3WIHL

Crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFGAGTKLELKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Roundabout homolog 1
total genus 52
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihL01
1YN6B 5F6IC 3LV3B 1F3JB 4UV4H 1JNLL 2X1XR 4R0LC 4Q0XH 4PYGA 1ZWIA 3V4PL 1P84J 1JUFA 2QKIA 1IM3B 4RCAA 5EBMA 1LNUA 1HNFA 4TUOB 3NBNA 1R3IL 5C0JA 3PV7A 1CFNB 5IQ7L 1IAKB 4AIZA 3TA3A 4GAGL 2W0KA 2ARWA 3HN3A 1HQ4A 1NC4D 3RAJL 2DQIL 1LEGA 4D0CA 1GRWA 3DRQA 3FO0H 2HH0L 5HBBA 2YWYA 4X7CC 4X4YB 4XPBH 5IEKB 3KPTA 2Y6SD 1BOGA 1NFIA 1I1AD 5D1ZB 2QKIB 3MJ9A 3UROR 5K9QI 1TZHA 3TGXA 1J5OH 3DWTA 1L0QA 2XACC 3E3QC 1XF2A 5EC1A 2BRQA 3FQUB 3HI5L 5EIVA 3I50H 4K8RL 4MB4A 3U48A 1P84K 4L8SA 1I9JL 1AD0A 4NSKA 4P2RB 1B6UA 5C09D 3Q6FB 2G75A 1A3LH 1YYLL 1F8TH 4MJIA 4ZTPL 2BFVH 1QUNA 1FFPB 1MRFL 1AR2A 4OFIA 3VXRB 1MREH 1S5IL 2WK2A 4F3FA 5JW3H 3MJ6A 3GMQB 3O9WD 4JY6A 1D5BB 3O3AA 2D9QB 1F58L 2V2XB 3DXAB 4Z8FL 1YEHH 1MQKL 4PREB 1MCQA 2BCKB 5ALBH 1XH3A 1T03L 4UNUA 2A74A 2UV3A 2AXFA 3CPLB 3IAQA 3A67L 3MBEB 3TYGH 2DQFA 2FL5A 5HHPA 3CXHK 3HE7D 1Q8MA 5CAYB 1A9EB 1MPAH 1TVBA 3EFDL 1QO3A 3JTTA 4M1DL 4MX7B 1W8NA 1CXHA 3KJ4B 3MRMA 2YC1A 3MRHA 4R96B 4WFEE 4CAGA 4UTBH 4LSPH 5ITBL 2C4XA 1T5WB 4TTDC 1WZ1L 3NIFE 2BSTB 5DZOA 1RZGA 3OMZA 5ANMA 5FUCC 3PWPE 4NO3B 5FO7A 4KVNL 4KHXH 3ZDYE 2P8LB 5KSAB 2NY0C 4P2QD 2ADFH 4GAJH 4NDMB 3MRNB 4IIQB 4CADB 1LO3H 4V1DE 4WFGD 1U9KA 3QEQB 3BP6A 5I73C 1OT1A 1U8PA 3SGDI 9CGTA 3T0XA 2VXVH 3P73B 1JV5A 1JZ8A 4Y1AA 3VXNA 3LKQA 5DJCB 1RJZA 5TFSH 3ZE0E 1PX4A 3THML 5E8DL 4H1LA 1S9XA 2AJXH 1ZLSH 4WFFE 3GMLA 2VISA 5E2TH 5IV2B 3QNZB 1FYTD 2B5IB 2AK4B 2X4RA 1GHFL 4X7TA 3C5JB 5T1MA 5HVHC 3M17A 3GI9L 4IBLT 4XI5D 4J12A 1KCLA 5ISZA 2HJLB 2BSRB 1IC4H 4CADA 2XPGB 4P2OC 3MLVL 1RK1A 4GW5A 1Y0LA 5CSZB 3BP6B 3RPKA 5BOPA 2H3NB 4NFBA 1K8IB 2DICA 4RDQF 3IB4A 4WV1C 3ZMRA 4EDWH 1YNLL 1LO5B 3ESVF 3OJMB 3J8F7 3FT3A 3MLXL 1NBQA 3ISWA 1FGNH 1VEMA 4YH6A 1D5ZA 4WWKA 1EPFA 4LCYA 4HIHA 4Y5VB 5FM5O 2X1QA 1Y6NR 2E5EA 3NAAL 1K5NB 1CTNA 1ED3A 4EI6B 4HDIA 5SWZA 1C12A 2HFFA 3QZWB 5LXGH 3O4OC 4NQDE 2UZIL 4P9MH 4HPOL 4LOUC 1KN4L 3TBWB 3TZVB 3WBDA 1XIWB 3MREA 4K3JH 4HGKC 4OCNC 3QXVA 1J8HB 4ZS6C 4LSQH 2B2XH 2FNBA 4PY7A 4UILH 1QPXA 1T66C 4HXBH 5DJ8B 3K1KC 4BKLB 2DL9A 1ADQL 2EDTA 4FXLA 4H0HB 4OCLC 2JB5H 2RR3A 4Z8FH 4ZPTB 1EJOL 2HT3C 5I1CL 1CFQA 4HWBH 3WNPA 1AD0B 1R6VA 4P2RA 4PUBL 1Z0MA 3OGOE 4P5TA 5BV7B 4NZTH 1LEKA 1MCHA 1WBXA 1QRKA 2BY0A 1DN0A 4R4NC 1CL7H 1DDHB 3OHXB 1RY7B 3CXDL 3N85L 3IXAB 1F4HA 1TZGH 2QSCL 2DQJL 2UZXB 1G7HA 3I75A 1JPTH 2BVQA 3VCLA 1KSRA 5C08B 4NKMA 4U6TA 4R4BB 4Y4KD 1H3TA 4PJFF 2IFFL 3NTCH 4RAHA 1PG7H 4JFDE 4KDTA 1YC8A 4NOFA 5A3ID 3WUWA 1S9WB 1HZHH 2CIKB 3UYRH 4KY1H 1JP5A 1BREA 3MRGB 1TVBB 3OJ2C 3EOTH 5IESL 5E2UH 3RDTC 1XGQB 3BVNA 3KPRB 3T3PE 4DOHE 4IRJA 5IVXB 5BMFH 1EEYB 3SQOL 1DLFH 5I17A 2APVA 3I6LD 5E8DH 2BXYA 5GJTL 2LQRA 3RVTD 4BH8A 2HVKB 5IHZB 4HUXA 2CD0A 3U9PH 6CGTA 3MV11 4JB9L 4ZOCA 5JLZB 2Z8VC 3UBXG 5C0JB 2EDQA 3BGMB 3X13B 3QDMA 4EUPG 4DZ8A 3O11A 5IMOB 3RWHB 3EOBB 1EAPB 4UIMB 3GBNL 5KVGH 1WIOA 3QWRD 2X1WL 2JIXB 4NQDD 4X6DB 3H9SD 1ZLUK 3P77B 5I17B 4XPTL 4UV4L 5DJ6A 5C0BA 3TIEA 3KS0H 1KJVB 3FO2A 3ZDXF 2CKBL 1H0DB 4XPAL 1RUKH 1QBML 5LGJB 4DZ8B 4EUPH 3KLSA 1MIEL 4XMPH 2H1PH 4RRPA 3SKOB 1K9TA 4NSKB 4BA8A 4FNLH 1NUFA 4F9LA 4WHYG 1AGFB 1P9MC 4M7LL 2Y36L 1BFOA 5CZVH 3IAGC 2ZUVA 4R26H 4S1SH 3LQAL 4KAQL 5GRXG 5EWIH 5I75C 2HKFL 2NY0B 3LKRB 5JHDB 1A7NH 1IKNA 3PP4H 1JGVH 1AD9B 3ARQA 3WFHA 2GK0A 5CMAB 3U7WH 3OKDA 1UACH 3TBYA 3PWJA 4V1DD 3VH8B 1C8PA 3SGJA 2VDRL 4YX2H 4J3XA 4U3HA 2MFNA 3GBMH 4JQXA 2AI0L 3ULUF 3G6JF 1RFDL 3MLWL 5CINL 1IKFL 5HHNB 2YXFA 3JWOL 4OB5H 3UJJH 2RCSL 4MD5B 5GGQH 4WDIA 5JDSA 4MJ6A 2IPUG 4ZNEE 4P48A 5B39G 3HZYB 2FX8H 4C54A 1CXEA 4PJGE 3QHZH 1U36A 2OK0L 2R0WH 5DD6B 1BFVL 3B9KA 5BS0E 3QO1A 1T20A 2YUWA 3JXAA 5IROA 1BZ7B 1EJ6A 1PD6A 2DRUA 3KGRA 4PJ5A 2X9YA 1PW3A 3LKQB 5IVNA 2X89D 4LKXA 4I4WB 4ODBD 1INDH 3O3AB 2B7DT 4JKMA 5HHQA 4H88L 5JXEC 4PREA 1HIMH 4G6AD 2Z93B 4XXDA 2HH0H 5T3XL 5IQ9A 1J12A 3LEYH 1H15B 3ZZ1A 4FFYH 3DUSA 3C5JA 4L4TB 4HIIA 2YPVH 3GBNH 4QXGL 3QPXH 1IM9B 2A9ML 1KACB 4CKVX 5IF0B 3NCEB 2I25N 4BELD 1XGTA 1QVOB 1UYWH 4HF5H 5FK9A 4LCIL 1DBBH 1SYSB 2H6PA 4RFEA 5GGRB 2A6JA 1LO5A 1NCWL 1HK6A 3KPPA 4JM2B 3S36H 1FNFA 3FZUD 5IFAH 4XMKL 2ZSWB 2VXTH 3X12A 4Q74A 2C3XA 2OP4H 4LU5H 1GZQA 1JGLH 4G9FA 1PVHA 3OG4B 1RPQA 3UTZA 5GGVY 3OJVC 2R2EA 5HGAB 5TDNA 3ULUD 1MRCL 3L1OL 2BNQD 3L6FB 1DEEA 3QAZB 1T83C 3OAUL 4OAWA 4F57H 2AVGA 3UP1A 1EBPA 2XTJD 3NPZB 3BDXA 1UFUA 1EX0A 4LCWB 1WBZB 5KJRH 1IGCH 2VXSL 5DJCA 2YPLD 4N9OB 4P2OB 4AQ1B 2VDMH 2F54B 4PRPB 4OQTA 2EDBA 1RQ5A 2JCCB 3D0LB 1FZJA 3RI5K 3FB6A 2AK4A 2X4RB 1ZEAH 2ZUWA 3RVXD 1BBJB 1P7QB 3QDMD 1PG7X 2AAVA 5HGAA 1W72A 3MLYH 4YE4H 1M7XA 4OJFH 1IGML 5DHYB 3WFBL 3QXDB 1N6UA 5E8OB 2NY2C 3GO1L 4QRPA 4CUCA 4P9ML 3O81A 4JKLA 1KFAH 5F9WB 1LK2B 3NZHH 5K59E 2AEIT 2P5EE 2ADFL 4GAJL 4Z7UE 1B4JH 1MI5D 3OL2A 2HG5A 4L4VD 3T65A 1I1AA 1WEJL 1HH9A 3B5HA 2HJKA 5EG6C 2X4PB 3QA3A 1NFKA 4NHCH 4PD4J 1JPSH 3CX5K 3IDYC 5GSVB 1QSFB 4HWBL 5EUOB 2E9IA 4XC1L 4A2LA 4PD4K 4GUPA 3TNNB 5D1QA 3LKSA 5EIIB 4KRNA 3NFPA 2HJFB 1X5ZA 3BP5A 4JE4B 4KKAD 4RGNB 4X6CA 4P5MA 1CICB 2OR8A 5C0BD 4KUCD 2H8PB 2ICES 3WIHL 2FDBP 3G08B 2BHYA 4PJ7B 3VFOB 4X4ME 4ZO9A 2VDPL 1U8MB 1IC7H 5EA0L 2WUCH 1QD0A 1G1YA 5T3XH 4LLVA 5ABDE 5DUML 4M7KH 3ZL4L 4K8RD 4YHOH 5GSVA 1B4RA 1TDQA 4JDTL 5EU5A 5L7XH 3MR9B 2A9MH 5J8OA 1CT8A 3SY0B 4KJYA 3GK8H 4QXWA 1T0MA 4RMUA 3EAKA 3MRMB 2IAMB 2W0PA 4I4WA 5KVDH 1NCDL 4GRWH 2XRAH 2AK1H 2H45A 2WUBH 3RDTB 2V5MA 3ARFB 3ZHDA 1FRGL 1RIHL 5TJWK 5TGBB 3BP7A 3TIDA 3AAZA 5T1KA 4L4TA 1KLFA 1AP2A 5EORL 3PWVB 5A3IC 2CLVA 4K9EH 3TA3B 3VGBA 4R7NB 2EDLA 3OAZH 4PJAB 2Q6WB 1FIEA 3W0WE 1XGQA 5I15H 1LGVA 5KVFH 1K2DB 4D3CL 5DRZA 1IQDA 5INCA 1RMFL 1FVEA 3ZDYF 1NAMA 4DUXA 3PWPA 4HIJA 3OBAA 2L7UA 3MV9B 3HZKB 5TDNB 4X7DC 2XFXA 5L88H 2PXYD 5E95B 1TJGH 1R3KB 4OZGF 4HXAH 3KLAA 1K8IA 4N8VG 4U05A 3QUML 1FVCB 5IW1A 3C08H 4L5FH 3F58H 3WL9A 1CD1A 4HFWB 4FNLL 3IDXL 2FZ3B 2XZQL 4NNPL 1DL7L 2YEZB 1NAMB 3EDJA 2BNRB 1B4JL 3CVHH 2W59A 3I85A 1DANU 4MZ2A 4UQ2A 3MV9A 1BBJA 3MCKB 3MV01 1W72L 1OAZH 1INEL 2FH6A 4DGVH 4OLZL 1XFPA 1U42A 5HI3C 3TZVA 3KPLB 1HEZB 2R2CA 3U1SL 2V7NA 3MSPA 1U2CA 1XGYL 3MO1A 4WHDA 5E2VL 5ESQB 5HHME 4R90L 4C4KO 3BEWA 4JREC 4MJ4A 2CUIA 2FEDD 4PLKD 5ANME 4DWHA 5HSFA 1HH9B 2R4SL 1TFHA 2OTWB 2FECL 2NY2D 2Q86A 2VZOA 3NH7H 3V79C 5F7KC 1RIVL 4F58H 4YXKH 2FRGP 4XPFH 2ERJB 4LEOA 4G6FB 4MMXC 3LKSB 1A2YB 4M62L 5EIIA 3TVMB 1DQDH 4NQXA 3DUUB 1MUJB 1OTSD 4Y4FB 3D2UB 3NPSB 3PDOB 5IB4A 3IVKA 4R4BA 4CL7A 1WWAX 3QISA 1YDPB 4RNRA 3VXMB 1Z9LA 1BOYA 4KTDL 3VRLE 4BFEA 5J4MA 3CZJA 4JM4L 3F6IA 1ZHNB 2GKIA 4MB3A 1A22B 3BPOC 5HHOA 1PYWA 3NGBB 1QEWA 3NA9H 1T0MB 1VGEL 1PQZB 3V7AG 2D7NA 4OF0A 3G5YB 2HKFH 4Y4HD 3P3YA 4H26B 3MOAL 4D2NA 3B2UD 3QWOB 3WHE0 5TGBA 3TFKC 3WIIH 2P5ED 5JLZA 4ZSOB 4JPVH 4HGWB 4I0PD 4JAMA 3SDYH 4BZ1L 1BX2A 2NY2B 1OCWH 3JUYA 5E8NA 3GM0A 4H1LH 1T7ZA 4QHNA 4GRLA 3CFDB 5HHOB 3FTGB 1C5CL 4K71B 2VXTL 2X70A 3FAXA 5FYJD 1PQZA 5FCSH 3QDAA 4DGIH 1F3JA 2NTSP 3FRPG 1W72B 1BVKB 4L9LA 3QXDA 2M26A 4LSTH 3HPLA 2ADJA 1XGTB 3O9WC 4YDLB 1GAFL 2YRZA 1HWHB 4XGZB 5ALCH 2X4OB 1FO0L 3SGDH 3QAZC 5DJ2B 4Z7VA 4E41E 3C5ZC 3L3GB 5E8EB 2AQ1A 4WU5B 2I26N 2V5TA 3C60B 5F7LB 1C5DB 1KJ3H 1BQHB 3K4AA 5TPWL 3VI4E 1AO7E 3FTGA 1A7OL 4LFHG 4PJ8D 2EYSA 4U1SA 2BNQE 1RUQL 5DYOB 1SMOA 4LLWA 3C8KB 1RIUH 4H88H 4L8DA 5EOQH 2AV7B 5BJTA 3OSKA 5FV1L 1Q72L 1JPGB 1HSAB 1FNEB 1MFDH 1J0HA 2YN5A 2PXYC 3IDNA 3MUY1 1MLCA 1ZA3A 1NUDA 1XR8A 4LIQL 4QXGH 3QCVL 4P2OA 5K9JL 1D9KA 3C2SA 4LKCA 4QXTB 1NUNB 5E0QA 5E8PB 3OKDB 4MA7H 1HEZA 1FG9C 3HB3D 4PV9A 3SDAA 1I7ZB 3KHOA 3BSZL 3BT2H 5IT2L 4PRNA 5T1LA 1JTTA 3AFLA 1JNLH 5IR1B 2R39A 5F1IA 3UBXB 4U6XB 5BS0B 2PXYA 3T3MF 2MPAH 3BZEA 4M3KB 3QXAB 4JFZL 1VDGA 1UCTA 1EIBA 3PJSB 1ZMYA 4NRZA 4K94C 4NC0B 5GISH 3WLWC 2BSSB 4DN4L 2CQVA 5CIPB 1WSST 4MD5A 5JDSB 4EN3C 3ARFA 4CW1B 4ODXB 3QEUA 4NM4H 3RWDA 5FUZH 4JM4H 4LEOB 4UQ3B 3S5LB 3FO1A 2GITA 3QUXC 4NO0A 5T3ZE 1NCTA 3IFLL 4TVPE 1A47A 4Q6YA 4M9PA 5DD6A 3RU8H 4RQQB 2DKUA 1UM6H 3DSFH 2J88H 3OXRB 4ELME 5I1KH 3U2SB 2VQ1B 1PZ5A 5J57B 3SPVB 2A2QT 3OG6B 1AKJB 3MBEC 3MRHB 2H2PD 4R97C 3UZVB 5LWYH 4JPIA 2EC9U 3OR6A 4P5MB 4OZFG 2VRAA 3QHFH 1RJLB 2Z93A 4KGLA 4ODXA 1DBMH 1IGMH 1BEYL 4UQ3A 3CK0H 3S5LA 3I6KB 2AK1L 4LVNB 3RZCC 5DRNB 3TWCL 5FYKH 1C5CH 1NGQL 1QFHA 1HE7A 3MLRL 2BFVL 4P3WA 3AROA 4RQQA 4OKVB 4K7PY 4XBEL 1WFTA 5DA0B 3OXRA 5DJDB 1VERA 4X6EA 2MJWA 2BOCB 3BESR 4FXGA 25C8L 4M7ZB 4PJ8A 1ACZA 5HI3D 1MY5A 3D85D 1KC5L 3WD5L 3GDBA 3NA4A 5MENE 1R5IB 3I9GL 4MXQC 5I8EA 1SEBB 1NGPH 2FD6H 4EXPX 2MTPA 4KHTL 5CJBA 3TESA 2C5DC 4MDIA 1YEGH 4NZUH 3VWJD 3R8BB 1MFEH 5T3ZH 5JOPE 5T1KB 3RKDC 4G9DB 1UA6L 2D7PA 4AMKH 1EO8H 4M61A 3RIFK 1EVUA 2UUDK 1N7MH 1KNOA 3ZE2E 4KK8C 5C9JB 3V0VA 3LD8B 5JORA 5F7YC 5D2LF 5FOBA 2D4DA 2P5WD 4LSPL 2EZ0D 1P7QD 2Y72A 2F54A 4C57C 5KAQG 4M43H 5I1JH 4FZEL 3BRFA 5BO1L 1K8DB 5DHVH 3JSSA 4ZPVA 5HI5C 1I1CA 2P5WA 2I9TB 4I0PA 1QHOA 1JYVA 3UTSB 4EI6A 4HS8L 3UTSD 5T5FL 3DSNA 4Y4HB 1T7YA 3MROA 4FQJL 4JRYE 1RZFL 4L8DB 4LCWD 4XPGL 2HN7B 4MSWB 1FRGH 3L5IA 1CFBA 4HGMA 1GGBH 1UQSB 2EO9A 4QKXB 2YOCA 3QIUC 1CU4H 2FHBA 1I7RB 2H2PC 1MUJA 4YBQD 4NZRH 1H3GA 5C0FA 2H32A 1A6WL 1A21A 3MNZB 4OQTH 1OTTD 4XCYA 2OL3H 3WL9B 4EVNA 2P48B 3BRGC 1QP1A 1T0NB 2KQMA 4KZDL 5CGYD 5D70H 4Y16B 2X4PA 3QA3B 5DQDL 1T80A 3MBXL 3O2VL 4DAGL 1QSFA 3TCXA 4NPYA 1LE9A 5EZOL 4WHCA 2GYSA 3E3QE 3BZEB 4KJQD 3NH7L 3EDKA 4ORGA 2VLJE 3FQNB 4UDUB 2W1NA 5CEZL 3OPZL 3MJ8A 3LPWA 1UWGL 3IXAA 1RUAH 5ESQA 4F7PA 2HT3D 3NMEA 4QRRD 2CLZA 4IMLA 4CW1A 3BO8B 5LJYH 1P7KB 1XF4B 5BVPL 2R0KL 2VDKL 1FFNA 1T3FA 2H6PB 4RFEB 1QFPA 4I3SL 2VZUA 4IEFB 3V52L 3FHQA 2E27H 2W65A 1ZAGA 3BJ91 1FJ1B 3MLTB 1R24B 1OW0A 4XP1L 3SKJL 2BRRH 5TF0A 5ITFB 4BSWB 3U2SA 4X99A 2BC4B 3FRUA 4LMQE 5JW4Q 2UWEA 1Q9LA 1V05A 4NNPH 1VFUA 4S11A 5GGVL 4NQXB 3S98A 4OD3L 2CLZB 5HHXH 2NY7L 4XNXH 4WUKL 5IB2A 4HUXB 4JO2L 5TFSL 5FECA 1YC7A 1NCCH 2DOCA 4J4PC 1T83A 2CGRH 1MFBH 3O6FA 1MCIA 1AP2B 2IAND 4TULL 3TCLA 2W65B 1SY6H 4PJBA 5DMIL 3HUJE 1V3JA 2PN5A 2D0HA 5DS8A 3ZHKA 1PYWB 2VN4A 1A6ZA 3CCHB 3JV4B 4JFPB 1KB9J 5JMRA 3QI9D 1JHKL 3P9MB 1JF6A 4ZXBB 1FC2D 3UYOD 1GL4B 2YD3A 1X6LA 4U1KB 3L3HA 8FABA 4HKZB 4WU7B 4ZNCD 5DK2A 2EH8L 1XR8B 1E27B 1WWWX 2XFXB 3I3BA 3BKYH 2GFBA 5DWUH 1CDJA 15C8H 1LK3H 4FRWA 5ACZB 1F3DJ 4DOHB 1QLEL 3KLAB 1LO2L 3ARGD 1JFQL 1G9NC 1VFOA 5T1LB 1T2QL 3GSQA 3SJVA 1KN4H 4GH7B 1KLUB 1CU4L 3H7BA 1I1RA 4Z7OF 2P7TA 2ZUSA 2ICWJ 2XQYK 3SGKA 4LAJH 5ISZD 4XZUA 5F1OB 2AXGB 3NFPB 2DQIH 3QCTL 1Z6JT 3PP3K 3Q5TA 5D1QC 1E4XI 4XGZA 1HDMA 3SGEH 1KEGH 3MOBL 4Y8DC 5DJ2A 1WFNA 3PGCB 4P57A 4EN3D 4NQEB 2Q87A 4Q2ZA 3FFCB 1RUPH 3FMGH 4QRUB 3C60D 2NY5H 3Q1SL 2BX5A 1NGYB 1ZHKA 2EYSB 2FX7L 3NZ8B 4CMHB 1J8HE 4BUHA 2D3VA 3MLUL 5EU6B 3QRFM 4U3XA 2VQ1A 3VXRA 1CT8B 3SY0A 3VGHA 4XXCC 2ATKB 2IPKA 2VLMD 5D2NB 2VOTA 5GZOC 1NMBH 5DFTA 4PJXF 4NNXB 1S5IH 5MP6L 3VGGA 2HFTA 5L0QB 1PG7L 1BAFH 5ICXB 2M1KA 1B0GB 2YXMA 4PV9B 5FUZL 5F71A 4MHHI 4YHZH 3ULUC 3NZ8A 4EBQH 4HG4J 5KG9A 4M6OL 5E2UL 4ZFGL 3BO8A 4Y4KA 1ETZB 1EUTA 1NSNL 5DC9B 4PJCE 1MFAL 5B39A 3SKUD 4ZSOE 5HJ3A 3G5VB 3G6AA 3KS0J 4PR5A 1F11A 5D4QA 5J9PB 4RNRB 3PJSA 3ZLQC 6FABL 3G04B 4HMEA 2VITB 3NABH 4JFED 2Q8AL 4BSVB 4KMTL 2FGZA 2NY6D 2IANE 2YMXL 3QHFL 3MUGB 2O61B 3LEXA 2F5AL 2GTWB 4U7SA 3G5YA 1IAMA 1QNZL 1BMGA 2K3TA 3QEQE 1HI6A 2NY3C 3GSNB 4NRXB 1S9YA 5FOBB 1CZ8H 3DX7B 3UXFA 4I2XE 2F58L 3O6FB 5T3ZD 4XH2A 3P11L 3SCMC 2EZ0C 3X12B 1OGTB 2P44B 2VXVL 2WWKO 5KZCD 4FG6D 4ZUTA 4IM8A 3GMRB 1KYOK 4ZPVB 2BNQB 3SDDC 5DWUL 3CH8A 4ISVA 1ZLSL 5GISL 2ITCB 2CKBB 4NZUL 5K9KB 4TRPH 2HN7A 1J0ZA 3VWKB 4Y16C 1OAXH 4GSDH 4APQC 1J8HD 5D72H 4DW2L 5K59F 1X5XA 2DN7A 4OBRA 3B9VA 2BOCA 3E2HB 5DD3L 1NFDF 4JM2D 4OM0H 3S3SA 3PHSA 4LEXL 5F1NA 1JF1B 1J0KA 5EWIL 1OP5K 3TF7C 3GSVB 1G0XA 1CDUA 3EDDA 3MLXH 5EO0A 5I1JL 1U3HD 5HI4C 4IOFC 1FH5L 3EOAA 4L4TD 3TT1H 1MHPH 2ZG3A 5ERWA 4F7CB 1OL0A 2ITDB 4M61B 2AJSL 4G3YH 4ORGB 4UOW1 4LCIH 3J7HA 5ITBH 1HSAA 4QRPB 1JYXA 2FB4H 4JRXB 3PWNA 5LXGL 1A7PL 5GS0H 4CMMB 1RZ7H 4P2RE 4D9QE 5LGKA 3O4LB 1KENL 1QYGH 2UZIH 3BZ4A 4IRSD 4BKLA 1KGCE 4MXVE 3OXSA 1DBJH 3MLWH 5DHXB 2CO6B 2OP4L 2O5YH 1FFNB 1MOEA 3DV6A 3M1BB 1YEIH 1EGJA 3UO1L 3RX5A 5EO0B 1ZHKB 1S7UA 1BAFL 1NMCB 4KRPC 3UEZA 5B8CC 3DX8A 1C1EL 1ZLWK 4ACPA 2QQNL 2FX8L 3AMLA 5D2NC 3VFSA 4CVZA 3O2VH 2EIZA 4GUPB 2C3VB 1TTFA 4AEIH 1HHHA 3V6BR 4F7MB 3T0DA 1TCMA 3H8NA 4FTVD 5LGHH 4LLYA 5H94B 4N0CC 4I5BA 5T3ZL 4P4RA 2YUXA 5KSAD 3O2WL 2AJ3A 2PNDA 1UA6H 4LGPB 1P9MA 4N9GA 4O51A 5DZNA 5IB2B 4EVNB 4X8JB 5C0CD 4EZMA 1J8KA 1DQQB 4RAUA 2EYTB 1S7WB 3MLVH 4JG0L 3ZKMD 1AR1D 4OJFL 2Q76A 2YD5A 3TPUA 1OB1A 5EU5B 4YHML 3JV5A 3ULUL 1L7TH 5IROC 4GG6A 3G5VA 3CDYA 2I07A 3VXOA 4U0RB 4ALAL 3T1FB 4XNMB 1A7QH 1AGCB 5JA9A 4JDVB 3SHSA 1EH9A 1IC5H 4OZIA 4L9LB 2ZUQC 2W9DH 4HKZA 3B2UC 4RAUB 4MB5A 4Z7VB 4PRDB 4NJAL 1E27A 1VPOH 4O2EB 2Y07L 5J1AB 4GW1B 4NWUL 3C60A 3H42L 4CDHA 5EPMB 5DJDA 4HXBL 3BQUC 4Z5RA 5DMIH 5JO5A 2DM2A 1PY4A 1IC1A 1HYRC 1YYML 3KNBA 3ARBC 4UIKL 3LS5L 5DYOA 4GLRI 3I3DA 3TJEH 4N8VB 1HILB 1CXLA 4OUUB 1AO7D 2OR7A 1QRNE 2N7BA 2WQRA 4XZUB 3ARTA 4NBZB 2UYLB 2XWTB 3GNMH 1YJDC 3IF1A 4RX4D 2BNQA 3BN9D 1I7TA 3VG9B 2JIXD 4KK5C 4JGMA 5GRVL 3NPSC 2JCCF 5I8CA 3MRKB 4X6FB 2AABL 4K94H 1JZ6A 4PRHB 4GQPH 3EGSA 4P99A 2GJ6E 4ZXBD 4G3YL 2KL6A 3RVUC 3REVB 4OZHF 3U0TB 1AGFA 3LPGA 4E42B 4Y2DA 1T89C 4U1KA 5EIQA 5KSVB 4HX1A 2AEPH 3MJ9H 5C7XL 5JHDA 5D5MF 5CIPA 1HXYA 3EOTL 4FQXB 4L3EB 5GRYA 3PNWB 4WW2F 1YUHB 1H5BA 4KAQH 5MERB 4DEPB 4X6FA 4MYWB 5DC4B 3V7MA 2ICEA 4Y5VC 4NC1E 5J12C 3GM8A 3CFCH 1NCCL 4PJGB 1X5YA 4B7IA 3RIFF 2YN3A 3SJVB 1B9ZA 2R1WA 3D3VE 5LQBH 1M05B 4Y4KB 4ODTH 4KI1A 3MCLL 3DV6B 3O3EB 1CYGA 1CFVL 4KKBC 2EEAA 4IDJL 2W0LA 3PL6C 3L7FB 4MQ7A 2NNAA 4PJFA 3EFFB 3T4AB 2CH8A 3O6FC 5MERA 3T0EB 1ZLVK 2QBWA 1X5AA 2CDEA 5DHVB 1BBDH 2A6KA 3K2UL 3OZ9L 2E6QA 2ICEB 4F7EB 3QIWC 3H3PH 2I60H 1AC0A 3W2DH 5IB3B 5C07E 4AY0A 4KUCF 3D2UA 2PUQT 3IXTB 4IMLB 4JHWL 3SE8L 2CMRL 2XZQH 4X8JA 5FYLL 4YLQT 3BRDA 2IQAB 2X4SB 5GRJL 4U1IB 5GZOD 2YBRA 3VXMA 4LKXB 3KPSE 1RU9L 4XH2B 4ZYKA 3AUVA 4NNXA 2B0SL 3B8YA 2NNAB 3NIDF 3ULVE 5F6IB 4XVTH 5SX4I 3T0EA 4FG6C 2P45B 3ZSSA 3DECA 3CC5A 4OLEA 5D7IF 2MNUA 4U3CA 2CKBA 3LQAH 4ENEC 4GG6F 4O58H 5JNYA 5KG9B 3MGAA 4YK4C 4TSCL 3OAYH 1HINL 1F13A 3VRJA 3TFKD 3LSOA 3RZCB 5F3HA 5FK9B 1EMTL 5ADOH 4ZSOA 2A6JB 3Q5OA 4O2FB 2EDOA 5TE6L 1Z9SA 4J6RL 2F8XC 4ELMB 2HTKC 5EPMA 5DTFB 4RFNB 1F6AA 2P5WB 5I75B 3RPIB 1JTOA 2OZ4H 3UTSA 3GBML 4Y4HA 2PTVA 2O26U 1RJCA 4WTZA 4HJJL 1ZS8A 2ZCKL 2AK4D 3ILQC 5CEXA 4HUWB 3D3VD 2NXYD 5DGRA 2GTZB 1RZJL 4K71C 3K74B 1UZ8B 1VFAA 1WBZA 3VJ6A 3HUJF 3CNKA 1MH5B 3JWOC 3ZKXB 4Q6IA 1KCRH 5I8OL 1F5WA 3U6RA 4M7JL 3GSNH 3OAYK 4NKIH 4OFYD 2JCCA 3D0LA 3NA9L 4EQ2A 3KDMA 2I24N 3BXNB 3HA0A 3GSQB 4NQCA 1FZMB 4NJ9H 4NN7B 3RBGA 4JQVA 5H2BA 1S7RB 3CFCL 3VXPA 1XGYH 5E2VH 1N6QL 3TT1L 2XWJA 4RA0C 1NDMA 1CVSC 1X5IA 5H37H 1SBBA 2EXWD 2IALA 3HC0B 2EH7H 2N56A 1ZA3B 4XNUL 1S78C 2IPTH 1MH5A 2YD6A 3FKUS 4Q2ZB 1JF1A 1JRHL 2YPVL 3MZTA 1X5LA 2ZKHL 4KGJA 3WKMH 2YPLE 4P5KA 4J2XA 4RIRA 1I7ZA 1RIVH 1IJ9A 3RA7H 1BHGA 1S7QB 3ARXA 2H26B 1S7RA 5JZ7C 3HG1D 4UNTA 2DIAA 4HSQA 3HE7A 4UT9L 2I07B 3OGCB 4HMCA 5JQ6H 3KJ6H 5FYLH 3BP5B 4NT6B 4OCXH 4YBLB 4JDVA 3HC0A 4U2ZA 4LU5L 1HQRA 5AYQA 4FFVC 4LHUG 4MQ7B 2FATL 3V6FA 1JVKA 5CHNA 1T1XA 2UVEA 2YK1L 1CDHA 4DW2H 3DURB 4IRSB 2GIYA 1RUQH 2NLJA 1L0XA 1OAKH 2YD4A 3L7EB 4WHYH 4Z7NE 4LPXA 5JA8B 1GIGH 1NPUA 3O6MH 3EYVB 3W39A 1U8JB 5DS8B 2X41A 3P4NA 2ICCA 4KK6D 4ODUA 5F93C 3P9MA 3ULUH 5HYQA 4FABL 2EKJA 4HS6B 3UTTE 3TV3H 4MVBC 4ZYKB 4I5BB 4YDJA 4FP8L 4J6RH 1I9IL 3M07A 2AJSH 5L8LB 1V7ML 4K8RH 3GKZA 4OFPA 2HLAB 2NLJB 1YPZE 4YWGL 3VA2C 3JV0A 2OZ4L 5D2LE 4J4PD 3W11C 1KELH 4R7NA 2PYEE 4LL9A 4H20H 4YC2B 4F8QA 2VZ1A 4W4OA 1FAKT 1NDGB 4PJ8B 3BHBA 3U0TA 5CP7A 2C1PA 4PP1D 3GZKA 4WJ5B 1QSEE 4ELMA 3HLAA 3ES6A 1JL8A 4NHCL 3PHOA 2FWOA 2E7CA 2GEEA 1ZV5A 1ZE3C 4D3CH 4YBHA 5E00B 5C07A 4U31A 3RY4A 3KPSB 1YPZB 4K8RC 1ZS8B 4I3RH 3W5MA 4ZNEA 3SDXE 4PG9A 4HLZH 5CUSL 1QLRA 1MIML 3LH2H 1N6QH 3MRCA 4P3DB 5JO5B 4PJGA 1FNGB 5HVFB 1RHHB 5D96C 4JGUA 3FQTB 3W5NA 1CLOL 3PF2A 3HUJA 3GHBH 1TQBB 3HMXL 4JFHD 4U7KA 5HYJE 2YEZA 4U1GB 1D5IH 4I0PB 1I8LC 3LKOB 5L7XL 1NGQH 2XZCH 4RGMB 2YD8A 1DL7H 4B7LA 2NW2B 2WBJD 32C2A 2PCPA 3BSZH 3TBTA 3KPLA 4MSWA 3KYKL 5ICXA 5CJ8A 1BFTA 5FUCE 1UQSA 3CVHA 3KAAA 1MCFA 4CMMA 3REVA 1FNGA 5DMJB 1MAML 3EO9L 4KZEL 4XC3L 1AXTH 3AS0A 4XP9L 2J5LC 3BEWB 1JPFB 3O3DB 4J1UB 4IS6B 5FGRA 4PBXA 2BERA 5EBGA 4G80B 4QY8B 5D93B 2X4NB 2LV4A 5KANG 5AEAA 1KTDA 4M93C 3AVEA 3MLSL 1B88A 4RDQG 3G04A 2DLHA 3FFCE 3AM8C 4RAVB 4IDJH 1T03H 3IFLH 4OGAD 1PFCA 2W07A 2AK4E 2CRZA 2XA8H 5CJXA 4PLJD 5I1KL 4LDEB 3REWA 1NEZG 3QEQD 1N26A 4HIXL 1XF1A 1K3ZA 2YR3A 4UNVA 1NCUA 5C9KA 3JTSA 4MXVF 5LCVH 1OHQA 1MQ8A 4S0TD 5DVKA 2EDJA 3QDJB 4N0FA 1U58B 4QHMA 1A4JB 1U91B 3L7EA 4PGCB 4MXWH 1WZ1H 2HAZA 2MWCA 3WS6C 5EU3A 4O02L 4BSWA 4GG6B 1OD9A 1G6RB 2GW5A 4ZUVB 4H20L 1XGUA 4XNMA 2NY4B 2P42B 4XBEH 4CJ1A 2YS4A 2OL3L 4YFDB 2MHAA 3RHWF 3MLPA 3C2AL 3CSYA 4K23H 4NP4L 4XAKE 4XNZC 3I02A 3WXWL 5J06A 3P30H 2KZ1B 4F57L 5GJSL 1S7XB 2VJXA 4LDOB 3WJLA 4OCRL 2VZSA 4KROC 5EZOH 2DYPB 5SWZD 2IQ9L 3KPQA 1A8JH 3S37H 5DD1H 4LASL 1FGVL 2X05A 5I0ZA 3FONA 1QFWI 3OJDB 4Z5RB 4ZO8A 1UWGH 1UENA 1T6VN 2IF7A 4GXUM 3CXDH 3DVNB 1MWAB 5CJ5A 2JJTA 1I8KA 2Q3ZA 5DUPH 4MJ5A 2ITDA 3MUZ1 1T04A 1DJSA 2GQHA 3MLYL 2BVYA 5K93A 3VFTA 2EEBA 3WFBH 4OKDA 5J6GB 4PJEE 3FO9B 4P2RD 3K4DA 3ZTJH 2VNCA 4D9QD 3BZ4B 2LU3A 2AXHA 3FFDB 2E8YA 3MJ7A 3OXSB 2WZPD 4N90D 5HXMA 4C56D 3HG1B 4M7JH 4XVSH 3HHRB 1AJ7L 3QI9A 5EC2B 1QR1A 2J6EA 4TUKL 1E6OH 2WBJA 1T7VA 3DX8B 4L1DA 3AM8A 3BYTA 3C8KA 4HPOH 3TA3D 3SQOH 4P9HL 4XI5C 4K3JL 3LCYA 3JVGA 1DLFL 2XNAA 3RQ3A 2E6PA 5KSVA 1MVUB 1I8IA 4P4RB 3T09A 5C0CE 5B3JE 1T21B 4NQEA 2A38A 4O51B 2JB5L 2CSPA 1VGEH 3BD5A 3QQNA 5DFVC 3ARFD 3QFJD 2J8UA 5F8RC 4YIQA 3BUYB 4IRZH 1A3RH 1BJ8A 3MYZA 5TE4H 2IAMD 3CMOH 1IC7L 1D3CA 5KOMC 1SJHA 5A2JH 1YJDH 3HAEG 4WTZG 4CDGC 2ESVA 4N90E 1FCCA 4WY7L 2XWJB 3B6SA 3LQMA 4L8BB 4UT7H 3SJVE 2X4NA 3IDJB 2CLRA 4OI8A 3GK8L 1J9CT 1EVTC 5ACMA 2MPAL 5C0NC 5IBTH 4JFZH 5C2UB 1KLGB 2Z31D 4B41A 1KCUH 1P4IL 5F7UA 2CDEB 4MXWL 1EUUA 1LO2H 3T0BA 3SDDD 1TPXC 4PRDA 1IGYB 5J1AA 4GW1A 1P4LB 4D9LH 5IESH 4HWEL 2IQAA 2X4SA 4NKIL 2FSEB 2GUOB 3CH1B 4JFDB 3B2VH 1AHWC 3MOBH 5EDXA 3G6JB 3STZB 3G6DL 3IDJA 1UM6L 3F7YA 3K8LA 4G8FA 4AEEA 5GS1A 4OZFB 3ROOB 5CBAB 3IYLW 5EO1B 3UDWA 1FCGA 2VITA 2Z91B 3VMOA 3DV4A 4OTXH 1FNSL 5H37G 4WWID 2CGRL 3OB0H 2EKSA 3T2OA 1YMMD 4NBYB 1HHIB 3IJYA 5DVOA 5F96H 1LHZA 3K1DA 4JFXA 5HGDB 2L0DA 1MCSA 4G8GB 3VRJB 4YGVA 1U8JA 2G5BB 1YMMB 1M6OB 3IGAA 3RNKB 3ET9F 5E9DE 1OF2B 1ZSDA 1WIPA 5FYLD 4Q9QL 5GS0D 3ULVF 3P4MA 5ETUA 2XY2A 5I8EB 2RCSH 5D7KD 3IT8D 1RZ8A 4PRPD 2NY3B 3EHBC 5D7IE 2F54D 4D94A 4LSUL 4YR6A 4PGDA 1BWWA 1UCBH 4GBXB 4UDTA 3PIQB 2CKBH 3KPNB 1QSEA 3BKYL 3BWUC 4K7FB 4ISVB 1EK3A 5IVZB 5AZEL 5DZLA 2WW8A 3PNWA 3QHZL 3MLZL 2R23A 4ZDHB 4WGVB 2MOVA 5CEXB 1DQJB 5INDA 1LE5A 4UAOC 1S9VB 3FQWB 5DA4A 2HA1A 2IH3B 3HZVB 4P9HH 3SDDB 4RBPK 5KVEL 2E7HA 3P4LA 4HKXB 3QUXB 5CUSH 4HHAA 4TNWK 6FABH 5L2KB 4YHKH 1R5WB 3RWCB 3BKMH 2F5AH 3C6LC 4MQXC 3RU8L 3SJVD 2Z9TA 5EC2A 4QOKA 1BWMA 2VE6A 5C0AD 5SWSD 1ZGLP 4APQA 4Z6AT 12E8H 3MRBB 4ZTOL 3X11B 5I1DB 1TMCB 3VU2A 4XPFL 4LLUB 3SDDA 3DX6A 4P9HC 1LP9A 1NFDE 5DQ9A 2W91A 1ORQA 2GK2A 4LRNL 1XGRA 2IGFL 4JFHE 4DK3A 2QHRH 3FQTA 1BD2D 4HJGB 5F7HA 1IGJB 4KMQA 4PRIB 4NQCE 4Y2OA 1X5FA 1I1YA 5TQ0H 5MP6H 3VGDA 4OLXH 1HNGA 4PG2A 3VGEA 4PRHD 3SEPA 2H26A 1OAXL 5IEHB 3MC0A 3SE3A 3MLSH 5D93C 4JFYB 5DD5L 3KXFD 3KJ4C 5EOCL 1PDKA 3QEHB 4N0YL 2B39A 1MCPH 4PS4H 4E41B 3BMVA 4KVCH 5HGBB 4E0RA 4NBXB 2AJ3B 1BFVH 1CTOA 2YRLA 3IDYB 3BIKA 3OPZH 1JPFA 2K7QA 3O3DA 2OR9H 1H8SA 2ZWLT 2C1OA 4HC1L 3DROA 4O2FA 4XBGB 1WTGT 4CGTA 2Q8AH 2AJVH 4X5LA 4JM2C 2R0KH 4LQFH 4P23B 5IEHA 3CAFA 4EDXB 1FNHA 3LRSA 4QT5A 4FFYL 4ONGH 4O02H 3U4EA 4F15B 1GC1L 1E4KC 3QPXL 2BRRL 3HZMA 1CDIA 1WQVT 4I18A 3REWB 4WFGE 2B5IC 3VXUB 2NW3B 5IUSA 4PJDE 4HUMB 1H3VA 1RZFH 4S0SD 3UTTD 4MWFB 1V7NL 2R4RL 3WFCH 3ARDC 2HVJA 1GGBL 1U58A 3MODH 3HS0A 4JFFB 5A2IH 3QIBC 4KJQC 5GS2H 2QADC 3GIVB 2L4OA 3MLZH 5E5RB 4JKWA 2BVPA 4OQTL 5IQ7H 1A6ZB 4JFPA 3UTPE 4QHLB 2V2WA 3CDGB 5I30L 1FZMA 1SY6L 2ZUXA 4PJHF 1UWXH 5F44A 4YDKL 2NXYB 5DEGB 5KBNC 4QTIH 1NLDH 2E7BA 1AY1L 1OVZA 3EYFA 4WU7A 4IDLA 3O6LH 1I7TB 2MQ0A 4PYHA 3FB7A 2KUTA 3L5XH 4LHUD 5TF1H 3BQUD 4M02A 1IGFL 4JFFA 3RGVC 3BPLC 1S9VA 3GIVA 4L3CB 3B5GA 3VFVB 1ZHBA 2XTLA 3GJFK 5AWNH 1MF2H 1S7QA 5IBUG 5LBSH 3RZCD 1FN4B 2EE6A 3QQ4A 5KVDL 3BT2L 5J1TC 2JB6A 5IT2H 2WNGA 4JZOB 3BP4B 4ZUUB 15C8L 4F9LC 3PGDA 1IVLA 4XWOD 1XEDA 2BSED 2RJMA 2E9BA 2WWMC 3B4NA 5AYUL 1HDMB 5FDWB 1HXYB 2O5YL 4KH2A 5AD0B 5C0GA 1MFNA 3AB0C 1S78D 4KU1A 4M48L 2Z4QB 1KCVH 2ARJB 2OX5A 4FTVE 4IRSA 4K2UL 1JNNH 4BJLA 1IGYA 4LF3A 4HH8A 3KPRD 4NQEE 2WBJB 4OZHE 3VWJC 5TE4L 4F9PC 3STBA 5IMLB 5ESVB 2Y6SC 1LP9F 3SKMA 3H3KA 1PLGH 5D7SL 4ZFFB 3BP4A 3S4SA 5IP4A 2AV1B 1KJMB 2J88L 1L7IH 3VH8G 4WY7H 4U6YA 1MVUA 3F7YB 2E7MA 1G7IA 3MLUH 1NC4A 2BK8A 4HLJA 3F7VB 4JANA 1F2QA 4BQ9A 4KKLC 2ORBH 4QHUB 2W0FB 5A43C 4XAKD 1KN2H 3LN5B 1IZKA 5DHVA 3G9VA 1TJGL 3F62A 1D6EB 2Y23A 4F7EA 5EULV 1ONQB 2GSGB 4HH9B 4DTGL 3LQZA 2VXUH 3BH9B 3ILQD 2V6HA 1BIHA 1NGZB 1OW0C 3L5WA 3WNMA 4BFIB 1W0WB 2JLLA 5B39B 1KOAA 5HJ3B 1SM3L 2V2XA 3DXAA 3LN4B 3QIWB 2D2OA 1D7FA 4OGXH 3L3IA 4QHMB 3ROLB 2WUBL 4P23A 3GSOA 3G6DH 2FWOB 3EHBD 4JFOA 4EDXA 4BSVA 1U8IA 2C7UB 4JPWH 2VWEE 3ARGA 1C7TA 4R6UA 2Y7QB 4EIGB 1FPTH 1KEMH 1U8KB 3F12A 4K7FA 5C07D 4ETYA 3OX8B 5FGBA 2DD8L 4A6YH 2OXHA 3HZMB 5I30H 3RWFA 2VERN 2CK2A 1HI6B 2B4CH 5I0DA 1GVIA 3PUCA 2MSPA 1QNZH 3KLDA 2V17L 2WWMD 1Z5LB 5IHBA 1ND0B 5E08H 1DBAH 2PTTA 3T3PF 5FM4A 4P4KD 3JZ7A 2DYPA 1N59A 3KPQB 1LO0L 4JLRB 1VADB 4HBCL 4G42B 4MNGE 4OGYL 4Z7QF 3GMPB 1C5BH 4QOKB 1ZKAA 1UCBL 2FIKB 1YN7B 3MRIB 4NQTA 4MJ5B 1VGKB 2CMRH 2IBZX 4U1HB 4LCCC 1UZ8A 3DX6B 1HYSD 5J6GA 2DI7A 1I4FA 1OF2A 1WAAA 3R1GH 1MCKA 5L8KB 5I9QB 1EERB 1KJ2H 4J1UA 4Z0BL 4OSUH 3FOMB 4PJXB 4YEEA 4X7TB 3GMOB 4YHYB 4WWKC 3B9KC 3DIFA 3IDIB 4JRYA 4ZO6A 4RX4A 4LP4A 3T2NL 1FN4A 3QQ4B 1WWCA 3HC3H 1AQDA 5HPMA 4ZUUA 4JFYA 3M45A 1ES0B 4EN3B 5F7FA 1MHPL 2NY1D 4UU9B 1KB5A 3S35X 3JWDC 1OARL 1I4FB 4MVBD 1F6LL 3MCLH 5DSCB 2OMNA 1FNAA 2VR5A 3OF6D 3CFJB 1M71A 1CICD 3B3IA 3BW9A 1H3PL 4J3WA 1UWEL 3U36A 4DJMA 5DR5L 4YXKL 3D0VB 3RZWA 4L4VA 3VFSB 4CVZB 4HZLB 2CKNA 1CE6A 3LHPH 2KBGA 3ZDZE 1FG2A 2R2HA 1UB6A 4FTVB 1OPGH 3KYNA 4FS0A 4YAQA 1YY8A 1G7IB 5C09A 5I8OH 1WLHA 1YMHB 2Y1VA 3MYJB 4RGOH 3T77A 1OAQL 4NNYB 1JHTA 1Y6MR 5E2WH 4OLYL 3TYGL 1FL6B 3G5XA 2N1KA 4KTDH 1ONQA 2GSGA 1UADC 4HH9A 4FQ1H 2FYYB 1X5KA 5D72L 3RX7A 5GJTH 3LQZB 2XA3A 3BAEL 1IILE 3BH9A 3VDAA 1SVCP 3UPRA 1D5MA 1YNKH 2AXJA 2ESVE 3ZE1E 5EN2B 4A6YL 4Y5YB 1B3JA 2BVPB 5DEFA 3SO5A 4QHLA 4WUUD 2D7MA 1OQOA 4ODUB 1ZXQA 4LNRB 3KG5A 3G6JA 4OV5A 1UB5A 3VG9C 5ESAB 3U46A 3DO3A 4LBEA 3EYFB 4NQVB 2DQGH 1CD0A 4LHJB 3RA7L 5ENWA 5FA4B 2NY4C 4JPVL 2Y7QA 4P2OD 5I19L 5I8KH 2OXGA 5EUOE 4MQTB 5KW9H 5KSBB 1PKOA 4KKAC 4S1DC 1JGDB 4RA3A 4M4RA 3BVNB 3KPRA 3DGGB 3VFVA 5E94B 4IRJB 3GSUB 3WE6A 3W9EB 1YMMA 4RMQA 3O8XD 1JTPA 3MRDA 4R9HA 4X8XA 2JELH 2AJXL 1RV6X 3V5KB 3IDUA 5E2TL 4OLXL 3PQYB 3ES6B 2A1WL 1O5DT 4L8SC 1MHHA 4UOW0 3RUGB 5JZ7D 5FA4A 4DVRL 5I76B 4JJ5A 5HDBE 3P0GB 1GSMA 5BVJB 2FIKA 3ELAT 4R4ND 1IC4L 4OCSH 1MI5E 2EEDA 3K3QA 4AEIL 1KEGL 1AC6A 3RY6C 3W0WA 3L5XL 5F70A 5E70A 3O2WH 2IANA 1F4YH 4M93B 3IDMA 1CF8H 1DUZA 3LPFA 3MGTA 5LWYL 5EOQL 1JUFB 4Y2DB 3WJJC 1Q94A 2DLTA 5D8JH 1UKTA 2DQTH 4JQIH 4K3EH 2HLFD 4ODHH 4NO0D 1R5VA 3DIFB 1YEDB 2CRMA 3QXWA 3RY5A 3V95A 4JFEB 1I8MA 4L9LC 3WN5B 5D71L 2OTPA 2Z8WC 1E4WH 2FX9H 2SEBA 1ORSA 3LKPB 1SQ2N 1KCVL 2VLJD 5A16B 1INQB 2NMSA 4K2UH 3VI4F 3IJHB 2BY1A 1J0YA 4PGZA 2JB6B 3L5WB 4BFIA 2AW2A 3Q2CA 3JWDL 2OMBA 3CU7A 1T2XA 2R0WL 4GKSB 4LHUB 4PJ7F 2HP4A 3RL2B 4WUUB 4FFZH 4WW1B 5SV4A 3PQYE 1IL1B 4F2MA 1TETH 5IKCA 3ECBA 4UB0L 3QPQD 3S5LG 1NLDL 4OV6F 5E6YA 1XF3A 3ARSA 5GS1C 2QL1A 4XBPA 1MHEB 4N68A 2C3WA 3GRWL 1YY8B 5T1KD 5B38B 3BUTA 2JJVA 3WFEH 1IBGL 1NFDA 3OKNB 3CMGA 4G8GA 3TNMA 3ARZA 3SKMB 3W2DL 2AGJH 2AV1A 4FZEH 2AJUL 1MEXL 3ARBB 2VDOL 1YEFL 3BFOA 2AERT 2DIJA 1RZ8B 1AO7B 4JLRA 3UBXI 3B5TA 3P11H 3VXUD 4MZ3A 1A14H 1TVHB 3E0GA 4GKNA 2MCG1 2GCYA 2ID5A 5JW5B 1CWVA 1I9RH 5EOTA 1EHXA 4POZD 43CAB 5AYUH 1MLBA 4MCYA 4TNVK 1YN7A 3MRIA 3MLRH 4HMDA 5I6XC 1KEML 1JGLL 3QFDB 3V4VH 2UVFA 4LSRL 3HR5B 4KK9C 4JDZA 5IJKC 3L3JA 4DN3H 4AEHH 5KS9B 4DGYH 1WFUA 3D9AH 4U0RC 3DO7B 1DUYB 1T5WA 4XXDB 5IBLD 3I9GH 4UOJA 2C4FU 2GSIA 5E08L 2BSTA 2R1XB 1WZMA 4JZJA 4X5WB 1OSPH 3V5HB 2Z31A 3EZJB 1DFBL 4WI9A 3WS3B 5L9DL 5BRZD 4J8RA 4GKNB 1KPRB 4I3RL 1UVQA 3CU1A 1L7IL 1SJXA 2P5EA 3MRNA 4Z7UA 4E5XB 5KANI 4MGXA 2R0ZH 4NO5B 2OSLB 2IMNA 1W0VA 4OZHA 1QVOA 1G9NH 2ZJSH 3KLHD 5DRXB 2OTUA 1B0RB 3IU3A 3EYUH 4KWUA 5CJXC 4Y88A 4I3SH 2ZSWA 3QIUD 2VDLL 1XGPB 4XMPL 2EXYD 3DVIA 4HV8A 1KENH 1QYGL 5FYJL 2GY5A 3VFMB 5C2BL 2IANB 3G6JE 3MA7A 3NFNB 1HZHL 3UYRL 3SE8H 4PRIA 3KYAA 1NLBH 4KY1L 1I1YB 3TYFA 1JI2A 4LLDB 4Q9BA 2KKQA 4R26L 4ESKA 4FQHB 1HSBB 2VB5A 4ZUWB 1BZ9A 1ZT7B 5HHXL 1OGAA 4XCEB 2VLJB 4POUB 4PJHB 4PJHE 2AEQH 5D7LD 3ZYJA 1A7NL 4JO2H 4PLNC 5JPNA 2WP3O 1Y18B 1S7TB 5BV7C 4Y5YC 3MV8B 4YZFE 1T21A 3QFJE 5DUBA 1LEIB 2YHGA 4M5ZH 3T8XA 1W0YT 4HV8B 2XV6B 4AENA 5SV3A 3WN5A 1N0XH 3MA7B 3NFNA 2IPTL 5BW7C 2BXZA 3I2CH 2XWBA 1SJHB 3WIHH 3CLFH 4DKFH 2VDPH 5IMLA 2WUCL 3WKML 1UGNA 1AQDB 4TNVF 3EO1B 1XR9A 3FT2B 4NC2B 2WMPA 3OGCA 2ZCHL 5DJ8A 3RBSA 1CIUA 1X5HA 4X98A 4KQ4H 5KSAC 3RJQB 1IAKA 3SDCA 4DVBA 4L4VE 5E6IA 5JR1H 1OWWA 1KLGA 1ZGLA 4PRPE 5E9DA 1LQSR 5JOFA 3DURA 3GKWL 1QLEH 4MAUH 1RIHH 5D7IA 1P4LA 3TNNA 3INUH 4JHAH 5IJVA 4FQCL 4D8PB 1Q9WA 3JBG7 1S7VA 3P4OA 1AIFB 3P4NB 1YY9D 4MA1B 3O8XB 3NCFB 1JBJA 2XN9A 4YNYA 3GB7A 4MAYC 3UTPD 5HYQB 3R0MA 4XNYH 3V5KA 2DWEB 1BIIA 2XKNB 5AUMA 3BEVB 4O4YH 3VI3E 3DX9A 4QLRA 1OAUH 4L29B 5DQJB 3QT2A 4IRZL 3FJTA 3BZFB 1NANI 5KSBF 2X44D 2HMID 2YA0A 2DJSA 3RKDD 2Q20A 3CMOL 1J0JA 1MFCL 4XVUD 3QQ3B 2Y06H 2VLRA 3K4ZA 5ID0A 5IM7A 4XNUH 2F15A 4JVWA 3L95A 1L9NA 1SJEA 1MNUH 4KMLB 1JZ7A 1BQHG 5IFAL 3P4MB 4OV5B 1UWEH 1P4IH 4U7MA 1HKFA 2Z31B 4L29A 5DQJA 3WS3A 1NBYA 3QIUA 4N1HB 1IAIL 4QCIA 2HTLC 4PTUB 4Y4FD 3PWVA 3TJHD 1A1NB 2PO6B 4HKJB 1SBSL 5D7LE 5IVZA 1NLBL 4YUEH 4FQLL 3KJ6L 4OZHB 3QQ3A 5KN5A 4OCXL 4M6OH 4ETQB 2XXCB 5ID0B 5IM7B 2JF1A 5E4EB 2JIXA 3WNOA 3MMEA 4YBQC 1GXEA 2Y4SA 1MCJA 4LGRB 1H3UA 4P2QB 4X4XA 4YGAB 4OLVL 3QRGL 5A16A 4IIQC 5F7EL 2YK1H 3K80A 3U1SH 4Z76B 3SE3C 3QFJB 3C9NA 4NYLA 2HWZL 3UPCA 1KGCD 4NHUB 5DK0A 2XICA 4PIRF 1G1CA 1GIGL 1OP9A 3MACL 3N1GC 3RL2A 5KSAA 4L8CB 1CLOH 5J0BA 4ZD3H 5IGXH 1EGJL 1AE6H 1FORH 2CJUL 5BZWA 5KSUA 3VD5A 1U8QA 2DBLH 3DXAE 3ZTNH 4FP8H 4LLUA 4MAYD 5IW1B 3IDMB 4LVHB 4H1LB 3A6BL 5DQ9B 4F7TB 5BW7A 1DANT 4V2CB 3FFCD 5JIPA 1D9KC 2R56H 3DJ9A 1F4WH 1MHCA 4YDIH 2IADB 2YA2A 1IGJA 2ZUUA 2DQDH 2PF6A 4MLIA 3JWDH 1AXTL 1P7HL 1L6ZA 3L3IB 4GMSL 5DGQA 3VFRA 5EZJA 5JXED 4YHNB 4L8CA 3H9YA 4OLUH 2MCPH 1NCAH 2QADD 4MAUL 3E6HB 3JV6A 2E7LA 2VSDA 3H2WA 3ARGB 2H32H 5EOTB 4G6KH 1FZOB 3MUJA 1G6RH 5C09B 4JN2B 2D0FA 2RHEA 1EAJA 3B43A 3H9HB 4HWBA 5F7DA 3QUKA 2GI7A 4LCWE 1DVFC 4F3FB 5C0EA 4B0MM 5JW4R 3UX9B 1D5BA 4XPBL 4PJAE 2OL3B 3QEGL 4GMTH 5JQHC 4HKBB 4YHOL 2AKRA 2W60B 2HFFB 1CK0L 3O9WA 4OTXL 4R0LA 1A1MB 2BCKA 4BZ2H 5L6YH 3FHAA 1CFSA 4K3DH 4HT1L 2F53D 1Q9WB 1NMAH 7FABH 1P5UA 1QQDA 4HS3A 1TTGA 1J87A 3VXTB 4Y4FA 1G7JA 1WZLA 3SGEI 1UB5B 2IGFH 4AZ8A 1U3JA 3RVTC 1SYVB 4AG4L 1N5YL 1YYLH 5GGTL 2QQLH 3I02B 2BVTA 3HCVB 4M1CC 4ELMF 4XCFL 5D71H 5HYJB 3AS1A 4KJPD 2FX9L 1C16A 2F74A 3G5ZA 1MCDA 1K4CA 4DN3L 1CS6A 4JQXC 5FHBL 3P9LA 4XVJH 3L5JA 4FQLH 5SWSB 1X6NA 3GSNL 5B22A 4PS4L 4K7PL 3MRDB 3N0PB 3WHE1 1I8LA 4PLJC 5LGHL 5T1DH 5K33A 1RMFH 5HHOE 1LDPL 1IM3A 3QRGH 2PTUA 1FYTA 5HDOA 3ZT7A 5GGRA 3VFTB 1ACYL 1XCTA 4CNIB 2R29L 2WAHA 3RUGA 4DKAA 3ARRA 1S7TA 3HMWL 2VISB 4AM0B 4P59L 3QNZA 5KN5B 4O00A 2X70B 4L3CA 5ECJE 4IJ3B 1UJ3B 5I1LB 5JXAH 3BKCL 1GGYA 1LVEA 2XWBB 3F58L 3LEVH 1TNMA 5I16B 4KVNH 3S96B 1Z3GL 5LG1A 2XPGA 3MUHL 5FGCB 2A0LC 2UY6A 3B9KD 2NY3D 3WLBB 3PGDB 4Y16D 4X4ZA 3R8QA 3S35L 4L9DA 1INEH 4ZS6D 35C8L 3GRWA 3IU3B 4QYOB 4I1NB 4G7VL 3ULSA 5HYIA 1EFXD 4HD9A 1HHGA 4Y5VA 2Y07H 3QH3B 3H42H 1MREL 1DTUA 4YIQB 2QR0A 3CZFB 4R97B 1X4YA 3ESUF 1NAKL 2YSSB 1D5XB 2NX5A 1U8OA 4PJCF 1MRDL 2I27N 4YDKH 3LQAC 1MQKH 5D2LA 3VG0H 4JO3L 1CICC 1ZT4B 4AIXA 4KROB 4NN6C 4Y1AE 4APQD 2V7HA 4X80H 5ID1A 3EO0A 3FN3A 1QBLL 2HT2C 3O2DL 3O3UN 4EI5A 3IJSB 4NUGH 1W8OA 1MLCB 2E6JA 3X14A 2YPLB 1QFOA 5FGBC 4WUUA 2VDQL 4IHOA 4IOIA 1SHMA 2OQJA 2H2SC 3ARGC 3CIQA 3U46B 4QTHA 5E4EC 5CBEA 4BZ2L 3MNVA 4MCZB 3QG6A 2VLKB 5EUKB 3ALXA 4XBPB 3H9SE 1NMAL 3PGFH 2WV3A 4ZO7A 2WM0A 5LBSL 4LRIA 2FEDC 1UH4A 3I3EA 2PW1B 3L9RA 1XAUA 4ZUSB 1RULL 3LZFL 5CEYB 1CE1L 1BOGB 4MX7A 4CRPA 2VL4A 4N8CH 1LP9E 5F89B 1NCBH 1AGEB 1EO5A 1GC1H 4QO1A 1XR9B 3FT2A 4LVOC 2JTDA 2ZPKL 4Z9KB 3LN4A 3QIWA 5DJYB 2WIMA 4NN5B 3RP1A 5GGSY 2BVOB 1JI1A 2FO4A 3UJTL 1F02I 1C7SA 4TTGA 3EJYC 4G9FD 3FO1B 1G0DA 3QDGD 4GAYA 4NKOB 25C8H 2D9CA 4HWUA 4MNQB 1V7NH 2R4RH 4UBDD 1U8IB 1KC5H 3WD5H 4MNHA 3HRPA 3STLB 4JFFE 1J10A 4U2YA 3VXSB 2XTJE 1UZ6F 1B0WA 2G9HA 3BIAX 4XAWH 4GKOA 1U8PB 5DD0L 2BY2A 3ZKXC 1BP3B 5F9AC 5F96L 1HHJA 4MA8L 4H25A 2CR3A 1OCWL 2XN9E 4P4KC 4WNQB 1B90A 1K4CB 3TJEL 4EKXA 4GXVH 1U8HB 4DKFL 1XH3B 3QFJA 1YEKH 3AAZB 5DRNA 5CFHA 4NHUA 1ZVSA 5T33L 1MJJA 4MNHB 5I1HL 1IGFH 5FUOL 3STLA 4JY5L 2ZCHH 2CXKA 4KQ4L 3DETC 4UT7L 1A9EA 3RWHA 5BO1H 4PJ5D 2R23B 2DM3A 1DQDL 3LOWA 3QCUL 1HXMB 5ALCL 1WF5A 3PL6B 5LAXB 2OTUB 4AQOA 5C0IA 3MFFB 3VE0B 4R3SB 3CUPB 3L95B 2ZOLA 3KXFB 4XPGH 5DRZB 3GKWH 3GJEA 1FL3B 4PJBE 4D9RD 4YO0A 4Y4KC 2J4WH 4JY4B 1FFOB 4FZ8H 4ZFOB 1CFNA 2J8HA 4LPTA 1IRAY 5I73B 4LSDA 1EO7A 5I9QC 1CBVL 2VE6B 2VC2H 3EYOB 1KIPA 3EW3B 3MJGX 5D7LA 3UAJD 3ECBB 3ZYZA 3R06A 4KK5D 4YHPB 1CLZH 5HDQL 4G6AC 2DYPD 5I71B 1LEGB 2BOBB 1ZT1B 2FEEI 4HAFA 3F7RA 1F4AA 4PUBH 3KXFE 1LP9B 3QCVH 4Q7DA 2ZOLB 3KXFA 12E8L 4UV7H 2VDQH 1KPVB 4QGTA 1J1PH 2I9TA 1RUAL 3RHWK 1F00I 1TZHB 3T1WA 2NY4D 5FKPA 5HVGB 1LEKB 1P69B 5FHAH 3SDXA 1DEEB 4OAWB 1KN2L 3BH8B 5DMGD 4GAFB 4D9RE 4PJCA 1IT9H 3A0OA 3EO1A 4KI5C 1BJMA 2J1KA 2MCPL 3V52H 5KSUB 1IEHA 4Y89A 5AG8A 3VFPA 4S1QL 1MCOL 4C56A 2FGWL 4JHWH 4ELKA 1YMHA 3IU4H 1FE8H 1O7SA 1T0NA 3RWGA 1R3JB 4GW4A 3HCVA 3I6LE 2BHZA 1JHTB 4Y16A 3SDCC 4O9HL 4NQDB 4KFZC 1U93B 4MJ6B 1RD6A 4M8QB 4XNXL 4UINH 3W0WD 1VA9A 3HKFA 3TBWA 3V5HA 5D7JB 5EN2A 5SWSA 1MJUH 2K1MA 2LTQB 3U7WL 4HWZA 1XCQB 1FVDB 1SVZA 3NFSH 3EYSL 1WC7B 1KTLA 3IKCB 5BZDB 2CPCA 3IVKB 3C8DA 1WISA 1HN1A 2EH7L 1XF4A 2VDRH 3MFGB 1QO3B 3T65B 3WFDH 3FT4A 5B8CA 1KB5H 1K3IA 4G6JH 5GGUB 4AG4H 2J8UF 5DR5H 2QQLL 4MA3A 3AXLB 4U1LB 4DK6A 5TE6H 5IHLB 1HCFX 4H1LG 3VXSA 1DN0B 3VWKC 4E9LA 2F19H 5F72S 4X99B 1J1XH 3OKLA 3FQXB 1F4WL 2R69L 4JRXE 2I9LA 5IFJA 4WW2B 5FYLE 4BQ8A 4POYA 4WUUE 4ONHA 1VCAA 1IM9A 1FSKB 5JQ6L 4UBDC 1NGPL 2FD6L 4LPUA 2IH1B 4HAGA 2EDXA 2D7TL 4M9OA 4F37K 1SYSA 1HOCB 1RZJH 1T4KB 1T2QH 1OLLA 3O6KL 1QLFB 4CVWA 1YEHL 1J0IA 5DO2C 4TQEL 4PP2B 3FB7B 5E1AA 1KG0A 3QUYB 4RWYH 1YECH 4RMSA 1HXMA 4QWWC 1ZLWH 4JVPA 3DPBA 1Q9OB 3O6ML 3ULVC 3MFFA 2R2EB 4X6DE 3VE0A 1QR4A 3DSFL 3N50A 2X6MA 5FDYA 1DN2A 5SWQA 3TC9A 5GSRA 2H9GA 3FMGL 1CK0H 4NOBA 4HC1H 3L3HB 3HI6H 1ZANH 3TA3C 4Z76A 4PJ9B 5D1ZA 1RK1B 4GW5B 5E2JA 3O3BA 4NCC1 3A6CH 4H8WC 1Q94B 4M00A 3C9NB 4G5ZH 4M1DH 3LKRA 2DQCL 5J11B 1T4KA 4C83A 4HS8H 4ZAKA 4LSVH 3WIFA 2CDGA 4Y8AA 2DM7A 3WSQH 1YNTB 1JMZA 5E6IB 5HGGS 3S35H 3MNWA 2F8OA 1CFTB 2AI0H 3TWCH 1FZJB 5BZWB 4TN9A 5BRZA 1G7QB 2FLRT 1ZHLA 3V6ZA 5L2KE 5D7IB 4UTAH 1JNHA 5CJOL 5INCB 1NAML 1MRCH 3D39D 1X5GA 1EEQA 3V8OA 4AIOA 1Q0YL 2F5BL 5TE7H 4JQVC 4K07A 4C83B 4EOWL 1H0DA 4HWEH 4X80L 2D7OA 2OK0H 1JK8A 4NUGL 1NSNH 5D7SH 3FFCA 3PABA 4MJID 3U4AA 2DQHH 3JV6B 4J3UA 1A6TA 1F42A 4Q6IC 3S8WA 2FR4B 1N7ML 5IR1A 3GI9H 2APWA 3FOLB 4HFWA 2PXYB 5D2LB 1F2XK 1E28A 3BPCB 5F7DB 2BY3A 5CILH 1X5JA 5TH2B 1NFIB 5C0EB 2APTA 1LILA 4HULB 1NGXB 1VKXA 1JGEA 3MV9D 2Y25A 2EXWC 2OBGA 3E1F1 5CS7A 4V1DB 4N8CL 1FGNL 4XP1H 3F7QA 1Z3GH 5DJXA 1RZGB 1U8MA 5I71C 5IBUB 1CZ8L 3PWJB 3VA6A 1UYWL 1A6TB 4HF5L 4HIIB 2FJGB 2JJSC 1GOGA 3UZEA 1WEJH 4LAQH 5C6WH 4P3CH 1RZKC 4PRAA 4M6NL 3EO9H 4KZEH 3RGVB 5GRZA 5CEYA 2XXMB 3H0TB 4KK9D 1T7XA 1R3IH 4JY6B 3T04D 5FYKE 1ULVA 2JJUA 3PHQB 2P8MA 4NO2B 5F1KC 3X17A 1FC1A 3HRZB 4RZCA 3NOIA 2A1WH 3QDHA 1CGTA 1T22A 5FEBA 1E4JA 2HVKA 4JO3H 4KJWC 3FQXA 3MBXH 3OKLB 3RAJH 2I9LB 3WJJA 4WW2A 1FAIL 1FP5A 4XNZB 5DK0B 3GSRB 2NZIA 4QF1B 4TOYL 3BKML 1J11A 3PDOA 4NO5A 2RFXA 2H3NA 1FV1A 4JDTH 3QIBB 4XTRD 1HOCA 3H0TA 3OTTA 1NEZB 3NIGE 4OLWL 4JRWA 2CIIA 4G8IA 2FJFA 4IMKC 4HUNB 4FFWD 1R5IA 2ORBL 1YEFH 4F7TA 1ZHNA 5LCVL 1AGDB 1QZ1A 3WMSA 5DJ6B 5C0BB 5A2FA 5C0BE 2WIIB 3RL1A 4WO4C 1MJ8H 3ABZA 4G9DA 5FF6A 4YHNA 4ZTPH 3VWKA 3UZQA 4PJXE 3O41A 2DMBA 1E4WL 4X6BA 4UTAL 1QSFD 1LNUB 4TUOA 3KYKH 5FFLA 2E7LC 1ES0A 1N6VA 3AMKA 4EN3A 1BX2B 3LIZL 1C1EH 5FIEA 2JJTC 1KB5B 1BFOB 4EOWH 5EBWA 3TBVB 4ZPTA 1ZVYA 1I1AB 1Q1JL 4YEFA 4L1HA 4GKZB 2DLFH 3MV7E 2HJKB 3ZKND 3ZYOA 5GGTA 1FGVH 3UTOA 3VD3A 2J3SA 1BF8A 4NQDA 5C6TH 3S97C 1BQUA 4R0LB 1I1FB 4I0PC 4U6VH 5EU6E 3EYOA 2OS7A 4P46D 2OCFD 5H35A 3N06B 5DUPL 3ZO0A 1QA9B 1FQ9C 3OB0K 3MO1B 4OM1L 3QXTA 1I7RA 5EA0H 3U7YH 1FO0A 3BI9X 3VXTA 4XP4H 3QUYC 4Q9CA 3I75B 4P5TD 4X4MA 2LU7A 4ONGL 4IOIB 1C5BL 4YFLI 4U1MA 5C2BH 1NANH 4ZAKD 2JK5A 2CUHA 3BD4A 3TO2B 1AGBA 3OB8A 4KKCD 2Y9RT 2Z92B 2C3HA 2XRAL 5I1AB 5EBLB 1T1ZA 1NEUA 5HHMB 3HE6C 4KDTC 1OP5H 2JJWA 2R2BB 4NCDA 4CBPA 3GSXA 2A6DA 5EORH 4ONOA 1UH3A 4BH8B 1T20B 5J7CC 2KH2B 4S1SL 2NY6B 1IGIH 4U1MB 3MV8D 5HDQH 4PRNB 1G7PA 3U4BL 4W6WB 5IVOA 2Q76B 1KB5L 2R4SH 3NCYP 1UH2A 2NYYC 5D7KE 3GMNA 4PBWD 4DFIA 3ARWA 3GIZH 4NUJA 3QULA 1J1PL 5E94A 1UEMA 1UJ3A 5I1LA 3UTTA 1J1XL 1TQCB 2VZVA 2R69H 1ERNA 4OZIB 4XX1E 3IKCA 2H9GB 2X89A 4RWHA 2ESVD 2MKLC 4CJ0A 3G08A 3PWPB 3P0VL 3DTXB 5C3TA 1EZVX 2EECA 4HXAL 3QIUB 3UJJL 2VDNH 5GGQL 2NTFA 4I48B 1F4XL 4U1LA 3AXLA 4RBPH 5D7JD 1MCOH 5F7WC 1OPGL 3S37X 3MR9A 2FGWH 2VR4A 3CFDA 4GRLB 1PKQE 3W0WB 3CCHA 5EU6D 3CZFA 1AKJA 2XKSA 3ARFC 2IBBA 3MMEB 3DRQB 3NCJH 2RGSA 1EEYA 4DGVL 4H8WL 1JNNL 1JE6A 4UINL 3TH4T 1OAUL 4C56E 3RL1B 3MOAH 2IFGA 3SBWA 1CF8L 2V5SA 1ZLUH 2LAAA 2A9NH 1BECA 4PJ7E 1QLFA 1MFCH 1RK0A 4M5ZL 2VLLA 5F3BA 4FMFA 2NTFB 1GJIA 2MQCA 1BQHA 4PY8I 5FCUH 1CGWA 1MELA 3EOBA 5D1XB 4QRRE 2VLKA 1X7QA 1U8QB 4QRRA 3Q6FA 3V5DB 1OY3B 4X6DA 2R0LL 1NKOA 1JWMB 3TBVA 4EIZC 1OTUD 1D9KD 4LCYB 1IEAB 2QHLA 1J05A 1S8DB 3OV6A 2D03H 3B8SA 5F89A 2VXUL 3WN5C 3E8UH 3OKOA 4XB8A 4D0BA 3WS6A 1ZTXH 4Z77A 1I75A 4G43B 4J3OC 4V1DA 4MDJA 4HIEB 1RUMH 3SDXB 1D9KB 1NH6A 2FLBT 3MREB 4GAYB 3RWJA 4PRIE 2YPKB 2AXFB 1P53A 2VQTA 2FJGA 4RMTA 3L1OH 4Z78A 5KVEH 4GAGH 1VSCA 3CLEL 3MRRB 3FQRB 1NFDB 5IW6B 1WAAF 2IPKB 3PWLA 3RVWC 4HKBA 4ONFL 5C6PB 1CICA 1MCCA 3MXVH 4HIEA 2F54E 2NY5C 3C5SA 1PKQA 4Q97A 1DDHA 3OHXA 1ZANL 2V7NB 2FHCA 3WNKA 4WFHD 3MV7B 2P5WE 4L8SB 1QQDB 1T1YB 1MJJB 3N9GL 2C9AA 2P8LA 4P2QE 5IB3A 1FVDA 5IHUH 4QF1A 1V3KA 4NDMA 5BZDA 5IF0A 2A6DB 4Z78B 5DVLA 1I3VA 4NKMB 1KV3A 1RZ7L 5E7FA 4PJIF 2CRIA 3O4OB 1NEZA 2FJFB 1YMME 4AL8L 4OF5A 5GGUA 1NGXA 4NCC2 1JGEB 3D1MC 1VKXB 4JZJC 1OM3L 1PY9A 4Q9QH 1G9ML 1ZA6B 3WUWB 5E8NB 1CG9A 1NCAL 1MIEH 4N1EA 5MEND 1F58H 4JY4A 1SJVA 4CN1A 4Z0BH 3D85A 4LARL 4YUEL 3L6FA 5CKGA 2DQFB 2FL5B 1CXIA 3QUZA 1A9BA 1MCPL 4PGBB 5F7MC 1UC6A 4WFHE 5IB4B 2OSLA 4XC1H 3MRJA 3G9AB 5C0AB 5C8JA 3KYMA 2UWEE 1OSZB 4H8WH 2FHFA 3DYOA 4OZ4A 5EFIB 1MY7A 2EE9A 2OR9L 1KIQA 3WDHA 3PHQA 5DVNA 2BDNH 3T0ED 1FBIL 4K94L 5GS0C 3QUYD 4U1JA 4KUZH 5JTWA 3D39E 1F6AB 3PQYD 5JMOC 3MACH 1ED3B 3EYQD 4WCYH 1YN6A 1BLNB 1JHLL 5FOJA 1MFDL 3GHEH 1KYOJ 5SWQB 5HHMD 1KIUA 4LLDA 1UJTA 2R0LH 3OKKA 2DBLL 1QPPA 1N2RA 2VQUA 3WO4B 3B9AA 5GGTH 1Z9MA 3HTLX 4TVPD 3QIBA 3UYPA 4JRYD 1ROWA 3C6SB 5FECB 2VL5B 4Y1AB 3VXNB 1UJ3C 3VJ6B 4ZAKB 2CIIB 4G8IB 1QHPA 3O6FD 1FVCA 1UKQA 3QDGE 4LRNH 3MV8A 4QXTA 5E8PA 4PGJA 4YDIL 1XT5A 4YPGB 5EZIH 2QHRL 5I66B 5DEZA 3VRLF 2ED7A 1A6AB 3KDMB 4YFEA 4D0CB 2Y5EA 3QJFA 4NWUH 3UTZB 3MROB 4OCYH 1JWMA 1MCBA 4OLYH 1BVKA 5B4MC 2W9LA 2ZOKB 3Q5YA 1PGRB 5CWSB 1ZT4A 1NDMB 4NM4L 4X6DF 3GGWB 5CSZA 4LCWA 3AB0B 1FIGH 1CQYA 5C09E 1WJ3A 1JRHI 4MDJB 4KI5D 2GK0B 4TOYH 3HE6A 1FL5B 2E9WA 2OQJB 3S88H 3IS0X 4UMGA 5JHDE 3WDIA 3K2UH 3OZ9H 4MCZA 3MGOB 5EUKA 4M43L 1X9QA 2X09A 3QJFB 2P49B 2DQGL 3UC0L 4Z18A 1LE9B 5BRZE 5AWNL 2YRPA 2AV7A 5BJTB 2WLZA 1ITCA 1B6DA 3HMXA 5IJVB 1I7UB 5IFJB 1QA9A 2HFGL 2Y5TA 5HHNA 3ME0A 2GJJA 1FO0B 1MJ8L 4WVRA 4I77H 4WDIB 1LK2A 1PBYA 2PYFB 4FFVD 5DRWA 2LE9A 4LQ1A 2F53A 1JN6A 4KHXL 1LWRA 3BEVA 4WI5A 4A6YB 4LKCB 4Q9RL 3LKNA 4POZC 5C0DA 5HPOA 4EQ3A 4MNQA 5I1EL 1JGUH 1NAKH 3VGAC 5KOVC 4O58L 1FJ1A 1KCSH 1ZGLM 5D70L 5E1AB 5F88B 2DBJA 4JCMA 5I1AA 1Q1JH 1QBLH 3MRLA 1K2DA 2DLFL 2Y5TB 1DBKL 5IG7B 1AGCA 5HHQB 4X6CB 3S3JA 2Y06L 1P5VA 2WBKA 4TVPL 5BV7L 3FN0L 3AS2A 4CU6A 4PJDF 1ACYH 3TIEB 1G9MC 4NQSA 5ANMB 1OWRM 3ARVA 4JAMB 1MNUL 1FSKC 2VUYA 3AC0A 3DNKA 4PTUA 3OQ3B 2VDKH 4BFBD 5FB8B 1YNTA 3GHEL 3LS4H 3QUMB 3W9DA 4PLOB 1UZ6E 3SKOA 1D5IL 4KJYB 1KFAL 3MXWL 3BGFB 1KCRL 3OAZK 1FZKB 3V0WL 3OR6B 3VDCA 4XP5L 3VMPA 4I13B 4Y4HC 5DMKA 4MNQE 5CEZD 3LDBB 2WBWB 2P47B 4NQCD 1BLNA 2GJ6B 1CLYH 3MZGB 4LPWA 2ZCLH 4TSBH 4DCQA 5C3LD 4XP9H 5FB8A 3ARDD 5I8CB 3OF6A 1A6WH 3PABB 4MD4A 5JIKA 3AS3A 1A6VH 4LLQB 2EDWA 3TBYB 4X6BB 4NRXA 4FQ2L 2VL5A 4RISH 4MA8H 5JW4N 5HHVH 2NXZB 4LLAA 3MNZA 3H7BB 4QRPD 4MJIB 4BK4A 3EYQC 2YD1A 2QJDA 4BQBA 3MRRA 4WWKB 1OGTA 3P77A 5ADOL 1JMXA 4GKZA 3WHXB 1CGXA 3S88L 2G2RB 4R7DB 3A6BH 4HZAA 4FQXA 4L3EA 3HZKA 2VUOA 1H5BB 3VFRB 4XWOC 5DJXB 2LVCA 5C0RL 5D6CB 2VIRB 1E4KA 3TVMA 1J8HA 2R8SH 3PGFL 2I5YL 2ICWB 2X4QA 4J3VA 1NCDH 4AEFA 1FHGA 2R1WB 2D0GA 1VB9A 4PRAB 4JN2A 1UM5L 1I9RL 1T2JA 1NCBL 1IEAA 3F5WA 1CFQB 1YDPA 4OSUL 4X7FC 3WHXA 3MGOA 1G9EA 1QOKA 3WYRA 3MTRA 1UG9A 2AKRB 2W60A 3QR2A 4Z95H 4M8QA 3QJHA 1T22B 4AEHL 2FO1A 3P30L 5GJSH 2XQBH 4OLVH 4PP1C 4NJ9L 5KVFL 1JGVL 1HHKB 4I9WD 4JG1H 5F7NC 2DD8H 1U3HC 1OARH 3QNYB 5JIIA 1PZ5B 3KYMB 1IMHC 1F90H 1V7MH 4NFCA 1I3GL 4RFNC 3DYPA 1S5HB 3O0RH 5E9DD 4I3GA 2H41A 4OGZA 4WEBH 1YEKL 5IBLC 2ZKHH 3GMLB 4AL8H 1OM3H 3TO4D 2AQ2A 3JWOH 3LEXB 4OB5L 2GTWA 3MRLB 2P24B 4JY5H 2IAMA 3M17B 4ZFOL 5M95B 2EH8H 3TO4A 4N9GB 2X40A 4M6AA 3B9KB 1DVFD 2ADJB 3HPLB 3VXUE 1N2RB 4G6FD 4OI7A 4EBQL 3BP7B 3TIDB 3DTXA 4TUKH 4O9HH 2QSTA 5E2WL 3SE4A 2EC8A 4IRJC 1NQBA 2CUMA 1KG0B 1A6PA 3CLEH 2ZP0T 1EAPA 4UIMA 2Q6WA 5ACZA 4X7EC 4D0DB 2XN9D 1QEWB 1Q9LB 3LRHA 2Z31C 3H6JA 3F8UB 3RRQA 1MAKA 2YMXH 1WV7T 5DHYA 1I1FA 3QUZB 2DKSA 1KNOB 3LEYL 5CWSA 3MXVL 4P49A 2YKLH 1FVEB 1JPGA 3QWOA 1JCKA 1RUPL 3CLFL 1OGAE 4GS7B 4P0DA 1EV2E 4JFFD 3ZSTA 4IJ3C 3WIFB 2XZCL 4UV7L 1KIQB 5F21B 5F9WC 5LGJA 1FL5A 1OGAD 4AT6B 4AIZB 5ILTL 2LU4A 1R3KA 3SDAB 5J13B 1GH7A 4D0DA 2ADIB 5F6HI 2JK5B 35C8H 2GY7B 4ZXBA 3SBWC 1G7QA 5CGTA 4WEMB 1IKNC 1IT9L 4WI2A 4PV8A 3QXAA 5CD5C 4L4TE 4OZFH 2BNRA 1RAMA 4JO4L 4C59B 1CR9H 3PWNB 5ID1B 1H5BC 1AQKH 1LO4L 1OD7A 3RWEB 2IALB 5JHLH 3WLWD 1N64H 3V2AR 1AD9A 4RGNC 3DI3B 4XCYB 4OD1L 4DVRH 2F53B 1C08A 4OM0L 3H7LA 4AT6A 4PRPA 5D6CA 1EZVY 4LEXH 1B0GA 1URLA 4GO6B 3VXQA 2VLKE 1AHWA 2ICWA 2X4QB 4NQUA 1K4DA 2G75B 1SY6A 1PZUB 4PRBB 1FNSH 4LLWB 4NM8L 2EIZB 4YXLH 3FQRA 1FH5H 4GBXC 3F5WB 2DTMH 3G6AB 4PR5B 3EYSH 4AH2B 2ZSVA 3AY4C 4K3EL 5HD8C 4Z7QE 2FB4L 2MMXA 5I1GL 3NACL 4ZXBC 3HE6B 4DKDC 1P7KA 1CI5A 5GZND 5BS0D 3VXQB 1M7DA 4HEPG 3Q3GA 1JNJA 4DGIL 4Q9RH 3VRIA 2CLVB 1CDYA 3MLTA 4KKNA 1TENA 1JWUB 5ITFA 1I1AC 5IWLA 1CDCA 2NPLX 4JKKA 1KCSL 5EZIL 3DX7A 1TPXB 4HQQH 4JZNB 3SGJC 2AJYH 3GI8H 4OCRH 1ZA6A 2IQ9H 1SEBA 2A77H 5DRWB 3AU1A 1JN6B 2VLRD 3KVQA 1KJVA 2JJSA 1WT5A 1SMAA 3OAUH 1ZVSB 3IAPA 1HHIA 3IJYB 4Y4FC 2PR4H 1TJHL 2HWZH 3LB6D 3NCYS 5C9JA 3IDGB 4OCSL 3BKJL 3VXSD 5D1XA 3DHJA 1IBGH 5CEZH 4M7KL 1NDGA 2VDML 1M6OA 4QRRB 2X9WA 5LAXA 3V5DA 2VAAB 3ARBD 2Q3AA 4YQXL 4N0CD 5I74B 3HI6L 3N1QC 3KPPB 4JM2A 4WI7A 4ZTOH 3UC0H 5KS9F 1ZEAL 2IAMC 3QCUH 5SX5K 5CD3B 3RX8A 5ILTH 1KBGL 3BN9C 1RULH 3AREB 3LZFH 5T1MB 3RNQA 4ODHL 4LAQL 4OF6A 1X3DA 4I77L 2WP3T 5JUEH 1VPOL 2EDRA 1MRFH 4FXKA 2BVUA 4XRCA 3VH8A 4BK5A 4LPYA 5JOPD 2P7TB 2QV2A 4DGYL 4WO4D 3WXWH 2NY7H 1FLRH 4KV5E 4TUJA 3CFKB 4Z7VF 4EJ1C 4U1NB 3M1BA 4CVXA 4NRYB 5CGYC 5ICZB 1GOFA 3AGVA 2EC9T 1P7QA 2X4UA