHA 3VXMA 1JTOA 4NUGH 4JZNA 3QDJB 3VRIB 2WBJB 3G6JA 1JWUA 3KHOA 1CICA 4KK5C 1HIML 4U1SB 5CLTA 5C3TA 2BNQB 3UPRA 3LEXA 3BQUD 1HZHL 1UXWB 1FDLH 3V0WL 3H9SE 2QADB 3HE7B 4GUPB 4ZPVA 3SE9H 1GGUA 4KY1H 2VZOA 1VFOA 1RZKC 1RZKH 1YN6B 1GGBH 3KNBB 4RQQA 4MJIE 3VFMA 4GSDL 2CQVA 1U36A 1HDMB 3JUZA 3BSZL 4OZIA 1G6RL 4JPWL 2K7QA 5H94A 3MRCA 1DQLH 2ZUVA 1OL0A 1VACA 3ILPA 5EU6E 1DBJH 4P5KA 2ENSA 1I1CA 4O58H 4G7VL 12E8H 1U8QA 1AGFA 3TJEH 1AD0B 1CGSL 1FPTH 4U4BA 4HJ0D 1WZKA 1G7LA 4RISL 1GOGA 3KJ6L 5IBUB 2X7LA 1KIPA 5F7MC 1MAJA 3W2DL 3INUL 4ZS7H 2X4PB 4CKVX 3V4VH 1AXIB 1E4KC 1EO8H 3X12A 2ZWLT 2IFFH 4ZD3H 4Y19B 2R0KL 5E8OB 4K7PY 4PJHB 2A83A 3MRIA 1JGLH 5JIIA 4L1DA 1SBSH 3SPVA 3JV5A 1X3DA 1CK0L 1YMMA 4PG2A 3PWUA 1VCAA 4I3GA 2CDFB 3CDCA 4ZUSA 2ATKB 2ZUWA 3TN0A 1RZ8B 4JFDD 3ARRA 5IHLB 1FBIL 4MXQC 5I6XC 1MJ8H 3WE6B 3GMOB 4JANB 1EK3A 4DKFL 4JDTL 5GJTH 4CVWA 3C2AH 4YEFA 1BBJA 4ZOBA 2NY6D 4Y5YB 1EMTL 5E6IC 1GGIL 5H8DA 3TZVD 5L8KB 1MRFH 4KPHL 1VEPA 3IKKA 4MAYB 3NA9L 4FQXB 4RNRB 4HUXA 5I1LB 3OKEA 5D70L 2R9HC 1N6UA 1QYGH 4OIIL 2GHWB 2XKUA 4EI5D 2X70A 5D6DA 4KJYA 1RZJC 2XOTA 4UTAL 5LQBL 5HD8D 4O2FA 1G7MA 1A3LL 3ARBC 5E24E 3FO2A 3CU1A 1R3IH 4NWUL 5IMLA 4C83B 3QXVA 2XICA 4JHAL 3E6FA 1CFSA 3LQAC 2DBJA 3ARDB 5I17A 1KB5A 3V4PL 1KEMH 4OGAC 5DT1L 1I8MA 3MLZL 1XF2A 5DMKA 1BJMA 1NLDH 1WSST 3D39B 1A6AB 2HT4C 3HC4H 1KIRA 4P0DA 5L7XL 3CMGA 4HUVB 1C5DB 5KOMC 1MCFA 3FZUD 3TIEB 2HMIC 1UB6B 3JWNC 1WAAF 1KB9K 1ZLVH 5C0BA 2GJ6A 1JWSA 4JFYB 4YHOH 1NC4D 1A02N 4XNZC 3IRPX 2BJMH 4E5XB 4X6DA 1TJIL 1MFAH 4YHLH 5TJWK 2BVOA 1T2QL 2VDNH 4WVRA 4PJEE 1YNTB 4LGSB 1S7QA 2AJUH 2OTWA 2IF7A 2IBZX 3QEQB 1MUJB 3UROR 1PVHA 3HC3L 4XBEL 1BF2A 1OOAA 4ZPVB 5GJSL 2YPVL 3VFWB 3GMMA 1RZGB 3HI5L 4Z7QF 2MPAH 4M6ML 4U1HA 1MLCB 4XPTH 5KTEL 1U9KA 3LS4L 5JR1L 5CP7A 3U9PH 5BV7H 3N1FC 1IEAA 2XN9E 2RGSA 5DWUH 4M62L 1D5MA 5F7UA 1BMGA 5DJDA 3OKMA 1FFNA 3LRGA 1XIWD 4S1SL 5TDPA 4KJPC 4DUWA 5DFVC 3OQ3B 4UMGA 1JFQH 4N5UA 4Y4FC 4LQFL 2NLJA 1KXQE 1W0WA 5FK9B 1FP5A 2X1OA 5A2JH 4YBLB 3D0VA 3NN8A 1WBZB 2GK0A 5KS9F 1TCRB 1XEDA 5F8RC 4LHJB 3GBNH 1U3ZA 3B4NA 1PY9A 5E5MB 3NCCB 4IOSD 3O4LB 3UTTE 2QR0A 3SDYH 5C86A 5C08A 2Z35A 4PR5A 3KPOB 4OCYH 4ETQA 5HHQA 4GKNB 2Y5EA 3GNML 4JM2F 5AD0A 3BWUC 5MEND 1JGUL 1XF4B 3CXDL 3ULUD 1PD6A 5DGRA 2H6PB 3QPQC 4KZDL 3ZL4L 3QEHB 3VI3F 4CMHC 2QTEA 2F9BT 2HWZL 4RSVA 3BW9B 5FYKH 4Q9QL 3BPCB 3R0NA 5FV1L 2FATL 1T7ZA 2ZG1A 4LSDA 3BWAB 4HPYH 4FQQA 1BWMA 1S9WB 1AP2B 4ZUWB 3DYMA 4F9LC 4FABH 2YPLD 2EDYA 4IS6B 3O3EB 1NCCL 2VR9A 5C0CA 1QFUH 4Y4HB 5I9QC 2I9TA 2CGRL 5MEOA 4NQVA 1A5FL 3QAZC 4C56E 1P9MC 3ZZ1A 4WIQA 1IAIL 3KPMB 5MI0C 2C3HA 3ULVL 5T5NF 1NEZB 3UTZA 4J7RA 3Q6FB 2NZIA 1GAFL 2M26A 1NMCB 4OLXH 3VDAA 4EN3D 4LU5L 3RIAF 3L3GA 2WNGA 2D9CA 4WUUE 5FYJE 4S2SB 1IC5L 4QY8B 3ZE2F 1TETL 4F37F 1CGTA 2UZIH 4WHTA 1I3RB 1N64H 1D6VH 4Y88A 4X6BB 1YEJL 1C7TA 5T3XH 3EJZC 4HIJB 2E6JA 1EJ6A 1KTLB 1QRND 3ZHDA 4Q2ZA 4LRNH 4OZIE 3VXPA 4JCMA 1IZKA 3KDMA 4K7PX 1YEDA 2W60A 1YY8B 5ITBL 3ZTJG 4LPXA 3MLPA 5A3ID 3TA3A 1R24A 3H9SA 4DKEH 1MVUB 4NWTL 5FGCE 3BQUC 3KPLB 2DJSA 2O5XH 3TFKC 4G8GA 4TOYH 4HPOH 2YRZA 5HDQL 3V4UH 1P5UA 1ZT1A 2W92A 5EIVA 3NIFE 3BD5A 1RJCA 2MTPA 3B2VL 4LVHB 3X14A 1PFCA 3PGCB 3BRGC 5ESQA 2FO4A 2X40A 4JFPA 2FIRT 4FQPA 3VWKA 3MCLL 1O0VA 3PJSB 2EKJA 1PKQE 4PRNA 1T6WA 5ERWA 3QHTC 2E7LA 3WJJC 3T2PA 3EYUH 2APVA 1ZA3A 3GMNA 5DMYA 4FQ2H 4JY5L 3F7RA 3EO0B 4YHML 4U7KA 4YDJB 3ES6B 4V2BA 4UBDC 1KTDA 2H8PA 1EGJL 1JI2A 5DJ0A 2NW3B 3EDKA 4V1DE 4X6FA 3C2AL 4D9QE 3QUXA 3MCG1 5IBLD 2J8UE 4XGZB 4RFNC 1MFCH 1T1WB 4ODUB 2VE6B 4BZ1L 1JTTA 5HPMA 4NZDA 4F7TB 2NY6B 3KPNA 1HCFX 1LE9A 5JW4R 3IDXH 3C87A 1W0VA 4YO0A 2IBZY 1VFBA 1ZT1B 2R0WL 4BFGA 3QNYB 5DD6A 1JZ7A 4JPKH 4MZ2A 4MVBC 4AY0A 1CFQA 2RFXB 1I8LC 3EJYC 3IDYC 5E08H 4RMRA 5BVPH 4ZS7L 3ARZA 5F1IA 2Z8SA 4LPUA 1S7WA 5HHVL 4JKPH 2XTLA 3QIBB 4G7YH 1JGEB 4HF5H 2ZZUT 2HN7B 3OR6B 3NFPA 5D1XB 4O51A 5DJCA 3V6BR 5CINH 4ZXBD 1REIA 3U7YL 3AY4A 5DO2C 2X89A 4OZGA 5DRWB 4K23L 3X3FH 5T5FH 4XMPL 4QHNA 3HN3A 2AEQL 3O11B 4OZGE 4PJ5D 3I6LE 4MGXA 3BSZH 1SJVA 3EYSL 3GB7B 4QF1A 2F58H 5I18L 1UCTA 4L29B 4OAWB 1NCWL 5KAQF 1E0OB 4MQTB 4QCIA 1GGBL 1UG9A 3ZDYF 3V79C 4XNXH 2R39A 2JJSA 5EZJB 3WNNA 2E7MA 2VABB 3BN9D 2DM2A 4PJGA 1JZ2A 3SGJC 3MV01 4G8IB 3KPMA 4GKSB 5FYKE 5EFIA 5E5UB 5J9PA 1XZ0B 2DIJA 1EA9C 2B39A 2VLRE 3ILQC 1QLRB 4OZ4A 3S37L 2DWDB 2F8VA 1NBYB 3VG0H 5HDBE 3SDDC 1YYLL 4WI3A 3BN9C 4L4TD 1OT1A 1KEGH 4PP1C 4PY7B 3TYGL 1CF8L 2ZCLH 1RZ7L 4CU7A 1FIEA 5F6HI 3S4SA 3ULUH 1U41A 1RULH 3DX9B 5ESAB 2V9TA 5DD1L 5C07D 4NPYB 3B6SB 4FFYL 1HH6A 3DVNB 1E4XL 4HC1L 5HVWA 2HKFL 4A6YA 1CYGA 1P4LA 1NJ9B 4PP2B 4X6CF 4Y1AD 1W0VB 5CILL 4YO0B 5FM4A 6FABH 3T0EA 5JPNA 4XI5D 5TFSH 4DGVH 1MRCH 1T1XA 3O6FC 4IIQB 2GSGA 3MV9A 4I18C 3OV6A 4DEPC 3IU4H 4RAHA 1CICC 4ODHH 1WFTA 1HYSD 1TQBC 3VXUB 2Y72A 3CZFA 3MJ9H 3TN0C 4ORZC 3WHE1 1PLGL 3S35L 5BZDB 2H8PB 2YUZA 4OV5A 3D39D 2C5DC 4DZBB 3U4BL 5IVZA 1OGAD 2XNAA 4XBGB 3DO7A 4PJEF 5DQ9B 1CGYA 1OB1A 4YHOL 2AJZA 2PXYC 3SGDI 3BW9A 3RWHB 3IETB 5J12C 3W0WA 4BUGA 4NNPL 2PXYB 2JJSC 5LKNA 3K8LA 5D6DC 2ENYA 1FFRA 3THMH 5L7XH 3ZKQD 5T1KA 2F54A 3OJMB 3DROA 3JWDL 3BP5A 1MIEL 4ODXA 4G6ML 4FFVC 3BP7A 3EJYD 1S9XA 1DCLA 2BDNL 1E4KA 3CK0L 4PB0H 2ADJA 1F4XL 2FBJL 3BP6A 4ZO9A 1IGTA 4MDJA 1A0QH 3Q5TA 5FDYA 2GSIB 2VJXA 1I3VA 3RGVA 1R5VA 3NA9H 4M6AA 4O5LL 1BIHA 1RK1B 2A9NH 2ZSWB 3L1OL 4P46B 4Y8DC 3RVWC 4M1DH 5EUKA 1VB9A 4MXQD 3ZTJH 3DTXB 1J1PH 2FJFA 3D39E 2OCFD 1FN4B 4CNIB 3BMVA 4NQDA 1OTTD 4RGOH 5FUZH 5IFJA 2YD9A 3F5WA 1IAKA 2BX5A 2IFFL 3L5HA 3WEXA 5DMIH 1T7XA 4NQEE 2EDRA 2D7TH 4PJEA 4WWKA 5C8JB 5F7EL 1UJ3B 2HT4D 3SE4C 4RAVB 2VITA 3RNKB 1ZVSA 2A77H 4X7EC 2CRZA 2CRIA 2ERJB 1DBKH 1F4YL 3MRKB 4K7FA 1T5WB 3QFJB 3P30L 5DRXB 1RZJH 3CFJA 4NKQB 2R8SH 2MOVA 4XP4L 4LLUA 2NY1C 3MLVL 2YR3A 3LB6D 3M1BA 4NPYA 2OL3H 1S7XA 4F2MB 2DWEB 5C2BH 1X5JA 5AWNH 2ZCHH 5EO1A 1R5WB 1K6QH 2VDRL 4D0CA 2NNAA 1X44A 2A6DB 3GZKA 4ZNEE 3KYKH 4OTXL 3RX8A 5D2NC 3L5JA 3UJIL 3H3BC 4EJ1C 4ZNEA 1L7TH 3P4NB 1RFDH 3HC0B 3BZFB 1FDLL 3QUML 3V0WH 2DWDA 5ICXB 4H8WH 1SJEA 3EHBC 1U8MA 4XNZB 1HEZA 3ZHLA 3HE6D 2OL3A 3RGVC 3W39A 5ADOH 3OAYK 4YGVA 1AJ7L 4L3CB 1A6UL 3UC0L 1CBVL 4JZOB 3O9WB 1Z2KA 3V6OA 3DO3A 2LU4A 4LPYA 1VSCA 3RKDD 4IDJL 3G08A 3PL6D 4OGZA 3VFVB 2W60B 4P2OA 1FVDA 2F54B 4WTZA 5CSZA 5DSCA 3I3EA 1J0IA 1YN7B 4RDQF 1Q9KB 1CFBA 4CMHB 3DXAA 1GIGL 5EPMB 5DF0A 4JFZH 2ITCB 3NACH 3KR3L 3CVHB 3CDGA 2EE2A 1U3JA 1UWGL 2A6DA 1I9RH 1F45A 5B21A 1A14H 3GSOB 1V3JA 5TPWH 4EI5C 5I1EH 2VQ1A 2WZPD 1D5MB 4K3GA 4YHYB 4JR9L 2NY5C 5DUPL 3WFDH 1DN0B 4K71C 3VW3L 4KH2A 4OBSA 2EH7H 3MV8E 2C4XA 2OSLA 3CVHH 4KC3B 3S97C 3U1SL 1H0DA 4P3CL 2PO6B 4WI7A 1I1FA 4LGPB 1JZ8A 4ORGB 4JR9H 4H0HB 5DUPH 3UTSA 1MUJA 3IDMA 1R3LB 3ZKMC 3S3SA 5SWZB 4OLZL 5D7LA 5CBEB 2OTWB 1JN6A 3EO1B 4FQCH 5D1ZB 2VWEE 3FZUC 1LP9A 2FX8H 3NACL 4QTHB 2XY2A 4U6YB 4L8BB 5F21B 5CD5C 5C0IA 3HAEG 4J4PD 1D9KD 3FB6A 3DX6A 4QHKJ 1C1EH 2YXFA 1NLBL 1I75A 2AJYH 1IFHL 1XR9B 1YEGL 3UPAA 4XC1L 2XTJD 3HG1A 1SEQH 2UWEA 4FG6C 2B2XL 1TVBB 4JB9H 5ETUA 4AYFA 3FONB 1F11B 2CMRL 1A7BA 1PJ9A 2Y7QB 4IEFB 5GHWH 1BM3L 3FT3A 4A6YL 1N8ZB 3P73B 3ZYJA 5IQ9B 4XCCL 4EDWH 4KI5D 1ZS8A 1AJ7H 4WGWB 2E7BA 1UZ8A 3O2VL 4MWFA 2QR0B 3LMJL 4XH2A 4K3HA 5GPRA 4LOUD 1DEEB 2ARJA 4DGIH 2UZYB 1WBXA 5JZ7C 3BMWA 4Z0BL 4RIRB 5HHXL 5K93A 1TZHB 3B9DA 5EULV 2DQGH 2BFVH 5DI8A 4NZTL 4MS8C 3CSGA 1UM6L 5DD0L 1AFVH 4M02A 4PY8J 3WHXA 1VHPA 2O5YH 1KB9J 1ZLUH 1FL3A 1B0GA 2OR9L 3FJTA 3C08H 1OLLA 3K46A 1NMAH 4Z7VA 5GXBB 3VE0B 5ID1B 4OB5H 5DD6B 5ALCL 1NGZB 2KZWA 3FRUA 4WUKH 2XNAB 2GFBB 1EX0A 3DURB 1CQKA 3L3DB 5DGQA 5TE6H 4HIHB 5F1OB 1IQDA 5KAQG 4MZ3A 1EBPA 5FUOL 3D0LB 2DDQH 3LQAL 4Y5XB 2D3VA 3BN3B 4JO4L 4F7TA 2I25N 2H32B 3W11D 4Z78A 5E2UL 4PJIE 5ICYA 4P2RA 1ETZB 5I6XB 1RU9H 2NXZC 4IIQA 4HK3J 4KV5E 2GTWA 4KKAD 3PF2A 4LSPH 1HYRC 3DX8A 1FJ1B 3EOTH 3VXQB 3U0WH 5H94B 3PP3H 4HS6B 1I7UB 3TT1L 4L1HA 5KJRH 3RZCA 1FV1A 5GZNC 3MACH 4LSQL 3T0DA 4PJAA 5GRJL 2IAND 3MV7D 2Q6WA 3L1OH 4PJBA 4A6YH 3A6CL 5DDHA 2DL9A 2MSPA 3OXSB 2BNUA 5C07B 3BHBB 4HJ0C 5JXAL 4BZ2H 4X5XA 1A1NB 4Y5XC 2AJVL 4LCUA 2Z31D 2X9XA 1SEQL 2Z92A 1F02I 1FGNH 5JIKA 4ONHA 5J13C 2GSGB 5I73B 3CK0H 2XZCH 1KELL 3IB4A 3AVEA 1BJ1J 2Z31C 5IT2L 1X4YA 3B83A 4NM4H 4PJ9C 4RNRA 3VXOB 4M7LH 1H15A 4RMQA 3C2SA 3KPRD 4X9GA 5EZJA 4MAUL 4ZTPH 5IESL 4HKJB 3ZDZF 1KNOB 3O3UN 4NCC1 1RZIA 2J2ZA 4H26A 1UQSB 4QRRD 4WV1A 2QSTA 4U3XA 2PR4L 2IQAB 2XRAH 5AEAA 1EUTA 3ARFB 4JAMA 3T0WA 4OZ4B 3HUJB 5FCSH 1FAIL 3ARQA 3JUYA 1A6TA 3STLA 2VXQL 4V2CB 5IHUL 3U4BH 4EUPB 2BY1A 5HGAB 4X6BA 2XN9B 2YA2A 3PDOB 2AI0H 2EDLA 4FHBD 4P23A 3GMQA 1A14L 5ICZA 2FIKB 1IAOB 1TLKA 5BS0D 3Q6GH 1XGTB 2PYED 5IGXL 3MX0A 1UKSA 1NGPL 5JW3H 2BVEA 2IWGA 5TFSL 2W07A 1G7QB 3DV6A 4NYLA 4YE4H 4LCCB 5HHPA 4UT6L 1AD9B 1L9NA 1XGUB 1FFOB 4U1HB 1A8JH 3MJ7A 1NDGB 2OI9B 4NN5C 3WN5A 5BMFH 5I75C 2OMNA 4QRSA 5AZ2H 4ZG1A 4PGBB 2VO5A 4S1RH 4WUUA 2XWTA 2A6KB 1NFKA 1CF8H 3NFNA 4LSVL 1CFTA 1FNHA 2PTTB 2CPCA 1U8HA 4K55A 4KXZI 2Y06H 2GITA 3GK8H 4J8RA 1QSEA 1UWXK 2J6EL 5KS9A 5HI4D 3VG0L 1DEEA 5IB3B 4L8CA 1C8PA 3OL2A 3BH9B 5CEZD 5I30H 4R7DA 5B3NA 1I1AB 1JI1A 1EAPB 4Y16A 2IANB 3MV7B 1LEKB 3QNYA 4NJ9H 3TNMA 4JREC 5C0CE 1KIRB 1FH5H 1INDL 3LDBB 5T1LB 2BSRA 3G5XB 2YSSB 1F11A 2VH5L 2XZAL 3D3VB 1CE1L 4OGXL 2ICWA 4NUJB 2F58L 1FG2B 1K6QL 5FYJL 3IDIA 1T6VN 3M8OH 4JO2H 3MO1A 3PWLB 1RIHL 2IAMC 1FCCA 5E70A 4Z6AT 3OG6B 2OTPA 1K8DB 4JN1L 4M6OL 2G2RB 4ZFZA 1RZJL 3QHZH 3FT2A 3IF1A 4U1IA 4JHWH 5DVOA 4PS4L 3CUPB 2WSKA 3LQMA 2CJUH 1PG7W 4MDIA 4PPTA 4WDIB 3T65A 1AKJB 15C8L 2NXYB 2LV4A 1OTSC 3RA7L 7CGTA 2D4DA 2HH0L 5DR5H 4GQ9L 4OSUL 1MPAL 2CLRA 3FONA 1M05A 5B4MD 5EO9A 3MLRL 5D5MB 1AC6A 1RJLB 4JG0H 3VFUA 1CDYA 1RJYA 4M3JA 1WIOA 3D18A 1VGEH 2JELH 4GAJL 1KENL 4N0RA 5C6TH 3MZTA 3HS0A 3F6LA 4PRIE 4XMKL 4LPWA 4P2YA 4D3CH 3SJVB 4MD4B 1I85C 5B8CA 2C3GA 1WT5A 2E9IA 4MA3B 1Z9OA 4WUUB 1MHCA 2IPKA 4GAYA 3SKJL 5E95B 3UTZB 3HPLA 3IJSB 4EUPH 5IF0A 5DFWH 3S88L 3PP4H 2A74A 3MYJA 5DJYA 3A0OA 2ITDA 4NO0A 3MROB 4JQIL 4RA3A 4HXAL 1CLOH 3MRFA 2XYCA 1F13A 2HVKB 4OZIB 1YJDC 3KPTA 4GW1A 1KV3A 4M00A 4JQXA 4PB9H 4YDKL 1EVUA 2YWYA 3E6FB 5D1ZC 1IGIH 4ODWB 5FDWA 4X5WB 3STLB 1I1AC 4ZQKA 3QRGH 4NO3B 2W59A 1XIWC 1F4HA 1IBGL 1EZVY 4X7DC 2AXHA 3FO0H 1FNSH 2G75A 5DURB 8FABB 3MLUH 3CXHK 5EC1B 1U8IB 5KSAA 3I2CL 3MGAA 4A6YB 3KS0J 3S8WA 1MHPL 1P1ZB 2LE9A 1G0YR 5IP4A 2R23A 2DQDH 4Y2OA 3C60A 2PYEA 1QQDA 1OSPL 1YEFH 3MCKB 5B39G 5C08E 2DQIL 3F58L 3H7BA 4QRQB 3RVTD 5BJTB 4HT1L 4JG1L 3T1FB 4LCUB 5IJKC 1ZS8B 3ULUC 4Z7OF 3IDIB 1VGKB 4Z7WA 43CAA 3TCLB 2NCMA 1UA6H 3ZKND 35C8H 1AO7E 4K94L 1MOEA 2X7LB 5I8KL 2R23B 4KQ4H 5I1IH 3LPFA 3MRGA 3DXAD 2OP4L 1P1ZA 1ITBB 1JHLH 4HIEB 4PYHA 3PL6C 3DIFA 1QFPA 3RBGA 5CKAA 5HI3C 3ZO0A 1J5OH 3QFJD 4OI7A 4HFUL 2Q86A 1FNGA 1FIGH 1KTKE 3FOLB 3I02B 4BA8A 2APTA 4YIQA 1S9YA 2H3NA 2ILLA 5CJOH 5D1ZA 4G3YH 3WSQH 1UJ3A 5GSVB 3GO1H 4ODTL 4PJEB 3ZKMD 4Z7VF 3RX7A 3D0LA 4P5TD 3DGGA 4POZC 3X11A 3S6CA 1P69B 1ES0B 1P4IL 4G42A 1CICB 2IANA 3MV7A 5D8JL 3CC5A 2CLVB 5C0BE 3CLEH 5A43C 4CADA 5SX5K 3CXDH 4HWEH 5SWQB 3RZCD 1F5WA 5HYJA 5J3HD 1T0PB 1NGWB 3IS1X 5DJYB 3VXMD 1D5XA 4C83A 3QB7C 1M1SA 3QCTH 3RY4A 1H3GA 1P7KA 2Z91A 4UAOC 2PTTA 5CJOL 1G7MB 4R7NA 1M7IA 2DLEA 2UVFA 1JNLH 4HFUH 3MJ8A 4LP5A 5FFLA 1ZTXL 3HNSH 2EIBA 3ARGC 2VDML 1A7PL 4KRLB 1KIUA 5D7JD 3U48A 1A7OH 1M71A 2OP4H 4I4WA 2VR4A 1UYWH 2CDEA 4JY4A 5FA4A 4BFIA 4JPIA 1X5HA 5I1IL 3DV6B 4PJXB 2W9DL 3HPJB 2W65A 2ORBL 3DNKA 3KYNA 3JZ7A 2PNDA 3EGSA 1OTTC 3O9WA 1BFTA 4NQCB 5IB4A 4CJ1A 4IM8A 1RJLA 2X4OB 5FGSA 1H15B 2I5YH 3V7MA 3TVMD 3DHMA 1Q9WB 2WK2A 3HG1E 3SHSA 1LMKA 5KVGH 1TQCB 2EICA 4LRIC 4N8VG 4MD5B 3DMMD 4OZHB 4PJHA 3WIFA 5DRZB 1U8JA 1EAPA 1AIFB 1HI6B 3D25B 3FFDB 5HGGS 4E42B 5LBSH 5IM7A 4G43B 4RAUA 5DHVH 3DX9A 5ESAA 1JPFB 4WWID 2RCSL 3HC0A 5E8EA 1QA9B 2BMKB 3GBML 5F88B 1KLGB 4IMKA 5C0NC 3VFSB 4UTBL 3OKKB 1T80A 4X7FC 1T2QH 5T3ZE 2Q6WB 4U1LA 4WNQA 1TJIH 1N4XL 4LOUC 4Z95L 4LLUB 2EE9A 3WE6A 4YAQA 1KJ2H 4QRSB 1XGYH 2VZUA 3ESVF 2ORBH 3VXQA 3GFUA 1VACB 3ILPB 1BIIA 4XT1C 2F15A 3A6OA 5AAMA 4D8PA 5GS1C 2Q76B 1KJ2L 3MRJB 4NRZA 1NKRA 3V4PH 5BZWA 4Z95H 2FIKA 5DJ6A 2MHAA 5K9QI 1I3RA 2UY6A 5F1NB 4G9DB 4Y19E 3HE7A 4GUPA 3LKPA 3P4OB 1A4JB 1MFBH 2WIIA 4U1JA 3CVHA 4OLYH 1LNUA 5IW1B 1A47A 5I1JL 1ND0B 1J0KA 1CD1A 2FB4H 5GQBA 3NPSC 4J1UB 5E2TL 4B7LA 3CPLB 4Y4KD 5FO9A 4XBPB 4FQHB 1MIMH 3AS2A 3T09A 5EU4B 2COQA 2UZIL 4N0FA 5KVEH 3TIDB 4PD4J 3DRQB 1C5BH 3SGKA 5LXGH 1QFWH 2AJSH 4KJWD 5D7IE 5EIQA 2HJFB 4V1DB 3GSRA 3N06B 4XMKH 5AZEL 4J3OC 5HGDA 3WSQL 1T5XB 4QNPE 2W9DH 5F71A 3C6SB 2YC1B 5EBLA 3W39B 2C26A 1JPTH 1VGEL 4X4XA 1HXMB 5FKAB 3QISA 2VXVL 3MOAH 4KWUA 5J1AA 3EFFA 4M7KH 4IBLT 1YZZA 1DZBA 1T83A 5CIPB 4MLIA 3PWPD 3IKCA 3TNNA 1B0GB 3NIGE 2RIKA 4Q0XL 3IU3B 5FOBA 1MRDL 1IC7L 4WEUD 2YMXL 4CJ0A 4Z7UA 5EU7C 3O6MH 3SDXA 3PWVA 4XPFH 3CH8A 1TVBA 1K85A 3GIZH 1CGSH 3MRNA 3O3DA 2J12B 2AJZB 3BKYH 2Y5TA 3HAEA 5I8OL 1GYAA 3K1KC 4NKMA 2Z93A 3HZVA 3VI4E 5HYSA 5JIPA 4R97C 4PY8I 1R5IB 3ZL4H 3HRZA 3NPSB 3MV8A 3QFJA 4BKLA 3G6AB 4ONHB 3RTQD 3D0VB 2ZP0T 2JIXB 5E1AB 1RSFA 5IVNA 2AK4E 1NCTA 4NNYA 3DUUB 2DQDL 3ZYOA 4KI1A 4I5BA 1LDSA 5C0AE 2YRLA 4YDJA 2HLAA 4JFDB 5C0ND 1BOGB 3ARED 3M45A 3WKNA 4NUGL 2VQUA 3CDYA 1T21A 2X5PA 4OCWH 1IEAB 1SJXA 3U6RB 1OSZB 5D2NB 5DJAB 32C2B 4TSCH 1E28A 3BDXA 4UNVA 1G6RB 3GK8L 4X0KB 1OY3B 4P2CG 1J05B 3IDNA 5BXFB 4K7PH 2CK0L 4Z0XB 1YC7A 5TF1L 1IGIL 2ADGA 4PJ5B 5EZIL 3VFRB 2EECA 4YDKH 1FNAA 1RVFL 1IZJA 1MCPH 1N0XL 4NN6C 3ECBB 1IVLA 1UA6L 2QQKH 4KGLA 3WNLA 1WBXB 1DBBL 4M62H 4UT6H 3A6BL 3BGAA 2C9AA 3QDMA 4W4NA 4DEPB 1FNGB 1CLYL 3C5JA 4HXAH 1NEUA 5C0JA 1AGBA 2A9ML 3Q6GL 4RZCB 1F3JB 4UDUB 4R97B 4PBXA 4LEOA 1JYNA 2BVQB 4XBEH 3MNZB 4ISVB 4NP4H 4ALAH 3QUXD 3H3PH 4KU1A 2NYYC 4I3SH 3V0VB 1K4DA 4DTGH 3IFPA 4N8VB 4WHYH 1KACB 3I2CH 1KBGL 1EBAA 4WFHD 2X4TB 3MLUL 4UUJA 3JWOL 1JZ4A 3RHWK 4BUHA 4LFHD 2X1XR 3DPBA 4GS7C 3L95A 1SEBA 1FNSL 4P5TA 1EZVX 3V8CA 1J8KA 4LK4A 3MR9A 4AQOA 4P4KD 3MRBA 2LAGB 5IV2B 3LKPB 1YEHL 3P4OA 3CH1B 2FR4A 4POYA 2A73A 1J8HA 4IHOA 3MRQA 3PWPA 4EVNA 5J11C 3KJ4C 4X6CE 3VFOB 1HSBB 4JHAH 4M7LL 3MFFA 4HAGA 5IT2H 4JRXE 1RUKL 3GSXB 3GSUA 3T0EE 1A3LH 1MI5A 5IG7B 1IM9D 3D5OF 3TBSB 3K4ZA 3PGDA 1FGNL 4XAKD 3CX5J 5DJXB 4JHWL 3HMXL 3OHXB 3EKCA 4RBPK 1XR9A 4NQDE 5C7XH 1MJ7L 3B9KC 3T0AA 3H9SD 4HMDA 1ZHLA 3CCHB 4AQ1B 1E4WL 4NO5B 1JK8B 3PIQA 3O6LH 4KXZH 3O4LA 2VDKH 3AU1B 1GL4B 4WEBH 5E4EC 4MNHA 4WI8A 2V6HA 5FM5O 2JCCF 2FNBA 3DVGB 4GO6B 5FKPB 5I15H 3QUZD 4JY6B 2ZUQC 4FXGB 4R8WL 1U8JB 1INDH 1RZFL 1QZ1A 3MROA 3MV9D 3P11H 5JO5A 5T33H 5F3HB 3RWJB 2HFFA 1RURL 2DDQL 1AKJD 4NRYA 4RFEB 5ADPH 4HS8H 3T4YA 4OSUH 2JB6B 3DI2B 2BY3A 3KJ6H 2VSCA 3LQZA 4JFQB 4QHNB 3GMPB 3WIIL 1K5NA 1RJZA 3GHEL 4WFFE 4PS4H 1WBZA 5ITFB 2OR9H 5GIRB 3GM0A 2RAMA 3DXAB 2LTQC 3QDJA 1QPPA 3FL7A 4MYWB 3OAUL 4JPWH 5GGRA 5C0AA 1JGEA 3BP5B 3QHFL 1LO5A 1QHOA 2HN7A 4P2QD 1CE1H 4MJIB 5F9JA 1ZHKB 4XRCB 3TYFB 1IGYA 5AYUH 1ZWIA 4JRWA 2CH8A 3BKMH 3U7WL 3LHPL 4LVHC 1FC1A 2VH5H 4PJFB 1WFOA 5DJAA 1TVHA 4KKLC 3HZKB 3HE6B 2SEBA 3IXTB 3LMJH 2VXQH 5DQ9A 1AGCB 4ZO8A 4O2CB 3AM8A 5C92A 3LS5L 1EHNA 5CHNB 2ICWJ 4KJQC 3MBXL 3HNTL 3RU8H 2PR4H 1ZVSB 2J5LC 3HR5B 2HRLA 4Z8FL 4M7LT 4NNYB 3ZT6A 3S96A 5HPMB 5ALBH 4UILH 4YPGB 2ZSVB 4ZXBA 4N90D 2NX5A 3RIAK 4XX1G 3R8BB 4X6DB 2EC9T 2L0DA 4Z76A 4MSWA 1IILE 1R5WA 1YEGH 3LKRA 5IOPB 2YD7A 2YSSA 4WFHE 2DWEA 4Q97A 3NGBB 4QHLB 2VSDA 2BXYA 1EUUA 5BVJB 4PBWD 3BUYA 3UEZA 3RBSA 4LDEB 1T5WA 5IVZB 2ED7A 4GQPH 5ACMA 1PYWB 4ELMA 4KTYA 5H2BA 5KSVA 1U58B 4PJBE 5ESQB 3NIDF 1SEBB 2ZOLB 2DLHA 1TPXC 3BKJH 5HYFA 4QXUL 1DBAH 3PG2A 4R0LA 5D72H 5EZLA 3QAZB 4O2CA 1JF5A 5LJYH 2NY6C 3AUVA 2A38A 1MQ8A 2FWOB 1ZVHA 5E6IA 2IH3A 4RMSA 4U6HB 4NGHH 2D03L 1FVCB 2J8HA 3H9SB 5E2WH 3HI6H 1L7IL 2N7BA 1JZ3A 3B8SA 4Z7NF 2GJ6D 4Q2ZB 1U8KA 1G7PB 4XVJL 3FRPG 5BS0E 1MVFA 3LPWA 1WGOA 3I6GB 5F70A 3IETA 1NC2D 2AJ3A 1BHGA 2W38A 2X4QA 3GSWB 3O2WL 1HDMA 2XZCL 4DVBA 2CRMA 4XAWH 2YWZA 1GVIA 4XBGA 4P3WA 1MCRA 1T4KB 2HLFC 1FVDB 5JXAH 3MLWL 1HHHA 3UO1L 4NZUH 2PTUA 4YZFF 4XXCA 5E6IB 1BVKA 1L0YA 2Q7NA 3L3GB 3UX9B 4D0BB 1LO4L 2BVUA 2MCG1 3VRIA 5TF0A 2FLBT 4JO3H 4HG4J 1EXUA 1WIUA 2DBLL 4LSRL 5CGYC 1P7HL 1X4XA 5F3HA 5L2KD 2VNCA 5C0RH 4HHAA 2ZCKH 2RBLA 4JREB 5TDOB 3TC9A 5CEZE 2I9TB 4NZJA 5A3IC 1IM3B 3O2DL 3TH3T 4NQVB 1ZLVK 4UOW1 4JM2D 1LD9B 3BT2H 5JHDE 5J1SC 4Y4HA 2DKUA 4RQQB 1FO0H 4PJIB 3QUXB 5A2KH 3QXDA 5E2UH 3H7LA 3VWJB 4OV5B 3D85B 2QBWA 2OL3L 3N9GH 1OP5H 1E28B 1UB6A 1JZ5A 3MOBH 4G8EA 1A6AA 3SE8H 4XAWL 4PIRF 1PKOA 5DJXA 1W8NA 5EC2A 1FC2D 1NJ9A 1NSNH 2R1WA 3Q0HA 4XNYL 3LKRB 1HHJA 1A3QA 2IBBA 2JCCA 3B6SA 2IPUG 5D1XD 3KG5A 4PR5B 1YEIH 2QLVB 4YHPA 2HT2D 4MAYD 4HWZA 4TTDC 1XGQB 3D69B 4XCYB 4JY4B 5FA4B 4BFIB 4OLZH 4WUUD 1NCBL 4TVPL 3QUYA 4LEXL 3H42L 4YZFE 5E4EB 4PG9B 4HH8A 1N6QL 3L3JB 3L3OA 4W68A 2GT9A 3C6LC 1J0ZA 1J1PL 1CR9L 4Y5YA 1W72L 4ZTOL 1GXEA 3BKJL 4WEBL 5F93C 4OV6F 2DLFH 2FO1A 4TVPD 4LPTA 5EU4A 2P8LA 2Y4SA 1IGYB 4LAJH 2IPTL 1N5YH 3ARXA 3G5XA 4P23D 1MJ7H 2I26N 1KLUB 2IH3B 2Q1EA 3HKFA 2FL5B 1NFDF 3QUZA 3VXNA 3OKNB 4PJ9B 4JN2B 4N1HB 4OGYL 1N3NB 5C6WH 1XGPB 2XT1B 4GH7B 2C3VB