3WIHH

Crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKLSHGKSLEWIGDIVPNNGDTTYNQNFRGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARFSNYVYPFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAILQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Roundabout homolog 1
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 219
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihH02
4JB9L 1OP3K 1A6UL 3L5HA 3S7GA 4CRPA 4GW5A 3MR9B 3NFSL 1Z9OA 3QIUC 4C83A 1WWAX 2G9HA 5B39G 3CMGA 4PJ9B 5HYQA 4JPVL 3QXDA 3RUGE 5IESL 1LE9B 4N0YL 1M7IB 1JZ2A 2LU7A 3T04D 3I6LE 1G9NH 5JUEL 2C3HA 4OF8A 5D1ZC 3D0VA 3D0LB 3ZHDA 1CXLA 4EN3D 2P8PA 5E5RB 4JFEE 2BDNH 4N8VG 1IC5L 2BC4A 1XGPA 2NY4D 1IC4H 3KLDA 4DUVA 3UBXG 2FX9H 4HXAH 4LBEB 5C09E 5T5FH 1N5AA 2WP3T 3R0MA 3VFSA 3S5LG 1BD2A 1G7LB 4NQSA 4A6YA 3EO9H 1A7OH 2GSIA 1GL4B 5F3BA 4BH7A 1I1AA 1G9NL 3R06B 1A9EA 4KKLD 2UZIH 3ETBF 4ODSL 5EO1A 4IS6A 5IWLC 4GG6F 3I75B 2EDOA 4R7NB 4F8TA 2ICEB 2BDNL 4I9WD 4B53A 3QZWB 1AY1H 4XWGL 2JTDA 5BMFH 1IC4L 3MUGB 4XAKD 3P3YA 2ADGA 1D5XA 1MLCA 3VXUD 4EN3B 4NDMA 5F88A 4X98A 4RDQF 4HXAL 3GSWA 5D7KD 5T5FL 5IQ9A 3NVQA 5JHDE 3QDMA 2NY4B 4X7EC 3UTTB 2D4DA 4JO1L 1I1RA 1TZHA 2E7HA 3F12B 3RVVC 3EO9L 4LRIC 3TT3H 1XGYL 4G6KL 1GIGL 2OCFD 2G5BA 5ID0A 1R3JA 5IBUB 4PREB 5SWQA 4UQ3B 2UZIL 3BP6A 3QWOB 3O11A 3S4SA 4DAGH 1YEEH 5A2FA 3IDIB 1XZ0B 3K0WA 3VXSE 5K9KA 5BMFL 1QFPA 4U6VH 1ITCA 1KLUB 3Q2CA 4WW1A 2WIIB 4XXCC 3QT2A 3KXFA 1MFCH 1OT1A 2FR4B 1KLGA 2AJUL 1RZKL 1AGDA 4WU7B 1OL0A 3TT3L 1U3ZA 4NM8H 1FIEA 5I1IH 3MGTA 4RX4A 5IHZA 1IC1A 1CLZH 5I2IB 2ZWLT 3QEUA 1EEZA 1E4KA 1H8OA 1XIWB 2VISA 4PJBF 2VDMH 1T66C 3QDAA 3HE6D 3NZHH 1I3RB 4RAVA 1YEEL 5DJ0A 2IQAA 3MRPA 5IF0A 3UYOD 2VQUA 4L29A 4U6VL 3TN0A 3WFDL 1CDBA 1UZ8A 4JY6B 4NQCE 1K8IB 5FK9B 1YPZB 3QUYD 4GXVL 1A3QA 1MFCL 5KW9H 3UMTA 3ARWA 3HTLX 3AUVA 4FXGA 1O0VA 35C8L 1X5KA 4JN2B 5JA9A 2C4FU 1OWRM 2PTUA 4NM8L 2CDEA 2E9IA 5C71A 4OI8A 1N6QH 5F96H 1U8KB 3QRGL 3S3JA 5L9DH 4X6DE 4X4XA 1H5BC 4PP2A 5ID1B 1E4JA 2FRGP 1JGDA 1JGVH 3P40A 4U1LA 4EXKA 4OZHF 4U1NB 1HHIB 2EXYC 3NZHL 3DECA 5I71B 1GJIA 2JB6B 3OPZH 2EYTA 3O6MH 1D5MB 4P46D 3RBGA 1KPUA 1ROWA 1JPST 1U3HC 1HDMB 2DM7A 4QHNA 4QY8B 3HE6B 4E5XA 2UWEF 1LDPL 2YPLD 4DTGH 3BP5A 3GMOA 4DGIL 1OCWH 1MF2H 5JNYA 5KW9L 1UVQB 3MZTA 3PWVB 4ZO6A 3BUYB 5MI0B 1D7FA 1OGAA 4W81A 4FXLA 5HY9B 1I1YB 3QUYB 3BP7B 3NTCH 5CEZH 1N6QL 5EN2A 5F96L 5IVZA 5L9DL 3CLFH 1U91A 3IDMB 1IVLA 2XTJC 1JGVL 3GSNB 4PJAE 1QOKA 1BPVA 3QDJD 3BGFB 3MRQA 4L8BA 3FCTA 3OPZL 2OI9C 3O4LD 1A2YB 3O6ML 4O58L 4UNTA 1VKXA 1ZSDB 1JWSA 3QNYB 2H8PA 1UXSA 3NPSB 1VFAB 2OR8A 4QRQB 3RX7A 3N9GH 3GGWA 5LXGL 4P46B 2Y9RT 3HPJB 4LLYB 5JPMB 5E08H 3GJFK 4YHLH 2Z4QB 2YPLB 1EZVY 3EYOA 5JO5B 3AGVA 1T2QH 5ELIA 3NTCL 5IFHH 5C0IA 1AQKH 2HT2C 1U8PA 4ZUUB 2B4CC 5D5MB 1QYGH 1Z9SA 3NIDE 4A6YH 1XGTB 5HVHB 2EE6A 1PZ5A 5D6DA 1FZKA 4LCIH 1LE5B 3H7BB 2YD1A 1KCKA 5IMLB 1FCCA 3QDJB 5IOPB 4P2QD 3C9NA 4LIQE 3O4LB 3IB4A 4NZUH 2CIKA 2IPTH 1T0MA 3GBLA 4WI9A 4NIKB 5E08L 4YHLL 2HJFB 4RZCA 1FZJA 3BESR 4U3CA 3TO4A 4L1DA 1JHTB 1T2QL 5IFHL 5IJKC 2Y5TB 1AQKL 1QYGL 2I5YL 3IU3A 3T65A 4GRLD 4A6YL 5JW4R 5J1AB 3W0WE 2DAVA 4E41E 3U9PH 1EO8H 4KVNH 4LCIL 1KC5H 2BOBB 1ES0A 3W9EB 1Y18A 2R56L 5DD0H 4LHUA 2DLTA 2EKSB 4H88L 3AU1B 3F7QA 4QRPA 3B9EA 4NZUL 4ERSL 1IAIH 5HHOD 4U1HA 1NUDA 4HLZG 3TPUA 5DUBA 5A2IH 4PGBA 1GRWA 4N5EC 4R0LC 3KPSD 2EYRB 1CLCA 3FZUD 4B50A 3NABH 1TMCB 3GEWB 1WIPA 3A6OA 4XHJD 4QHLB 1PG7H 2MQ0A 3QUXC 3U9PL 3A6CH 1EO8L 4KVNL 1FC1A 1KC5L 5ICYB 3GB7A 1CF8L 4LEOB 4GRLB 5I8EB 3T0DA 1NMCB 1U8IB 3AM8A 2BXZA 5C07D 4KH2A 4OT1H 4G9FA 5GIRA 4FG6D 3U4EB 3MBEC 5HHOB 4XI5C 4XB7A 3BXNA 2HJKA 2GUOB 1U8QA 3V6FB 3I3EA 2DJUA 3GMLA 2HMID 3NABL 4NKQB 1PG7L 1TETL 3O9WA 4M61B 1RUMH 4GO6B 3HB3D 1A6TA 3KPSB 4OCNC 3A6CL 4MYWB 3KDMA 1IC7H 1IGCH 1SMAA 2X1OA 5F97E 5EB9A 1NCNA 1XGRB 3ZE1E 5E5UB 1OD7A 3CVIH 3V0VA 3MJ7B 1LO5B 3VG0H 4XPHH 4JFYB 2NLJA 4LQ1A 2A6IB 4P2RE 3CH1B 1CDGA 4M6OH 1K8DB 4I0PB 4QTHB 5ITBH 4QOKA 5IV2B 4LLVB 1E4XL 3JV0A 3PHQA 4MAYD 3BGMA 2BY3A 5C07B 2WBJC 4HKXB 3NH7L 4Y5XC 1C12B 5GRVK 4G8GA 4N0CC 3ZDZF 5I1KH 3FFCA 2YRLA 4OZFG 1ZLSH 5F7NC 4ZPVA 1XCQA 4UB0L 4PJIA 1RUML 1JNJA 3VRIA 2ITDA 1IC7L 1IGCL 3VRJB 4WFFD 3Q5TA 3G5YB 1JUFA 4YPJA 1CE6B 4IM8A 4J4PA 3UTSA 4XPHL 1I3GH 3VGDA 4S1RH 3BQUD 1F3JA 4M6OL 4R97B 5ITBL 2NR6C 4NO5A 1NGXB 3RWEA 2VLMD 3P73A 4P59H 3MFFA 3SJVE 1J86A 3T0WA 1FNAA 5I1KL 1ZLSL 1HNFA 3RGVA 5HI4D 4MAYB 4Y4FA 4LRNL 3D18B 4RNRB 3FQRB 4HJGA 3MCKA 3JTSA 1K4DA 5TH2B 2ZUSA 1I8LC 4PJDF 3REVA 3QIUA 1WCBA 5IKCB 2WBWB 3VRLE 1WWBX 4R2GD 3V4VL 1A0QL 4XB8A 5DUMH 4ZXBC 4UDTB 1VACB 4M48L 4S1RL 2XN9A 2DOCA 3SDDD 1YEKL 5JQ6L 5AD0A 3B8SA 1ZHBA 2DJ4A 5C0JA 5E7BA 3GMNB 3BQUB 5D1ZA 3RTQC 4YGAB 4ZFGH 1EV2E 3J8F7 2R2HA 3C8HA 5EZOL 1W0VB 1PKOA 3MRRA 3U79A 3FT4B 5B3JF 3D87B 4N9OB 3SQBA 1RJLA 1NBZB 3IFLL 4WEUD 2Q6WB 5T1LB 4LFHD 1YMMD 1BREA 4UAOB 1U92A 3MREA 3EYVA 2DQTH 1H3UA 5DUML 5HVWA 5F44A 5D7IB 3HNVH 2Q87A 3BFOA 5IW6B 1NDMB 4HWUA 3V6OE 4KV5F 4OI9A 5DI8A 1LK2A 3B5HA 2IALA 2XPGA 4XP6H 4JFHE 4QXWA 3L3GA 4ZFGL 5IWLA 5BRZA 2Z31D 1SVZA 3B9KC 4AEFA 4N0UB 2DQEH 3RX5A 5C08D 4TNVK 5FO9A 5IR1B 3ZHLA 5JORB 3GSVA 2YWZA 1VB9A 2FEEI 4LRIA 3RVWC 2DN7A 1YMMB 1N4XH 2BSTA 5D2LB 1ZGLM 1JMZA 2M1KA 1ZKAA 4ZFFB 4NNPH 1I8IA 3NIGE 3ARDC 4XP6L 1P4LA 4MMXC 1H3WM 1U8MB 2YSSA 5ISZE 1KPRA 5DVLA 5JQHC 1P5UA 3ORJA 4MA3A 1CDIA 4W70A 2Z31B 4KJPC 4KKCC 1UM6H 2ILLA 4V2BA 4IMLB 4XXCA 1IGFH 5CGTA 3TH4T 1UZ6E 1FQ9C 4S2SB 3TYFB 2RCSH 5C08B 4TVPH 1LO4H 1N4XL 4HS6A 5A2JH 4E0RB 4MJ6B 4BQ8A 3KYOA 4P2OC 4X7CC 1DN0B 5C0BA 3H7LA 1BZ9A 2FZ3B 1FL3B 1VADA 4FTVD 4PGCA 2HFGL 3K81A 3SDXF 3FQNB 2F54D 5C0CE 1R3HA 4LMQI 3DV4B 4G6AC 3WEXA 5MENA 1P1ZA 3TLRA 1BFOB 4HW6A 2ESVD 3ZYOA 1UM6L 3FO0H 3HUJF 4PRID 4F33A 1S7SA 3EUUA 1QO3A 1LGVA 2V5MA 4J6RL 2RCSL 4G80B 2QQNH 3BZEA 4PG2C 4TVPL 1B0WA 1LO4L 5J3HD 4KC3B 2YUWA 1CFNA 2PYFB 3IKCB 4JGUA 4YHOL 2BVTA 3B2VH 3C60C 4LK4A 1XGQB 3GSRB 1E6JL 5E6ZA 5DQ9A 3VGBA 1QPXA 1KUMA 4FTVB 5C1MB 1JF1B 1EXUB 1S7UA 3V95A 4XXDA 2QR0B 3LN5B 1T22A 3FO0L 4K7FB 2F54B 4GOSA 4GG6B 1IM9D 3VXMD 3S36H 2FL5A 1NUNB 4HMCA 2ESVB 4PRIB 4Q97A 1Q94B 3O8XC 3BWAA 3QEGH 3DV6B 1UKQA 4AY0A 3GUTA 4JVUA 4C54A 5J9PA 2R2EB 1M7DB 1J8HA 3QIWA 2P5WA 2E9WA 5A2LH 5C2UB 4Z7VE 4EI5D 1A21A 2LAGB 4QHUA 2LAAA 5BS0E 4U1IB 2V5RA 1IAMA 3OKOA 4AG4H 2OXGA 5T1MB 4ZFOA 3FT3A 4JG0H 2UUDH 2N4IA 1ITBB 4J1UB 3CZFA 4Y1AE 3O3EB 1J7VR 3MV7E 1IM9B 3ARFD 5CSBA 3VXMB 4NGHH 1NGZB 1EUTA 2OL3B 4JRYE 4W4NA 1CGWA 5CIPA 4PY8J 4IBLT 1RY7B 5KOMC 3P4MB 2K9UA 4MNQA 3MRDA 4GW1A 4LDEB 4JG0L 3DIFB 3CFJB 3U30B 1H0DB 1Z9LA 1T7ZA 4M4PA 4NQDA 2YEZA 3LPFA 3NCEB 5IVXE 4YR6A 2Y4SA 2VXTL 1CLOH 3BE1H 1VFOA 3OKEA 5CBAA 2E6QA 4NGHL 1MRDH 1S7TA 5IJKA 2J8OA 1L0YA 2JJSC 2FHCA 4JZOA 3ARFB 2JK5A 1AE6H 5I75C 1WBZB 4LCWD 5GRZA 4F7EA 2BVPB 4XMLH 4DEPB 1EK3A 5KVDL 4WFGE 1CT8A 4RQQA 2C3VA 4GQ9H 5JIPA 4IRZH 1BBJA 5BXFB 1T20A 4XCNB 3N1FC 1ZTXL 4XPAH 3DROB 1JPGB 4OZHB 4HIXH 4YWGH 2GFBB 3VG9B 3IF1A 3P9MB 2YD4A 1CLOL 2EZ0C 3BE1L 3EJYC 1TJIH 2DLHA 4I48A 3QYCA 2CH8A 3DURA 1RFDL 4G8EA 3EOAB 2X40A 3ZMRA 1OLLA 1AE6L 3PWPD 3RJDA 3BH9A 3O2VH 4XMLL 1QQDB 1AFVH 4Z7UE 2G60H 4PRHE 1QSFD 1ADQL 4GQ9L 3W5NA 5I1AA 4MB4A 2R1XA 3T4AB 4WI8A 1RIHL 1DDHB 1NANH 4XPAL 3M1BA 4JLRA 3ROOA 4J7RA 4YWGL 1MCPL 4NJAH 3UPRA 4QWWD 2FEDD 2IBBA 1S5IL 1BECA 2APWA 3IGAA 3MBEA 1IJ9A 1YYLL 3D85A 2QQQA 3O3AB 4LNVA 2HH0H 5EOTB 1L7TH 8FABA 4ZNEA 4MZ3A 3MYJB 4D0BB 4HXBH 3V0WL 1NMAH 4IDLA 3O2VL 4QHMB 1AFVL 1I8KA 2G60L 1CCZA 5INDB 1BFSA 3PWPB 5IG7B 2GIYA 2BNRD 1BQHA 25C8H 2I24N 2R39A 5EU6E 4NJAL 1IT9L 2CXGA 1P7KA 1A1MB 3X3FH 1HH6B 1X6LA 2V2XB 2XWTA 5BJTB 1FVCB 3VW3L 5JW4M 5GS1B 2HH0L 2WBJA 4M1GH 32C2B 4PB0H 1DCLA 4Y5XA 4POUB 4XVUD 3KLHC 1L7TL 1JK8B 2VYRE 4WWID 5BW7A 4HXBL 2ED7A 4WTZA 1RIUH 4L4VA 3TV3L 4HJJL 1K5NA 3A67H 1Y6KR 4PJHB 5SWSA 5CZXC 4M7KL 1JI1A 2BP3A 3RY4A 5J1TC 3RWHA 1BF2A 1FGNH 2JIXA 4OZGE 3BWUC 3X3FL 1P4BL 1XIWC 3IJSA 2BNRB 1JGLH 4LSUH 4H8WC 2FX7H 2EDQA 3FB8A 2PTVA 4M1GL 3LN4A 4PB0L 4LSDA 3RKDC 2J2ZA 2BSED 4D8PA 3T0EE 3IETA 1A3RH 2FHFA 1YYMH 4PJCA 2Z8VC 5BV7H 1YMHB 4MGXA 1DQML 3OKKB 2X4NA 1E4WH 4FQCL 3ARBC 3A67L 5FECB 1I8LA 1ULVA 5TGBA 5C6TL 4JM2F 3O2WH 4DZ8A 1DQJB 2QHRH 2DJSA 2C3GA 4ZXBA 4MXQD 4QRSB 4GAJL 3LKRA 5CIPH 1FGNL 3TH2T 5HTSA 2CDGA 1WWCA 4YC2B 1JGLL 4LSUL 4X8XA 5DRWB 4APQA 4KZDL 2VAAB 2UVFA 4OGYH 4G9DB 5I71C 1BQUA 3RTQA 4KK6C 1E4XI 5GHWH 4DUXA 5E94A 4ZFOL 2DQGH 2H41A 2VL4A 4DZBB 1RZIB 2AXJA 3B9VA 3HE6C 4OFYA 3PWUA 3FMGH 1R0AH 1A3RL 4HJ0D 5JZ7D 5EC2B 2VXVL 4X4ZA 3RJQB 1XAUA 1E4WL 2NYYC 1PQZA 2CLRB 5D93C 3F8UB 1FO0A 2DIJA 3DX9A 2HFEA 4LNRA 2PCPB 4UIMA 4Z7OE 1BLNB 2B4CL 1TVHA 4PGEB 5HHXH 1IGYB 3IFOB 3B3IB 4UT6H 3MV9A 2RIKA 2Z91A 4DKFL 4QRRA 2BSSB 4D0CB 4JO3L 4OGYL 1JNLH 3BGFC 1OSZB 4RWHA 5INCA 4K9EH 3JZ7A 1YEHL 3SCMD 2OQJA 2A6DB 3KYNA 4Q9QH 4RGNB 3FMGL 1R0AL 3C08H 3MRFA 3H9SD 3BZFA 4MSWB 1X9QA 1BVZA 4B0MM 4P46C 1PKQE 3BO8B 1EMTL 3G5XA 4XCFH 4Q6YA 1TLKA 2J8UE 2CSPA 3KPLB 4HWZB 5IHLB 1OQOA 2OJEB 3WN5B 3O4OB 2B5IB 3Q0HA 5GQBA 4KHXL 1QR4A 1BBDH 4FQIH 3QG6B 2D9QB 4UT6L 4NZJA 5FKAA 2X4OA 2AI0H 1JNLL 5HVHC 1S7RA 3ILQC 3U0TA 3ARDA 2L7UA 4XBEL 4ZPTB 3VFGH 2EE9A 3OAYH 2X70A 4PJ5E 1RV6X 2D7NA 1CICD 1OAXL 4P5TD 2D2OA 2QV2A 4OGAD 3SCMB 3BHBA 3OJDA 4UILH 5ADPH 2V6HA 1ZGLP 4LVNB 4OM1H 3MRNB 1IZJA 1QFHA 1NBVH 2BVOB 4XGZB 1LO3L 2JB5H 4QXGH 1TZGH 3FB6B 2YRPA 3MRCA 4WW2C 1BBDL 4FQIL 2A0LD 4P2OA 4RGOH 2FO4A 2AI0L 4Z7QE 3ZDXF 3V6ZA 3LKOB 5DSCA 4WJ5B 1A1OB 5KJRL 5IFJB 4OJFH 5C70A 1LDSA 4WO4D 3PQYD 5E8PB 4CW1A 3VFGL 3ULUE 3NFPA 4YO0B 4WI7A 4R4FH 3TO2A 3WJLC 1DEEB 1CTNA 4BFIA 2FSEB 4ETQB 3HZMB 2X1XR 4U6XB 3TBTB 3C6LA 3IKKA 5D7LA 4B7LA 4ZTPL 5J6GA 5ADPL 1A7RL 5ILTH 1QSEE 4OM1L 2H2PC 5DD5H 1CICB 5I17A 5F93C 2OMNA 2JB5L 3CC5B 3QQ3B 4HH8A 5KG9A 5CEZE 4NUJB 3MRIB 3KYMA 1ZEAH 4KROD 3L5XL 2EXWC 2JCCA 2F58H 3X13B 3QFJA 1OP9A 4OJFL 3QAZB 4R4FL 5DVMA 1IM3A 1NMCC 4JVWA 4NC2B 3PQYB 1DUYB 3KHOA 5ESAA 4YHYB 2PYED 2YXFA 3O6LL 1LEKB 4F3FA 1VFUA 5ILTL 4O2EB 1HXMA 5BO1H 1NUGA 1FZOB 5LWYH 1PYWB 4MXWH 5DHYB 1MCBA 1CD9B 4QXTB 4S1QL 4NJ9L 3ESUF 4C56E 4XC3H 2OK0H 3WFEH 3O8XA 1ZEAL 3ARED 1AJ7L 4H26B 4YNYB 2F58L 3CFEA 3G6JA 4KI5D 4YDVA 4IOIA 4PRPA 4YFDB 3VXTA 5FF6A 4KROB 3FZUC 1Q9KA 5I1DA 3CFKB 1W0WA 2VDPL 5JLZB 1XR8A 1FFNB 1N64L 1WWWX 1NJ9B 1WIOA 4G6JH 1YDPA 4I2XE 3MLSH 1VFBB 3HG1B 5DEFA 4KMTH 5BO1L 3ALWA 4I0PC 5E8EB 3U46B 3MPCA 5LWYL 3I6GA 4LSPH 3DMMA 3AY4C 4MXWL 2PYEB 3HS0A 4U1KA 4G3YL 3DYMA 5F6HJ 1U8OB 2OK0L 3WFEL 1F11B 3BPNB 4FZ8H 1OGTB 4HIHA 4V1DA 3S4SG 3QDME 2F19L 3EDJA 1LP9F 5CGYD 1FO0H 4I5BB 1PBYA 2P48B 4O2FB 3V5HA 5CHNB 5E2TL 1MFEL 4M8QA 5F7YC 1E0OB 3GMMA 2IWGA 1W8OA 4HX1B 4G6JL 4NN6B 4Y4HD 3MLRH 2C1PB 5B4MC 3T1WA 3E6HB 4KMTL 3QZWG 1MOEA 4R97C 2A73A 4N8PA 5IUSA 4LSPL 1NC4D 3ECBA 1IFHH 3MRJA 4H1LA 3HZKB 2VLKD 5FOBA 3QUKA 4HQQL 2PW2A 4FZ8L 3QDGA 3HUJB 4MAYC 3C5ZD 4NYLA 1EFXB 3RWDA 1FO0L 1ORQB 1WT5C 5IIEB 5GSRB 2EDNA 3AS0A 4TUJB 1MIEH 4PRBA 4CJ1A 1ZS8B 4XMPH 3MRMA 3RUGF 5DK0A 1WBXA 2D7QA 3S34H 2YN3A 3MLRL 2A83A 5AWNH 4KK5C 5HGBB 1BQSA 1HHJB 4ZUVB 5GS3A 4XPBH 4Y4HB 3WIFA 1IFHL 3TBYB 4JFQB 3FHAA 5I1GH 3D0LA 5HI3D 3RQ3A 1NC4B 5EU7E 2UYLB 1AC0A 1WBYB 1OM3H 2VZ1A 3LDBB 1LHZA 2J88H 3AXLA 4XMPL 3C5ZB 1B4RA 1RVFH 2WLZA 4O02H 4UAOC 4DN4L 3ZKNC 1UT9A 4LHJB 3NA4A 1CD1B 4I9WE 4FMFA 7FABH 3VXUE 3AMKA 5AWNL 4YHNA 5D7KE 3DARA 3PG2A 3TBSB 1NFKA 2DD8L 5I1GL 4G42A 4XVTH 3RIFF 1JTTA 4PV8B 3I75A 2K7PA 4R7NA 2NXZD 1KNOB 2ICEA 4NQVB 5EOCJ 1DBJH 3MUGA 1OM3L 2XV6B 3M07A 2N1KA 3C2SA 3NCCB 1QLFB 1KCUH 5JOFB 2J88L 4WHDA 1RVFL 3HAEB 5F89A 3VI4E 1E6OL 3UTTA 3QPXL 1T1YB 1BVLA 2VRAA 5HPMB 7FABL 1YPZE 4LSVH 5I19L 4HLJA 3LPWA 4P23B 4H20L 3LCYA 1KACB 5DJXB 5C0EB 4PREA 3F7RA 3QCUL 1OHQA 3BZ4A 4LAJH 4MS8C 4HUVA 2JKXA 3QWOA 4OUUB 1A47A 2D7PA 3IDIA 4FQHB 1MVUB 3V52H 1UQSA 4IDJH 2XWJA 4QGTA 4YUEH 2Z31C 2NXZB 4QF1A 1AR1C 2APXA 4XP9H 4HGWA 1OTTC 2FR4A 3RAJH 3SY0B 3CSBA 3H9HB 2HLAB 1G9MC 3FOLB 4LSVL 4XPTH 3C5SA 3RNKB 4YBQD 2XT1B 1I9IH 1HKFA 3MUY1 4XVSL 1XIWA 4ODVH 4Q9RH 5I8KL 1S9WB 3EDEA 5GGSB 1F00I 4JN1L 5E4EB 3V52L 1HWGB 1DE4A 1OAKH 4IDJL 1PGRB 3STBA 5ERWB 4JY6A 4XP9L 5FK9A 1BZQK 3W2DH 2R23B 3ARBA 3MV8B 3MBXH 5T1DH 3RAJL 4DGVH 2IADA 4DQOH 4XPTL 1V3JA 1A7BA 1ZHNB 3DETD 2I9TB 2YPLE 5DQJB 1QNZL 2CUMA 2HAZA 4X6DF 1EJOH 3OF6A 1JE6A 4GKZA 1I9IL 1RUQH 4UTAL 5F7HA 1FVDA 4QO1A 2XZAH 1NGPH 5ALBL 2ICWB 2JB6A 1PY4A 1D5MA 5H94B 4ZOCA 3KVQA 2VXUL 5IBLD 3LQZB 4XRCB 1SQ2N 3U36A 3PXHA 5HYFA 1RK1A 4H1LH 2EC9T 2AK4B 2F8XC 3QDJE 2GJJA 4ZOEA 3W2DL 1YEGL 3REWA 3O4LE 2N7AA 1UGNA 2HKFL 3MBXL 3PWVA 1NEZB 4DGVL 4DQOL 1QVOA 2BMKB 2W9EH 3QG7L 1YQ2A 4X4YB 1S7VB 5HY9A 1I1YA 4BK4A 2AV7B 1Q9OB 3UROR 4RWYH 1K6QL 3K1KC 2W9DH 4X5WA 4OFDA 5BVPL 1Z9MA 2ID5A 3O3BB 2MHAA 4PJAF 1R3KB 5F9JB 1NMBH 1UYWH 2DMCA 2IJ0C 3P4OA 2XZAL 2EO1A 4LCUB 1NGPL 4HPYH 4K94H 3W82A 3RVXD 4ZQKA 1U58B 3CJJA 4FFYH 2NY2D 3QNYA 3RBSA 6FABH 2HT4C 4XMKH 3HR5B 2UUDK 3E2HB 5C3LD 2CRMA 2Z93A 5JPMA 3RY6C 2RBLA 2Z4QA 3ZKXB 4HKZA 5JO5A 3BKJH 4P2QE 4ODWB 3FT2B 4GRMB 5AYUH 4RWYL 4G8IA 4WHYH 4YHMH 3NIDF 1D6VH 1NMBL 1UYWL 2XKNA 1XGTA 4K3HA 4HPYL 3H3PH 4LKCB 1LEIB 3CDGB 3G5VA 1X4XA 2OTPA 4FFYL 2FYYB 1IRAY 6FABL 4XMKL 3SDAD 4YK4C 4P9MH 4X7SH 4DJMA 1QKZH 2NY2B 3U30C 1I7UA 3RP1A 1K2DB 5HHMD 2CKBA 1YN6B 3FFCE 4LSRL 2F74B 3BKJL 1EA9C 1JHTA 1DUZB 4HWEH 3DUHA 1RJCA 2FBOJ 5DK2A 1KJ2B 5GZND 4WW2A 3BOVA 5LGJB 4ZUTB 1D6VL 4F7PB 1SYVA 5J1AA 5FAAA 4DEPC 1I7ZB 3N1PC 1QRKA 3EO0A 4P57B 2CRIA 2P7TA 3KPSE 4NHCH 1KIPA 3WJLA 2GJ6A 4P9ML 4X7SL 3QPQD 5AZEH 3ZT7A 3CPLB 3SGEH 3BW9A 2XKSA 2EEBA 3DLQR 3SDAB 4O2CB 4NQXA 4P4KD 1CDJA 2IPKB 3VU2A 1KT2B 3SE9H 1MI5D 4HWEL 5DC4B 2Y23A 5IW1A 5C07E 1P7HL 3UZEA 4Y8AA 4QHLA 4NNXB 3VMOA 5ICYA 4I77L 4OF7A 4AQOA 1N7MH 1RUPL 4NHCL 4FFZH 5HVFB 2WINB 3BAEH 1A14H 5MEOA 3T3ME 1WLHA 1MFNA 3DX7A 4D3CH 5F6IB 5AZEL 2OS7A 4P49A 4R90L 5TDOA 4M7LH 4H8WH 3MCLH 2OJZH 2XWBB 3CX2A 1P9MC 5EZJB 3X11B 3SE9L 1OP5H 3KPNB 5LAXB 3WL9B 1S9VA 2VWEC 5J4MA 1JZ7A 4P4KB 2RFXB 5FIEA 4GS7B 3JV4B 4M61A 4MDIA 1T7WA 3ZE1F 1OSPH 4JHZA 1QSVA 1N7ML 1S8DA 1KIRB 4FFZL 1X5AA 4UOJA 3BAEL 3QEQD 4MD5B 4D3CL 4M9OA 2KDGA 1LO5A 2V9RA 4JFYA 3NMEA 4M7LL 2A9NH 4H8WL 1V5JA 3PGFH 4K23L 1K8DA 4I0PA 4WFFE 5IV2A 1D5IL 4D9LH 3AY4A 5D96B 1FNGB 1HE7A 2FEDC 1BWMA 2X4UB 1X6NA 4L3ED 4HKXA 3WE6B 4GXUM 5FDWA 1WISA 3Q5OA 4KGJA 1HYSD 2NTFB 5I1HH 3SO3B 3QEHA 2VLME 1OSPL 5DZOA 3TA3B 1T7XA 1OTSD 4HEME 2P8MB 5D2NC 2D4FA 1A6WH 2HVJA 1MFBH 4JFDD 4RCAA 3PGFL 3HMXH 2GK0B 3O41A 1RPQA 4NHUB 4D9LL 4X7FC 5D7IE 2HLFD 2DI8A 3JBG7 2AQ2A 5HYSA 4Z7NE 1KLFA 3FO9B 2BY1A 4HH9A 1Q1JL 3QSKB 1R3LA 4JKMA 2CO6B 5GRJH 4LFHG 4RNRA 4L3EB 2H6PB 1WT5A 2XOTA 2FWOB 2PO6D 1CL7H 1AO7A 4OLWH 3VRLF 1AXSB 1NLBH 4ISVA 5IKCA 2QKIA 4HT1H 2NW3A 2AJYH 2QEJA 3ZKSD 5B38B 5CCKH 1A6WL 2BY0A 5C0BE 1BGXL 1ORSA 4R7DB 1MFBL 4JDZA 4YBLB 3FFDB 3RZWA 5EZIH 4YC2C 1YMME 5D2LE 1CFVH 3PP4H 4WUUD 4I3GA 5MENE 2HYMA 4TPRL 3VFMA 5C9KA 2GJZB 3FRPG 4X6CA 2CKBH 2VE6B 3UJIL 5CAYB 4OLWL 1JPFA 2EDXA 1NLBL 5T1LA 4HT1L 2IBZY 2OR7A 4TUOB 1BQLH 5CCKL 2PO6B 1T7YA 3QUMB 1I8MB 4UU9A 2VIRB 5C08E 1AKJD 2QTEA 4JR9H 1J1PH 2W0FB 3RPIA 1NDMA 1DBBH 3PGDB 4LCCB 3UC0H 1DQQB 1DL7L 4M93B 1CFVL 3PP4L 5JDJA 4HCRA 1MCFA 2ERJC 5I1EH 1SMOA 4RGNC 1DR9A 1CZ8H 3PABB 4N0UA 1UH2A 2CKBL 5HHNA 5JMRA 4BSWA 1ZXQA 2H26B 5A43C 1GGYA 1ZANL 3QNZA 4Z18A 1KG0B 2VLRD 3DVIA 3VGHA 4DK6A 1N2RB 1CIUA 3EDFA 1AXTH 1BQLL 3AB0C 4BKLA 5ACMA 3O4OC 2FX8H 2X4PA 5J11B 1J8HE 2B5IC 3IXTA 1B2WH 2P5WE 2ARJQ 1DQLH 2KQMA 1A6VH 1J1PL 4JR9L 2R4RH 1D9KD 2VC2H 4QT5A 2IG2H 1KTRL 3NIGF 1XF2A 2BNQD 1AKJB 5FYKH 5B21A 3OAYK 1CFBA 1XR9B 5ICXB 1ZT4B 4IOFC 1U8MA 2DRUA 4WY7H 5EBWA 1HHHA 4L5FL 1CZ8L 4JCMA 8CGTA 4LKXB 1UB6B 3WKMH 4LPUA 1TQBC 3SCMC 1T2JA 3OG4B 4FTVE 4IMLA 4LVNC 1T7VA 3MXVH 5IMOA 1H15B 5C09D 4PRNB 2OX5A 2F54E 5E00B 1DZBA 1VPOH 1NFDF 1F6FB 2FX8L 3LEYH 1G7QA 1B2WL 1DQLL 2ESVE 4E0RA 4MJ6A 4PRIE 1A6VL 2R4RL 2VC2L 2IG2L 2EE2A 3RUGB 4OV5B 5L2KD 1GZQB 5E0QA 5FYKL 1FL3A 3HMWH 1GAFH 1G7MB 4MQTB 4WY7L 5ITFA 3FQNA 4KDWA 4JHAH 4Y2DD 5SWZA 3DV4A 4IHOB 4HMEA 3WKML 4YJZL 5EU3B 2G75B 4FA8A 4Y88A 1L0XA 3IRPX 4NRYB 3MXVL 4LOUD 3UP1A 1CVSC 4OGAC 1VPOL 3DUSB 3LEYL 3OGCB 1S7QB 4D0DB 3DBXA 3I6KB 5IB4B 3KAAA 4Z95L 5C09B 1AQDA 5F3HB 3IKCA 3VXME 5CSZB 5TJWK 1OLZA 1MPAL 1FAIL 1KYOK 1KCRL 3N1QC 3RZCD 1XGQA 3HMWL 2A0LC 1MNUH 3D39D 3E1F1 4XPFH 4N8VB 1EVTC 4C57C 1N59B 3KPRA 3V7AG 3UBXB 2YUXA 5IROA 3T0AA 4YHYC 3TBVA 4Y2DB 4QNPE 4XPGH 4K7FA 3S5LB 4GG6A 5F8QC 1NEUA 3VMNA 4F8QA 4NRZB 3EFDH 4D9QE 2DF3A 2NPLX 3QI9A 4TSAH 4FZEH 2AXFB 4GRWH 3BEWB 5JHDB 2I60H 4OGZA 3V7AE 2NTSP 1X5FA 1MQ8A 3E6FA 2R2EA 3IVKA 2QQKH 4KROC 1MNUL 3EYFA 4Z7VF 1T21A 5ENWA 5D9SA 4XPFL 4M6NH 2DQCH 4IRSD 2HN7B 5KSVB 4HGKC 4FP8H 3PWLB 1KENL 3D2UB 1SBSL 3GK8L 3GSQB 5DJZB 4U1IA 1XT5A 5TQ2H 1TTFA 1CU4H 2GAZA 4XPGL 2FIRT 5FO7B 1BFTA 1YA5A 4KGLA 3O6KH 3LD8B 1CLYL 1BQHG 2HTKD 3RY6A 4CAGA 4FZEL 3BPNC 5HBBA 1NL0H 2I60L 5MERA 4OZIE 1D5ZB 1A4KB 1UM5H 4OLZL 4FABH 1NBYB 1S5HB 4JFFD 2QQKL 3VGEA 3UYPA 4XBPB 1DVFC 3KPOB 2IGFH 4PJEA 2DQCL 4ORZC 2KZWA 2IH1B 5HI5C 4FP8L 5F7UA 2YKLH 3M8OH 2HJLB 2XY2A 4MWFB 4OFPA 5DJDB 3ZYJA 2EYSA 5MEPB 4X5XB 4LCWE 4PJBA 1KB9J 1NC2D 3DIFA 2ZCKL 1RHHA 3PWNB 5GGTL 2MMXA 5IVXF 1JWUA 1Z0NA 4HCRH 3P2TA 4NO0D 1A6AA 1HHKB 4RMWA 4C58B 4NQCB 2XG5A 2VNCA 5K9OB 5FUOH 4KRPC 1V8HA 2W0KA 1UM5L 4FABL 1J05B 4L8DB 3OKLB 4ZO7A 5CSGA 3I3BA 2NY0D 1MFDL 4BK5A 1T03H 2R1WB 3U9UB 1WBZA 1UXWB 2IGFL 3QDHA 2YKLL 4JKLA 3M8OL 1IGMH 4X6DB 4JKPH 4P4RB 2GKIA 2X4RB 3UTZB 5ANMB 4XCNA 4D9RD 1MCOH 4GUPB 3DROA 4QYOB 1JPGA 4KK9D 4OZHA 5I73B 4Y4HC 4HCRL 1QSFE 1ETZA 1QFWL 1BOYA 5J1SC 5GRWA 3GKWL 1NC2B 2UWEA 4FQPA 4ODUB 4PJCE 3UZVB 3QHZH 3CH8A 5FUOL 4NO0B 4M03A 4OUOA 5AG8A 4BSVB 1IGJA 5T3XD 3LDBC 4X8JB 3WDIA 2WWMC 1T03L 1L9MA 3QNXA 1CFSB 4Z7UF 5F6HI 1G9MH 2FJHB 2ZKHL 2CJUL 2EO9A 1IGML 3P9WB 2NY0B 3VWJB 4JKPL 3B83A 3VGGA 3SE3C 4Z77B 1MCOL 5D1QD 2X4TB 4PJHE 4YHZH 1MRFH 2APFA 4OZ4A 4LSSL 1G1YA 4ZO9A 3ISWA 1P9MA 1U0QA 1PLGH 4S1DD 5HGHA 1KTDB 2JF1A 1UM4H 2BNRE 3QHZL 5H37H 5EOTA 2W9LA 3I85A 3QXVA 43C9A 2YD7A 5IM7A 1NCBL 4M5YH 2VDLL 4JPKH 4MD0B 5CD3A 3GI8H 3SKMA 1G9ML 3GIVA 4QHMA 1BMGA 2I07B 4HK3N 1XFPA 1A9BA 1PY9A 3L6FB 1X4YA 1HHGA 2X4QB 3CFIC 4P23C 4QXUH 2X05A 2Z0BA 1BZ7B 3RA7L 4YHZL 1HEZA 4OTXH 1MRFL 4EOWH 1F58H 3HFMH 1NKRA 3SKOA 5K9JH 2VLJD 3NCYS 5BJTA 4LPXA 4L1HA 2EDRA 4TVSa 2VDOH 4F58H 1CN4A 1FL5A 5C0FA 1NDGA 5IQ7H 4HBCH 2D31B 5EBLB 5IP4A 1MQKH 2NXZC 3D6GA 4JPKL 1JNNH 3GI8L 1RQ5A 3QP3A 1KIUA 1WF5A 2F5AL 1F4HA 4XVJH 5HGAB 1YY8B 5DRZB 4KZEL 1PSKH 1B88A 5D2NA 1MJ7L 4P5KB 3RL2B 4QXUL 1M71B 3W0WB 1IEBA 2Y07H 2V9TA 3BDYH 2B39A 4OZGF 3CSYB 5B8CB 1KPVB 1Q9LA 4EOWL 1F58L 4PV9A 3JUZA 2FO1A 3HFML 3B6SB 5K9JL 3DTXB 3VH8B 3QWQB 3M45A 5D71H 2I26N 4F58L 3QA3A 5E4EC 4ONHB 4JFXB 2H2SC 3NZ8A 1NSNL 2VLJB 1Z5LA 3TT1L 1MQKL 1EO7A 1MREL 4ONFH 5HJ3A 1JN6A 1JNNL 5DQDL 1GGIH 4XVJL 1U93A 4X4MA 2YBRB 5FECA 4YXHH 3PV6B 1PSKL 1QBLH 1LEGB 3PNWA 4LL9A 2Y07L 3BDYL 1DQJA 5DRNA 2K3TA 4WV1C 4QRSA 5T1KB 4MQ7B 1LVEA 4TULH 6CGTA 2CUHA 1JP5A 5D71L 1A7QH 3RWIB 5EULV 2WW8A 2X1PA 2NXYB 4KK8C 5HGDA 3EGSB 2G2RB 3GJFB 3BPLB 4MD4A 1GGIL 1FNSH 4DKAA 2CLRA 1CDUA 2H3NA 4PPTA 2R9HD 3DVNA 2WUBH 4YXHL 1R5WB 3WJJC 2IEPA 4Z7OF 1QBLL 1SM3H 5DO2D 2Y36H 1J12A 3RWCB 2BVQA 1BLNA 1ZOXA 3MOAL 5LCVL 1OQXA 3H9SE 2EC9U 5D70H 1HI6B 1AGBB 2GY5A 1IGYA 15C8L 1TVBA 2EE3A 1IQDB 3FO2A 2BSSA 3RWGA 3WNMA 4D0CA 2HFTA 3KPMB 5KN5B 1J0JA 4YGVA 1LK3H 4PFEA 1XGUB 3E3QE 1A3LH 3H6JA 3PE9A 4LP4A 3AS3A 5EO0B 2H9GB 5E6ID 1D5BB 2DKMA 1AIFA 1IEAA 3JWDC 5KBNC 3E2HC 1JWMB 1MLBA 2WWKO 5T3ZD 4JY4B 1E27B 2J8UF 2VZVA 2V7HB 1LWRA 3ZKXC 1CIDA 5DJ6B 3KPLA 4MAUH 1P4IL 4J8RB 1IKFL 5IHBA 5D70L 3OR6B 1BJ1H 2BCKB 1WICA 3QG6A 5FHAH 2PTTB 3O6FD 1QG3A 5F7KC 1MAMH 2AS5M 1P6AB 5BOPA 2JELH 1FN4A 3WXVH 4ZPTA 1LK3L 4BZ1H 1DBKH 4MA7L 5DFTA 4OZFB 5IB5A 1GSMA 3SKJL 1F4WH 4MZ2A 3RFZC 3C8KB 2Z92B 4XTRC 2AXHA 3ZDYE 3B5TA 1EAJA 3PQYE 4CVZB 4DK3A 2NX5A 3MX0A 3QJFB 5TDNA 5E6IB 3GHEL 1JRHH 4KRNA 5GGUB 3VWKC 5KANG 4XGZA 4MAUL 3ARUA 3AROA 3QO1B 5IK3A 2EDEA 4Y19D 5KSAD 4KJYB 3OHXA 3QUZD 4Y8DC 4Z7QF 2WUCH 3RIAK 3ULVH 4KQ3L 4LDOB 3HZYA 5FCUH 2Q86B 4PJDA 4ZYKA 1QHPA 3OR7B 1XF3B 5FM5M 3L3KA 4WJ5A 1A1OA 1H3TA 3ULUF 4M3KB 3EBAA 4WEBH 4JM2C 1G7IA 4BZ1L 1DBKL 1QRND 4JFHD 3O6FB 3DO7A 1F4WL 4ETQA 1NAMB 3TBTA 4PJ8D 3IFPB 4I3RL 1XH3A 4JPIB 2IH3B 5BQ7B 2EIBA 4EDXB 1JRHL 1F4XL 5KSBE 2V2TB 3SO5A 4F2MB 2RAMA 2KUTA 3DVGB 4HKBB 4JO2L 1INQA 4UOW1 4K7PY 4MJ5B 4LQFH 1QEWB 2WUCL 3EKCA 5FCUL 4U4BA 5DFWH 1JV5B 3X13A 1MHPH 4Y19B 1B0GB 2YK1H 3MRLB 4WEBL 4AT6B 3NFNA 1JFQL 2PR4L 2X4SB 4G8FB 4XWOC 4WHYG 1CG9B 5BZWA 5C0AD 5F6IC 3PP3H 3RKPA 3PL6B 4KI5E 5L8JB 4GAYB 4M5ZL 2E7LC 1NFIB 3I2CH 2ZG2A 4O2EA 4NP4H 3ZTNH 3HI5H 2GQHA 1FZOA 5TF1H 5FGCB 5HDBE 4PJ8B 5I16B 3H3BC 4QXTA 4L9LB 2D0HA 3EYUH 5GS0D 1YNKH 1I9JH 4LQFL 3MGOA 3RHWK 1H3VA 3FRUB 5D1XD 4GS7C 4MHHG 3C87A 4P48A 3ZSTA 1JZ4A 1J0YA 3MLXH 3QCTL 2YK1L 2MCPH 4Z5RA 5BZDA 3CFKA 3FO1A 3WCYA 2O61B 4CADA 1J18A 2GT9A 3PHSA 5I74B 3L9RB 3TYGH 3GBNH 2Q8AH 5C0CD 3K4AA 3TWCH 1T3FB 3HG1A 5TFSH 1BX2B 3HI5L 5E8EA 5C0AB 5ISZB 1SEBB 5GJSH 3SE8H 3U46A 4X9BA 3TZVD 4ORGB 5D96C 2ZUQB 4ELMB 2W65B 1I9JL 2D7TH 5IB3B 1CXEA 3BN3B 3MXWH 4CMMB 3T2OA 3MLXL 4R26H 5ETUA 2BY2A 2MCPL 2AJ3A 2VLKE 2Q7NA 3TA3C 5HD8D 2ZCHL 1DVFA 1HOCB 4GBXB 4AH2B 1TPXB 4HX1A 3TYGL 4X7DC 3MJ8A 4LPVA 3WHXB 1BAFH 2CO7B 2GK2A 3HC0B 3E6HA 3MZGB 5TFSL 2B1HH 3GMQB 1S7XB 5C0CB 2PKDA 4DVRH 1NCTA 3SDXA 3HZKA 2C3XA 4PTTB 3A6BH 2KQNA 1CD0A 2D7TL 3WFHB 4WFHE 3MXWL 2V5SA 4HK0B 2MKWA 3TZVB 3HUJA 1GHFH 4RFEB 4YZFE 1EFXA 4FQJH 2IAMA 4R26L 2WM0A 5IIEA 3UPCA 1TNMA 2D3VA 4TUJA 4ODHL 4NBYB 5GJTL 1JZ3A 4POZD 4U0QB 2YD3A 1UJ3B 4HUWB 1BAFL 5E9DD 4M1DH 2L4OA 5BS0D 3V5KB 4NO3A 2B1HL 4O00A 4YBLC 1EHNA 2ZOKB 3BIKB 4ZUVA 1QR1A 2O5XL 3T0VA 2AVGA 1KELL 4JFQA 3QIBC 5I1LA 5JHLL 3MFGB 3HZVB 4TSBL 4S0TD 3BD4A 2A6JA 5F9DC 3WO4B 4HMDA 2OTWA 5FOJA 5F9WB 2APBA 3I50L 2ZG1A 4HSQA 1MHHA 4WU5A 3HLAB 2BVEA 5I6XC 1U36A 3JV5A 3HI1B 1J0IA 2PO6C 1EFQA 2A2QT 2PUQT 4FQXC 3SE3A 4M1DL 2YHGA 3S35X 4LLMB 5J6HB 4Z7VB 5JPNB 3V4PH 4WHTB 4LCCC 1A4JA 1J1OH 5JDSB 1PX4A 4M93C 1N6UA 3JSSA 4XNMB 5E9DB 3TBSA 5BS0B 3X12B 1UACH 4KKAD 2Z35B 1KNOA 2KH2B 2PF6A 2EDWA 5CMAA 4YX2L 4PJGE 4Z78A 3OKYA 5HXMA 4U6HB 3U0PB 4Y1AB 4H25B 4MJID 4XAWH 3ROLB 3VI4F 3MV7B 3OMZA 2BFVH 3KJ4C 1QBMH 4UI2A 1U8NB 1QBAA 3UJJH 1YPZF 5AUMA 3MNVB 2NY1C 3HRPA 5HPMA 5J11C 4QRUB 4P23A 3S88H 3CXHK 3WS3A 3V4PL 1WEJH 5C0EA 4Y2OA 4M43H 4LLAA 5KVEH 1J1OL 4NT6A 4Z7WB 1VEMA 1DANT 4XNYH 3BJ91 1Q9WB 1QFWI 4ZSOA 1OD9A 3QCVH 5GGRA 1IKNA 4CNIA 4Z76A 1MVUA 2HA1A 5EBMA 4XAWL 4EUPA 3FONB 5AG9A 4XBGA 5FXCH 3K8MA 1QBML 4HV8B 3L5WB 1P7QD 1IGIH 4MJIB 4JE4B 5DJ8B 3UJJL 3L3DA 4S1SH 2W0LA 3H9HA 1CS6A 4MX7B 2HLAA 5D72L 3GFUA 1C1EL 1ZT7B 1BIIB 1CGXA 5HYJD 3RNKA 1WEJL 2Y1VA 2BZDA 3BP4B 4M43L 3FJTA 5KVEL 1FYTD 1MHCA 1XF4A 2QQLH 4XNYL 5EPMB 3VFUB 1S9WA 3STZB 2Q7YA 5GGSA 1UFUA 1VESA 1VEPA 1ZA3A 2YPVH 3BH8B 2F5BH 5DTFB 4AEIH 2ICES 4YDJB 4UMGA 5DD6B 2R23A 4HFUH 3NACL 3MV8A 2CIIA 4S1SL 1FIGL 1KEGL 3GM0A 1KJMB 1I4FB 1YEIL 2P1YA 3NPZB 1GPOH 3MRGB 3O3UN 4HUNB 3VFTA 4WV1A 4ZTOL 4MCYA 1MH5A 4PRHB 2PW1B 3OX8A 1N0XL 2QQLL 5HYJB 2GJ6E 5DVKA 4PLJC 2ICWA 5J56B 1PDKA 1UH3A 2R8SL 1G7HA 4KMLB 1V05A 4LPYA 3HR6A 4WI6A 3Q6FB 5DYOB 1T5WB 5H35A 1OF2A 4IJ3B 2AK4A 1JL8A 3MNWB 4KJQD 4HFUL 1ONQB 1GZPB 5FDYA 1L4IA 1MWAB 5L6YH 3WJJA 1NEZA 2BMKA 4X4YA 2KZ1B 5T5NG 1YEDA 1GPOL 2F53D 1Q9OA 3LH2H 4UT7H 1T1WB 1QA9A 5EORL 3MMEB 4IRJD 4NC1E 5E4IA 3MYZA 4OQTL 1SJXA 3WIHA 5F9JA 2R2BB 2MNUA 3KNBB 3CAFA 2AEQL 4GJTB 2EDDA 5B3NA 5JXEC 1U58A 1CFQA 3CXHJ 5EUOE 5DJCB 4JQXC 5EBGA 2P5EA 3QFDB 5FO8B 3P9LB 3LD8C 4WTXA 1I7RB 1T5XB 5FA3B 2P43B 1FCGA 3ARGC 1QHOA 1IBGH 5SX5H 4EVNA 3CDCA 2PNDA 4ZS7H 2ATPA 3RVUD 3GO1L 3LH2L 4UT7L 4Y7MA 5DEZA 4RFNB 4ODXB 3SGJC 5HHME 1EBPA 1FSKB 4Y16C 2F53B 4PRAB 5IT2H 3L3IA 3M17B 2X7LA 2NZ9C 4U6YB 3MA7B 3FB5B 1EEYB 4IRJB 2ICCA 4LKCA 3CDGA 3WD5H 4OZGB 4G7VH 3I02B 2XZQH 1YY9D 1W72B 4I1NB 1OTUD 5C0NC 1MCHA 1WSST 5SX4I 3BKYL 2DL2A 1UCTA 1CE1L 5GRUH 4NQUA 3LS5H 1EHAA 4U0RC 3VWKA 1IBGL 3QQ4B 2F74A 3CXDL 1KEMH 4ZS7L 5IJVA 1MCSA 1LO2H 1YNLH 3MLWH 5ICZB 2GSGB 4G6MH 3VXRD 4OLEA 2VL5A 2EIZB 4HWNA 2IMNA 3AAZB 4F7PA 5IT2L 5C2BH 3HE7D 3LN9A 1G6RB 2AXGB 4NKOB 1FVEB 1MI5E 4JM2A 2CLVB 3U7YH 4NSKA 3G04A 3WD5L 3T2NL 3SDCD 4KI1A 2VQ1B 2OP4H 3MLTB 1LNUB 4LP5A 5E2WL 4Y4KB 4OFIA 3TBWB 3CPLA 5JA8B 1NGWB 2O5ZL 1AGEB 1M1SA 5GRUL 3U4BH 1KT2A 4YQXL 1KEML 4EUPH 4NKDB 4K2UH 1ED3B 4GRWE 1LO2L 1YNLL 5CWSB 4R4BB 4G6ML 3DXAD 2YPKB 4XZUA 1AO7E 1U8JA 4YHPB 1RI8A 4ZFZB 1YEJH 2RJMA 4PLKC 1E28B 4NNXA 4HZLB 3VXRB 3JWOC 3U7YL 3F6IA 4EKXA 3T3MF 3VE0A 4EBQH 1TQCC 2MSPA 3VWJC 3B8YA 2OP4L 4M6AA 1G7PA 3FAXA 4U6TA 1C5DA 4PJ5D 5KSUA 3P4NA 4MDJB 2E7LA 5TPWH 3S37X 2XWBA 3CMOH 4X0KA 1EERB 2QSCH 1UJTA 3QEQE 1F42A 2PETA 4U1SA 3P0GB 4K2UL 2C7UA 5LAXA 3PJSB 3AC0A 2XNAB 1RZGB 3VXPB 1YEJL 3QULB 2J8UB 3JV4A 5DURD 2CR6A 1T4KA 4PJXB 1H3XA 4OLXH 2R29L 1GGTA 5EU5A 5J12B 4EBQL 3KPQB 4HS3B 4OKDA 3BEVB 3WS6C 4ZD3H 1P2CA 1U2CA 5TPWL 1KN2H 3CMOL 4YIQA 3TVMB 3MRHA 2GTZB 2QSCL 4M7LT 4OIAA 4PJ5B 3TM6A 4N90D 1OAQH 3V5DB 2HVKA 3JTTA 2IAND 5DZLA 3IDNA 3QWRA 4JFDE 3LAFA 3LKNB 3WE6A 4S1DC 2AQ1A 4PY7A 1UB5B 5JW5B 1YNTB 1KIQB 2YWYA 1FV1B 4OLXL 1R5IB 4NQEA 3RWFA 3C5JB 3TA3A 1N8ZB 5F1OB 5HDQH 2DM2A 5GZOD 3TIEB 4OLYH 5DURB 3UYRH 4YDLC 5B8CC 1JYWA 4OLUH 1J9CT 2OMBA 4ZD3L 4F15C 2AK1H 1KN2L 2YN5A 2GK0A 5D7IF 5IHUH 2ZCLL 4NHUA 2CD0A 5DRXB 2OYPA 3TCLB 1NCAH 2RB8A 2A1WH 3FQUA 2COQA 2LU3A 3FO9A 1FLRL 5DEGB 3JWDH 3N0PB 4WWKA 2YUVA 5DXWA 4R4NC 4Q2ZA 4I18C 2FWOA 1AGFA 3DVFA 3OZ9L 4WUUE 4ZOAA 1BD2D 4ZAKB 1EDQA 1AXSA 2YC1A 5HDQL 4C83B 5HHVH 3VFRA 2G9HB 2XQBL 5HYQB 1IILE 3QXDB 1I1AD 4OLUL 4X80H 3WIHL 2AK1L 5D2LF 4CKVX 1A6UH 2Q20A 1UWEH 3FFDA 5IHUL 2X44D 4UT9L 3PDOA 5SWZE 1NCAL 4K8RC 2A1WL 3QIBA 4AM0A 3GSOA 2NY3D 3D0VB 5FYJH 5TE7L 3JWDL 2P24B 4DN3L 4JFOA 2NXYC 2P8PB 5FA4A 3F7YA 3BPLC 1JNHA 3QDMD 2VE6A 1SBBA 4BQBA 5GS2H 5JUEH 3S35H 2GEEA 1N5AB 5FYLH 2I27N 4XCEA 3VFSB 3CCHA 2MJWA 5CD5C 1BD2B 4A6YB 4FQXA 2DM4A 2EH8H 2VIRA 3VGFA 2GSIB 2VKWA 2VLRE 1UWEL 2W0FA 3DRQA 1I1AB 4LCCA 4LLDB 1A9EB 1K4CA 3D3VA 2FEEL 4I2XB 4D94A 5FYJL 2IFFH 4KJWD 4M1CD 4QRTA 5DD3H 3HHRB 1WQVT 4NOBA 2YR3A 1C5BH 4MJ2A 2NY3B 2DM3A 3IU4H 4GKNB 4ENED 3KXFD 2BNQE 2NNAA 1H3GA 4PGZA 4GSDH 1D5XB 4M7ZB 4X98B 4ODSH 3S35L 5FYLL 3QDMB 2W91A 4LGSB 3UZQA 3UCRA 1RMFH 1TFHA 4RX4D 5SV4A 3S96A 3QR2A 1LP9A 4XWGH 2EH8L 3JXAA 5DO2C 2B1AH 3EOBA 5ID0B 3LMJH 4NFCA 1R3JB 5SWQB 1KJVB 3BP6B 4JO1H 3S4SB 2IFFL 1ZT4A 3G6AB 3TN0D 1L7IH 1HH9A 2ADJA 1XGYH 5DD3L 5EO9A 4G6KH 5E1AB 1GIGH 1H3PL 1C5BL 1MJ8H 4YEEA 3IU4L 4LKXA 1UB6A 3NIFE 4RSVA 4GSDL 1YECL 5L2KE 3OAZK 3FB7A 4WW1B 5FGBC 4P3DB 1RMFL 3U2SA 1KLGB 4AIXA 1DN2A 1HXYB 1MJJA 3Q1SH 1YJDC 3MNZA 2B1AL 4GW4A 4PJEE 2EDTA 3MGTB 3LMJL 3F6LA 3EAKA 4AYFA 2WBKA 4EJ1C 3LS4H 3RUGA 4OV5A 1GZQA 2AJUH 4JQVC 3T77B 4EIGB 3OV6A 1RZKH 4UINH 3BYTA 4K71B 1L7IL 2ARWA 2EIEA 2X1WL 5DJ0B 2YD5A 3EO1A 1ZVHA 3V4UH 1MJ8L 3VDAA 5IF0B 3VFOA 1GCFA 5EU3A 3TN0B 2G75A 2IC2A 5B39A 4V2CB 4JANA 1UZ8B 3T1FA 1OGAD 3D39E 5DJ2A 4AL8H 4JFEA 3DYPA 1F2XK 2X9XA 3DUSA 4O4YH 4L4TA 1S9KC 2ITCB 3OAUL 1C16A 3OGCA 4HG4J 1S7QA 3Q1SL 1WZMA 3I6KA 5GGVH 3WFDH 5L8KB 1Z3GH 5DMKB 1TITA 4R96A 3KPPA 5D7JC 4NCDA 3LS4L 4X4XB 4GXVH 4PP2B 3VXUB 3IDYB 4C55A 2FJGB 35C8H 4N8VA 4UINL 3ZKQD 3LOWA 3PP3K 1QP1A 3V6OC 4JY5L 3KPTA 4MQXC 2EYTB 4WI3A 3V4UL 1KPUB 3PL6C 3FQWA 3IFNH 4QNPF 4QHNB 1RJYA 3QRGH 3T8XB 2NY6D 4E5XB 1LO0H 2DQIH 3S5LA 3BP5B 4AL8L 3GMOB 4WCYH 4NRZA 4PJ8C 5JNYB 5IB2A 4O4YL 1NGQL 1P5VA 3QQNA 3ME0A 3BEWA 3QO0A 5GGVL 5JHDA 1Z3GL 4X9IA 1LDPH 2VZUA 1FNEA 1RUAH 5EN2B 1RIVH 1NLDL 4DGIH 4R3SA 2GITB 2AERT 4QLRA 1CTOA 4PLNC 4UOW0 3V79C 3WNPA 4R6UA 3MRQB 1BJ1J 4L8BB 4RAUB 3T0XA 5JXEA 5I74C 1KBGH 5KS9E 3FCTB 2Z8SA 2FH8A 3D2UA 3OKNB 1VKXB 1JWSB 3IFNL 4JFFE 5TDPB 1UXSB 4PR5A 2J8HA 4JQXA 1LO0L 5FO7A 2DQIL 3GGWB 2VKXA 5ANME 3BSZH 3TO4D 2BHZA 4WCYL 3VXSA 2NY6B 3ARGA 4O58H 3WUWA 5CJ5A 3LIZH 1MCCA 1GOHA 4Q74A 4BQCA 4OZIF 4ELKA 2FGWH 4ZS6C 1O7VA 3K8LA 1JGEA 5K59E 3ULVE 5GISH 5C0IB 5LXGH 1RUAL 3OKMB 1RIVL 1U8PB 3SGJA 5KTEH 1WZ1H 4Y16A 2Q76A 1FFOA 4LU5L 4LHUD 2NW2A 2IH1A 4GBXC 1GC1C 1KBGL 1TPXC 3PDGA 1PZ5B 4BFGA 4QRPD 2Y6SD 4MWFA 5DJDA 1JI2A 5MEPA 1CYGA 4HUXA 2C1OB 2CIKB 1X5HA 3BSZL 5TF0A 3B43A 1T0MB 4K55A 1HHKA 4RZCB 3LIZL 4NQCA 4D9RE 3P11L 2FGWL 3TO4B 1Y6NR 1EPFA 5GISL 1J05A 1JCKA 1YZZA 3NCFB 5KTEL 1WZ1L 4KU1A 5D2NE 3IU3B 3T65B 3G9VA 1UXWA 4CN6A 3SDYL 5CEYA 1AD0A 2RHEA 1HIMH 3VA6A 1ES0B 1YEFH 4I4WA 4XNQA 4X6DA 1Y18B 1R3IL 4OI7A 5HD8C 4P4RA 1UJ3C 3K74B 3BPOB 4LHUB 5T3XE 1MCLA 4GUPA 3EJZC 2D0GA 4G9FD 4QRPB 2I5YH 2AJZA 3P0VL 4KPHH 4QTIL 3L5IA 3OTTA 4U1HB 2R56H 1FG2A 3LRGA 5DUBB 4TVPD 4PGBB 2BVYA 3O9WD 4L8SB 4Y0GA 4H88H 5C0DB 1ZA6A 3WO4C 2QADD 4HIEB 1CFTB 4X4ME 5TE6H 1FC2D 5F9WC 4BSVA 4ERSH 5LGHL 1AI1L 4YXLH 5F1IA 1A7NL 1N0LA 43CAA 2P42B 5A2KH 1HIML 2AKRA 1QLEL 4MHHI 1YEFL 5FUZH 3V7MA 3GB7B 3VWJA 2JJTC 2Y25A 3VH8G 4PJAA 4Z77A 4PJHF 4QOKD 5HHPB 1MIMH 4KPHL 4YDIH 4OB5H 2PXYC 4KWUA 5GIRB 4MVBD 1QUNA 1CF8H 4G8GD 3FFCD 2NZIA 3PHOA 1KXTB 3BXNB 2HJKB 5C8JB 4GMTH 2J12B 5A3ID 1U8QB 5TE6L 3T08A 5DF0A 4YXLL 3N1GC 3O9WB 3L1OL 4P2QB 4MD0A 2VLJE 4NKIH 1A6TB 4WTWA 2WV3A 2I07A 4J4PD 3UTSD 5FUZL 3S37L 3L6FA 2JJVA 2ZSVB 4N0FA 3Q3GA 2WZPD 3EZ8A 1BZ7A 1MIML 1TETH 4FQ2H 2C9AA 4OB5L 4YDIL 3WS6A 4ZO8A 3TFKD 3LRSB 3RVTC 4CN1A 1DSFL 1MHEB 4QOKB 3RGVD 3PHQB 2FBJH 4Y4FD 5CP7B 1JPTH 2VH5L 1I9RL 4GMTL 5BOZG 4G8GB 4BQ9A 3C09B 5EA0H 5EBLA 3FFCB 4I3SH 3QIUD 2XQYK 1DANU 1XCQB 3IJYB 4ZPVB 3F7VB 4NKIL 1IAKA 3VRIB 1E4XH 1X7QA 2ITDB 5HGAA 5DRZA 1II4E 1IQWL 3NH7H 3RL2A 2XN9D 1PEWA 1BVKA 1JUFB 4JJHA 3W0WA 4E41A 3CSYA 5MP6L 4UB0H 4FQ2L 1RZFH 5EIIA 3ZE2E 5D1ZD 1F3JB 3TESA 4MA8L 4PUBL 2XA8L 5CZKA 2FBJL 3GSUA 3RWEB 1JPTL 2JJUA 2QJDA 1KTLA 3MFFB 4JFXA 4ONHA 3ESVF 2BVUA 3G6DL 2Q8BH 3JV6B 3PIQB 5EA0L 3EFFB 4I3SL 3LKQA 4Y4FB 1HN1A 2CQVA 4I18A 5I30H 4HJGB 3MCKB 1K4DB 4YPGA 4IIQC 1ZV5A 3REVB 3QIUB 1WCBB 1LEGA 5CJXC 4XCCH 4LRNH 1RZFL 3ALXA 5T1KA 3ZYZA 4MQ7A 3L95A 4OCRH 3KS0H 5BRZD 2DLGA 3ULSA 5AD0B 5DWUL 5C0JB 3NN8A 3V4VH 3BKCL 1A0QH 1FE8H 2R2HB 4X99B 2Q8BL 4M48H 4OQ1A 3LSOA 2G2RA 1YEKH 1TENA 3ZL4H 5JQ6H 5KOVC 4DOHE 3WFBH 3MRRB 3RNQA 4N1CA 5I30L 5HYIA 3RVVD 3MV11 1TJHL 1R5WA 2Y06L 4AJ0A 1U92B 3RWCA 4NOFA 3P77A 1A7PH 5EZOH 4XCCL 2ENYA 5FB8A 1AGBA 5C6WH 3TGXA 2XQYG 5ALCL 5T3ZE 3IFLH 4OCRL 2OZ4A 2ICWI 5LBSL 5KN5A 5DGQA 2WQ8A 4P2RA 2E8ZA 1FE8L 2DBLH 2H9GA 2HT3C 4X7TA 1C5CH 3ZL4L 4DCQB 3WFBL 1X5YA 4JY4A 5SX5K 1LD9A 4BM7A 4FHBD 3G5ZA 1GGUA 1A7PL 5F1NA 4J8RA 1UWGL 5ACLA 1HILB 5C0BD 3OR6A 2BCKA 3TNNA 4DVBA 1FSKC 1T66D 5I9QB 2P8LA 4Z0BH 5ESVB 1I8IB 1WFTA 1P4LB 2DDQL 2WQRA 4Y19E 5MEND 2DBLL 5HHQA 2YSSB 2HRLA 5DS8A 1KPRB 2DI7A 4R2GB 1C5CL 4HIIB 3ZDYF 3ZT6A 4MA3B 3FTGA 3SJVA 4P9HC 3MC0A 4CVZA 1T89C 3QJFA 3DHJA 1QRNE 3SDDB 3EDKA 5GGUA 5FGBA 3T0EC 2X9WA 5FGCE 2DWDA 1OB1A 3OWEA 2DKSA 5H8DA 2FIKA 2Q3ZA 4K3GA 3JWOL 2EXYD 3OR7A 1ZVYA 4Z0BL 3DX8A 3GMPA 5C0BB 3PGCB 1N6VA 3MV01 4JQVA 4PTUB 4GH7B 4NZRH 2AV1B 1ADQA 4Y4KC 1R3HB 1NAMA 4NNYA 2DQFA 3SDXE 3WEXB 2C4FT 5MENB 1QFOA 4LIQH 5BQ7A 1P1ZB 5KSBF 5ADOH 4F33B 3LQAC 4KY1L 1QO3B 2P46B 1EIBA 2HFGH 2V2TA 2EC8A 1VERA 5C0AE 2BOCA 3BZEB 5AZ2H 4FOMA 1QEWA 1J8HD 2XTJD 4ELME 3QIWD 2P5WD 1CFNB 1JV5A 2SEBA 3WNOA 5D7JA 2ZPKH 4Z0XB 4J6RH 4Q6IC 4JDVB 3BMVA 3KWWB 4FQQA 3V6OA 1CG9A 4NZRL 4KI5F 1BOGA 5DQ9B 4AENA 3U82B 3PL6A 3DRTB 4AK1A 4LLUA 4YHOH 1NFIA 4LIQL 4XXDB 2HWZL 5HDBF 5ADOL 1IGTA 4KFZC 1E6JH 2B20A 3B2UC 2FL5B 1J1XH 3RDTC 4PJ7A 2HT2D 5DHVA 5F7EH 4RMUA 5AZ2L 3E0GA 3BWAB 3FRUA 2AEPH 1NPUA 5C6PB 2VUYA 1MCWM 2ZPKL 5J9PB 1J8HB 1MAKA 1FBIH 3QIWB 2P5WB 3CDYA 4FFVC 1RZ8A 1H8SA 4MNQD 3L3OA 1LILA 2OI9B 3X14A 2DLFL 4HLZH 5DR5H 3D25B 4NQDD 2X5PA 1H5BA 3TVMC 4ZFOB 5ISZA 2X89A 5DJAA 2FB4L 3CZFB 1J1XL 5BV7B 1IARB 3CUPB 3IS0X 5F7EL 3SHSA 1U3HA 5IB3A 1NKOA 4JHWL 2AEPL 4WDIB 2LTQC 3BRGC 4L4JA 1NFDA 1FBIL 3VFNB 1F97A 5CIPB 4GBXA 1S7WA 4AH2A 1D6EA 4OKVA 4PBXA 3WHXA 5DR5L 5EFIB 5E2UH 4E9LA 3ULUC 4MNQB 1VFMA 3MRDB 4K8RL 4GW1B 3GMQA 4ZSOE 2R0KL 2XKUA 5A16A 4N5ED 5E99H 1HQ4A 4D9QD 2YEZB 3WLBB 1ZLWH 3NGBC 5FM8A 1MCJA 2EDKA 2DB8A 5E9DE 3OKEB 3WFHA 4E42A 4YZFF 5IB1A 4F9LC 1S7TB 4U7SA 3LV3A 4I13B 3LEVL 4PBVC 2L0DA 2ZUYA 3W11C 4JZOB 3MLYL 4ZAKC 2JK5B 4F37K 3OB0H 2R1YA 2VXTH 5IBTH 4KUZH 1CT8B 4RQQB 2C3VB 1BBJB 5F21B 3WYRA 5E2UL 1T20B 1TCRB 2OZ4L 4MNHA 3QXUA 1SVCP 4NC0B 3EYSH 3MBED 2V17L 4XI5D 4BH8A 4BZYA 3D85D 1YUHA 5KVDH 5E99L 1I9EA 2I9LA 4Z7WE 3VFWB 4WI4A 1WVZA 3RHWF 3BIBX 4EI5B 3CDFA 2OTUA 1ZTXH 3DURB 5F7DA 4HDIA 4KMQA 3SPVA 5J7CC 1MUJA 3HLAA 3H2WA 3L3HA 1ZGLB 1ERNA 1INDH 3BH9B 5IBTL 4RRPA 4KUZL 2JJTA 4MJIE 1D3CA 4HKJB 3CFCH 1RFDH 1XMWA 1R6VA 5D7SL 3S97C 4LLMA 2V7NA 3ZKMC 4AEHL 4Z7VA 5IMMB 3E8UH 4XH2B 3M1BB 4JLRB 2BRQA 1CR9H 3EYSL 3ROOB 1PW3A 2PXYA 3UPRB 5I1CL 1OY3B 1B9ZA 4XNMA 4UV4H 2WBJD 4PJ9C 3IGAB 1ADQH 4TTDC 4PJGF 3UO1H 1NAMH 4N0CD 5CJ8A 3MBEB 3L7EA 2C5DC 1RIHH 1A8JH 4L4VD 4U6HA 4Y1AA 8FABB 3ROLA 1MCPH 1F6AB 3MV7A 4FNLH 1ND0A 4KTYA 1S5IH 1U8NA 1INDL 4OZIB 2ARJA 1MCNA 3JWNC 5SWSD 1FFQA 3VXQA 1YJDL 4PS4L 1YYLH 1I8KB 2BX5A 4JRYA 4R0LA 5AYQA 1U95A 1RHFA 2AABH 4LVOB 4PP1C 3IXAA 2JIXD 3CFCL 5C7XH 3NBNA 3CFBB 1OT2A 2NR6D 3E8UL 1BQHB 1SYSA 1SJHA 2J1KA 1CR9L 4LF3A 3V0WH 3QUXA 1S3KH 3EHBC 2FLRT 4UV4L 1P7KB 3CLEH 5H2BA 1KCLA 3VXOA 1P84K 4QCIA 3QXTA 1NAML 3UO1L 2XWTB 4LCWB 2E9JA 3HCVA 5HYJE 1FYTE 4H0HB 1IAOA 5IVXA 5D4QA 2YMXL 1IT9H 4YFLI 4FNLL 3ILPA 4JREB 4MXVE 4Y5YB 4AMKH 2ADIA 4L4VB 5DHVH 3OXSA 3CK0L 5DJ8A 4ZXBD 3VW3H 2AABL 1JMXA 5C7XL 5LQBL 5SWSB 1KB5A 1CXIA 4EN3C 5DUPH 4APQD 1B6UA 3BP4A 4YFEA 3RL1A 1S3KL 3RTQD 3ARRA 3CLEL 2NY4C 2ZSWA 4HJJH 3TV3H 3VFUA 5JOEA 4OFYD 3FB8B 4M7KH 3LN4B 3HPLA 4OV6F 1JZ5A 1DBMH 1QSFB 4U31A 4F7CA 5DTFA 1KCSL 3G08A 1PEZA 3IETB 4HIJA 1JYNA 4PJCB 4AMKL 1P4BH 4YDJA 1CQKA 5EU7C 5DD6A 4GKSA 4B7IA 3P4LA 5FYKU 4IIQA 4TSCL 4LVEA 4KKLC 5TGBB 5CJXA 1JF6A 4PGDB 3QH3A 3MV9D 5LG1A 4QRRD 2VXSH 5DUPL 5F7LB 4DZ8B 4ZXBB 4Z7UA 4OFVA 1CBVL 4PRHA 1DQMH 1GC1H 2EECA 4FQCH 4APQB 5I76A 5C6TH 2F53E 4BZ2H 1XF5A 2E8YA 4YHIB 5E94B 4J3TA 3EOYG 1DBML 1X5XA 2VZOA 4GAJH 1T5WA 3H3KA 4JM4H 3PWUB 4KZDH 1NH6A 1Y0LA 4TNWF 2VLLA 1ONQA 1MWAA 5IEHA 4LMQE 1FO0B 3RVWD 4LNRB 1NQBA 4N0RA 4UIMB 2VXSL 2CGRL 1TVHB 3I9GH 2R0WL 2VXVH 3ARDD 1GC1L 1HYRC 2Z91B 2R2BA 3BN9D 4ODTL 3W9DA 1T0NA 2XFXA 5INCB 3UBXI 4BZ2L 1KF9B 5EU6A 1A6ZB 1FZMB 5EUOF 5T5NF 4QGYA 2B4CH 2NQCA 2YOCA 4KJPD 1OPGH 3INUL 3KYNB 4URTB 4KKCD 4JM4L 4KKBD 4R8WH 1IMHC 2XG4A 4DKFH 3MRFB 3QFDA 4X83A 5GPRA 1P84J 3KLSA 3P9LA 4JO3H 3U6RB 3G5XB 1T5XA 5FA3A 4YDKH 1UADC 2EEDA 1TZIA 5TQ0L 1YEHH 4P2OD 4NO2A 2VITB 2CK2A 4FFWD 3B9AA 3I9GL 4ODXA 3QISA 5E8OA 1EMTH 5FKAB 2X4OB 3OXRB 5IFAH 1A1NA 5MI0C 4HC1A 1S7RB 2CKNA 3U0TB 4G6AD 3C6LD 2VUOA 3QUYC 3F65A 4OZGA 5D7LD 1W72A 3VXRE 2IMMA 3SQOH 3V8CA 3Q5YA 1OPGL 5CINH 1YC8A 1RK0A 2X70B 4KHXH 1ZVSA 4R8WL 4OCSH 3WHE0 3GNMH 3MLPA 4UUJA 1AP2A 3OJDB 4KKNA 1EX0A 1HWHB 1T89A 4XBEH 4YDKL 3T0EA 3TO4C 4JZNB 3B9KA 3NPSC 4WGWB 3QFJD 1IEHA 2O5YH 3MRCB 4OAWA 4NQEE 5EU4B 1OAXH 1HKLH 3DGGB 4Q58C 2FO4B 3LB6D 5IFAL 2R2CA 4NKOA 5DSCB 1G6RA 4FXKA 1FL6A 2CLVA 1H8NA 3BZDA 1LO3H 1EAPA 3MQIA 4CW1B 4PJXE 3NFPB 3DXAE 3D9AH 3SQOL 2VQ1A 5CINL 3TO2B 3BPOC 4N5UA 5IVOA 3MLTA 1LNUA 4BFIB 3ARTA 4OCSL 4Y4KA 3TNMA 2A74A 3GNML 3C6LB 3NCYP 5D7LB 5J6GB 5KJRH 1J10A 2E3VA 3WNLA 1WAAA 3O8XD 4GRWF 3EJJX 1IL1B 4NKDA 4WFED 4MNGA 4L8SC 4R4BA 4GLRI 5KG9B 2O5YL 2YPKA 1HKLL 1PG7W 4MCZB 4RIRA 4PRPD 3KYMB 2VR4A 4ZTPH 5T33H 1A7RH 2JCCB 1ZT1B 2FHBA 1WCQA 3QFJB 3H9SB 4HZLA 1A5FH 5CBEA 4Q6IA 4XC1H 5I15L 3P30L 1KB5H 3D9AL 3RGHA 4PJFA 1IM3B 5E56A 3EW3B 1J0HA 3UTPD 3L5XH 4JZJB 3AM8C 5E5MB 3DMMD 5ESAB 3MJGX 4JRXA 4NKMB 4F3FB 1CGVA 5GRXG 1L9NA 4JFZH 5DDHA 4V1DD 1HSAA 1PKQA 1WZLA 1C08B 3RDTA 3AVEA 5J8OA 1V3LA 3VXPA 4N68A 3O6LH 4U1JB 5T33L 4P5MA 2J8UA 2X42A 3O9WC 3MO1B 1RULH 4N90E 5F9OH 3G6JB 3VFVA 1X5JA 1Q8MA 4YDVB 1A5FL 2IANE 4P5TB 4XC1L 3VXTB 5FF6B 4S1QH 5CZVH 4NJ9H 1KB5L 1YC7A 1Q9KB 4PG2A 5I1DB 4RMRA 4HS3A 1N3NA 1AJ7H 3N1MC 2E27H 4NQTA 3BEVA 3D3VE 1OOAA 1G0YR 3GJEB 3C60A 3TVMA 5DEFB 5C86A 4JFZL 3I6GB 1CD8A 3DMMB 2VDPH 4GRLC 3QDGD 3HS0B 1N64H 3RIFK 3WKNA 1SJEA 4WO4B 4V1DB 3HNTL 4NN5B 1V7ML 1W2KT 5JW5A 1MWAH 1RULL 5F9OL 1FV1A 3V5HB 5A3IC 1R5IA 5CZVL 3RI5K 1LP9E 1X44A 2W60B 4G3YH 1AGCA 3AFLA 4JGMA 2Y5EA 3ARPA 2E27L 4YAQA 2F19H 1BD2E 3TEUA 4J3XA 4U33A 1MFEH 2A73B 2EZ0D 5E2TH 3EJYD 5DRXA 4XHJC 2UY7A 3MRJB 4H1LB 5FOBB 3QUKB 3RX8A 1QSEA 2PW2B 3OQ3B 3Q48A 1NCWL 4F9LA 4TUKH 3WDJA 5KSBB 3QDGB 1MCIA 4KXZI 1L6ZA 4HWBL 4Y4FC 1MWAL 3BKMH 2G5RA 3HKFA 4HUUB 4NYLB 5F8RC 3UTOA 1UA6L 1HSBA 4ZAKA 5TE4H 4NFBA 4PRBB 2YZ1A 5I75B 4MLIA 2JLLA 3MRMB 4JFPA 4YFLF 4HQQH 1MVFA 5DK0B 1WBXB 4FG6C 1T1XA 2W07A 2B2XH 2A83B 5L2JB 1JF5A 3VD4A 1C7SA 4HC1H 4X6BB 4BUHA 3AREB 2HMIC 2DYPA 3MCG1 3U83A 3WIFB 1W72H 1BJ8A 5ESQB 2L7JA 3HB3C 2QSQA 2A6KB 3TIDB 2P24A 4TUKL 4OCXL 3ES6A 1M05A 1CI5A 2JE8A 4P9HH 3A0OA 2MTPA 3BKML 4C56A 3UTTD 4L4TE 2EIDA 5TE4L 2B7DT 4LCYB 3R1GH 3AXLB 1Z0MA 4OF5A 2BHYA 2VN4A 4GKOA 3BPCA 2B2XL 1FGVH 4U1MB 1U8LB 3KXFE 2JJSA 3STLA 1G6RH 4HC1L 4GQPH 4M9PA 4YHNB 3TJEH 3MR9A 1T83C 5KAQG 4LLDA 1W72L 4DN4H 4PJ9A 3PUCA 4G42B 4I2XA 1UCBH 3KLHD 1LE9A 4YE4H 1M7IA 3H0TB 3L5JA 4P9HL 4WFHD 3VFPB 3MJ6A 5DK3A 4GKNA 4OLVH 2P47B 3LQAH 2FX9L 2DD8H 3BQUC 3R1GL 3DYOA 5F89B 4MLSA 1FNHA 5CZXD 2BJMH 1NUFA 1W8NA 1BVLB 2CDFB 3GSXB 1FGVL 1UENA 5CS7A 1A7OL 2VLKB 3K4DA 4HAGA 1G6RL 1XIWD 3K2UH 3WUWG 2WK2A 5DD1H 5I9QC 3TJEL 5HI4C 4KUCF 4LBEA 2D0FA 1E6OH 4F7MB 1KJVA 4HHAB 3QPXH 3BZ4B 4HUVB 3RKDD 1UCBL 1G7LA 4YE4L 4YHKH 3G6AA 5I19H 4H20H 5E1AA 3EIFA 3NIFF 4R2GC 1AY1L 1UQSB 2XWJB 4OLVL 3LQAL 3ARBD 3R06A 4LVHB 5JIIA 1CQYA 3O45B 4QF1B 3QCUH 3SDDC 4HGWB 4P3DA 2BJML 3OF6D 3QZWA 3BVNB 2M8XA 1HXYA 4PJEF 3IDJB 3ZT5A 3C5SB 3K2UL 3H9YA 4EN3A 2P44B 3K4ZA 5DD1L 1OGAE 1EH9A 4L9DA 4OSUH 3J7HA 4KK6D 2RGSA 2O26U 1UEYA 5CEXB 3F12A 3T77A 4C4KO 4DAGL 4YHKL 4L8CB 3FQXB 3KS0J 1DE4B 2NYYD 3SGDI 4UQ3A 4XVSH 4L3CB 4XNZB 4AIOA 5I8KH 3BD5A 1S9YB 3ARBB 1XZ0A 4JKKA 4U7KA 2ITCA 4JN1H 2IADB 2H32B 3L7FB 4BELD 4QEGA 5I1IL 2GW5A 5DMKA 4AIZB 1KLUA 4R9HA 1CLZL 2WIIA 4OSUL 4GKZB 1JZ6A 1VGEH 3FL7A 4GAFB 3VXUA 4KRMB 1FVDB 2VDML 2FJGA 4WU7A 3ULUH 1QNZH 3DI3B 5I2IA 3T8XA 1ACYH 3VXNB 1U8HB 3U36B 4UTAH 5ACZB 1RK1B 4W6XB 3U7AA 4PJGB 2EDJA 3WV0A 3BRFA 1I3RA 3REWB 5ALBH 3GDBA 5D93B 3D69B 3IRZA 1QVOB 2VXUH 5EUKB 2VERN 4KQ4H 4Y5VB 3S36X 4LHUG 4BJLA 4X5WB 3ILQD 1K8IA 1TCMA 1VGEL 2FECL 2GITA 4GG8B 1YPZA 1YEGH 2MHAB 4M00A 3QIWC 2HKFH 5KS9F 3FN9A 4M4RA 4JN2A 3P4OB 4RAUA 3QG7H 4QKXB 3ULUL 4ZQKB 1DBAH 3F58H 3OKNA 1R24B 2WP3O 1K6QH 2OLDA 3ALPA 5TDPA 1U8KA 5BVPH 1ACYL 5ID1A 1S9XB 4DTGL 2VR5A 1U3JA 4U1NA 1HHIA 1OCWL 1MF2L 5ABDE 4QRPE 2Z93B 3CSGA 4G7YH 4JJ5B 1K3IA 5BV7C 3OB8A 4HKZB 5F72S 5K59F 3ULVF 4H0GA 1HDMA 4QY8A 3HE6A 1NCDH 4KQ4L 5CEZL 3OKMA 4G8IB 3SEPA 3CIQA 2P4AB 1UKTA 3CLFL 4BFBD 1UVQA 2XKNB 3BUYA 2GJ6D 1MFAH 3BISA 3G5VB 1DBAL 3F58L 3QUYA 2CXKA 3BP7A 1HQRB 4YXKH 3IDMA 4PIRF 2H2PD 3N9GL 5J3HC 2C1OA 5HYEA 2K1MA 3GSNA 1G7JB 4UNVA 1AR2A 1I7UB 1EZVX 3OJMB 4OCWH 1ZLWK 1PX3A 4G7YL 1A2YA 2CKBB 1ZSDA 4IEFB 4MA1B 4RA3A 1NCDL 2EXWD 2VO5A 1VFAA 4G9FE 4QRQA 2MFNA 3BD3A 5DK2B 4P46A 3ZE0E 4WW2B 3ABZA 3HPJA 5F9AC 4LLYA 3OB0K 3HI6H 1SYVB 1MFAL 2YPLA 5FYKD 4LSRH 4TVPE 4CGTA 4WIQA 3EO0B 2P7TB 1KIPB 3FKUS 2GJ6B 4HAFA 4K9EC 4YXKL 4CVWA 4ZUUA 5D5MA 4H5SB 4NBXB 1X4ZA 4U7MA 2IPTL 3BW9B 1DQDH 4OCWL 3GBMH 4I0CC 5E03A 1LE5A 3H7BA 4NQXB 5IMLA 3QDJA 5IOPA 5FUCE 1DFBH 4L8SA 4QOKE 5C0DA 4EI5C 5I18H 3O4LA 4HIEA 1CFTA 3HN3A 5IW1B 5EG6C 2HJFA 3HI6L 4G8GE 1FPTH 2DTSA 2FGZA 1QFWM 3OKDB 4PJIE 3QBTB 5DD0L 1KULA 2Y5TA 1G0XA 1JHKH 5MEOB 3DX7B 4I0PD 3ARFC 5HHPA 1A64A 1ACZA 1I3UA 1DQDL 5TDOB 1IAIL 3B9DA 3GBML 3UTSE 5EUOB 2BOBA 4I77H 1K85A 3W9EA 1RUPH 4WNQB 1VHPA 2EKSA 1DFBL 2Q1EA 3ZSSA 3CVHB 3AU1A 5I18L 3ELAT 1MY5A 1S9VB 5C8JA 4R90H 3O0RH 5EDXA 2ZNWA 3VG9C 4P2QA 4MDIB 1FPTL 1M7XA 3IT8D 3T3PE 1S8DB 2E5EA 3RY5A 5HHMB 1JHKL 2EYRA 4LVOC 5B4MD 2ZSVA 1TTGA 3MRBB 3TC9A 1GOGA 3LRSA 4CMHB 2XACC 5EOCH 4OT1L 1MHEA 1I85C 1VENA 2XN9E 3LEXB 4LEOA 4GRLA 4OIIH 5I8EA 2DIAA 4S10A 5CP7A 1U8IA 3NCBB 5FDWB 4PY8I 3O0RL 1KN4H 1AO7D 2KL6A 1Q38A 4K23H 2R0ZH 3IJYA 4JREC 3F7VA 4Y5YC 5BW7C 5E7FA 1D5IH 4HS8H 1F6LL 3QEHB 3U4EA 5HHOA 3MA9H 1J87A 2GUOA 2IBGA 3V6FA 3CVIL 1RURH 4KK5D 3RRQA 5JOPD 2HVJB 3ZE2F 1MI5B 3VG0L 5J13B 3KPSA 3U48A 3O41B 5EOCL 2XICA 1XGRA 4OIIL 3MJ7A 5HYSB 2YD8A 4HH9B 3JV6A 1KN4L 2A6IA 3PIQA 1R3LB 3CH1A 3EFFA 4DGYH 2R0LH 3C2AH 2R0ZL 5T1LD 4QTHA 5BRZE 4GRWB 5E70A