3WIHL

Crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFGAGTKLELKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Roundabout homolog 1
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihL01
3WS3A 5E08L 4HMDA 4NQED 1T04B 2NTFA 2NXZC 4K3JL 1G6RB 2HMIC 2FBJL 3WIFA 4F7MA 3O3UN 1ZVHA 1VERA 2XZCL 3MR9B 4JVWA 4Z77B 4HDIA 4FXGB 2OM5A 5FV2A 3PHQA 3W5NA 1JV5B 5DZLA 2NXZD 1BFVH 4XCEA 2IAND 5MP6H 4XGZA 4LRNL 1EPFA 4RAUB 4PRAA 3MRRA 1ZMYA 4GW5A 5F7EH 3PIQB 1NC4B 3TBYB 1P4IL 3DETC 5F7MC 3BP6A 4JVPA 1GCFA 3WIHH 5BJTB 2ARJB 3QQ4A 4H8WC 5IHUL 4WI5A 2ZOLB 4MJIE 2DYPA 2GI7A 4TSAL 4HJGA 4QOKE 3QUML 2F54D 1QYGL 4POZC 3HMXL 3H9SA 3QEHB 3F7YB 4PJBE 1FDLL 3QCUH 1T20A 5F97E 4BH8B 5BV7B 3DETD 1KN2H 2ADJB 2PN5A 2C4FT 2OR9L 4P3CH 3CC5A 1OAUH 1S7XA 3LH2L 4OKDA 4POZD 3IDGB 3AU1B 1WBXA 1DBMH 2R23B 3S96A 1A1NB 2LTQB 2FATH 2M26A 1BZ7B 4PGEB 1A6PA 2BVEA 4HEME 4JZNA 2BCKB 3VXUE 1JPFA 2WBJB 3H8NA 3QIBA 5LAXA 1CDIA 1FV1A 2PO6A 3AXLB 4HIJB 5MENB 1SM3H 1T7XA 2HKFH 3KPMB 5DMJB 3MUZ1 3Q6GL 3MRHA 4GW1B 3D3VB 2JELH 2H32B 1VADB 43C9A 4X7SH 1N3NB 1I7UA 5C0BB 4OLXH 3O3DA 1BVKA 3LHPH 3X13B 3HMXA 3PWLA 3CSPA 1ORQA 1DE4B 1DBAH 1MSPA 2HG5B 1CTNA 4XNZB 5DRXB 3RWIA 1W8OA 3LIZL 3MRJB 1CFTA 4X6DE 3TJEH 1Q9OA 1MAMH 4MQ7B 4LLYB 4NM4H 3QWOB 3E6FA 2FJHB 4R4NC 5C0AB 1LE9A 2R1XB 3DX9B 4OCYH 3T4YB 1U8LA 1GGIH 1SQ2N 3TPUB 1Z9LA 5ERWB 1KV3A 2IF7A 1BQHB 1BEYL 3E2HC 3QCTL 4G6JL 4H20L 5ICYA 4FZ8L 4F2MA 3S36H 4C55A 4D3CH 5IEHA 4KQ4H 1IGJB 1INDH 4HS3B 2GTZB 3WNKA 3MRDA 5EZLB 3HZMA 4HIIB 4R4ND 1WCBA 3JXAA 3TYGH 1KC5H 4FOMA 1U36A 2YWZA 1DSFL 2DIAA 4N1EA 2GK2A 3VE0B 4HWBA 1IT9H 3C60B 4OLYL 1U8KB 2OTUA 4PR5B 4PRIE 5GRUH 5I30H 3SKNB 1JPST 1G6RH 1WZLA 3QHFL 4QYOB 4APQA 4B50A 4ORZC 5A16B 4YEEA 2I9LB 3U9UB 2C3HA 3UTPE 4WVRA 3FT2A 5TE4H 2XG5A 4HPYH 4NKIL 2GK0B 3QFJE 4G3YH 3ZL4H 4NC1E 2NPLX 4ACPA 5HHNA 2HFFB 1LMKA 4MVBC 1YNKL 4KTEL 1QNZH 1ZLSH 4JZJA 4PJ5D 4E5XB 4JRXA 2A2QT 3QAZC 1ETZB 2Z31D 4FMFA 3RKPA 3MLVL 5ID1A 3LZFH 1C16A 5IBTL 5BOPA 5LBSH 1UADC 5IMMA 4Y4HD 1A3LL 4MVBD 3MLRL 5CWSB 6FABL 5C1MB 5DD1L 1IC7H 4DUVA 5LWYL 1RZJL 3MRPA 2BVQA 4MNHA 4DKAA 4K9EL 3SDXB 5GZOC 5J12C 4BQ6A 4X5WB 3FO2A 3ZTNL 4HJ0D 1LO2H 1MLBB 1E4WL 2OZ4L 4Z7NE 5JPMA 1A7OH 1XGRA 2X40A 2FX9H 3U1SH 1GIGH 1MJUH 5JHDE 1HXYB 1T80A 2VXVL 4OGXL 4GAFB 4GG6F 1FNGA 1MCDA 5DSCA 5A43C 4PG2C 3GRWL 4I3RL 4JM2C 1T7WA 3MGTB 4NZTL 3JV6B 3MODH 5DJCA 3QUXB 4MCYA 4PG9A 3H3KA 1FLRH 1E0OB 1WCQA 3MV7D 5DC4B 2HJFA 4U1NA 1CQKA 3FRUA 5H2BB 1QEWB 4YH6A 3ULVL 5DUBB 5HYJA 2E3VA 5IW6B 5KSVA 4MDJB 2IBBA 2ADFH 4JM2D 3CFJA 5FEBA 1JYWA 4DKDC 4D9RE 1AR1C 4JO1L 3IJHA 4NHCL 3IDJA 4PRNB 1JNNH 3FFCE 1ND0B 4RMQA 4JJ5B 5E8DL 4N0FA 1ZS8B 3KPSD 4Y4FA 3WLWD 4HWUA 1JWUA 5HHME 3P30L 5T3XD 1B0RB 3RGHA 4C54A 2EDEA 3BHBB 4GRLC 1Q0XL 1UKQA 4A6YH 1AR1D 4QRRB 1ZHNA 1IEHA 5GRJH 1JBJA 2EDTA 1E27A 2ZUXA 4GXVL 5IJKA 3GRWA 4Z7WA 3H9ZA 1FAIL 1CE6B 1CD0A 3HI1A 1BOYA 1NBYA 4Z95H 4MD4A 3C8KB 1FHGA 4GRLD 4P4RB 3GHEL 4L3ED 1I7ZB 2APVA 5AAMA 4WDIB 3HAEA 2EIZA 4UUJA 4OZHE 1DN0B 3VXRA 3HC4L 4NNXA 5BQ7B 5JW4M 5FA3A 4G8FB 3MRMA 5F6HI 4K7FB 1Q9LA 3NZHL 4PJXF 3GJFK 1T21B 4Y5VB 2ZUTA 2DAVA 2YOCA 3SKJH 3HNVH 1NGWB 4R4FH 3NAAH 5DUMH 5HHVH 3VFSB 2YEZA 4AENA 1CGWA 4WWKA 2BNRE 3W0WA 4HKZA 4NT6B 4GS7C 2HAZA 1MAJA 4P4KB 2F9BT 4P57A 4EOWL 3DX6A 2NLJB 4PJ9C 5T3ZH 5FKPA 5T1MA 2VLRB 2GJZA 4ZD3L 1I4FB 3PDGA 1YC8A 4NN5C 3PGDB 1BHGA 2J88L 3LEVL 3O3EB 4KHXH 1OAZH 1MH5B 1KB9J 3U36A 1UXSB 1QSFE 1YN6A 2MHAB 1OARL 3OKLA 4XPGH 4JO3L 2YD6A 3SDAB 2R2HB 1ZHBA 2AK4A 4QRSB 1WBZA 4KRPB 5D1XA 5DR5H 4RGNE 2ESVD 1WT5C 4HIXL 4PJHB 3KS0J 4H5SB 1KJ2L 1S8DB 4ODVL 4OTXH 3FB8B 3S37H 4RA0C 1Z2KA 1PDKA 5IW1A 4NOBA 4ONHA 3MYZA 1T3FA 4Y4KA 1LEIB 5DFWH 1FN4A 4PY8I 1ZHLB 5I71B 3MLTA 4X5LA 1LD9B 4NQDE 3BGMA 3AAZA 2FNBA 2ZOKB 3H9HA 5DLMH 2CUHA 2C3VB 4QOKB 1RK1B 3KPNA 2DJSA 3CNKA 1K4DB 3IXAA 1F4WH 5D4QA 5LGJB 2OJEB 4HFUL 5AZ2H 4JHAL 1FZOB 4OZIF 2MPAH 5IESH 2HT4C 2ZNXA 2GKIA 5HHOB 3C08L 3LN4B 1IGCL 4GOSA 4KK8C 2AV1B 2B1HL 5DHYB 3STLB 4C56D 2OI9C 4TUOA 5DHXB 3HE6A 3EO9L 1SMAA 3IFNL 1J0ZA 4YPJA 3RPIB 4HUWA 1Q94B 5TDOB 4MQSB 1QHOA 1U9KA 4JKKA 5I1HL 3PGCB 1KJ2A 1RQ5A 4NN7B 1AXTH 1EERB 1FIEA 2B7DT 4KK8D 2UZYB 2HJKB 4YWGH 5I8OH 4TOYL 3BUYA 1QR1A 1IE5A 3TWCH 5EWIH 2VL5B 4M3JA 1NGXA 3U6RA 2G5BB 4WO4A 1EGJA 3FB5A 2D31B 2CRYA 2D7MA 1QQDA 2PXYA 2ZSWB 3HUJA 5MP6L 1KB5H 3Q0HA 5F7HA 2A9NH 2H6PB 3RVWC 5F7EL 3QRGL 5BW7A 4J12A 4WI9A 4G80A 1UXWB 4M61B 5F8QC 5FOBA 1LK3L 3WIHL 3BW9A 4M7LH 4UDUA 2PYEA 3O6FA 3VFPB 4EBQH 3K4AA 3QDME 3L5XH 2VYRE 3HE7A 3MNWA 1UZ6F 5JPNA 4M7KH 5C3TA 1MJJA 5CHNA 1HHIB 4YBLB 1MHEA 2V2WA 2BJMH 2ZCHH 3BXNB 2KH2B 3FB6B 3C87A 3RVWD 1MOEA 3L3KA 1KN2L 3VH8A 4S1RH 5FYKU 2YK1L 1OAUL 4CADB 1OOAA 1PLGH 3VFRB 2XPGB 2CLZB 3RL1B 3H9SD 5DRWB 4ZS6C 4Z0BH 3SKMB 3WNMA 2WP3O 3HRZA 3DYPA 3VFGH 3EDFA 2G5RA 4WW2B 4YUEH 3ME0A 5EORL 3EOTH 4X98A 1RZKC 1LDSA 5EBWB 1F90H 5HYSB 3LQZB 3QIBC 2PO6C 5DD5H 1F02I 4K3EH 1SM3L 4XWGH 3MRBB 1QZ1A 2HKFL 3GK8L 4N8VG 4ZS6D 4G6FD 2VISA 2FL5A 2JELL 1FYTE 4JFYA 5GGSY 2XZAH 1NUGA 3M1BB 1PKQE 3LHPL 3TO4A 2BERA 4LLWA 1D5IH 4ZFOL 4S1SH 4K8RH 3SDDB 2IPKA 3OF6D 3VG0L 1MFAH 3TJEL 5KSAB 1CXHA 3SE9H 5GGSA 3BSZL 3GMOB 2IPTH 2D7TH 1BZQK 1YDPA 5EFIA 2LVEA 3MRKA 1AC6A 1DEDA 4YHYB 4WENB 1PFCA 1AE6H 1EFXB 3HCVB 1S9VA 3I50H 3IF1A 3S36L 4U6HB 5A2LH 5FIEA 2CKBB 3PABB 3RWDA 2P8PA 3TYGL 3KLAB 1KC5L 4NO3A 5ICXB 2X7LB 5IFAH 5DFTA 1FBIH 2VR4A 4DOHE 5CZVL 5GSRB 2VQ1A 3GMQB 5H94A 5C0CB 3BDYL 5IKCA 3UJJL 4LSTH 3I9GH 4P9HH 2EDRA 3O81A 4LHUB 4WWID 4APQC 1MELA 2AABL 4KKCC 4FP8H 3PWUA 3DTXB 3QXUA 3K8LA 4UMGA 3SOBH 1G0XA 1NJ9A 4O9HH 2AS5M 3FL7A 3LS5H 4G3YL 1MQ8A 4CMHC 4F15C 4FRWA 2PW2A 4U1HA 3DPBA 1UQSB 4KTYA 4QGYA 1QNZL 4JZJC 5FF6B 1L7IH 5FGCB 3NACH 4KKCD 2WUCH 4F7CA 2Q7YA 4MD0A 5HVWA 3V4UL 3CXHK 3RUGF 1ROWA 1H9VA 3O9WA 5FYLL 3LZFL 3HC0B 3JUYA 3O11A 4MJ6B 5CS7A 3MXWL 1SY6L 2WWKO 4IEFB 7CGTA 2XNAA 3PP4L 5GIRB 2GT9B 5JOPE 4NIKB 2A6KA 4IRJD 3LKSB 5KANG 5B22A 4OZIE 3Q6FA 1QLFA 3CFDA 4YFDB 4B53A 1NANI 2GJ6A 4NKMB 2W38A 4LGPB 2UYLA 4HWEH 3G6DL 3ZKQD 2WLYA 1J0YA 2VXQH 5SX5K 1LO2L 2VKXA 1B0WA 5KVGH 4WFFE 1A7OL 4X4ZA 2QR0A 4GSDH 1JNHA 1MHHB 3GIVA 1OSPH 1KIQA 4ZUSB 1TETH 1GIGL 4DZ8B 4ZDHB 5DQDH 3QDJD 5BVJA 1VFMA 4U1MA 4G6MH 5L8KB 4K3DH 1RU9L 5HDBF 3BGFB 4PJ8A 3WS6A 2Q3AA 4JY4A 2YXFA 32C2B 4CDHA 3TNMA 1JZ5A 5I73B 5IM7B 3BZ4B 3MODL 4NUJA 3KNBB 1P7HL 4TTGA 2Y23A 1A6VL 4GG8B 3BT2H 3LMJL 5BZWA 1WWBX 1FLRL 25C8H 3IGAB 2BNRB 4RAVA 2ADFL 4JN2A 3DOSA 1A3RH 5GGRY 4X9HA 1V7MH 4PJCA 2VLJE 3I6LE 3CFKB 5KS9E 1YMHB 4R3SA 1JNNL 1U8PA 3GMLA 4Z5RA 1UZ6E 4OBRA 3TGXA 1X9QA 4Y4FC 1N6UA 2GSIB 5HYJD 3AC0A 3NN8B 2JB6A 3KYKL 1F3DH 2XKSA 2EEBA 3PWPA 5BZDB 4OUUB 5GGRA 3U30B 2CKBH 4A6YL 2FB4H 3DXAD 2VC2H 2BOCB 2JJVA 4MXWH 1BVZA 1FYHB 2BOBA 5T1LD 3ZYJA 1BWWA 4HX1B 4OFYA 3C5ZD 5IJKC 4RGNB 3BAEH 4Y4FD 4RFOH 1AO7E 2DQIL 1CFSA 5C0EB 5KVDL 3RGVA 4PV9A 4MQTB 4TN9A 3VFVA 5M94B 3JTSA 3QPXL 3ULVC 5FECA 4JM4H 1OTUC 4NO0B 1ITCA 4OZGA 4NQDB 1PKOA 1P7KA 4DVBA 3QJHA 4MA1C 4XC1H 1N5YH 1I9JH 3ARYA 1IJ9A 4JGMA 1AP2A 5BS0B 1ACYL 5IJVB 1PG7W 4L4TE 5JR1H 1BQSA 3SKJL 4P2RA 4Z8FH 1NCDL 1EIBA 5DUML 4R4FL 5HVHB 4LPXA 2VH5H 4H1LB 1OTUD 1I1RA 4WWKC 1W0VA 4QF1A 3S97C 2W0LA 4Y88A 3P4MA 5CEYA 3U7AA 5TE6H 4M1GL 3HLAB 1MVUB 1TZGL 4DKFL 3GSQA 3F58H 2Y1VA 3SDXF 4P2QD 2W65A 2R1WB 5IBUB 4AIZA 4XPGL 3FO9B 3IFPB 4FFWC 2DKUA 4LLQB 3OB0K 3T2NH 5ISZE 2LU3A 4TUKH 5D1XC 1JPTL 2D7PA 4HPOH 1J1OH 1S7VB 3GSXA 3GMMA 5F88A 1F3RB 3G08B 2FYYA 2Z9TA 5I1JL 4AEIH 1WBYB 3GSWB 4MHHG 3U2SA 4KRNA 2XA8H 5FYJL 4FFWD 1AKJA 1FFPB 5J8OA 5JMOC 2AK4D 2BY2A 4Y4KC 1EJ6A 3DYOA 4W6WB 1D3CA 3PNWA 3UTTB 5AD0B 2HH0L 5JOEA 1VEPA 4YDKH 3FQUA 5IIEB 3HS0B 1JMXA 3JWDH 4PRPA 2I60H 1CDBA 1U41A 3GGWB 3MRNA 2VR5A 4KUCD 1F4WL 1H3VA 4JPIA 4Y4KD 3U4EB 5C7XH 2OTWA 2VLLB 4ODWB 4PJAF 1JGVH 5EOCH 3TA3B 5F96H 4HFWB 4KHTL 2VITA 1WICA 3HE6C 3QB7C 4R26H 4FS0A 4U05A 4IMLB 4N8CL 2GJJA 5IVXF 5J06A 5JOFA 4RGOL 3OXRB 4LMQE 1P4BH 2B20A 3DMMD 4MAYA 1YEGH 1AXTL 2NY1B 4F3FB 4BYHA 5HGHB 3SDYH 1M6OA 5LXGL 3WN5A 5IT2H 4KJPC 4YWGL 5I8OL 2Y9RT 1FO0A 2R0KH 4TVPH 2QSQA 3HE6D 1WIPA 1AC0A 3RVTC 1JFQH 2HFEB 5BRZE 5CJOH 1I3VA 1KJ3L 4XCNA 3WO4C 5TFSH 3G6AB 3KPQA 5D7IA 3OGCB 3ZYZA 3ARDB 3RY6A 3IU4H 3V7AG 2ZWLT 2BVPB 4KJPD 1HH6A 1XIWD 2PXYC 5SX5H 1KB5L 2EECA 3RVTD 3SJVA 2A9NL 2DQDH 1XF2A 4O51B 1T7YA 5BW7C 1KOAA 3QUZD 1VFAB 4M7LL 3O6FC 3JSSA 3VXMA 5CGYC 1HKFA 5DJAB 5HGBB 5KSBA 4FTVE 3C5JB 4KI5C 4E0RA 2BDNH 4WJ5B 2PXYD 3G5YB 4QRQA 4ESKA 5I8EA 3SBWA 4RMSA 3NCFB 1QD0A 1FIGH 4OUOA 5B39G 1T5WB 1UYWL 2VJXA 2PYED 2P5EE 4RIRA 5CGYD 5FGSA 5KVEL 2Q1EA 1PLGL 1D5BA 5GGUB 4KI5D 4EI5D 4UIMB 2QQNH 3ULSA 3RVUD 2J8OA 4UINL 2L7UA 1AR2A 5EPMB 2R15A 1ZA6A 4LFHG 3TESA 4HKJA 4PJHF 4QEGA 2O61B 4XWGL 1J9CT 2Y06H 3D39D 4ELME 2A74A 2CPCA 4WFHD 4MSWB 4UIKH 2EYSB 2VXUH 5SWZA 1KCRL 3TO4C 1FL6A 1HYRC 2FEDC 5HY9B 4FQQB 2Y36L 1LEKB 1V7NH 4PB9H 3L5WB 3O4LD 4PJEA 4Q97A 4S1SL 3QXDA 4GKSB 3LKNB 3S34H 3PXHA 4WI4A 3R0MA 5HGDA 3L3DA 3VWKD 5L9DH 2D7TL 4JGUA 3TO4D 2FEDD 1RJLB 1LO0H 4Q0XH 2QADB 3KXFA 2R8SL 1LWRA 4KKAC 4M1DH 1CFNB 4WIQA 3BH8A 3FRPG 1NAMH 1AE6L 2BZDA 2Y7QA 4I5BA 1UJ3B 4DK3A 43CAA 1NMCC 3QG7H 5D70H 5D5MA 1A4KB 4KMLB 1F45A 3E8UL 4ONOA 4HKXB 3MOQA 1VGKA 3FQXB 4L3EB 4RBPH 2ATKB 3MFFA 3F8UB 2YN5A 4JZOB 4LAQH 3GMRB 4LVNB 2WQ8A 4N9GB 5JNYB 2X5PA 4LSTL 1C08B 4P9HL 4U1IB 5T1DH 2J1KA 3T0XA 4HZLB 3EBAA 4X8JA 5FA4B 5F89A 1P84J 2BRRH 5FYKD 4FP8L 5DRNB 4Q9BA 4I9WE 3FO0H 4W4OA 2NYYC 1R3HB 3GJEB 3GBNL 4KZEH 2JB5H 1ACZA 2E7MA 4R96B 1KIPA 1AXSA 1NFDF 3KPLA 3KR3L 4DGIL 3NACL 1H3UA 4XP4H 3GJFA 1RIHL 1JNLL 3QO1A 2DMCA 3U46B 1YEJH 4GMTL 3O9WC 2NYYD 1JWMB 4X99A 1LNUA 2EDYA 3QIWB 1CDGA 4PLNC 3D0LA 4WHYG 5C3LD 1QR4A 2R69L 4LPWA 4OFPA 1EEZB 3ARFB 3ZZ1A 5EBGA 1CR9H 4RRPA 3B6SB 4X6CA 2DQCH 5DVKA 3VD5A 3EHBD 5T33H 1I1YA 3O9WD 4PJAE 2YD5A 4JPVH 4P49A 4WW2F 2D0FA 4HWEL 3L3HB 1EMTH 3TV3H 1OF2B 1YEFH 1QOKA 2XICA 3QQ3B 3WL9B 4DCQB 5IVXE 1P4LA 1F8TH 1M7DB 3STBA 2FZ3A 5TF1H 1URLA 1E6JL 3GNML 1OSPL 1A7PL 1HQRA 3WFDH 1TETL 1T4KA 2GJ6D 4U1GC 1JJUA 1Q9KA 1KIRA 1T6VN 4G6ML 1Z5LA 4K3DL 4YDLC 1YMMA 4X6DA 2EH8H 4EUPG 3MX0A 4PJ8C 5IB5A 3WS6C 2ZCKH 3MV9D 4UI2A 2Z8RA 4WU5A 2ICWB 4NDMA 4NZUH 4ZTPH 3FT4B 3T77B 2IBZY 5F3HB 1BM3H 5HBBA 5CD3A 1P1ZA 4AQ1B 5DMKB 1QO3A 1A1OA 3C6LA 25C8L 1ZTXH 4Y7MA 2DTSA 4HK3N 2EH7L 5F6IC 3DX8B 5IVNA 4L4VE 3BRFA 5ESQB 4NRYA 1A3RL 2AXFB 2F5BH 3QFDA 5I2IB 5ITFA 4HK0B 4LDLB 3DRQA 1ZSDA 2CDEA 1HHGA 1RFDH 5DJXB 2CLVA 4XNYH 4KMTL 3G6JB 1OAKH 1DN2A 4I2XB 5JXAH 1U3ZA 4KVNH 4JQXA 5BXFB 1C1EL 1WTGT 4MXWL 4ODXB 3ARGB 1XFPA 4NNYA 5GISH 4ZUUA 4C4KT 3BAEL 3WUWA 3GFUA 3HPLA 5JORB 4ETQB 2EE2A 5DK2A 3PWPD 4Y5XB 1B4RA 4HC1L 3RGVC 3JWNC 4DFHA 3HZVB 3PV6B 1YPZE 1R5VA 5EU3B 1HILB 2WQRA 3FN3A 3RDTB 4OCXH 3VXPB 2NW3B 4LCIH 4OFYD 2EDKA 3UC0L 2YZ1A 2DKMA 3T8XA 5I17B 1N5YL 1F6AA 4L9LA 1W72L 4XNMA 3N9GH 3RGVD 2X70A 3OKMA 4QHLB 2WW8A 1IQDB 4Z8FL 3FT3B 3TCLB 2VH5L 2PCPB 4P3DB 4DN3H 1T22B 2VUOA 5CD5C 3L3GA 5C0NC 5HPOA 3MBEB 4PP2B 3GO1H 1T66C 1RUKL 5TE6L 1NC2B 2E9IA 2FWOB 5EU4A 1Z0NA 3QEQB 2BSSB 3RBSA 1HXMB 4V2BA 1RZ8B 4NQCA 3PWJB 5I66A 1GGYA 4P2RD 1BREA 1K8DB 3F58L 3B3IB 4PGCB 5CD5D 5HD8C 5IMLB 4P2OA 3NCBB 4L8SA 2E7CA 1R3JA 5CKAA 2YPVH 4QTHA 1U92B 1QSEB 3KJ6H 5GRXG 4XNQB 3T0DA 1J1OL 6CGTA 2DM7A 5DRZA 4RX4A 4J8RB 2X4RB 5HD8D 1VPOL 1W72A 1IM3B 1YEHH 2XIDA 3V5KB 2AEPL 3EYFA 1S7SB 2XA8L 4Z78A 4WEBH 1ZVSB 4FQLH 3ZHDA 2P1YA 3TLRA 3UP1A 2HRPL 1J5OL 3A67H 1UEMA 5LJYH 1IZJA 4OIIH 4PB0L 3D25A 1MHPL 3X3GH 4AEHL 1A9EA 2Q6WA 5C07E 4FTVB 3KWWA 3FFCA 4WFGE 3JWDL 5F44A 2I60L 3CFBB 4LKCB 3DVFA 1RMFL 5EIIA 1GZPB 5IMOB 2A6IA 4ORGA 5DD0H 3FO1A 4NPYA 4HS6B 1NFDE 4ONGH 3L3JA 1JGVL 2WNGA 5EOCL 1MCCA 4HBCH 3RWJB 4XX1E 2CIIA 3DECA 4PRPD 1LO4H 4MDIA 2R2EB 3FQRB 1CXEA 1AD0B 1C5BH 2D7QA 4IOSD 1WZ1H 2Z91B 3BIKB 2DQEL 1P4BL 3I2CL 2NY7H 4MAYC 3T3PF 3U0PA 3V2AR 3SDYL 1TVBA 1EO7A 3WN5C 3MSPA 4FQ2H 1CDYA 3MMEA 4OIAA 3O8XA 4G8GB 3SE3A 5CEZE 4QRUB 4F7TB 3FKUS 4AH2B 2A83B 2XN9A 5D2LB 4ELMB 2JIXB 4JFOB 2P5WA 5J6HA 3WFEH 5TFSL 3FTGA 4FQXA 3IAPA 1BVLA 3X12A 3VDAA 3V4VH 3EYSH 4R2GD 3IU4L 3RY6C 1W0WB 3T3MF 1N8ZA 7FABH 3E3QE 4J3UA 2PTVA 4PJGE 2W9DL 1WV7T 2DQDL 2RFXA 4MNQB 4D8PB 4FABH 1OY3B 4N0UA 1EEYA 5JW5B 1J05A 5L2KB 1A7QL 3OAYH 2UZIH 3OBAA 1NGYB 1OWWA 1S7UA 2BDNL 1OGTA 1QKZH 4MMZC 3SJVD 4JREB 1B90A 4R4BA 3SBWC 2VMFA 1CXKA 1NDGA 2X05A 3UYRH 3VXMD 1MFBH 4KZDL 1I9IH 5DVLA 4MXVF 3BZFA 2V7HA 2QQNL 1Y6MR 5F9OH 4NOFA 5EIQA 3GMPA 2EC8A 4NBZB 1MRDH 5I18L 4JDTL 3R8BB 1IM9D 3BP7B 3BQUD 3RFZC 1G7LA 5F9JA 4LRIA 1J0KA 1UB5B 4CL7A 2Y06L 2EDOA 4W70A 5I1IH 2F53B 2CLRA 2VZUA 1SYVA 2VXUL 4OCMC 4ZO7A 1V7NL 3FOLB 3S8WA 3QXWA 4RDQG 2W9EL 1F3JA 3LN5A 2EICA 3LPFA 3N1QC 1PX4A 3MYJA 3S34L 1S9YB 3TBSB 3DI3B 4OI9A 1ZXQA 4Z7VB 3JUZA 4R97B 5SWZD 5EUOB 2VLKA 3S5LG 5E00A 3B9KB 2J8HA 4OZFG 3HMWH 1NAML 1MCHA 5T1LB 3W9DB 5CBAA 5TDPA 4X7TB 3VXSE 3S9DB 4GAGL 1PVHA 3B5TA 4RQQB 2HKHL 3PHOB 2R1YB 1AY1L 3RIAF 2XXMB 3L7FA 4P9ML 4JANB 3WKMH 3AREB 1DQMH 4HAGA 2X41A 3T09A 3G5ZA 4N8VB 1MCWM 4OCSH 1NCCL 4RMTA 5T1DL 3GSOB 3CMOH 1L9MA 5TPWL 3OX8A 4MX7B 1DLHA 2V7NA 4ZS7H 4MAUH 3OHXB 2BRRL 3TIDB 4GG6A 4YR6B 4K23H 3FO0L 2NX5E 2IH1B 2A6DB 4W4OC 1AGBB 4MNGA 4M43L 5GJSH 1PG7H 4GAJH 2JB5L 1BMGA 5INDB 2JJWA 4YHNB 1I8MB 2VDMH 4XP4L 3W9EA 3KLHC 1A9BA 2VL4A 2YSSA 3NIGF 2R4SL 4MA7L 1S9KC 1YEJL 2OR8A 2A9ML 3QULB 2YPLB 3SHSA 4GUPA 3JWOC 3QDGA 2Q8AH 4D0DA 4Q6IB 4JFDD 35C8H 1AQDA 4WU7A 4HGWB 2CDGB 5CMAB 2DS4A 3RWHB 1JF1A 5T33L 4I0PD 4NQEE 2MTPA 3IKCB 3QIUA 4AK1A 2P48B 2EE9A 3R06A 4QRPA 5F7NC 4NKQB 3BKJH 3MJ9H 3VW3H 1EMTL 3TV3L 1FYTA 2XTJB 1YEFL 1MCOH 5J9PB 4X8XA 1F8TL 1PKQA 1GAFH 2W0PA 2UUDK 1IAKA 4HIHA 3WFDL 5DT1H 5JLZB 3CSBA 3JV4B 1AGFB 2KZ1B 2WINA 2X4NB 3EIFA 2IANE 4M1CC 2O5XH 5IB4B 2ENYA 2X4TA 4RAHA 2W0FA 3RWFB 1TQCB 3S36X 2MMXA 4FQIH 1BM3L 2F54E 4PJXA 4M1CD 1VEMA 1ZTXL 3C6LC 3L3OA 5A40E 3G9AB 4KJQC 3D87B 4NHUA 1N6QL 1YMMD 3EFDH 4IDJH 3ULUC 2Q76B 4BFIB 3DMMB 3UCRA 5TDNA 3DUHA 5M95B 2FJFA 2BNQB 1CGTA 1D5ZB 2FEEI 4OQTA 3C6LD 3D1MC 3RZCA 1UWXK 3SDCA 3ULUD 3GKZA 1DBBL 3HKFA 2AI0H 2N7AA 1YEEL 2BSED 3OKYA 4PY7B 4LNVA 2E8ZA 4Y5YB 3B9VA 2V5YA 4JQXC 4LCUA 4PGBB 3BO8B 4LVHC 2IMMA 3C8DA 2B5IB 3KPPB 4MXVE 3VJ6A 4YE4H 3PUCA 4GRMB 5D2NE 3QCVH 5IHLB 3B9AA 5J89A 3SGEI 2Y5TB 3OR7A 4HUXA 4LEOB 3UO1H 3QUZB 1Q1JL 4YHZL 1VFUA 2D0HA 3VU2A 3BPLB 4UBDC 4LCWB 1ITBB 5DF0A 4JKMA 4CDGC 3QA3A 4KDTA 2ARJQ 4KJYA 1A7NH 2R2BA 1YJDL 2AXGA 1KEGH 3BN9C 3O45A 5L2JB 3MREA 4DUXA 3CU1A 1A6ZA 3TYFA 1KSRA 2H2PC 4L9LC 4M00A 4YHIB 1XGUB 1N0XL 4PGDB 2LV4A 3MCLH 2O5YL 3CVIH 3BN9D 3FFDA 4PFEA 5I9QB 1IMHC 1KPUA 2H2PD 4G8EA 3T0WA 1P6FA 2A73A 3UTSA 1CICB 3VFMB 4J3TA 3PL6A 1U58B 1BPVA 4Y1AA 1MCKA 1JZ4A 4OD3H 4ONFH 4L8SC 3VD9A 2R39A 2R0WL 2YPVL 1D9KB 1D6EA 1I9RH 2XZZA 5C09B 5JO5B 2MNUA 1FG2A 2ICWI 3LPWA 3T0EA 2FLRT 1RD6A 4NQCD 3WXVL 3K0WA 4IOIA 5C08D 4OV5B 3EDJA 3CSYA 4K2UL 3UX9B 1S7QA 3QUYA 2UWEB 4GO6B 1YEHL 3WE6A 3BP4B 3MJ6A 4TUJA 4XMLH 3BD5A 3VWKB 2E9WA 4WEBL 4O2FA 3HRPA 2HTKC 1CXIA 3H7BA 4PJ5E 3A67L 3LEYL 3V8CA 1MI5B 3GSNL 3TBVB 3KYOA 1F13A 2G9HA 5E9DB 5SWSB 4ZSOB 1P53A 1KJMA 5EC2B 3RY5A 1Y0LB 3C09B 4KJWC 2V2TB 4AT6B 5C2BL 2F5AL 3UJIH 5DJ8A 4NSKA 4WCYL 1K85A 4U6YA 5DD0L 5FO9B 4LPTA 4H0HB 4LPYA 2ERJC 3H6JA 4OCWL 4XC3H 4HBQA 4YK4B 4HBCL 1XGTA 2ZUVA 2IADA 3TBWA 1RJYA 3U79A 5IGXL 1U8JA 2GAZB 3EZJB 4OB5H 5I74B 1LO4L 3RP1A 3G6JF 3B5HA 5IOPA 4F7PB 1GHFH 1DQJB 3JV5A 1AO7A 3P4OA 1IFHL 1BIIA 3GSVB 4UAOB 1CF8L 1A8JH 3T1FB 1CT8A 4K94C 2HYMA 3PV7A 2E7LA 4FQ2L 3OJDB 4FXKA 1OB1A 4HSQA 4H25A 3O8XC 1P7QA 4DEPB 2VDQH 3LEXB 5ETUB 1CGXA 3SE3C 1FL3A 3GSNA 1G6VK 1I9EA 4GBXA 3WHXB 5GJTL 3NCJH 4FQXC 5DI8A 3ECBB 3TZVB 2FR4B 3V4VL 5CLWA 5HHPA 3ZE1F 4I3SH 3MV7E 3IS0X 2NQCA 2VLMD 1BD2B 2AKRA 4P2YA 1MCRA 1KYOK 2XN9D 3BDBA 2PTUA 5I1LA 4LF3A 2P5WD 5EO9B 1JPSL 3CVHB 4FQXD 1X7QB 5ALBH 1K5NA 1FZKB 3X11B 1U8HA 3AB0B 4AZ8A 4S10A 4PRDB 2PYFA 1YEKH 1EHLH 1BJ8A 1KJVA 1Q72L 5CJXA 2APWA 3LS4L 3KPSE 2VXTH 3GBLA 5B38G 1MFEH 1J88A 3M8OL 1CG9B 4N90E 4JRYA 5DEGB 4ODTH 5T3XE 4AM0B 4MLSA 3E1F1 1MHCB 4YDJB 2VDKH 4ZAKB 4UTAL 1HSAB 2LU7A 4HXAH 4TSCH 5MERA 1VCAA 2R4RH 5GHWH 1T04A 3DV6B 3MLZH 3WFHB 1MRDL 1MF2L 5E8NB 1ZLWH 4OV6F 3MR9A 3CIQA 3EGSB 4MJ4A 1MCBA 4LRIC 4Z77A 5K33A 3WLBA 1V5JA 3K1KC 4NJ9H 5DURD 2BNUB 1FFQA 3P0VL 4WUUB 2XFXB 5HYFA 4RAUA 4RMRA 1S5IH 3TBYA 2QKIB 3CH1B 5BJTA 4Z7UE 1NGPH 1T7VA 2ARJA 4U0RB 3VD7A 2OL3B 5FGBA 2YD2A 2ZOLA 1VFBA 2CJUL 1T2QL 5DTFB 1A5FH 3RUGA 1UFUA 3QEHA 4PJ7B 1QRNB 3F7YA 2ZUYA 4ZOBA 3VMOA 5B39B 2PF6A 4BFEA 3K4DA 3PP3K 2ZNWA 1W0YT 3CPLB 2CRMA 5LQBH 3UTOA 2ADJA 5E2TL 4BFGA 4E41D 3HMWL 4RGMB 3TN0D 5EC1B 3G5VB 1U6AH 1V3LA 3H3BC 4GH7B 3AU1A 3WUZA 5ENWB 1RUPL 5BRZA 4PGEA 4OD2B 2VLKD 4L8CB 3QI9D 5KVMC 2UV3A 3WKML 3RJQB 2BCKA 1DQML 2ESVE 2WBJA 2C1OA 2P43B 3AXLA 1UCBL 4HIJA 5MENA 1T0MB 5D2LF 1T03H 1KENH 4RZCB 2VB5A 1GGCH 4XBGB 3CMOL 4GW1A 4A2LA 4I4WB 1JGLL 3D3VA 1NAKH 2QJDA 1D6VL 4ZS7L 2H32A 1ZK9A 1VADA 4QKXB 2L0DA 1N3NA 3MOBL 5C0BA 3X13A 4O58L 4B7LA 4K23L 4NC0B 1DE4A 2J6EL 3MV8D 2HG5A 4A2MA 5DRXA 1FNEA 2ILLA 3FB7B 5DD6A 4OLEA 5GJSL 5IFHL 3MRJA 4RMWA 3BEWB 4AJ0A 2CO6B 2OK0H 5CIPB 4LLYA 3DUSA 3QWOA 3ZDXE 3FQWA 3DX9A 4P48A 3CVHH 4C56E 3DGGB 3TPUA 5ERWA 1NBVL 4U1JB 1F4XH 5KZCB 4ODBD 3WFCL 2DQJH 4G8IB 1LHZA 3DVGB 2GTZA 4UT9L 35C8L 2YD4A 3DVNB 3EDKA 5EZLA 3HPJB 4CN1A 5B3JF 3ZT6A 4UT6H 4PBXA 1G9ML 5HGAB 1OQOA 3HC3H 3QIUC 1X5IA 3C60A 1CVRA 1RUAH 5C92A 3BKJL 3VW3L 4PRHB 4PR5A 4BKLB 1MCOL 1Z3GL 3P4NB 2BFVH 2EE6A 4ZPTA 1JRHH 1CDJA 1G9NC 1GAFL 5IHZB 5J7CC 2WM0A 5DT1L 5A16A 3QIUD 2I9LA 4JY6B 3OXSB 3TC9A 3U9UA 3TFKC 4QRPD 4ODUB 2GK0A 3CXDH 4EQ2A 2HFFA 1FH5H 3NZ8A 1A6WL 5JMRA 3GI8H 4E5XA 1CWVA 1ETZA 2B2XH 4KDVA 5K59F 3UBXG 4P2CG 4HG4J 2B4CH 1RHHB 3FHQA 2OL3H 4Z7VF 3EFDL 3TPKA 5EOQL 4IDJL 5EUOF 3K1DA 2BMKB 3ARXA 2WIMA 5CWSA 4Z0XB 2ICES 1KCVH 4NQTA 3MTRA 1KPVA 2FX8L 4QT5B 4NWUL 3H9SE 3MLWH 1KXQE 3RZCC 2DMBA 4XPAL 3SDCC 1ORSB 3SDXA 1RZ7H 4PGZA 5F7YC 4X5WA 1ZLVH 15C8L 4WY7L 3BVNB 4QRTB 1RZFL 5CP7A 5H35B 4M9OA 3QCVL 2X2YA 1OAYH 4EUPB 1HXYA 5HVGB 3C2AH 4ZPVB 2DIJA 1NMAH 4LIQH 2V17L 2DN7A 3BPOC 4KDTC 1I3UA 3MGTA 3JV6A 3BI9X 1PYWB 3QUXA 1MCQA 4EXKA 2K9UA 1TZIB 4YFEA 4OLVL 4S1QL 1GPOH 1NCNA 5H2BA 1QEWA 4FZEH 5DUBA 1QBAA 2HLAB 3RZWA 4MDJA 4JE4B 1XGPA 2DTMH 2HA1A 4UT7L 3QAZB 5D1QB 4NFBA 2IBZX 4L3CB 1RZIB 4M6MH 2BK8A 4PRNA 1A2YB 1ND0A 4PJAA 3MCKB 4Q9QH 5C6PB 4B41A 4JJ5A 3SGDI 1K8IA 1ZS8A 5CINL 1IM9B 3I84A 3BQUB 3ZTJG 3BKCL 3UPAA 1YQVH 3PL6C 2YUZA 5D7KE 5IVXA 4KXZH 1U8IB 1T0NB 1FSKC 1NMBH 4QRRA 3FN9A 3WNLA 5JDSB 5SWQB 4X9FA 4ONFL 2ATPB 3WSQH 1Z0MA 1CE6A 3T0EC 1P6AB 1YJDC 4PRBB 4U3HA 4X7DC 3UTSD 3S88L 2IAMB 3PL6D 3KPRB 3C8KA 4Y1AD 1I7ZA 1OAXH 5E4EC 2DICA 3F7VB 3QUYC 2DQUL 4KFZC 3TH2T 4UNTA 4WEUD 1DN0A 4L29B 3T0ED 5KANI 5EIVA 1F2QA 4HXBL 4L4VA 3EW3B 4KUZL 4G9FD 4KY1L 3NTCH 1R3LB 3T2PA 3QH3B 3VFSA 4XBPB 3VGAC 4NT6A 4HAFA 5FKAB 2P24B 4P4KA 3UJIL 1JZ8A 4NM8L 1GC1L 3U9PH 2NLJA 5HHXL 1R0AL 2ZUQC 2V6HA 2CK2A 2VLRA 4TVSa 1X5HA 2FGZA 1LEGA 4WGWB 2GCYB 4WHYH 3IDNB 3PGDA 4XC3L 1X44A 1CGVA 2AJ3A 3HNTH 4OB5L 2RR3A 1FQ9C 4D94A 2WIIB 3T1WA 1GHFL 2X9XA 2CR3A 2MHAA 2YC1A 3DSFH 3VA2C 2LVCA 1MCFA 2XWTB 2Z4QB 3SDAA 1TPXC 1CI5A 4X9GA 3AMKA 4QRSA 12E8H 4I77H 4LLMB 2E7LC 4X9IA 5E94B 3QDJE 1IC5H 4K71B 4UV7H 3REWB 4PJHA 2VDQL 4JAMB 4H5SA 4NJAH 1KFAL 1S8DA 3FB8A 5IVZB 5IHBA 4GBXC 3NCJL 4EUPH 4IHOB 4PJIB 1XZ0B 3GSRB 3VFNB 4EDWH 1DQTA 4WHDA 1IARB 4YHKH 1ZHLA 2JCCB 5AEAA 1LD9A 1CK0L 4I3SL 1P7QD 4LNRB 2ZOKA 4MGXA 3BP5B 1OPGH 5BVPH 1NBQA 4LQ1A 4GBXD 1T89A 2FJGA 4JPKL 1HQ4B 1K4DA 5DFVC 4XAWH 1WUNT 5F9WB 4K7PL 4BSWB 5LGJA 2OJEA 5JW3H 1FZOA 3EO0A 1YEKL 4YZFF 5E5MB 1KGCE 5C0DB 4G7YH 1UWGH 1X5FA 1Y18B 5CJXC 5HHOA 4AYFA 2ED8A 1ZGLP 1KN4L 2VXTL 4IM8A 5DHYA 3STLA 1MFEL 3PWVB 5K59E 4EKXA 3OAZH 4ODTL 5HYJE 3UZEA 4J3WA 5ID0B 1CLYL 5DFVD 5DVNA 4LP5A 4U6VH 4PJ9B 5TDOA 3DXAE 3PGCA 4NN5B 5T5NG 1UKSA 5ANMB 4KKBC 2L7JA 2BSRB 2R4RL 4K7PY 4XPFH 5FHAH 2HVKA 4NQVA 4JRYD 5C0RH 4LLUB 4M6NH 4HIEB 2VL5A 3IFLL 3D85D 1RULL 3P9WB 4MB4A 4KKBD 5CEZL 2G5BA 2D31A 3DV4B 4Z7WE 3L1OH 5IQ9B 3EOAA 3IJSA 2NY6B 3LQAL 4N9OB 4JFFB 1R3IL 3R4DA 4LSVL 3T04D 4M61A 2H3NA 1NGPL 3VFPA 5FGBC 4YDVB 3VXRE 4YXKH 1JGDB 1HHIA 3A6BL 1A5FL 1B4JH 5B4MC 1FNAA 2LU4A 5AWNL 2EO1A 4Z7QE 5BV7C 3ZDZE 1NC4D 1UM4H 3I02B 4PJDF 1VHPA 4PBVC 1HWHB 4I3GA 3OKDB 4CADA 3VFRA 3W0WE 1FGVL 4ZFGH 1JI1A 1XF1A 5MEOB 2XPGA 2ADIB 2CLZA 3LN9A 3RL1A 5DRWA 1G7JB 2OI9B 3S98A 3ARVA 5B4MD 3SKMA 3ZE2E 2LTQC 1MCPH 4LSDA 1A1MA 3DARA 1T1ZA 3OMZA 4WW2A 1NSNH 1MJ8H 4XWOC 5EBWA 1X3DA 2WBJC 3LQZA 3ILPB 4N0YL 3MRBA 4CJ0A 3I3DA 3O3BB 2AK4E 1YECL 1NGZB 3F5WB 1AFVL 3M1BA 2XZQH 4JKPH 2WBJD 4HDIB 1S9XB 1DCLA 1MWAB 4NQSB 5EU7C 5MEND 3IS1X 2H9GB 3VFTB 5JQ6L 5E5UB 4XNZC 4XCFL 1ADQH 3D3VD 3V6FB 2OK0L 3S5LB 4GW5B 4EVNB 5B8CB 3GMOA 4OZFB 5C0BD 3QRFM 1NUDA 2DYPB 4JFEB 1F4XL 1EFXA 1FJ1B 3HCVA 4JB9H 1A6TB 5TF0A 2R56H 4R90L 2DQJL 4U6HA 1VGEH 4V1DD 1T20B 3QZWG 2CKBA 1A7BA 3PABA 1XR8B 3EJJX 4GMSH 4HCRL 5C0AD 1TTGA 3KLAA 4NNPL 4E42B 5ICXA 1D5XB 2X7LA 3DO3A 3HG1B 3CC5B 4CU8A 4WI6A 1CL7I 2W9LA 2FH8A 5GSRA 3GMQA 5C0CA 1F4YH 2VAJA 4BSVB 2C3GA 3C60C 1WBXB 1RUAL 5GS0H 1CLCA 1YEDB 4XVJH 2BFVL 4LHUA 5DQJB 1RY7B 4H0IA 4NC2B 3OZ9H 3RA7H 4FFZH 1JPFB 1VENA 3QIBB 4LL9A 5LAXB 1FV1B 3DTXA 5J13B 1UKTA 1T1WA 1R24A 3C60D 3CXDL 4P5TB 5D7JA 5A2KH 1UQSA 4XP1L 1ULVA 3QUMB 3VD4A 5FF6A 1G7IA 4LOUD 3O3DB 3RHWK 3PWLB 4D2NA 3LKQB 1ORQB 1SVZA 4RA3A 3HUJE 2OR7A 4HWZB 4NN6B 1X5KA 3NA9H 2LAAA 2IGFH 4HCRA 3HC0A 1G9MC 2PUQT 3QEUB 3QHZL 4PIRF 2IH3A 3I85A 1JHTA 1Q9OB 2PYEE 2R29H 1LE9B 5GIRA 2GT9A 4KI5E 3EOBB 2GYSA 1QFUL 5EU6B 5TQ2H 4KGJA 5T3ZD 4HLJA 3MLUL 4NKMA 4F2MB 1RZ7L 2ICEB 1B6DA 2AEWA 1AGCB 1NCTA 3MRDB 5CILH 2R0ZH 1WCBB 4OD1H 1MHHA 3W39B 4OT1H 4UQ3B 4ZUSA 4FQJH 3D39E 4RRPG 3EYQC 4DZ8A 4OGZA 4ZDHA 1OAYL 4WFHE 3TO2B 3ZKMC 2OCFD 3SQOL 3C2AL 2OTUB 2ITDB 1ZT4A 5C86A 3SE8H 1T5XB 2FCBA 1IC4L 1IGFH 4I18A 3BPCA 4APQB 3O4LE 3KYNB 3IB4A 4TYUA 3BZ4A 5IM7A 5TH2B 4DWHA 3QUXC 4DGVH 5M7QA 3CFIC 3EYQD 4QHMB 2YRLA 2HT3D 3FT2B 5FFLA 3ZKMD 1MWAH 5KN5B 3P77A 5I1KL 4OSUL 2ZUSA 4U6XA 3JVGA 3FCTB 4JRXB 3BUTA 3QUXD 3CFKA 4OZFH 5K9JH 3KGRA 4KRMB 4H8WL 5ID1B 1XH3B 4Q9QL 1WISA 2BC4B 4OCRL 4YGVB 1CLOH 5F70A 5IMMB 1BJ1H 1HIMH 2GSIA 3ARBB 1RV6X 1NEZG 4OUUA 4N5EC 3PWNB 4F9PA 2BOCA 4PJDE 5E08H 4P59H 4MNHB 4HX1A 4O00A 3WSQL 1PJ9A 2EXYD 2FO4A 1Y6NR 2CXGA 1ZHKB 2XZCH 3FO2B 1QTYT 5C0EA 4N5ED 2APXA 5JPMB 4QRRD 4D0CB 3T65B 1J8KA 5D1ZB 1RZKH 2EYRB 4LRNH 4NO0A 3RPKA 1H5BB 3V4PL 1N2RB 2F8OA 1Q9WA 1P4IH 4U33A 5JUEH 5IJVA 3B2VL 5IHUH 3CH8A 3DYMA 4LASL 4TSAH 4YDIL 4YIQA 4MCYB 2J8UB 4H1LA 3HMXH 2XKUA 4NKOB 3PHSA 3O0RL 4P4KC 4U1NB 4XP9L 3FRUB 1U8QB 3WMSA 2E5EA 3BX7C 4JDVA 1EO8L 2B8OT 1Z9OA 1MVUA 4OLZH 3QHTC 1KG0B 4XBEL 3THML 2R1WA 1IGML 2OBGA 5D2NA 4P4KD 4N0FB 2OTPA 3IFPA 4X83A 3SDAC 2VLRD 5DA4A 1MY7A 1M71A 12E8L 5IB1A 4XAKD 4JN1L 2GJ6E 1L6ZA 1OM3H 1JGUH 3AS3A 2DBLL 1U3HB 1MVFA 1E27B 5DA0B 3G08A 3ZE0F 4Z7WB 4NJAL 3MV9E 3BD3A 3GSWA 2EYTA 2VOTA 3SDAD 4HWBH 1JIBA 3HI1B 5I1DB 1FFPA 1NBYB 1JHLH 4KRPD 4K8RC 3CFCL 4XMKL 5C6TL 1GC1C 1DDHB 2EIZB 3UTTA 5F1NB 3VFOB 5DC0A 4LDOB 3LIZH 1JF5A 5IIEA 1OPGL 5BVPL 5FA3B 4QHNB 4LSRH 5EO1B 2XWBB 1T89C 3GGWA 3JZ7A 2EDBA 5JW3L 4K8RD 3U4EA 4L3AA 1TJIH 2VLLA 4I13B 3NFPB 3JTTB 4UILL 1BEYH 3QCTH 2DWDB 2MJWA 2VN4A 4G6JH 4HFWA 4X4YB 4QOKD 4WWKB 3W0WB 4HKZB 3V52H 4IMLA 4P57B 5T1MB 2Z0BA 4PJCE 2IFFH 3G5XB 4HQQL 3OXRA 1QLRB 3K46A 3V6BR 4UQ2B 4ZXBB 4NN7C 1DSFH 5K9KA 5HGHA 5HHOD 5CAYB 4XPFL 5HGGS 2C3XA 4OLYH 3U36B 2O5ZL 3BKML 1LDPL 4M6NL 3OKLB 3PWPE 1IBGL 1GYAA 3B4NA 4XCCL 1A4JB 1FVEA 1ZHBB 4LEXH 5J11B 4XVUD 3G6AA 3U0TB 2Z31A 2IQ9H 3OGCA 5D1XB 2X44D 4Y16D 3L1OL 2BVPA 1P5UA 1BIHA 3QXVA 3O2WH 4Y4HA 5GGTL 5EOTA 4XB8A 4LARL 4KTEH 4O51A 1CYGA 1VFAA 3QUKB 1P2CB 4OLUH 5I0ZA 3MLVH 5L8JB 4GLRH 4MZ3A 1DR9A 1A47A 5DJAA 4YXKL 4JKWA 5HGBA 3C5JA 4JFHD 5B38B 2CIKB 4YBLC 4WJ5A 1B4JL 3H9HB 3G5YA 4X80L 1WFTA 1HN1A 3MLRH 4X6BB 6FABH 4XNXH 4CNIB 1U8MA 3CD4A 2CQVA 4Y2DD 4NKDA 2BY3A 1UM4L 5CGMA 5LWYH 1UM5H 3HI5L 4HZAA 4JO2H 4P2RE 1RZJH 5SX4I 5IWLA 2M1KA 5GGUA 5T3XL 3CDCA 4UIMA 2GY7B 5ADPH 1MCPL 3OJVC 1BFOB 2VZSA 3L9RA 5EPMA 1NSNL 4P3WA 4WW2C 5DEFA 3CDYA 1KJ2B 1X5XA 3LQAC 4WTXA 3GHBH 4W6YB 5L8LB 3E3QC 2HRLA 4LSUL 1K6QH 4PJIF 3MGOB 2AV7A 4MSWA 4JR9L 5D7LB 4LHQB 2X4QA 4LCCB 3GRWH 2VQUA 5EO0B 4XMPH 2ITCB 2V5MA 4PRID 2JCCF 1SJEA 1VA9A 2ZPKH 1EA9C 4NZTH 5HY9A 3U6RB 1LEKA 4WO4B 3CX5J 2FEEL 4HUVB 3FB5B 4GKSA 5FUCC 1KIUA 1TVDA 3LKNA 4KV5E 3HAEH 2FIKB 5I1AB 1ADQL 5D93C 5DJ6A 4CAGA 3ULVH 1FFRA 2DQHL 4FQ1L 1EXUB 2E7HA 1W8NA 2EDLA 4J2XA 4G80B 1CLZH 5L7XL 4L1DA 1RJLA 4UDUB 3O6FB 4JO1H 2P44B 3HE7B 5LGHH 1CFNA 3MNZB 5CHNB 4PRPE 3SDDD 3VI4E 4YFLF 5E8DH 4KDWA 4JB9L 3SCMB 5J4MA 2R56L 1WTLA 3ELAT 3IETB 5KSAD 3WNPA 4X6CF 4YHPB 1A4KA 2C4FU 4MB3A 5F9DC 3L3KB 4HKXA 4S0SD 1OP3H 3VH8B 4L3EA 1S7TB 1XGQA 4OJFL 2CUIA 4JZOA 3GMRA 3D18B 1EFXD 1F4YL 3IKKA 5SV4A 1FAIH 4X9BA 4YQXL 4N9GA 5JNYA 3OR6A 1C08A 4U1IA 5C8JB 4XVJL 5IB2B 4LSSL 2O26U 3OZ9L 4NQXB 1FE8H 2IFGA 4FFZL 4NZDA 5DJ0A 3LKPB 3QJFB 2EDXA 4PV8A 5C0CD 4EXPX 3HI6H 4GKZB 1R3HA 3KJ4B 3GJEA 1OWRM 3QXTA 5D7JC 2FL5B 3ZE0E 4LHUD 4PLOB 4R96A 5D7IE 5CZXD 4AG4L 5GGQH 5LCVL 5JW4R 3FONB 1UA6L 3L95A 4WV1A 3U46A 3NA9L 3SJVE 2IGFL 2IPKB 3QIWA 2NZIA 3L6FB 3EO1B 1KNOB 5GGSB 3VXME 3N1GC 3UAJD 1HCVA 5CGTA 2J88H 5KSBE 4O2EB 4XT1C 1EEZA 3LEVH 4RCAA 1GL4B 2GW5A 3KYMA 5IV2B 2CD0A 1M05A 5E95B 3BD4A 1OARH 1NMCB 3IF1B 4JO3H 2VDLL 3L3HA 1F11B 2EIBA 2R0ZL 1OF2A 3QQ3A 3WL9A 4DCQA 3P2TA 3U48A 2P49B 1M7DA 4W68A 1OW0A 1PG7X 1IVLA 2Y4SA 1KJ2H 5DJDB 1CGSL 3A6CL 4ODVH 4ISVB 1AGEB 3BGFC 4ZFOB 1IGFL 1IGIH 1H3GA 4K3HA 4I18C 5J0BA 1AHWB 5I73C 3UBXB 2ICWA 1HKLL 2XKNB 3MACL 3PWUB 3FT4A 3T77A 4DGVL 5F3HA 1IEBB 5JHLL 4RWYH 1EGJH 2YD3A 1MREL 1BBJA 2NTSP 5SWZE 3DX8A 2FGWL 1C5DA 1KLUA 4JHAH 5ESQA 2AXFA 3JVGC 4PJEE 1HSBB 2Q7YB 1DLFL 1BFTA 4MD0B 5I2IA 4HK0A 1IGCH 5K9JL 1X6LA 4UNUA 1FNLA 2B1HH 4Z7OF 2AJVL 3SO3C 4KQ3H 2Q8BL 5DJXA 1PSKH 3EO9H 3IFNH 4XP5L 3O11B 1WQVT 4RNRA 1A02N 2BNRD 3U7YL 3CZFB 3G6JA 4HJJH 2RQ8A 4HH8A 4PJFB 4I2XA 2XNAB 3U30C 5ITBH 1G1YA 5BXFA 2Z93B 4F9PC 2A6KB 4QHUB 4ODXA 4P59L 3Q6FB 3OG6B 3O4OB 2X4SB 4TOYH 1Z6JT 5D5ME 4PUBL 3H42L 2RIKA 4FFYH 5JORA 4ETQA 4XZUB 3ZKSD 1IKFL 4U4BA 5AAWA 2ID5A 3PV6A 4KC3B 4TVPD 1DBKL 1HILA 1JNHB 3GIVB 4IJ3C 1RZKL 1JYVA 4H26A 5BVJB 4RGND 1RJCA 3I75B 2CRIA 5I17A 2ORBL 3QRGH 4YDLB 1O7VA 1LK3H 4PJ8B 3VG9B 5JUEL 4AMKH 1XAUA 3TNMB 1XF3A 1VEOA 4I8DA 4U6TA 4R9HA 3RU8H 1MQKL 3FT3A 3QWQB 5AUMB 3TCLA 5HVHC 2PCPA 4P3DA 1L7TL 4NO0D 4NQDD 1ZOXA 4N0CC 4M6AA 4JFDE 4UB0H 3QISA 5F6IB 5BS0D 2YBRA 2XY1A 4HUUB 1NC2A 5EG6C 1DEEA 3QEQA 2BSSA 1XMWA 2YK1H 2EIDA 1CGYA 2YD1A 4OLZL 4BUHA 3RNQB 1OP5H 1K8DA 2P8MB 1HCFX 1U8PB 4PGCA 1M1SA 4QCIB 5IMLA 4N0CD 2NXYD 5D2NC 4KPHH 4HKBB 4S0TD 3FQNA 1R6VA 4MCZB 5IROA 2AJSL 5EORH 1MRCL 1U92A 1AD9A 2CMRH 4X6CE 4KK9C 5JIHA 1QSEA 5GGRB 4XNQA 5FO8A 3C8HA 1OM3L 1JGUL 2VXSH 5FAAA 3GK8H 3OF6A 2X4RA 5KSUA 2IPUG 1IM3A 4DZBA 2VDNL 2ADGB 4U1SB 1JWSA 1AI1H 1S7SA 4DAGH 1CDCA 4HWBL 2DQFA 3W82A 1JHLL 1FFOB 1NFIB 4KK9D 3D5OF 4O2CB 4X5XB 3DURA 4PV9B 5I6XB 2JE8A 3PE9A 3JTSB 4NZRH 1X4ZA 5T1KD 4JQVA 3VG0H 3RX8A 1YMME 1L4IA 2Q3ZA 4OZGB 5F3BB 2VDOL 4V1DB 4LSRL 1RK0B 3CFBA 3BSZH 4LKCA 4OCLC 4FQPA 1OGAB 1KB9K 2NY0B 4UZGA 1AP2B 1F6FB 3VI3F 1V3JA 4YNYB 3VXNB 1TJIL 1B3JA 3UTTD 2FECI 1S7WB 3N85L 3RWJA 1X5AA 1TTFA 3ULUE 1W0VB 3KLSA 4QF1B 3V52L 5C0IA 1DP0A 2R2EA 4A6YB 3VGGA 1AD0A 4OFDA 3UTQB 5CEYB 2X4PA 2Z91A 3BIKA 1G1CA 2IFFL 4UU9B 2B0SL 2DL2A 2V9QA 4LLVA 2H45A 4P23B 5CZVH 3GSQB 3H0TA 1J8HB 3BDYH 5AYUL 3TA3D 1SMOA 3UJJH 2W65B 3K80A 3IYLW 4G8GA 1KTDA 1HI6B 4HV8B 3O2VL 3LOWA 4QRUA 4F7TA 4R0LB 4AH2A 2A83A 5D2LA 3U83A 3ARTA 2JIXA 4LEXL 4JFOA 2DLEA 5ESAA 3HHRB 3IRZA 2AABH 2Z31C 2IQ9L 2NY1D 5F71A 3WFZA 2XWJA 5GXBB 2X4UA 1W0WA 2GY5A 2APBA 3GSXB 3PQYB 3O2WL 1U93A 3X14A 3O2DL 4Y4HC 4MNQA 2HT2D 3WXWH 5C0FA 2FBOJ 3U2SB 3OKKB 1AKJB 5JW5A 4X0KB 4OLUL 3ZDYE 5L2KA 4IRJA 3V4UH 3N1MC 1CL7H 2J8UF 3ARDD 1NCBH 1VSCA 5FYLH 1CU4H 3DUUB 1HHJA 4UOW1 3EZ8A 3AMLA 3FQUB 2NMSA 3MXWH 1SY6H 4G6KL 1YUHA 4XNXL 3MRNB 4HJ0C 3V6OE 1UM5L 3PP4H 5CSZB 3X3FL 3MUGB 3ZTJH 4JO2L 1TZHB 5IWLC 1JE6A 2FHFA 2CO7B 3QDJA 4PYHA 5IBLD 3C5SB 5CJQL 2VITB 4ZNCD 5ADPL 3G6DH 3MOAL 1ZLUK 5JOFB 3VWJB 4NQCE 3TF7C 3RNKB 3VXOA 3GSUB 5C08E 3BP7A 1N4XH 4MAYB 5EZIL 5GRVL 3O2DA 3O3AB 1ODAA 3MROB 5DJYB 1M6OB 3GHBL 5GS3A 4UTBL 1IILE 1K6QL 1RU9H 2F53A 5GS2D 1WFUA 4GRWB 3V9FA 4PD4J 4XCNB 4XMPL 4XI5C 1SJXA 2ZPKL 1U8OA 1A6VH 3LMJH 3GMNB 3CDGB 3BH9A 5DVMA 2X4OB 3OKEA 3GDBA 2AJZB 4M93C 3BWUC 4RISH 1S7RA 3WLWC 3TBSA 1XF2B 3V0AC 3CFEB 4Z7VA 1MPAL 2LAGB 4Q58C 4XI5D 1CLZL 1LP9F 5EUOA 1N64L 4JHBA 2QADC 3DXAA 5LGHL 3HB3C 3HZYB 3M07A 5T1LA 3C5ZA 4E0RB 1UJ3C 3GI9L 4X7TA 5EZJA 1I7TA 3ORJA 1I75A 1RIUL 3KYKH 5FM8A 4Y19B 3SGKA 4RQQA 4YX2H 3PHOA 2R1YA 4ELKB 3FN0L 1QLEL 2QADD 4JANA 4MQXC 1TMCB 1FL5B 3HB3D 3AREA 5EA0H 4N8VA 3MRIB 3OV6A 1NLDH 1G7HB 5AYQA 2DQIH 2WV3A 3A0OA 4IS6B 4KVCL 1DJSA 5KVDH 1ZA6B 4MX7A 5I15L 1FE8L 3OHXA 4MQXD 3TIDA 1KB5B 5IF0B 5L0QB 5I19H 3QPXH 3FZUC 1IAII 3DI2B 3HI6L 5E24E 5IW3A 2VLME 4UOW0 3RWCA 4OBSA 5E03A 2XN9E 2P5WE 3CZJA 2NR6C 1P5VA 1CDUA 5DMIL 2QBWA 1ACYH 5INDA 5DVOA 2VERN 1FFNB 4MJ5A 5ESVB 5GGQL 5IFJA 1NCDH 3FZUD 4WV1C 4P2QA 5E6IB 2ZKHH 3QIWC 1VACA 3QULA 4N0UE 2YPLA 2X9YA 3QZWB 2NR6D 3B8SA 3VRIB 5HGDB 1I1AB 3L3DB 4M1GH 1I8LA 1K9TA 2X42A 3NABL 4WHCA 1EDQA 4Q6IA 4WFEE 1TZGH 3Q3GA 3KXFB 4YC2B 5CMAA 2AQ3A 4DKFH 4U1LA 5MI0B 3RWHA 4XH2A 4KAQH 2CK0H 3VI3E 4QY8A 3BH8B 1PGRB 1KCSH 4JHWL 3QIWD 1JZ7A 43CAB 3AS1A 1S9WB 5J9PA 3OGOE 3D0VB 3ARFD 1JPTH 1OW0C 1HK6A 5JLZA 3OKNB 4I0KA 1AGFA 2X4NA 1TNMA 4J3SA 5I1JH 4J1UB 4J7RA 1C8PA 4ZUWB 5FYJH 3K2MC 5IB4A 4CW1B 4IRSB 1U91B 1IGIL 3QR2A 5FB8A 4X8JB 5IP4A 3IU3B 3AM8A 5F89B 4GRWH 4OZ4A 2HH0H 4MJIB 3QWRA 4X6EA 3HR5B 4LKXB 4RWYL 1WFOA 1EGJL 2CDFB 4PJBB 3CJJA 2Q76A 4HLZG 2DQTH 3DMMA 3KPLB 5CFHA 4E41E 1J1XL 1CZ8L 2GTWA 3BGAA 4OKVB 3ZYIA 2BNQA 4KHTH 4KQ3L 1P9MA 1D5ZA 3IVKA 1RSFA 4I48A 1PSKL 4JG0H 1FCCA 4N8CH 3I6GB 1WSST 2DDQH 3F65A 2VLKE 4HJJL 2BVOB 4RGOH 4PY7A 3WDIA 4Y5YA 2COQA 5ITBL 1ZT7B 4PGBA 3W2DL 3VXUB 4K07A 4Y16B 5LXGH 1NUNB 3BO8A 3ABZA 1S78C 1XIWA 3MA7B 1DL7L 1CIUA 2CXKA 2UVFA 4GRMA 4FFYL 2Z35A 1KJ3H 2Y5TA 2OP4L 2DWEB 3QUZA 4TTDC 1XCQA 4LCWA 4M7LT 4PREB 1QSZA 5C70A 3MV8E 3ARGD 1S78D 3LRSB 2BXZA 1ZLUH 2F15A 4POYA 5EN2B 1Q9KB 1KIRB 1HE7A 5L2JA 4Y2DB 1J7VR 4X6DB 5E56A 4TTDD 4GG6E 1CQYA 4AMKL 4YHIA 1KTRL 4PGDA 2HVJB 2YKLL 4EI5A 3RDTD 3RU8L 1II4E 5FV1L 4MNGE 4C83B 3BZDA 1P1ZB 1A1OB 3L7EA 5F1IB 2MQCA 4UB0L 1NEZB 1UYWH 4C59B 5KVEH 1CICA 4MD5B 1JTOA 3VFMA 4KKNA 3S35H 2H26A 5ITFB 3WNOA 4OLWL 1LP9E 2G60L 3SO5A 2NZ9C 3QDGE 3D39A 2W60B 1HHGB 4UINH 4XXDB 2ARWA 3MBED 5FM4A 4KPHL 4ZTOL 5IMKB 5DJZA 4LK4A 5IROC 4PRIB 3UBXI 1NC2D 5C09A 5JO5A 4CJ1A 3NA4A 1LE5B 3QEQD 2CMRL 3O4LA 4OV5A 3VRJB 4X7EC 2VXSL 2I9TA 2MCPH 2QHLA 2NZ9D 4J6RL 3KDMA 4QRPE 3BP4A 4ZUUB 1AI1L 3QFJB 4DAGL 1AXIB 3MRCB 3VWKA 1AQKL 2OYPA 1KCRH 3ESVF 4BH7B 3QPQD 2Y36H 1QSED 4HMCA 3ISWA 3TBVA 4NZRL 5SWSA 2VSDA 4ZSOA 4F58L 2EIEA 4JQVC 3AY4A 1D5MB 4IBLT 4OF6A 2F74A 1Y0LA 3T8XB 5BCAA 4CUCA 4JPWH 4L5FH 2R8SH 3T0BA 2X70B 3NPSB 3RL2B 2D4DA 4PJXE 4CVZB 3DIFB 1EJOL 3QNZB 5FCUL 4PJDA 4FTVD 2GAZA 3GJFH 5K9QI 4PJFF 4YPGB 4F7PA 4NUGL 3E8UH 3ZSSA 1PY4A 2SEBB 1IL1B 2IALB 5EU4B 2DM2A 1S5HB 5IK3B 2JJTA 4L1HA 4U2ZA 5EUKA 2BRQA 3T1FA 5J6GB 8CGTA 3K8MA 1V3MA 1A7RL 3OJDA 4FQHB 1I8KA 1DANU 4P2OB 1ONQB 5JHDB 3LEXA 2ZUWA 4NP4L 1R3JB 4G9DB 5FK9B 3PDOA 2G2RB 3ECBA 3TZVA 2FR4A 4KROB 3MZGB 2W1NA 3Q2CA 3QXAB 1CE1L 5DRZB 3BJLA 5A2IH 1W72B 4G8GD 4LPVA 3GBNH 1OT1A 1BD2A 2CKNA 3WXWL 4XPTL 2JIXD 2QSTA 1GJIA 3KR3H 4DGIH 2C5DC 3X11A 1FZKA 1RIHH 1CL7L 4IRJC 1JNLH 3IAGC 1NCBL 2NY4B 3D25B 4GMTH 1CU4L 3J8F7 3NOIA 4F33B 5AG8A 2X89A 5EULV 1FVDB 3FFCB 4MNQD 1CG9A 5DEGA 1FGNL 5EIIB 2A6IB 5HHMB 2R69H 4AM0A 5L2KD 3FO1B 1MHCA 4YDJA 1BZ9B 4S2SA 1OL0A 3DV6A 1DQQA 3UTSE 3FAXA 3WFHA 2I25N 1MFCL 2IWGA 3MV9A 4JFZL 5E8NA 4OGYH 4OAWB 1HEZB 4L4JA 3PG2A 1N4XL 4Y1AE 1E6JH 3GNMH 3V5DB 1A7PH 4CN6A 1INQB 4EN3B 5C9JA 1TVBB 1AIFA 1OP9A 2CUMA 3IDYB 2X9WA 3MMEB 3LRGA 2BNUA 4OZHB 1J0HA 1DVFB 5GRWA 4WUUA 3T0EE 2XFXA 1TIUA 1FZMA 1LK2B 2NNAB 3QG6A 4G9FE 3FTGB 4BZ2H 2DI8A 2IC2A 1BVLB 1U3JA 3AS2A 3X12B 3QQNA 3QNXB 1JNJA 4X6FB 2LE9A 3QP3A 5IG7B 3NPZB 3LY6A 1MLCA 4RISL 4U31A 2EH7H 2F53D 2RFXB 1WEJH 5E99L 1I3GL 5B39A 1BBDL 4R97C 1EEYB 1I7RB 1RIVL 2AEIT 2H1PL 2R0LL 2XQBL 4GAYA 1S7UB 4BELD 3C5ZC 2OXHA 5CP3A 3G5VA 5EC1A 1XR9B 4KMTH 3KPOA 1WGOA 1QSFB 5E1AB 5IQ7H 4XX1G 2YRPA 4YX2L 5ENWA 4U7MA 3SGKC 1BJ1J 1NDGB 1Q38A 3LPGA 4L8CA 4D9LL 1IAOA 1C1EH 3B9KD 3AREC 4GW4B 5EA0L 1GZQB 1NLDL 1UWEL 4RZCA 1E6OH 4FFVC 4IOFC 4NZJA 4XBGA 4M9PA 4HC1H 3GBML 1G7LB 1ZEAL 5I19L 3ARED 3NIDF 4XCYB 1MCNA 1MCSA 3UC0H 5FM5O 3NBNA 1HHHB 4XVSL 2QQKH 1BGXL 5DHVB 4FFVD 4IOFD 3FB7A 1L0QA 1W72H 3BEWA 3P0YH 5DS8B 2BHZA 1MCWW 2XOTA 5CIPA 4OI7A 4B0MM 3MPCA 3FRPA 3VGBA 2J3SA 2ZKHL 3LN5B 4GFTB 3S4SG 5A3ID 2NXYB 2ZJSL 3KHOA 4QHKJ 1E4KA 1RUKH 5HYQB 3DVGA 1I8LC 2V2XA 4HT1L 4FQCL 4Q6IC 3DVNA 4KAQL 2CK0L 1KCSL 2MQ3A 1P84K 2DM3A 3BE1H 1OHQA 2YPLD 4JRYE 4QNPF 1OCWH 1EHXA 1TCRB 4UDTA 1F58H 1NQBA 3DWTA 4BKLA 1GOHA 1LILA 3LD8C 5T1KB 3RIFF 1VPOH 3WKNA 3EJYD 4JY6A 2AEPH 2HWZL 2EEDA 3I6KA 4K94H 5GS1B 1FO0L 2HRPH 2XTJD 1J5OH 3OX8B 2XXCB 2FDBP 4PB0H 4F9LA 3AM8C 1MHPH 1TQCC 3S3SA 4AEHH 3OKOB 3BN3B 3QDMB 5C0GB 4JFQB 3HR6A 4C57C 2Y72A 5GZNC 1NCUA 1RHHA 1RMFH 5DK0B 2PW1B 1T1XA 4CVXB 4AL8L 1NAMB 2BMKA 2DQTL 3LKRA 3H9YA 3DMMC 1GVIA 1TDQA 3W9EB 3BMVA 4Z0XA 5EBLA 1A9BB 2R9HD 4TRPH 3QWRD 5I1CL 4QT5A 3VGFA 3SKOB 1FAKT 2W59A 5GZND 1XF4A 3RUGE 1P9MC 1W2KT 3INUL 1YN7B 2EEAA 4JG0L 3IDIA 4GUPB 3QDGB 2DDQL 1ORSA 5F93C 4WRLA 4KRLB 2DQEH 4XTRD 3I2CH 4WU7B 1AQDB 4Y5YC 1KBGH 4JY5L 3BVNA 1NH6A 4QRTA 1JZ3A 2BNQD 4RMVA 5DQ9B 5H35A 1XIWC 1QSVA 4PBWD 1NGQL 2B5IC 4XHJC 2OSLB 4ZO6A 5F9AC 1U8NB 3R06B 1H15B 4EUPA 3OAUL 1CFBA 3QUZC 4ZPVA 1FYTB 3BPLC 5HPMA 5JXED 1PKQB 1PX3A 5MENE 1C12B 5KAQG 5HDQH 4PTTB 3RVVC 1PYWA 4XHJD 5LG1A 2Z92B 2W9DH 4U7SA 2WINB 4XXCA 1TZIA 2FX7L 5DGQA 3D3VE 2XQYK 1OQXA 1TFHA 5HDBE 5C0BE 1GGTA 5DHVH 1A7QH 4LCWD 2HLAA 3B2UC 3PJSA 5EU7E 5JW4N 4EI5C 5D1QA 3RVVD 1ED3A 3RVUC 5IR1B 1X6NA 3L3OB 3MRQB 4NHUB 1PZ5A 2W92A 1G0DA 4XNUH 5I9QC 1IM9A 3BQUA 5C0AE 4KZDH 1CICC 3B2UD 3LCYA 2VZ3A 3S35L 2FJFB 1WAAF 1U8IA 2DLFL 1T0NA 3MUHL 3DBXB 1IEAB 2I5YL 2JTDA 3CAFA 4TNWF 2VDRL 4CU6A 4DOHB 5SWQA 4WW1A 3RZCB 5I18H 2XG4A 3SDCB 2ATPA 4JDTH 4XP6L 1C5CH 2D3VA 4PRBA 1CICD 2GITA 2IAMA 2JK5B 2EDJA 4NQUA 2IQAB 4BQBA 4YLQT 5TGBA 2MCPL 1WZKA 4YXHH 4L29A 4FMKA 5ICZA 1QBLH 3MNVB 1F97A 3OR7B 3VWKC 1D9KD 5D72L 5C09D 2YPKB 2OLDA 4EI6B 3RJDA 2ZSVA 2W9EH 4Q2ZB 4KJYB 1OAQH 3EYOA 3AY4C 2AXGB 3QH3A 4XBPA 3C09C 4WTWA 2P45B 2BY0A 3MREB 4JPWL 2P24A 4L5FL 2NY3B 3TYFB 1EAPB 5E70A 5CEXB 1UH2A 5D96B 3TJHC 2NW2B 1MI5D 3W5MA 5E9DD 5SWSD 4YK4C 5T3ZE 1A64A 4OZIB 3P73B 3WD5L 5CSBA 4GAGH 5I74C 4HHAB 2P47B 2WIIA 1H8SA 2HKHH 1AY1H 2EO9A 1NL0L 4P9MH 3PGFH 5F7LB 3JWOL 4ZODA 3TJHD 5E8EB 4UAOC 2JJTC 5DYOA 5KJRL 2F58H 4LLMA 3RQ3A 1EVUA 3MLYH 3SDXE 4DEPC 1NCCH 1UH3A 4JAMA 3MO1B 3SQBA 5TPWH 4BZ1L 3FOMB 2X1XR 4IHOA 4PJIA 1XZ0A 3TZVC 4IOIB 3VFNA 4F57L 2YUVA 1A6UH 2VTFA 5E4EB 2JCCA 5D9SB 4ZUVB 3OB0H 3QUYB 4LNRA 4M43H 4ZYKB 3BP5A 3TEUA 4O2FB 1OT2A 4JFDA 1IAIM 1ERNA 1HQ4A 4ZFZB 3MJ8B 4BSWA 3TZVD 3VXTB 2DB8A 2R4SH 4MA7H 3EHBC 4I0PA 5E5MA 2VLJB 2G9HB 5KS9B 5C0DA 2A9MH 1XGYH 1AGDB 1KJMB 4D9QD 3UTZB 1BD2D 1YZZA 4CMMB 5ID0A 5F7DA 2ZZUT 1BX2B 3EFFB 5JIKA 2VRAA 5I1GH 3ULUL 2MCG1 4F8TA 4EJ1C 4M7ZB 1RUQL 2YZ8A 2KQNA 2BSRA 2X89D 1U8JB 3IFOA 1JZ2A 3RAJL 3VXSD 4O4YH 2D03H 4OGYL 4OQTH 1EX0A 1AO7B 4HIEA 1K4CB 3P4OB 2GFBB 3RWEB 1TPXB 5DDHA 4ZAKD 4QRRE 5EBMB 1HHKA 3P4LA 3RBGA 4DFIA 3DV4A 1OB1B 3TIEB 5FO7B 4X4MA 1FC1A 1FL3B 3GSNB 3UJTL 4G5ZL 4JFFA 2VE6B 4BZ2L 5D71H 4L4TB 2B4CC 4U0RC 5HHPB 4YDVA 1JGDA 5E2VH 2AW2A 1N6QH 4WUUD 4R7DB 5INCA 3NCEB 1WEJL 2OMNA 2VIRB 5I1LB 3VDCA 4NO2B 5D8JH 1K5NB 3I02A 2PYFB 4HW6A 3OKDA 1SVCP 1QFWI 2KQMA 1KJVB 3CDFA 3MRFB 1YQ2A 5MEOA 2MFNA 2ADIA 1QRND 5IQ7L 1DBBH 1YEEH 2VLRE 3BDXA 1MAKA 5ISZB 4XAKE 3UZVB 2XI9A 1A6AA 4J3OC 1DQDL 1KCUL 1IZKA 4KKLC 3ZKND 1E6OL 5K9OB 1Q1JH 4HH9B 4YHZH 4LFHD 4CVWA 1B9ZA 3DGCR 3O3BA 2DBJA 3B43A 5DD3L 4YHOL 1PZUB 1NGZA 3F5WA 4JFPA 5I16B 1YJDH 1S9XA 4PJHE 1MWAA 1CN4A 3WLBB 4NQSA 1MY5A 4PS4H 2H9GA 4KKLD 3VFTA 1ZGLM 4LCYB 2QQKL 3IJYB 1A0QH 4U1KB 3D2UB 1F6LL 2HMID 3P0YL 3V6FA 5HI5C 1N0XH 3S5LA 1F4AA 4EVNA 5B8CA 3V6OA 2VUYA 4JFXB 4OZFA 3BIAX 2DRUA 2QL1A 2O5YH 1M7XA 1IQWH 1VFBB 3BJ91 5CCKH 5F7WC 4JFEA 2ED9A 1FJ1A 1A6TA 3RUGB 1WWAX 1E4KC 2MWCA 3DX7B 3U7WL 3CK0L 5HI5D 1XR8A 5C08A 3ZYOA 5C0JA 5HHOE 4E42A 4NO5A 2X09A 1D5XA 3HG1A 1JGEA 3WEXB 3BE1L 3HZKB 5KZCD 1H8NA 1OCWL 4BSVA 4OF3A 2R0WH 1F58L 2IJ0C 3Q5YA 3V0WH 5BRZB 2P7TB 4H0GA 3WXVH 1YEDA 1VKXA 5DQJA 2BVYA 3JV0A 4K2UH 5HDLA 4OZHF 3OL2A 4YBQC 2C1OB 3AFLA 2EDWA 4K94L 1JPGB 2R2CA 4Q9RH 3ROLA 4P5TA 2J12B 1TTUA 4PRHD 3LEYH 1TNNA 2BY1A 3QUMA 4F9LC 3GEWB 3GSNH 1KEMH 2IEPA 2NY2B 1UVQB 4L8DB 4JFHE 2BP3A 3O41A 3BPNB 4YBQD 5CUSL 1O0VA 3LKQA 3LDBC 1VFOA 4HWZA 5C2BH 1FNEB 2F5AH 5DD6B 3QEUA 4WCYH 1FVCB 3MC0A 4ZFFB 1V3KA 2DMKA 3E6HB 4I1NB 3DUSB 4XHQA 4OCWH 1G9EA 4TRPL 2P5EB 2H2SC 3FQWB 3EOBA 3IDUA 5EU6A 4C4KO 5IGXH 3CLFL 2VAAA 2EC9U 5ADOL 2ICEA 5EU5B 3ZKXB 1QBBA 1IFHH 3KLDA 1AGCA 2YD8A 1CF8H 5KOVC 1KBGL 2HFGL 5BO1H 4R2GC 3ROOA 4Z6AT 2H2SD 2ZG1A 3W39A 4UQ3A 2QEJA 3FHAA 3MXVL 2ZUUA 3RIFK 2A77L 2VZOA 3T4AB 8FABA 3TO2A 1ZA3A 4FN0A 5EDXA 5FCSH 5GJTH 2ITDA 1T5XA 4ZPTB 1FPTL 2FECL 4MB5A 1FG9C 4QGTA 3WIIL 3KYNA 5HDQL 5TH2A 4HWNA 3RTQB 4QHMA 4XXCC 3RX5A 4OM0L 1BLNA 1BAFL 1L0XA 4AY0A 1JPSH 4DGYH 5KN5A 4S11A 1N6VA 4Y2OA 3NCYP 3NZ8B 1I85A 3FCTA 4P0DA 5D1QC 1Q72H 5FUCE 3V95A 3LS4H 2C7UA 3RWGB 3Q5OA 3M8OH 1XH3A 4PP1C 1HH9A 4XNUL 4M4RA 5FHBL 2BC4A 4YGVA 2EDNA 3ARBA 3BQUC 1EUTA 4OM1H 4UTAH 2F19L 1FNSL 3NMEA 5D1QD 1KPVB 5BV7H 4YO0B 3PWNA 1QA9B 2X1PA 1M7IA 2FD6H 2QV2A 4PP1D 3P9MB 1MF2H 1NKRA 1C5CL 3EUUA 2DQGL 1ZHKA 3KVQA 2IAMC 5JZ7C 1RUMH 1UB6B 2HJLB 4FG6C 3MRLB 5FUOH 5C0CE 4G7VL 4D0CA 5CP7B 1FCGA 3T65A 5D1ZA 3P0VH 3MZTA 4YXHL 4NBYB 2EYRA 2I07A 4R8WH 3F6LA 1QBLL 1H5BA 1N2RA 5GZOD 3DROB 3VD3A 2IAMD 5JZ7D 4QLRA 3KPRD 2FSEB 5T5FH 4X4XB 4E41A 1NANH 5DXWA 4FG6D 1E4XI 2CJUH 3TN0A 4DTGH 1T2QH 1OAQL 4M6OH 2H32H 2J8UA 3V6ZA 4NKOA 1EBAA 4EQ3A 3GUTB 1CFVL 1JL8A 5LKNA 3CCHB 4LVOB 3QI9A 2J5LC 1U8QA 5FGCE 5E2TH 5TJWK 1XGPB 3OSKA 3BRDA 2AJYL 1N5AA 1KG0A 4QWWC 5KG9B 4TNWK 5J1AB 4FNLH 5EH1A 4PJAB 1K8IB 1RUPH 2OZ4A 3F7QA 3PGFL 4N90D 4N1HB 5DO2C 4EDXB 5IVXB 2F58L 1G7MA 3MV8A 1UCBH 1RI8A 4QWWD 4NRZB 2YA0A 3MLYL 4K71C 4LSPH 3BEVA 5CBEB 1U3HA 3VMPA 3STZB 1HOCB 3NCCB 4HF5H 1JGLH 5MEPA 1TXKA 2E27H 1D6VH 1R5IB 3QEGL 3DVIA 4P99A 3MOBH 3QO0B 5I1DA 5DO2D 4O58H 4JLRB 2Q86A 1A6UL 2OXGA 1VDGA 2HLFC 3F12B 5IB3B 2J6EH 4CBPA 4D0BB 1DDHA 1G9NL 2FRGP 5F1NA 3VFOA 2K3TA 1CXFA 5IFHH 1WITA 1DQLL 4QHNA 1NCAH 2WAHA 5EO1A 2XWBA 3M17A 3ALWA 4L4VB 5F9WC 3U0WL 1T6WA 4GT7A 4HLZH 4Y0GA 2HLFD 1BOGB 4I0PC 2GSGB 2X1QA 1LP9A 1NBVH 3NFPA 3JTTA 1I3RA 1NBZB 1XGYL 2RHEA 5D6CB 1I8IA 2DWDA 3WFCH 4X4YA 4O5LH 2KPNA 4UT9H 4HEPG 1SYSA 1N59A 1YNLH 1KXTB 1G9MH 4NRXB 5I1GL 1IAIL 1LEGB 3G5XA 1QLRA 1MRFL 5DUPH 4UQ2A 4ZXBA 2DD8H 2CSPA 2N7BA 2NY5C 2AJ3B 3REVB 5GS0C 4LQFH 2WZPD 1OVZA 2YUWA 1CFQB 1A14H 1SEQH 4O4YL 2D03L 2VDPH 3LKOA 2YC1B 4OQTL 1Z3GH 3UEZA 4PJ9D 4WNQA 4LP4A 1A4JA 5C71A 2MKLC 3NCYS 4M5YH 4TVPE 3U0TA 1YPZB 4P5MA 3T3PE 4ODSH 3EOYG 5GS0D 1ZWIB 4WUKL 5HJ3B 2NY6C 4MXQC 1HNFA 1A6WH 1B2WH 1S3KL 2AVGA 3GB7A 5D71L 2WP3T 3QUKA 1P2CA 3IT8D 3V0VB 3T3ME 5B38A 5E2VL 2CIKA 3K4ZA 2RGSA 4W81A 5EOQH 2NY6D 5BS0E 4JFFD 4MXQD 4LHJB 4X6BA 4CNIA 2FJGB 4XPBH 1G7QB 2QHRH 3BWAB 5D8JL 2FX8H 2EKSB 3EO0B 4NWUH 1UZ8B 3NH7H 4GQ9L 4M62H 4XPAH 4URTB 5GGVL 3L3IA 3SGJA 1WJ3A 2NCMA 3B9EA 1GSMA 2XYCA 1BFOA 4HUMB 5DZOA 1MJ7H 15C8H 4WY7H 4IIQA 1RZFH 5L6YH 2YA2A 4ALAL 3S7GA 3EYVB 2HT4D 4XRCB 1QP1A 1HDMA 2V5TA 3V79C 4GKOA 2HVKB 4NQVB 3MLPA 4LDEB 2EZ0C 3MGOA 5D7LA 2D7NA 4DUWA 1MIMH 2ENSA 4LCCA 5EO0A 2ITCA 2V17H 3ZHKA 1E28B 5GGVY 4ETYA 5HSFA 1T1YB 4HUVA 1BF2A 4PS4L 3VFUB 4OLVH 4S1QH 3FQTB 1A0QL 5C07B 4ZG1A 1BFVL 3EOAB 3IJSB 4KK6C 2EZ0D 2FIKA 5I1AA 1TQBC 3WHE1 4F7EA 1EXUA 5B8CC 3V6OC 4UT7H 5E1HB 2AK1H 1B6UA 5KS9F 2H3NB 3UTTE 1IQWL 1SEBB 1NFDB 5CCKL 3MNZA 2ED7A 1IGTB 5SV3A 3SCMA 2AERT 4FHBD 2HN7A 4KK6D 5CINH 3CUPA 3IETA 1UCTA