3WIHL

Crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFGAGTKLELKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Roundabout homolog 1
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihL01
3V5HB 4UB0L 1Q0XH 3WV0A 3MUY1 3RVTC 1Z6JT 2BVTA 1MY5A 3RX7A 1A7QL 2EKJA 4LU5H 3SDAC 4APQC 5D71L 1ZT7B 4NKDA 1UWEL 3FFDB 4Z76A 1P5VA 3O2WL 2Q6WB 5EO0A 5BS0E 1EAPA 5GS0L 4M6MH 2EE3A 2Z93A 5IESH 3QPQD 1SYVA 1GCFA 1YPZA 1DL7L 4LOUC 3VFWA 3FFCB 4PY7B 4JO1L 2H9GB 2EDRA 3TEUA 4V2CB 4M1DH 3UBXB 1KCSH 1IEBB 3H9HA 5ACZB 4WUKL 2D9QB 3VDBA 4LPXA 4EXKA 1A3LH 5CKGA 2APBA 3S34H 4JFFA 1MJUH 3QDGD 4X0KA 4HQQL 5DURB 4NN6C 5C0EA 4OZIE 1DBJH 4ESKA 1GGYA 4JJHA 2QSQA 5CKAA 1KIQB 3QXAB 4WI2A 3O6FB 4MD4A 1Q9LA 3H7BB 1NFKA 2JJTC 1HSAA 3X11B 3MRBA 1C8PA 4Z7QE 1OWWA 3NFSL 3SE3A 2I24N 4LMQE 3Q5OA 3WDHA 5IF0A 4HXAH 4P5TD 5F1OB 3OJDB 2AVGA 1P2CA 2VDKH 4HIIA 4Y4FB 5D7JB 1INQB 1RQ5A 3GSUA 5EC2A 4QRRE 4ZSOB 1QVOB 3MNWA 5EZJB 1RZIB 3P4OA 4PD4K 3EDJA 2Y1VA 4XX1G 5FYKL 4WJ5B 1RULH 4R96A 5C07A 4OLXL 1MSPA 4RMRA 4Q0XH 3N1FC 4I2XA 1RZJL 2VLLA 2YD4A 1CFBA 3QPQC 3F7RA 3GJFA 3KLSA 1DANU 3OKDA 1L0XA 5C6WH 4FP8H 4NRXA 3TBTA 3C09B 2DLGA 5F8QC 3QDMB 1XGYL 4NPYB 3SJVB 1IKNA 2WIIA 5J3HD 5EU6A 2R0LH 4P5MA 4U1LA 4AENB 3SE9L 2C3VA 3DBXB 3I02A 4IJ3C 3MA9L 4Z7VE 5T1DH 5DI8B 5B21A 1Q94A 3DO3A 3B5GA 1JMXA 1I7UA 3D2UD 2XA8L 4P9HL 1GSMA 1E4XH 4JHWH 3WJLA 1QFWL 1B2WH 2HVKB 1UENA 4ZNEE 3D3VA 3QIBC 2WUBH 3AGVA 2ZUTA 1IGIL 4M9OA 5HVFB 2VQTA 4PR5B 1EK3A 5D2NC 4TOYH 4P5TC 1ZLVK 3UPAA 5IVNA 4P2QD 1WEJL 4J1UA 4Z7WE 1DDHA 4EI6B 5DJ0A 1T6VN 2AKRA 1YEJL 4MJ5A 5E2UH 3WFEH 5EG6C 5I1EL 1QSFE 1MCJA 1T2JA 1TETH 2Z91A 4LSSH 4HZAA 3TA3B 1BVLA 4RX4D 4YQXH 4CADA 4YHMH 3HCVB 2AERT 5FUOH 1YEFL 1LEGA 5J1AA 3RGVA 5I1LB 3C5SA 5GISH 1DQQB 3ALXA 1I7ZA 4M43L 1R5WA 3QIUC 1HE7A 1MCLA 5TPWL 3WLWC 1T03L 5J3HC 1QG3A 3FQXB 4WHTB 5E8DL 5T1KB 4XBPB 1WFOA 4XX1E 3DV4B 4I0PB 4UTAL 2EXYD 4KI5E 5F1IB 1ACYL 1C1EH 1XR8A 5LBSL 5I71B 2EKSA 3MQIA 5KSAB 2VXVL 3IXTB 3TZVB 1S9XB 4G6ML 2D9CA 1J0YA 2MPAH 1EO5A 4PJEB 4S1QL 4H20L 1RK1A 1XF2A 1D5MB 1JV5A 1RZKH 4OD3H 1ZSDA 1REIA 4GG6E 4RZCB 4XPHH 1U91A 4KTDH 3ZL4L 5I1DB 3WS3A 4WV1C 5JR1H 5B3JE 5E5RB 1RZGB 3MOQA 4JPKH 3P4MB 5F3HA 2AW2A 2W9DL 3LV3A 5DMKA 1PZ5A 1D6VL 1NCBH 3LRSB 4WCYL 3W0WB 3VFRA 5K9JL 3FB8A 2BSED 3OKMA 1KCUL 5DVLA 1S3KH 4NO2A 1JVKA 2W60B 4BSVA 2J6EA 1QSVA 3IVKA 4QXTA 4JREC 1BVZA 2D31B 4TNVF 4LCCA 4XBGA 2NNAB 4QXUH 3CUPA 3QO0B 2AK4E 5JW4N 1U8OA 2OTUA 1Z9MA 2C1PA 3QWOA 4Z6AT 1N2RA 1QFUL 2EYRB 5SWSB 4P3WA 1KEMH 4D9RD 4NQDB 5FO9B 1YQVL 5FF6B 2XN9E 4N0UA 4NN5B 5GS1A 1NBZA 1UQSA 3RAJH 3KGRA 4S0SD 2EXYC 3CVIH 3L5HA 5L9DL 2D0GA 1JPTL 4MB3A 4TPRH 1EJ6A 2XZAH 1I8IB 4L3EB 5IK3B 5KANG 4LCYA 2LU4A 3BVNB 4G8FA 4XZUB 4YAQA 4GRWE 5F9AC 1ITBB 3HMXL 4PJ8B 4QHNB 5BZWB 5CJBA 4DTGL 3PGFH 4OIBA 3HC4L 4ZTOH 4PJDB 1G0XA 1K6QH 1TJIH 1D5BA 3RKDC 1IGML 3DGGB 3PXHA 4HX1A 3VXNA 3LB6D 2BHZA 2EDFA 4XC3H 1JF1A 4WFGD 4LLDB 3T2NL 3FFCE 3OKNA 4QKXB 1WZ1L 1EFXA 1GGBH 1N5AA 2GITA 1KN2H 4MHHG 4L5FL 4DVRH 5BVPL 4OV6F 3GSQB 4FHBD 1MAML 4KHXH 3SO3B 1M6OB 4WDIA 3JWDC 4K7FB 3ZKNC 4HAFA 4AEHH 4CMMB 4DVBA 2J8UA 2YWYA 4QEGA 4QHKI 1R24A 3UTPD 3VXMB 2IFFH 5MEQA 3JVGC 1OW0A 3V6OC 5HSFA 3LRGA 5IFHH 4U1IA 3KPPA 4I9WE 4D0BB 1E4XI 5JHDB 1KJ3H 5IMOB 3QNXB 4K3DH 1F3JB 4H0GA 4Z95H 2WBJD 3GSNH 5DMIL 1OM3L 1RIUH 3NACL 1ZGLM 5GGUB 5CEYB 4GAGL 4JY5L 3N06B 3O6MH 2EDOA 2FH8A 3NH7L 1IQDB 3WEXB 3S35X 4KV5E 1O0VA 2Z31A 2A6KA 5FGBC 5MHSD 2PNDA 4OM0H 3CGTA 1BFVH 1LEIB 2VZ3A 3HE7A 4FQHB 1CFSB 3QUML 4LFHG 1J5OH 4U33A 2C1OA 3CC5B 4WUUA 1MQKL 4OTXL 3FQNA 1YJDL 4K23L 2BXZA 4N0YL 1JZ2A 5HHMB 5C6TL 4PGDB 1FC2D 3BQUB 2A6DB 3MV8A 1M71B 3OG6B 3MOAH 3L95B 3L7EA 1MHHA 3GBML 3CFDA 4LKXA 3B4NA 1HH9B 4PB9H 4D94A 2R15A 4EI5D 3FN0L 3QDME 3KPRE 3LD8C 1K85A 3SJVE 1ADQL 2RQ8A 2O5ZL 1DBKL 3GMRA 4X7SH 4PJCF 4ZS6D 2J4WL 4I5BA 5FDYA 3FT4B 3QUKA 4KZDH 6FABL 1NCCH 1LO5A 1NFDF 4EUPA 5DUBA 3CDGA 1ONQB 5IFJA 1LD9A 1RIVL 1NGWA 1GIGH 1HHJA 3DOSA 1KULA 3HG1D 3E6FB 4LQFL 5DF0A 1U8MB 1S9VB 3NIGF 1NGZA 3ARFB 4QGTA 3QEQD 2P42B 1IFHH 4NKIH 5I1IH 1AQKL 3SQOL 1F6AB 3ETBF 3BDXA 1MLBB 2CMRL 4GW4A 5D7IB 2P1YA 3TNMB 3U30C 5C08D 4FQ1H 2NXZC 1AP2B 5C6PB 4FQLL 5SWZD 3U4EB 4XWGH 3B2VL 5JORA 3STLB 5E95B 4N8VA 3RIAF 5GS2H 4GRLA 4AEIL 3CJJA 3GRWL 3O41B 5E6IC 3BH9A 3O2VH 3QBTB 5AUMB 3HRZB 2FIKA 3QUXB 3PWNA 1CL7I 1AH1A 2A9ML 5DEFB 3AXLA 5HYFA 2BOBB 3EYOA 2C3WA 2BVYA 5F70A 2N7BA 1VFBB 4U1NB 4P57B 2HVJB 3WIHA 1JCKA 1AXSB 4P3DB 3G08B 4L4VA 1HEZA 3I6GB 4U1SB 4WI6A 4X9HA 2BVOA 4TUJA 1OCWL 3O3BB 1MCOL 2W59A 4XP5H 1JF6A 5B38B 5DD1L 1KLGB 5A3ID 1JNHA 3RZWA 3ULUF 3QDJD 3AS1A 4E41B 2W38A 5F7DB 4CN1A 1MRFH 5FECB 1XZ0A 3QCVL 1KFAL 5DJ6A 5FHAL 4PJEE 1NAMH 2J12B 2DYPA 4JRYD 5TE6H 1A6TA 1U8PB 5DC9B 5E99L 3O9WB 1MHPL 4HGWB 1F3DH 1JYXA 3HC3H 3I50L 4OBRA 3GUTA 1W72B 4N8CH 3SE8L 2JB5L 3DSFH 3QHFH 3S8WA 4PRHB 3HZMB 2YA2A 4R97C 4GMTH 1WAAF 2R69H 3GSNA 4ZFFA 5ABDE 1X6LA 1BJMA 1CFQA 1KEGH 3EJZD 3DNKA 5I30H 3Q6GL 1FBIL 1RZ8B 4FNLH 4G43B 5AEAA 4ODVL 1PYWA 4UDTB 3TM6A 3ULUC 4M5ZL 3UO1L 2X9WA 3EFFB 3LQAH 1JI1A 4WO4A 4OZHB 3T3PF 2HJKA 3IDJB 4J8RA 4HCRH 1MH5A 4HG4J 1GOGA 3VFPB 2F53D 3P4NA 1FZJA 5ESAA 3E3QC 3MRDB 3C87A 1S7RB 2I5YH 2ID5A 3LZFL 1WISA 3RDTD 2DQEH 3MRNA 3BZDA 2IALA 4NQDE 3KPSA 4MAYA 3IDMB 3MGTB 4QRPA 4ZTPL 4QCIB 3X3GH 2J1KA 5DQDH 1P84K 4ORGA 1IILE 3SGJA 4EUPH 2WSKA 3HFML 5DRXA 3T04D 4CDGC 4P99A 3VWKD 3G04B 3AMLA 4L3EE 2FYYB 3JZ7A 3IDIB 1DUYA 2XV6B 4JFPB 5IKCB 3TN0A 2SEBA 5HYQB 1ZLWK 3L7FA 4JVPA 2DI9A 5SWQB 1C12A 4PJ5B 2AJSH 1J12A 4HS8L 4PJ9A 3V6BR 2A77L 4WFFD 4G5ZH 1E4JA 1A14L 2CO6B 4PJDE 5AYUH 3QPXH 1B4RA 1J8HA 4JJ5B 2X4PB 5BVJB 4EUPG 2JB6B 1NMAL 2VDOH 2P43B 1ZV5A 2X2YA 4LARL 3WFZA 5E24E 5AZ2L 3MLUL 2YN3A 1M7IA 1RUML 2CLVA 1WBXB 4DGYL 5SX5H 1NCNA 3VFUA 5GZOD 3QNZA 5CS7A 4TSCH 3RRQA 3TBSB 4OM1L 4OF3A 4NZJA 4Y4KD 3QFDB 1FNGB 3D85D 1L7TL 4M1GL 1GJIA 1GGCL 2ZUXA 5ALBH 4Y4HA 1GOFA 3IKCA 4LLMA 3I9GL 3TO4A 5C0GB 1CTNA 2D7MA 2A83A 5I1JL 4PV8A 1T0NA 4JY4A 1T7ZA 4IOFD 3SKOB 3ROLB 2CLZA 4HGKC 5J1SC 3T0BA 2FR4A 4JRXB 4QXGL 3RJDA 1HHKB 3SCMB 5D9SB 5FOBA 1Q0YL 4XNMA 3GKWL 4XH2A 5FB8B 7FABL 4OGAC 1HHIA 3MRFA 2FWOA 2IQAB 1X6NA 5HY9B 1VB9A 3SDDB 3VWKC 5J11C 4WNQB 4YDKL 3THMH 5B38G 2O5YL 4HC1L 4P2RD 3L5WA 5L2KB 5L6YH 3FTGB 3SQBA 1XGPA 2ADIB 2VABB 3O8XB 1DLFH 4WFEE 4NUJA 3BESR 3BT2H 1G7LA 5HHME 1T1XB 4Y19B 2FIRT 5JTWA 1GAFL 3HUJA 3MROA 1F8TH 3MLWL 5IJVA 4YHYC 5L88L 4HG4K 4UQ2B 3IFOA 3U9PL 4JFZL 3GBNL 3A6OA 5ELIA 1FL5B 3G6DL 1S7QB 5GZOC 4RGNE 4KPHH 3C6LD 3ZTNL 3PL6B 1OTUD 3NGBB 2YBRB 4ZAKB 3VI3F 2NY1D 3FO1B 1FNSL 5F71A 5F44A 3BP7B 3Q6FA 3JWDL 4HWBL 1HSBB 4LVHB 1RU9H 1QOKA 4JZJA 3OXRA 1DE4B 3AY4C 4CU6A 5HPMB 2LVEA 2Y7QB 1CDHA 3G5ZB 4NQSB 2YUXA 1DR9A 1UXSA 2CDGB 3QSKB 5ALCL 1PDKA 1HYSC 2K7QA 1S7SA 3E8UL 5E2VL 3W9DA 3ZT7A 3NA4A 2XIDA 4KJYA 4KVNH 2RGSA 3T77A 1F3DJ 2HMID 3OZ9H 5FDWA 5I9QC 3CXHK 4J4PA 1INDH 3FRPG 2UV3A 2FECL 2ZNWA 1AD0A 4NKDB 5KSUA 1O5DT 4Z76B 1CTOA 5EO0B 3U0PB 1EGJH 3TJEL 5HDQL 2Z93B 1AXTL 5DR5L 2VDLH 1SYVB 1YPZB 4U6VH 1LO4L 4NJ9H 1ZT4A 3FQTA 3VFWB 1D5ZA 2B4CC 2H1PL 2YKLH 5JQ6L 4ERSH 2FJFA 1OP5H 4XVUD 4HPYL 3H9HB 4X6FA 1BBDH 5IWLC 1JHKL 5MEND 4LLUA 4H88H 1FVEA 3K4DA 4JFFB 1JPSH 4X0KB 5I1KH 3D0VA 1BWWA 5ESVA 2JIXA 1HQRA 3KJ6H 2NY1C 1CT8A 5C0EB 3DXAD 5HHQA 4HS3A 1P4LA 4NQED 1UH2A 4WENB 5I18H 3BGAA 4FRWA 5BMFH 3MXVL 3FB6A 4X6EA 4XNUL 4UOJA 3ARED 4E41E 2VJXA 4XPTH 4MD4B 5C0BA 1Q9LB 2F5BL 2OMNA 4OUUA 1HSAB 2VXQH 3MRBB 3D9AL 4M48L 5DK3A 2FATH 4C57C 1QFHA 3WFBH 3D0LA 5IF0B 3GSXA 5E4EC 3RWIA 4HIIB 1P2CB 4PRHE 4WY7L 5CD5D 3D48R 3GSUB 4WIQA 3CFKA 5EC2B 3MNWB 3MJ9A 3IAQA 5F7FA 1YEKL 4GQ9H 1J0IA 3QRGL 4JM2C 4N0FB 3WFCL 4JQIL 1S78D 1V3MA 3FAXA 4R96B 2EDKA 5C07B 1BQHA 2OXGA 5H8DA 1AHWC 1ORSA 3Q1SL 2PXYA 3TVMA 2DLFL 4NP4H 3HR5A 3EKCA 3BP5A 4I2XB 2VLLB 5CZXD 4PJ7E 1U8JA 3GGWA 5C92A 4BYHA 3GJFB 1EO7A 3OKDB 2ZUVA 4NRXB 3TBTB 1U3JA 4FFZH 4BFGA 5EZOL 1IAKA 3MUGA 2WIIB 3K81A 5EU6B 5EFIA 3EYUL 4P5MB 4U1LB 2PTUA 1TLKA 3DARA 4BZ1L 2C3VB 3I02B 3KPMA 3VD3A 2Q20A 1I1AC 3S7GA 4PJXA 1Q94B 4N5UA 1G7HA 4RFOL 4PJFA 3P30H 1I7UB 2HKFL 4XMLH 2CRZA 4XNZB 5TF0A 2AJYH 3AREC 3SKJH 5C8JA 5DJZA 3ZHKA 4YDLC 3D3VB 4UIKH 1YZZA 1CN4A 2V9TA 4UT9L 2OI9B 4PJ5E 2P45B 5C1MB 5DS8A 3PDGA 3MZGB 4HK0A 2V5YA 3MCLL 4Z0BL 5CD5C 4J1UB 1DDHB 2YPVL 3M8OL 3LDBC 5DJ0B 1P69B 2D7PA 2EDHA 2AKRB 4H25A 5KZCB 1NC4D 4MJ5B 2C4FT 1WK0A 1XF3A 1MRCL 2Z91B 1BVLB 4TULH 3MLSL 3UJJH 1FSKB 3MXWH 4CADB 3N1GC 1I1CA 3KLAA 3BPOC 2EC9T 4JQVA 1LEGB 5J1AB 4JFXA 3RGVB 3GMLA 4YHKH 3BDYH 1I7ZB 3WXVL 1A7RH 2PW1A 4K3EH 5I6XC 5EU5A 5DFTA 1SBSH 5GRVL 1IAIH 1R5WB 2MHAA 1VEPA 2YD6A 2F58H 3INUH 3CIQA 2DQCH 5IEHA 3CAFA 1V5JA 2XTJB 2N56A 4OSUH 1N5YL 1J0KA 1XR8B 3B83A 4P3CL 2EKSB 3L3KA 3N9GL 2BSRA 4Q6IA 3QI9D 1CE1H 3HMWH 2DQDL 2CH8A 5GGTH 3GFUA 1RK1B 3BKCL 1XF2B 4U1HA 4YXHL 1JV5B 3KLHC 1I3UA 1ZSDB 1HKLH 5L2KE 1UYWH 2IPTH 5HDBF 1YEGL 2ITCB 3GK8L 1U91B 1WZKA 3WS3B 5SX5K 4X4XA 2BRRL 2O61A 4FQJL 3ZT5A 5JO5A 1VKXA 3V5DA 5JPMA 1J87A 5F3HB 5JXEC 5DMKB 3LV3B 1PZ5B 1B0GA 4NFBA 5E4IA 3TBWA 1A8JH 4FG6C 1D6EA 1VGEL 3U1SL 3VFRB 4ZFGL 4R4NC 3NA9L 4BUGA 3FB8B 3OKMB 5BOPA 4JEGB 4X80L 4NO2B 3DVFA 4BSVB 3BE1H 2NR6D 3UTSA 3IVKB 3Q48A 4NRZA 3CK0H 4QXTB 4LPVA 1HNGA 3IU3A 4XPAL 1RMFL 4LCCB 2CRMA 3DTXA 3CUPB 4XT1C 5IBLC 1UADC 4LVNC 2COQA 1OVZA 1F4YL 1H8NA 1U8OB 2OTUB 2C1PB 1NLBL 2Y06L 3QWOB 4CVWA 1FORL 1N2RB 4G8GA 1JZ8A 5ADPH 5HXMA 2UWEF 1T3FA 2MCPH 4F57H 3TNNA 4GAJL 2ADFL 3ARGC 1NCWL 2GJ6A 1JGEA 5I73C 1OAUH 3MV11 4UV4H 1GHFH 1PX3A 4N0UB 3HPJA 2BC4A 1H0DA 5C7XL 5GS1B 5KSBF 4NQVA 1NBZB 1UQSB 3VXUD 3L5JA 1DBAH 1XGRA 2DQIL 3QI9C 1GL4B 1NCDH 2R56L 5B39G 4LCYB 5JA9A 3R0MA 4G8FB 4PREA 1B6UA 3IAPA 4YAQB 1OGAA 4L29A 4ELME 3U0WH 3C60D 1LE5A 4PRPB 1JF5A 3PP4H 5HHVH 2RIKA 2XG5A 3QHZL 5KBNC 1DLHA 2D7OA 3QJHA 3VXTA 1D5BB 1HCVA 4HBCL 3VXNB 1W0YT 4HX1B 1AY1L 1YPZE 4MYWB 5D6CA 1JF1B 4HJ0D 5TH2A 3LEVL 4N5EC 5FIEA 1RFDH 1TVHA 4O51A 1YEHH 1EFXB 4X7TA 2GITB 1N5AB 3MGAA 1ZXQA 2AEIT 1P4IH 3UJTL 5DJCA 4Q9QL 4WDIB 1HKFA 1TVBA 2WAHA 4KMLB 4PLOB 4Y2DC 3LY6A 3U46B 3BDBA 3OKYA 4F7PA 4JFFE 2X4TA 4DVBB 5FEBA 4WEBL 1K3IA 1OF2A 1QNZL 1R24B 2VDRL 1BZ9A 5MEQB 4FQCH 4K94H 1CXEA 4U1IB 3KPPB 3MLTA 2IG2H 1OAXH 3OBAA 1T0MA 3KNBA 7CGTA 3QXDA 4MJ6A 1J0JA 5T5FH 3ILPA 4BSWB 4KKCD 5EO9A 2ZUWA 3HI5L 4ONFH 1VESA 2IAMA 2XICA 1J86A 4LIQE 3WDJA 1A6AA 4X8XA 3H42H 2Z31B 2A6KB 5EU4A 1OAKL 2DMCA 4LLYA 4PFEA 1VFMA 1ERNA 3HE7B 4ODWA 2C1OB 1FGVH 3IDGA 1EBAA 1QQDA 1OAZL 3FQNB 5C07E 1D9KC 3SDCC 1WIUA 3ARDA 3WNLA 2PYFA 4RRPA 4JPIA 1OP5K 2ZJSL 4FTVA 3HKFA 4XAKE 5DZNA 4I2XE 1MRDH 3MV8B 5GGQL 3L7EB 1MHHB 2GI7A 3CFDB 4LKXB 1KB5A 4CUCA 3UJIH 5F9WB 4HJ0C 1N0XL 1IAII 1LDSA 1QFOA 2APTA 4KK6D 4MLSA 4RISL 4FXLA 3T08A 3MLVH 4JN1H 1FFPA 5EU6E 5EO1A 4O4YL 3GMRB 1QSFD 1H3GA 1JGUH 2QADB 4L9DA 3I3BA 4I5BB 1B9ZA 4NUGH 2YRZA 3QUKB 3RZCA 2NY5H 5D6DA 1LO5B 1RJYA 3CDGB 5DUBB 1PKQA 5IFJB 4AG4L 1LD9B 5HI5D 1NGWB 3VW3L 1HHJB 4CU7A 1RSFA 5IIEA 3ZDXF 3MV7D 2OZ4H 3LS4H 3RA7L 4L9LC 1S7TA 4N68A 1DFBL 1U8QA 1NGZB 4HBQA 5CBEA 3MBXL 4DN3H 5KTEH 1NLDL 1URLA 2J7LA 4GW4B 2WBWB 3T0EC 1S7WA 2AGJH 1CG9A 4LBEA 3NAAH 5GSRA 5GJTL 1NEUA 1MCNA 3HR6A 4S1RL 2JCCF 4HAGA 3WN5C 5ETUA 5L8KB 3O2DL 2GYSA 4PGZA 2JE8A 5IQ7L 4GRLB 2K3TA 2Z35A 2ILLA 3OXSA 5DD3H 5IUSA 3TC9A 2VL4A 3BH9B 1T7WA 3CCHA 3VWJC 2FIKB 1QUNA 3PWNB 4XAWL 9CGTA 4MZ3A 2DN7A 3AXLB 4OCXL 2VZSA 4EBQH 3EYOB 5J06A 4YDJA 4D9LL 3U4BL 4M7LL 5C2BL 4KK6C 4S10A 4L4VB 1HEZB 1BVKA 2BVOB 4NCC1 1GRWA 4TUJB 4HH8A 3ROOA 4GXUN 5KVFH 5DD6A 2D03H 5A43C 2IQ9L 1AGDA 3RTQA 4P2OD 4FQ2H 4KRNA 3L5XL 5F93C 3OV6A 1UEYA 4TVSa 1INEH 4H1LG 4Z8FL 1JNHB 1G7IA 4F7CA 3EZJB 4QO1A 5BW7A 3DYPA 1XZ0B 1EZVX 3BWUC 4OQ1A 5DJ6B 1BF2A 2DYPB 1A6TB 1JP5A 1EH9A 5D93C 3QCUH 4Y5VC 3EFDH 2F54E 2G60L 3KR3L 1X7QA 3GUTB 5KN5A 1J8KA 1CF8H 2QQLH 3GSNB 3DVIA 4R2GD 4ZFFB 3RWEA 1OLLA 1YYLL 1CFQB 4G9FD 4PJBA 5F6IC 1L7IH 5GGVY 1KC5L 1QYGL 3JBG7 4U3CA 2FBOJ 2EH7H 1JRHL 1PYWB 1LDPH 5D1ZA 4P5KA 1CBVL 3VFGL 1IGCH 3SDXA 4PLJD 4WO4B 5F96L 1NJ9A 1PY9A 3TT1L 3UZEA 2HJKB 4J8RB 1HQ4A 1MH5B 1S7VA 2JKXA 1GC1L 1BHGA 4PJGE 3EDEA 3P4NB 1FZJB 2NY7L 5ESAB 3FFCD 3B8SA 2ERJB 3L3JA 3MRNB 3VFNA 5KVDL 2IALB 1PFCA 3CDYA 3KPSB 2Q7NA 4MAYB 5IW3A 4QRPB 4ZQKA 3RUGF 4WTZG 2AS5M 1U3HA 3AM8C 2JF1A 3CD4A 2EEAA 4P2OC 5IBUG 5DURD 5JXAL 4ORGB 4N0UE 3PHOA 2CLRA 5DRXB 3ELAT 3MLZL 5HYEA 2RAMA 2BNRA 2NY3C 4BM7A 1DSFH 5JMOC 4I9WD 1KJVA 2HT3C 4L8BA 4NZUL 3O6FD 1DUYB 1KPRA 3TN0B 2SEBB 3L7FB 1C12B 2YWZA 5CINL 4K9EC 4PJ9B 5C3LD 4IRSC 4G6KL 2B1AL 4LASL 3WO3B 3VXQA 5FKAA 4F58H 4UT6L 3GZKA 5CLWA 1BFTA 1J8HB 4ZXBA 4UQ3A 1A1MA 4Y4FD 5D7JD 3A0OA 3VXSA 2LFGA 3WSQH 1M7IB 2PO6D 2CLVB 3MJ8A 5ADOH 3VFUB 4XCYA 3E0GA 4A6YL 3DI3B 3QNZB 1I8LA 3W11D 2BK8A 1X5JA 2J8UE 1N8ZA 3D39E 4PLJC 4XNQA 4Y4HB 3IKCB 2YD5A 4LLMB 1HDMA 3TO4B 2A83B 1HI6A 3QUZC 4J7RA 2HFGL 2AJVH 4PV8B 2CKBL 1T0NB 4JY4B 3QDMD 1R5VA 3RBSA 1LK2A 2CLZB 2V7HA 2HT2D 4RA0C 5D8JL 2W0KA 2QTEA 2FR4B 2FHBA 3Q3GA 4YPGA 4PJAE 3O6KH 5GGVH 5FOBB 1LP9A 1KXQE 3EYQD 5FCSH 5JUEH 1IRAY 3S98A 5KS9A 4KRMB 4XNMB 1BFSA 2HRPL 4XH2B 5DWUL 2FNBA 1F42A 4NO5A 2FGWL 4OLYL 4GG8A 2WUCL 1HHIB 4GLRH 3MRFB 1ZVHA 3IFNH 2FWOB 3N85H 1UG9A 1T1ZA 4K7PX 5CGMA 3NTCL 4NQXA 3L5WB 5IQ9A 2DIAA 1A2YA 4JO3L 5DFVC 4XCCL 1T2XA 4WUUE 1C16A 3SOBL 4M7JH 1XGPB 3JUZA 3ZMRA 2V6HA 4NUJB 1B4JH 1L6ZA 1G7LB 4CAGA 2QSTA 3OB0K 1ZANL 3F58L 5D7JC 5F6HI 3MBEA 1RZKC 3HUJB 3MROB 4YEFA 3IJSA 5IJVB 3DV6A 4X7CC 3GEWB 5ACMA 2PO6C 5F7WC 1B0WA 2HKHH 4YXKH 4KJQC 5D5MA 4XCFH 1CU4H 4S1SL 1TTFA 3W11C 4OF6A 3TBYA 4LEOA 3TA3D 3Q6FB 4UT7H 4JZJB 5C0AA 1BAFH 5DUMH 3OXRB 1T7YA 1NDMA 4IIQA 5F72S 5T3XH 4Y89A 4QRSA 1QFWI 1TDQA 3KWWA 2LU7A 1UXSB 4MXWH 5BV7H 3EHBD 3UYRL 4U6YA 1S7SB 3W9DB 3EYQC 1CE6A 1FPTH 3KDMA 4KJYB 3N0PB 5T1KD 3T77B 4I0PD 4LFHD 1KNOA 4K7PL 4OLEA 5EOCH 5FDWB 4X6BA 4LIQL 4LSQL 4V2BA 3VU2A 3TZVD 5JOPE 2EDJA 2NW3A 1DQTA 4JCMA 3TFKC 1AD0B 1KTDA 3QFJD 5KSUB 3HTLX 5FUCC 1F4HA 4PJIF 2P49B 1LHZA 2C3GA 3HNVL 2HH0H 1WSST 5DVMA 3BP6B 1U2CA 4GMSH 2OMBA 1YNLH 4KQ4L 1ZT4B 3FQTB 4L3CA 1D5ZB 1DQLH 3T65A 3VG9C 2Z8RA 2WP3O 2FJFB 1A1NA 2ZOLA 3H6JA 5D1QA 1QTYT 4X6FB 4Z7UF 2VXTL 3W0WD 3BRFA 4L4VE 3SGKC 4LLUB 5DD0H 1V7ML 1FVEB 1OP3H 2V9QA 3HHRB 4DEPB 1QBMH 4XC1L 5ESVB 3STBA 2JIXB 4Q2ZA 1HQRB 1CT8B 4PGEA 4GW5A 1A64A 5HHQB 1R0AL 3ZDZF 4HS3B 1P4LB 2R4SH 4OFPA 5F1KC 4P46A 3FB6B 4X6EB 1XR9A 2ICWA 1UA6H 3HPLA 4HJJH 2DAVA 4YXLH 5IOPA 2OYPA 3KG5A 5C0BB 3P0VH 4I4WA 5TDOA 4OUUB 1PLGL 3HZVA 3FL7A 4OF0A 4Y5XC 4QOKA 5SWSD 2CR6A 4IEFB 4NQDD 2DQHL 1TJHL 3EHBC 2VOTA 4XGZA 3D0LB 2E9WA 3GSXB 1A6VL 4OCRH 3RWIB 1E0OB 2E7LC 4DZBA 3CFKB 4I0PC 1HXMA 3SDYL 2I9TA 1ZEAL 4MXQD 1XGQA 2UUDH 2EZ0D 1U6AH 4L3ED 1LVEA 1KBGH 3BI9X 2EDBA 2ZP0T 1CZ8H 4P48A 1CICA 2E6PA 1EVUA 1F4WH 4PJ8D 4OCYL 1BQHB 2ZWLT 2VDNH 1MFDH 1Q38A 3PWPA 1ORSB 2PXYB 3TVMB 3BHBA 3HR5B 4E5XA 2QKIA 3WFDH 1JTTA 2DJUA 1H5BA 3BP5B 5KAQG 2R8SH 1Q0XL 2NY0C 1U8JB 3GGWB 3I2CH 2BNQE 4BA8A 1Y6NR 2CK0L 2DD8H 1F97A 4LAQH 3OPZH 1G7JA 3AS3A 5F9DC 2PTTA 3T0AA 1JNJA 5K9KA 5ACLA 1QSEE 3BGFB 3MUGB 1IAKB 3VI4E 4Z9KB 1HWHB 3DI2B 5EFIB 4OZGF 3BAEH 2FGZA 4M6ML 5B4MD 3KPSE 5IESL 5IMMA 3KPMB 4FFVC 4QRPE 4RMTA 4KGJA 4CMHC 4PJXB 3BSZL 3OAYK 4XP9L 1FLRH 1G7HB 4PJFB 3VXMD 4P49A 4IRJA 1A4JA 4GLRI 4RFEA 2NMSA 1C5BH 3MRCA 1KCSL 4Y1AA 4NQUA 5C8JB 4AIOA 5DJZB 3EDFA 5JHDD 1A3LL 1UM4H 1AFVH 3S34L 2VXSH 3V8OA 2W91A 1MJUL 5HPOA 2X4RA 2DICA 3QO1A 4ZUSA 4M7LT 3RVVD 1J11A 1JFQH 3MODH 4HK0B 4JDZA 5GPRA 1J8HE 1WFNA 3BYYA 1NMCB 1RUAL 4MXVF 2XZQH 4LPWA 4NZTH 5CSZA 1EMTH 4H25B 1XF3B 4HUVA 4GKOA 5KVMC 4HXAL 4OLZH 5FA3A 2VDKL 2QHRH 2GJJA 4O5LH 1J1OH 3DVNA 3KLAB 2H32H 5HHMD 3BQUD 4G7VH 4JFXB 3LN5A 3PIQA 3F7YA 3GMLB 4LNVA 4X4ZA 4M1CD 1S9KC 4RFNC 1E4WH 1IAIM 1VPOH 1F5WA 2PW1B 1PSKL 1RULL 5EU5B 3SDAA 4C4KO 4XVTH 5KSVA 3GIZH 3BPNB 2MHAB 4OZFA 4Q0XL 4YFDB 4B7IA 4C83A 2ZUSA 5BS0A 2MSPA 4M7ZB 5F9OH 1JBJA 4P0DA 1YYMH 3DMMC 5IEHB 2H26A 3B9DA 3QAZB 3EOTH 5DA4A 1V7NH 5J56B 2YD7A 2X4SA 2BSRB 4Q6IB 1MFBH 2D4DA 1G84A 1Z2KA 4OLVH 3RX5A 1NFIA 1AR1D 4OF7A 3O3UN 2R0LL 5E1AA 4W6WB 5J4MA 4WHCA 3RY6C 2ORBH 3ARFD 5TDNA 2ICES 5M95B 3NBNA 2QJDA 4GKSA 4M5YH 4PY8J 3I84A 1X44A 5E1HB 3C2SA 3D87B 5FYLE 1UVQA 4X4XB 2O61B 4LEXH 5JO5B 4RMVA 4YK4B 2VH5H 1VKXB 1E4XL 4JHWL 3V5DB 5JPMB 3QHTC 3HUJE 1B0GB 3TBWB 5JW4Q 2L7JA 1D6EB 2WUBL 2JJTA 2W07A 3RL2A 3SKNA 5LQBH 2IANE 1S8DA 4NCDA 2O26U 2APXA 2EDTA 1ND0A 3UTSB 4KJWD 4JGUA 4TOYL 5BO1H 4NRZB 4R3SA 1QBAA 2XACC 1ZLSH 3IU3B 3VGDA 3ISWA 4ODXB 4MA3A 5DHVH 3DTXB 3QUXD 3GM0A 5C0CE 1QD0A 4QTHA 1BQHG 2NY6C 2PETA 1F90H 3P11H 5MP6L 4G8GB 3LQAC 5E2UL 3WFEL 1T3FB 4MD5A 5CAYB 1YECH 5D7IF 1TETL 4JPVH 3TT3H 3TNNB 5IP4A 1ZLUH 4JFDB 2GJ6B 4YQXL 1WWCA 3DJ9A 5J89A 3BUYA 3D69A 4YHML 3HPJB 4M61A 2BC4B 4LPYA 1H0DB 5FUOL 4NQVB 5EIVA 3UZVB 2R0KH 4GQPH 4GXUM 5GISL 4KUCF 5LGJA 3B5TA 4MQSB 1XGRB 4ODTL 2PR4L 1XIWD 3BEVA 4K8RD 4E41D 2NZIA 2XI9A 4J3OC 2AJXL 4PREB 2XFXA 1IEAA 1OGAB 4L29B 1LE5B 2OCFD 3O9WD 1IC7H 3ARFC 1JYNA 4Z7VA 1A0QH 3CZFA 3CDFA 4EIGB 1C1EL 1DLHB 3VXTB 3MJ7A 4UAOC 4PRHD 4RMSA 3U83A 3ARWA 4HJGA 2MPAL 5D6CB 5TH2B 4N0CC 2E9IA 3B3IA 1TVHB 4O51B 4JQXC 4U0RB 4X7TB 1AJ7H 5C0ND 1PG7H 3QIBA 3UAJD 1MWAH 4NO3A 1QHPA 3GSVA 5DJCB 1TVBB 4XPHL 1L0YA 4KTDL 4DW2H 4F7PB 4YC2B 2X4TB 5F7NC 4K71B 3AROA 2VLMD 1OF2B 1T1YA 5D2NA 5LJYH 1BZ9B 4P5TA 5HDOA 4JPKL 1IZKA 2YXMA 4LHUA 3QUYA 3MLTB 2VAAA 2X4QA 1NCBL 3PV6A 3VD9A 1P7QB 2GTZA 1DQDH 4M3KB 1T0MB 1FNFA 3KNBB 3QXDB 2WZPD 4MJ6B 3TWCH 5GGSY 3ILPB 5DO2C 1M05A 4U2YA 2H32A 4YHZH 5EO9B 4K3JH 3EJJX 1MIEH 3QWRA 5FM8A 2IAMB 2JELH 4QXUL 1CL7L 1QFPA 4HIHA 1A6AB 2B20A 2W9LA 4U2ZA 1JMZA 3M17A 1ZAGA 3KPNA 3ESVF 5EU4B 1KEML 2X89D 4O58H 1TMCB 1XIWC 3NCMA 4LLYB 3BEWA 3QIUA 4ODWB 2DQGH 3IDGB 4PJ5D 1QQDB 4OF5A 4BSJA 4X7EC 1E27A 1MI5E 4OZHF 3ARDB 5ERWA 2QQNH 3O0RH 2PYFB 3RAJL 4JPIB 5ICZA 5IV2A 4FTVB 3CVIL 4TVPE 1CLCA 2EO9A 4TPRL 3TYGH 1SM3H 3PABA 2XZAL 2ICEA 4NNYA 1I8KA 2NXYB 2P5EB 3FO2A 4YPJA 1KB5B 4MJ4A 4OI9A 4P23C 4EN3B 3MZTA 4Z7NE 5L0QC 2XY1A 4HULB 1P4BL 2NLJA 3UAJC 4KROB 1FFPB 1IC4H 2VKWA 3PGFL 5EO1B 4GG6A 2CGRH 3CH1B 1K6QL 1TJIL 1BQLH 1WGOA 1K9TA 1TCMA 3RZCB 5JLZA 3O45A 4WV1A 3MRKA 5E56A 4QWWD 4PJXE 4XC3L 2Z4QA 1RJYB 1DANT 3QXUA 1PKQB 2NY2B 4PJFE 1A6ZA 1VSCA 1GGBL 5IIEB 4QGYA 1KN2L 3LHPH 2IC2A 4DVRL 5GHWH 3QXWA 3OTTA 4KHXL 4ENEC 1A1OA 1S7TB 2DBLH 5TQ0L 1U8QB 5E9DA 5CBEB 4AEHL 3BISA 2OR8A 4JRXD 1TQBC 2DKSA 3KHQA 3ZTJH 4HWZA 3SCMD 1BQSA 4DUXA 4QHUA 2IFFL 1X5HA 5DMGD 4F3FA 1S7WB 4BH8B 1CG9B 3BO8A 4LBEB 1UWXK 2FL5A 1RPQA 2AK4A 5KVGH 4NZRL 5GSRB 4MB5A 4X99B 1KJ3L 4R6UA 4K3DL 3LS5H 4M4PA 4Z95L 5FYJU 4QRQA 4G6AD 4N0RA 1GXEA 3GSNL 1J7VR 3SDDD 5ETUB 3QIWD 1RIUL 4Q9RH 3C5JA 1H15A 2ZUQC 3PWJB 3ZTJG 4NC1C 2XN9A 5L2KD 2Z35B 4NC1E 3OXSB 4C56A 1RZ7H 3O6ML 3O8XD 1MNUH 3CCHB 2VRAA 5CLTA 1CGSH 1TPXC 4JHAH 4RCAA 5E8EA 4OM0L 1UZ8B 4MSWA 4Y19D 1BFVL 4PJHF 4YDJB 4FXGA 4RWHA 1J5OL 1BIHA 1FL6A 3NMEA 1BVKB 5DRZA 1VERA 2B2XH 3ZKMC 3RY5A 1MQ8A 3ROOB 4MZ2A 3ZE2E 5K9QI 2YC1A 3RTQB 3BRGC 2WBKA 3PL6D 4L8DA 1MCQA 4ZAKD 4R0LC 2IH1A 3MOAL 3NPSB 1OOAA 2WWMD 4M6NH 5H35A 1G7IB 2DIJA 4F7CB 4PB9L 4KMTH 1DN0A 1HHHA 2CSPA 4I77L 4E0RA 2LQRA 1MCDA 4HLZG 4CW1A 1PKOA 1ETZA 4X7SL 3PP3K 3O11A 3OF6A 1X7QB 4LCIH 4HWBA 1MCBA 2ZSVA 2FX9H 8CGTA 1OWRM 3K2MC 3KS0J 4J3UA 2AV7A 3T2OA 4KZDL 1NCCL 1TZGH 3NABH 4YE4H 5KN5B 3GJEA 1BBJA 3JVGA 1NCAL 3V6OA 1GIGL 1I1YA 2X9YA 3RWEB 1R3IH 5EA0H 3DX7B 4PJBB 4IOSD 4CJ0A 4YHIA 1QKZH 2GT9A 2I27N 3SDDC 1IFHL 4URTB 5IT2L 1EEYA 5H37H 3HNTH 4NKIL 3TH3T 3QIWC 1YEEH 1KJ2H 5D1ZB 4P5KB 1X5ZA 2Y5TA 5HYJA 5DEGA 3UTSE 3SDXB 3VXRE 1NJ9B 1HQ4B 3R0NA 1S7VB 1LNUA 2QQQA 5FGBA 3IFPA 4XWGL 1N64H 1CQKA 3VFTA 4RRPG 4G8GE 4ALAH 5EU3A 4WI3A 3L3JB 3VFNB 1SHMA 4D9QE 2NZ9D 2APWA 4ZOBA 3DUUA 1EV2E 3O2VL 1I4FB 4ZQKB 5J9PA 4JG1H 2GJ6E 3GMMA 3V4VH 2EXWD 3WFHA 3PHOB 2CLRB 4JFHE 4KQ3H 1CLYH 2MFNA 2BNRB 3U0TA 4G6FD 1KJVB 4HUKB 4L8BB 5D96B 3KPRA 4NGHL 3BIKA 1KPRB 2J8HA 1F45A 2MMXA 4XP5L 2E27L 4R8WH 3VRLF 5FKAB 3VXQB 4F80A 2XRAH 32C2B 2AEQH 4ZXBB 4UQ3B 4TSBH 1A1MB 2G5BA 1MRFL 2EE9A 3VXSB 5J12C 5AG9A 1TNNA 1NAML 3MJ8B 5TE6L 1A21A 2EC8A 2R1XA 3LSOB 5EN2A 4XCYB 4I3RH 3K0WA 4EQ3A 3HC3L 5C07D 4N8CL 3QHFL 3DSFL 4IS6A 2XYCA 2Q1EA 4YBHA 2P4AB 1G9NH 5INDA 4GMTL 4CBPA 3QJFA 2R69L 1N8ZB 4XAKD 4OGXH 3R1GH 8FABB 4XNQB 4QF1A 1KEGL 1YMME 2LVCA 4PJCA 1HDMB 1T21A 4FNLL 2A2QT 1HI6B 1MEXH 2GFBA 1R5VB 1LK2B 2V7HB 4YBQD 3N1QC 4D3CH 1NFDA 1U8NB 1PQZA 3Q3GB 4YPGB 4H26A 5EU6D 3V2AR 1LP9B 3LQAL 4MA7H 3D6GA 2Q86A 3MUZ1 5KS9B 1N6QH 5E6IA 4WHYH 4HCRL 4HXBL 5I0ZA 4NO5B 4GG8B 4PTUA 3TPKA 2YEZA 3UPCA 1PVHA 4MMXC 1T1ZB 2NPLX 4ZUWA 4I8DA 2DQEL 3BYTA 2X70A 4LPTA 1AO7A 3M45A 3D3VD 4NQXB 4KKBD 5IQ9B 1A2YB 1C16B 3X3GL 5DQDL 3K2UH 5GRUH 5D72H 4FTVE 1VFOA 4MNQA 3U9UA 1W0VA 4I18C 3CSBA 4YWGH 3MBEB 2BY2A 5CJXC 4IMKC 3DV6B 2DBJA 3K74B 1JJUA 2AJSL 2F9BT 4AL8H 4FQQA 5D5MB 2GSIA 5ESQA 4G5ZL 1WFTA 5KZCD 5AYUL 3QPXL 5JNYA 3TBYB 4LEOB 1UWEH 3L3HA 3JTSA 2WQRA 4YLQT 4W4OC 5C0AB 4DKFH 3T2PA 1PJ9A 1PKQE 2FBJH 5ECJE 4IIQB 4HIJA 3RGVD 3N1PC 4ZPTA 4B50A 5J6HA 5DD5H 1DL7H 4JDTH 4QRSB 4TSCL 1SJXA 3KWWB 4G9DA 3MRGA 4WFHD 1FHGA 4XMPH 3FQRA 4KKLD 2R39A 4U6YB 4ZD3H 1CE6B 1QLRA 1KIRA 3KDMB 3IJHA 5ALBL 5ICXA 2Y9RT 2XTJD 3V6FA 1KNOB 4HQQH 4QTIH 4X6BB 1HILA 3T3MF 1H3PH 2NW3B 3I6KA 1KTDB 2V5TA 4MB4A 5I8OH 1WAAA 4U1GB 2J88H 3CSGA 4DN4H 2DQTH 3NFPA 5EUOF 1QLEH 1T4KA 3O4OB 4L3CB 4WU7A 1EUUA 5D2LE 1UM6L 3T65B 3BZFA 1VEMA 3DIFA 5ITBH 1ZWIA 3H3BC 1A1NB 1A3RH 2ZOLB 5D1QB 5L6YL 4GW1A 1CLZH 3PWVA 4YJZL 1R3HB 3C8HA 4XVSH 3QYCA 1DLFL 3RIFF 3BT2L 4Q2ZB 1MJ7L 4PGEB 4BELD 3SEPA 5FFLA 4GW5B 4P46B 4PIRF 1XR9B 2ICWB 2X41A 1T2QH 1BMGA 4OLUH 1VCAA 5JW4R 5IOPB 1U58A 2NY4C 4I4WB 5TDOB 3QQ4A 5HHOE 4JGJA 4HDIA 1B0RA 3HZVB 4RBPH 3MRQA 1PZUB 4KPHL 4QOKB 1I9EA 2UZYB 1LEKA 4K94C 1MPAH 4XGZB 4CN6A 2XPGA 4LNRA 1RU9L 1P7KA 2E7BA 4DZBB 1KV3A 4F7MA 1WFUA 2XTLA 4XI5D 2DQUL 4YZFF 1N6VA 2EICA 1HXMB 2I9TB 1F00I 3K3QA 1XGQB 2M1KA 1KENH 4Y88A 4KRPC 3QA3A 1P1ZA 1CICB 1P7HL 4KK9D 4KH2A 5ENWA 4PUBH 4PRPD 1DVFC 2CIIA 2I9LA 3PWPB 1J1PH 3BHBB 1T22A 4E5XB 2QKIB 1H5BB 4J3WA 3OZ9L 3SDXE 2DB8A 1IGIH 2Q8AH 2VLJA 4HEME 1INDL 4M93C 1G7JB 4HKXA 4H0HB 2PTTB 2K1MA 5GGRA 5K9KB 3FB7A 3DX9A 3K4ZA 1EFXD 2L7UA 1EGJL 4BFIA 1JI2A 5IMMB 5J8OA 4NJ9L 1MJJA 4GT7A 4AEEA 4HH9A 4IRJB 3EJYC 4GKNA 4RFEB 4P9MH 4DKDC 3MRCB 4ERSL 2BNRE 4Y1AB 4JANA 1BBDL 2JLLA 1FC1A 3VFMA 2C7UB 3FCTA 4H88L 4QNPF 3U4AA 2NY5C 1JPSL 2X4RB 5I1KL 4ONOA 3QO1B 3MCG1 4ZUSB 3KJ6L 4BQ9A 1DN2A 2D0HA 3QQ9C 4JPWL 3VGHA 2H3NA 4AIXA 5I18L 5BMFL 1KCLA 1FNEA 1BD2E 4JDZB 5E08L 4MX7A 1YEIH 4XI5C 4ZOCA 2VXQL 2Z31D 3HI1A 3GI8H 4EIZC 1TTGA 5CSZB 4XP1H 2QQKH 1Q9WA 3HE7D 3WFBL 4X6CF 4DWHA 4HUVB 1P9MC 1JN6A 2A1WL 2D7QA 3DVNB 4P59L 5EB9A 4O00A 4PB0H 1ZMYA 3IT8D 2RCSL 3RKPA 3LN5B 3MV8D 3PIQB 3F7YB 4H5SA 3TLRA 4GQ9L 3D25A 1Q1JH 1UJTA 4HFUL 3DURA 3SDAB 5KSVB 1OLZA 3VE0A 2IWGA 4HW6A 4OZFB 4C83B 3REWA 2ED9A 5BS0B 1LMKA 3WKNA 3TESA 4NP4L 5DMYA 1LP9E 2FHCA 1FYHB 2H26B 2QADD 1CXIA 4C55A 5KS9E 5DHXB 5EH1A 2VIRA 5FHBH 2X4SB 2DLEA 1PD6A 4FA8A 1UACH 4FFZL 1OW0C 3HE6D 3UPRA 4UIMB 1BP3B 1NFIB 4IOIA 1QPXA 1EIBA 4HKBA 3C5ZC 2GY7B 4YHNA 1CDUA 3M1BA 5E1AB 3ZZ1A 4U6XA 3T09A 5HYIA 5IWLA 1UT9A 5TDNB 1QFUH 5I74C 2X4OA 1MUJA 4GKSB 4JRWA 4NN6B 1HH6A 1UVQB 2R23A 3P30L 4XMLL 1T7XA 3SKJL 3T2QA 1OB1A 1U36A 3L3OA 3ARRA 5JOPD 2XKSA 2OTWA 1SMAA 5HD8D 3QQ3A 4HV8A 3RL2B 3A67H 3SKNB 4LAJH 5D5ME 1SJEA 1S8DB 2A38A 3OKOA 1CXHA 4GRLD 1IGYA 1ND0B 1R6VA 1FIGL 4P4KC 3EZ8A 1MF2H 3HMXH 4R3SB 3GSOA 1IC1A 4W81A 5DJAA 2JJSC 3UX9B 1DJSA 3OKLA 4JKKA 5I1AA 4MA3B 1TITA 4IDJH 5C0AE 3O2DA 4QTHB 2F5AL 5IBTH 1JHLH 1ZGLA 4JM2A 4WI5A 3TH2T 3V7AG 1C7TA 3EO1A 3NIFF 2G75A 3O4LA 4MD5B 1ZLVH 1MOEA 4L4VD 1EEUA 2EDDA 4TULL 3EYSH 4NQCE 1AHWA 4PS4H 2VDQH 3RHWK 5IB5A 3BUYB 4O02H 3D69B 4M61B 1KYOJ 4YHKL 3RVWD 5F88A 5LGJB 1T5WA 4YX2H 5A2FA 1GGIH 5DSCA 1A7RL 4K3EL 1IBGH 1SBSL 1IAIL 3BEVB 3HE6C 3B2UD 3DLQR 2F58L 2EO1A 2XFXB 2EDLA 1IEAB 2WWKT 4X9IA 3INUL 2DYPD 2DQCL 1MHCA 3DX8A 4Z7VB 4IJ3B 3CZFB 4OSUL 4MGXA 3MJ7B 1I1AA 1XFPA 1JTOA 1CE1L 5T3ZH 3HMWL 4HJGB 3CLEL 4HWUA 4ZFOL 4ZFZA 3WUWA 3B3IB 5CJQL 4GAGH 2P5WD 3AREA 5I66A 3NH7H 3QIBB 5GJSL 4LSVL 2ED8A 4NO3B 1HKLL 3GSVB 4B7LA 1UYWL 3JUYA 2IPTL 1IM3A 1ES0A 4F15B 1G6RH 2IJ0C 5F8RC 5IR1A 2Q3AA 1BQUA 1T1YB 5D2NB 4P5TB 2R1YA 4WO4D 4LHUB 2EDQA 3QUYB 4JR9H 4TYUA 43CAA 4Z7WB 2VAAB 4K23H 2X4QB 3JV4A 3PV6B 1JWMA 1OGTA 2OJZH 3NCFB 3U7AA 5ANMA 5IB3A 4ZO6A 1E6OH 3HAEG 1M05B 1LO3L 2H32B 4QOKE 3BE1L 5CUSL 2IADA 3KPSD 4MAYD 4QRPD 5TE7H 1A7NL 5IROC 3TF7C 3VFVA 4HIHB 4NFDA 3MOBH 2D7TH 3N50A 2J4WH 3M17B 4OZFG 1H3TA 2FH6A 3KPNB 4IMLA 3T4AA 1N0LA 5ADPL 4XMKH 1NH6A 4NC0B 3BH8B 6FABH 2MCPL 1KJMA 3BEWB 4F57L 3QIUB 2EIBA 4HZLA 5E2WL 3TN0D 4PGCA 4LQFH 4UV4L 3MC0A 1GHFL 4PJ9D 1E27B 1JZ6A 4F8TA 4MA8H 5ERWB 3PWPE 5DEZA 5ICZB 5IV2B 1DBAL 4M3JA 4UILH 5LCVH 4JFEA 1J8HD 3PABB 2ICEB 4NNYB 5GZND 1I8KB 4LDOB 1Q9OA 3FO2B 1UB6A 3VGAC 3WUZA 3U0WL 1ZHBA 2NLJB 2YUZA 3PP4L 3AU1A 3U6RA 5HHVL 1AC0A 5MEPA 5DVNA 3W81A 3VH8G 4GG6B 2HTLD 4Z7OF 1XF4A 2OM5A 5JLZB 3O45B 4WV1B 5EIIA 3MRKB 4HUWA 2Z4QB 1AQDA 5HI3D 1A6ZB 1RFDL 4Y4HD 4X8JA 1YEHL 4BFEA 1TENA 5JXEA 4A6YA 1P4IL 1UZ6F 3P9WB 4Y1AE 3WKMH 2A9MH 1TZHA 3B6SA 1A1OB 3PQYA 1TTUA 5E9DB 1PEWA 1RIHH 4M6OH 4HWZB 2J5LC 2W0PA 3MLYH 3NPZB 4QHUB 1OD9A 4DGIL 4F3FB 4JREB 1UCBH 3FHQA 2D0FA 2BP3A 1GH7A 3BO8B 4K94L 4HK3N 4KZEH 2FL5B 2AK4B 2CKBA 2IG2L 1OAXL 1IC5H 4WW2B 2RHEA 5BV7C 1A7PH 4QRQB 4POZC 5T5FL 3C5JB 4RDQG 1H15B 3AB0C 4ONFL 2XN9B 5F89A 3ARGA 4AQOA 5JDJA 5IHZA 4C56B 4PLKC 2YA0A 4S1DD 3H42L 4M6AA 3SHSA 5FYLD 3GSWA 3MA7A 5I1HH 4MSWB 2JB5H 5E00A 3QI9A 4FXGB 4PRDA 3W5NA 4GRWB 4ACPA 5LVEA 1FGVL 4ELMA 1FL6B 3DYOA 5DRZB 1SQ2N 4G6JL 2FHFA 1KF9B 4K07A 1UWGH 2YC1B 1MFNA 3L1OH 1AD9A 4L8DB 4XPBH 4GBXD 1MRDL 4HSQA 2B5IB 4HS6A 2IH1B 2UWEA 4M5ZH 5K93A 3BKYH 3LMJH 5H35B 5KAQF 2W92A 1DN0B 2IGFH 1HHHB 2YR3A 3QP3A 2CXGA 2I25N 4E0RB 3MLVL 2OL3H 5I19H 5KSBA 4DQOL 1FVCA 2F8VA 2VUYA 4JN1L 4CW1B 1ETZB 1JGUL 3LEYH 2RR3A 2EE2A 4LHUG 2XY2A 2ZSVB 4XNXH 4Y2DA 2JTDA 2NY5L 2AV7B 1A6WH 3LIZH 1U8IA 1LO0H 3GJEB 5CILH 1BBJB 4I13B 2EEBA 5HGHA 1I1YB 1FRGH 1X4ZA 2AV1A 2VXUH 2HN7A 3PXJA 2OZ4L 2A0LD 4Y5YA 3LS4L 5DVKA 4O2CA 2KL6A 1J10A 4YHIB 4FFWC 3OGOE 3TGXA 2ZUYA 4LVOC 4J4PD 2GT9B 4XP4L 2ZZUT 5KTEL 4AM0A 1BWMA 3DSNA 1EEYB 3MLXH 4JE4B 1FN4A 5AAWA 2NX5A 1JWSA 3G6JF 1IZJA 2Y5TB 5HYJB 2AGJL 4MJIA 1SJVA 1QEWA 5H2BA 1NGPH 5DEGB 1JPST 1OPGL 4S1DC 1T20A 4XXCC 1LO2H 4YHLH 1MVFA 1LNUB 3OJVC 4F2MA 3GNMH 3IFPB 4W6XB 2FB4H 5DA0B 3VFTB 2VWEC 1QR1A 4LARH 5EU3B 3FMGH 4L4JA 1WQVT 5DD3L 3DUUB 1D9KA 1S5HA 1VADA 3SDCA 5J9PB 1TQCC 3GMMB 3EIFA 5JIHA 3WFHB 2JIXD 4GBXC 4EBQL 4W6YB 1A3QA 1FAIH 1J18A 4G8EB 4DKEL 5E03A 3U0TB 3NCYS 2LAAA 5HTSA 2Y36L 3KPRB 4ZO7A 3BIKB 3LD8B 5C0BD 5KVFL 2OK0L 4NO0A 4FQ2L 2KPNA 4YHOH 2G5RA 3AS2A 1INEL 3UTQA 4P2CG 4QXGH 4U49A 1CLOH 3BMVA 4N90D 1YDPA 1FH5H 2G5BB 4K9EH 3DUHA 1ZTXH 3BZEA 2UY7A 1CDGA 1JK8A 2OTPA 4RAVA 2ARWA 4KXZH 4O2EA 4Z78A 2HLFD 2R1XB 4L9LA 3ES6A 5EN2B 3EFDL 3TV3H 4X6DF 1KB9K 1SY6H 3WIIH 3GSRA 4YDKH 5C0FA 3FN9A 4IS6B 3RVXD 4HC1H 5CMAB 2VSCA 2Q8BH 5INDB 3TVMD 3T0EA 1CF8L 2QQLL 5A16A 4TVPD 3U30B 3EGSA 2D7NA 5D2NE 2NXZB 4QF1B 1L7IL 5KOVC 2BMKA 4PJCB 1T21B 1BOGA 2EH7L 5F3BA 3WN5A 4E42A 2GFBB 2XWBA 2GCYB 4NJAH 1NFDB 1PQZB 1IGCL 5MERA 4H26B 4U1KA 2Q86B 4UTBL 5E6IB 2WNGA 5JQHC 3VWJA 4Z18A 4YFLI 1Q8MA 4PTUB 5J0BA 2EYSA 2YEZB 4N1CA 2XWTA 2A73A 4OV5A 4DUVA 4ZUWB 2DL9A 2X70B 2J8OA 1AO7B 5DK0A 1SMOA 3V0VA 5BOZG 2X6MA 4XBEH 1II4E 4WVRA 2JCCA 4J3XA 2HLAA 3B9KD 2J3SA 3UBXG 4MNQB 2X4NA 3CFBA 3U9UB 2AJ3A 3HB3D 1CD8A 1W0VB 3E8UH 2V17H 1A6UH 4BZ2H 4FOMA 3MFGB 4MQXD 5LXGH 3MV7A 3SPVA 5A2KH 2XWJB 1N3NA 4FQQB 2GSIB 5ESQB 3UC0H 2F54A 4F58L 4Y5VA 4JLRA 3GO1H 1CR9H 3RVXC 3L3HB 4R7NA 1ORQA 1ZLWH 4R97B 4GKZA 5DRNA 3WSQL 1XGUA 1OARH 3BN3B 3LN4A 4HIJB 5ADOL 4ZPTB 5J6HB 4HWEH 3L3IA 4I0KA 1CGYA 4G9DB 3MRGB 3IS1X 5E9DE 3S4SA 3FQRB 1VACA 5FYJE 2X1PA 1MLCA 1OTSD 3FONA 4HLJA 5C0RH 1V05A 1ZHNA 3ARPA 1QLRB 1KIRB 3IJHB 5ICXB 1CGWA 4ORZC 4LRIC 4QY8A 3TIDA 3BWAA 3V6FB 5B8CB 3HLAA 5FCUH 4PJGA 2AJVL 4QRTA 1G7QA 5IGXH 1HILB 1U95A 2GEEA 5GRYA 1HHGA 3I6KB 4XNUH 3BPLC 3PJSA 5GGVL 5JUEL 1F4AA 1OSPH 2CDEA 4FN0A 3AM8A 4C56E 1RD6A 4P2OA 4WWKD 3NFPB 3SY0A 1N6UA 3VGFA 5IB4A 4R7DA 3B9KC 4U1JA 3IFNL 3N85L 2V2WA 1T4KB 4WU7B 1VGKA 2Y5EA 3BN9D 1ROWA 3BZFB 2KH2B 3DIFB 4WY7H 1ZWIB 2VLKA 3L3GA 4MQXC 4GW1B 3PWVB 1C7SA 4M7JL 1AR2A 1IMHC 4IRSA 3FQWA 1AXIB 3WFCH 1B4JL 3UTSD 5EULV 3WJJC 4K2UH 3TJHD 2C3XA 1K8DA 5D70H 5EZIH 1RURL 1SY6A 4UU9A 3RUGA 1U58B 4G9FA 5T1LD 2HKHL 3QQ4B 4YXKL 4TN9A 4HDIB 1B0RB 3MRPA 4G8GD 4XCFL 3MRQB 1CU4L 2E8YA 1OQOA 2PYEA 3BPNC 3EOAA 4D9QD 3AUVA 1R5IA 4JFDD 3F5WA 3ULVD 4M7ZC 1OTSC 4UT7L 2GQHA 2XPGB 4LNRB 4PP1D 3ZT6A 1MFEL 1P7KB 3D39A 2YRPA 1BAFL 5DC4B 5DUML 3ZE1F 4F7MB 2W65A 3VFSA 5C0DA 3V6OE 4KXZI 5T3XL 2YMXL 1J0ZA 1UJ3C 3QUZA 4RFOH 3VGEA 4QYOA 4MXWL 4JFQA 3L9RA 4OJFH 5KJRH 5BV7L 1KPVA 1P1ZB 3QA3B 4MA1C 4X9FA 4PGBA 1OGAD 4PJAA 5ENWB 4D9RE 2CIIB 3F7QA 1FPTL 2EYTA 1WC7A 2YRLA 1T22B 2XA3A 5HYJE 4OAWA 3IGAA 3TIEA 5EOCL 4WWKC 2VLJB 2X09A 4BH7A 1MCFA 1F4XH 4OCSH 3IDYC 4HKXB 3A6CH 3MCLH 5GGRB 5J11B 3FB7B 1MJ8H 3DX9B 2VO5A 1V3LA 2HH0L 4BFIB 2YPLA 3FRUA 2QEJA 4AT6A 4GMSL 4LCWA 1FCCA 1YNLL 3C2AH 5F21B 1MJJB 2LE9A 3H3PH 4HH9B 1DQLL 4WTXA 4GKNB 1NC2A 1IGFH 3LB6C 1U42A 2DL2A 2R9HD 4JANB 4WFGE 1P7QD 2PO6A 3VFMB 1A5FH 3FCTB 5DD0L 1R3KA 4RGNB 1QBML 2GK2A 1OAYH 4OUOA 4POUB 2H3NB 2R4SL 2OR9H 1MCWM 2IAMD 3OR6A 5I8KL 1OTTD 4CDHA 1FNEB 2R4RH 4V1DA 1NANH 2VUOA 4MX7B 4HJJL 4L4TA 3UTPE 4YXLL 5DZOA 2MCG1 4H8WC 3P0VL 3H0TA 4D2NA 4KDVA 1N59A 3HI1B 1MREH 1JGDA 1Q9WB 1WWWX 2WBJC 4XPFH 1P84J 1FVDA 4OCRL 1JHTA 5EOTA 5JZ7D 3JWOC 1JN6B 2ADGA 3ARDD 3S35L 3BX7C 5K59F 1I8MA 3HI6L 4FTVD 1FDLH 2DM7A 5DI8A 5FGCB 1HYRC 3WE6A 4H5SB 1R3LA 4IHOB 3D25B 2P5ED 1KBGL 2NXYD 4PJCE 3GI9H 3Q5YA 1CZ8L 4FQJH 3DURB 3PGDA 4EDWH 1SJHA 4EN3D 1F4WL 3VE0B 2VDNL 1MFDL 3REWB 4FZ8H 1NFDE 4KROD 1QP1A 3WFDL 1RK0A 1JGVH 4ZFGH 3S37H 5DQ9A 3I2CL 5BRZA 2IMNA 1WTGT 2VIRB 3ALWA 4YC2C 4X5XA 2DD8L 3RZCD 4LAQL 3OPZL 3NIGE 3MLPA 4PR5A 4MVBD 2DJSA 2NY2D 3UPRB 2IH3A 4XPAH 5D1XA 2YK1L 4IOIB 5INCB 5KANI 1X5KA 4HKBB 4MAUH 4EI5C 4YHNB 3M1BB 3F65A 3BAEL 1IARB 5CEXA 4U6XB 1AO7E 3VMNA 1ZK9A 4CNIA 2FDBP 3SGKA 2X4OB 1MUJB 4OCWH 1FLRL 4ZS6C 1HH6B 5DJYA 2R23B 4HFWA 1C5BL 4PJIA 5FKPA 4MNQE 2BNUA 2KQMA 1QRNA 1OB1B 3R8BB 1UM4L 2W1NA 3L3OB 3NIDF 5I1LA 4RWYH 2OTWB 4MHHI 3QQ3B 4YHPA 4HV8B 2NYYD 1IM9A 3DROA 4Y5XA 1LK3H 2R56H 1SJEB 3QEQE 3OKOB 2VB5A 4W4NA 1JFQL 3MODL 1IGYB 5FO8A 2YPKA 4FQIH 1TJGH 3NZHH 4I3SH 5E4EB 2BSSA 3GSOB 5DJAB 3OKLB 5I1AB 5HDLA 1YN7A 2E7LA 4Z7UA 4I0PA 1T7VA 1IE5A 5C08E 2XZQL 4NZTL 1QBLH 4JDVA 1ZGLB 1EMTL 2E8ZA 4JM2B 4F7TA 2HWZH 3EO1B 2G75B 3O4LB 2BFVH 2VDMH 2R29L 2RBLA 4EN3C 3QFJA 4OLZL 2GAZA 4RGOH 2QHRL 4KROC 4O5LL 5IB5B 3ULUE 1AHWB 3UJTH 1FFQA 4YUEH 3RTQD 3NIDE 5I75C 4PJ7B 1KCKA 4DCQA 2BNQA 4PBVC 5F88B 2M26A 1T5WB 4WEBH 5DSCB 1E4WL 1VPOL 2VDRH 4XVTL 3GIZL 1QSEA 1J1XH 3NVQA 4TTGA 4J2XA 3E3QE 3OMZA 2EIEA 2HT4D 4TQEH 5F9OL 2R2EA 4U1MA 4KGLA 1YYML 1WAAE 5E5MA 3W0WA 1OQXA 1MHCB 4RGMC 3EOTL 1V7NL 1I1AB 4UINH 4MQTB 3HI5H 5A3IC 12E8H 1Y0LA 4ZFZB 5I15L 3WUWB 3O3EA 1CGTA 4U6HA 5I66B 3SGDH 2ORBL 4X9GA 3OJ2C 3MRHB 3ZYIA 5SWSA 3T3PE 1IM3B 3VGGA 4M5YL 1ES0B 4JRYE 1LQSR 3MO1A 5D1ZD 3MTRA 4M03A 4EDXA 2WM0A 5IR1B 4LEXL 3IYLW 1CQYA 2VH5L 3ILQD 1W2KT 5ISZA 2R1YB 4OZGA 4KTEH 3CXHJ 43CAB 3LQMA 1SEQH 3JV4B 1FFNA 1JWMB 1OGTB 3JV6A 3K46A 3EJZC 5J13B 3LDBB 1G9NC 5ANMB 5IB3B 5L8LB 1PG7X 3E2HC 5GS0D 2BVQA 5BO1L 5MI0C 2IADB 1ZLSL 1T80A 5HGAA 3K1DA 2W9EH 3N1MC 2CK2A 2CPCA 4PJBF 5FYJL 3ZKXC 2HJFA 3VFVB 3BPOB 1NANI 5HI4D 1F90L 3P11L 4ODHH 3T4AB 2BNRD 3WHXA 3VRJA 4IBLT 3NCJH 5I6XB 3OKKA 1YECL 1KJMB 4JPVL 3TT3L 4BUHA 4HZLB 2HT4C 3RDTC 5GXBB 4FQXB 4PGCB 3TPUA 1TVDA 3LPGA 3DMMA 3MYJB 1DFBH 2MKWA 4K8RH 3OKEA 2R0KL 1I9JH 1OD7A 2V2TA 4JFEB 2CRIA 3LKQA 4ZXBD 2VLJE 1NLDH 5CZKA 3FB5A 1Q9OB 1UB6B 1Y6KR 1KG0A 1PEZA 3VXSD 2VN4A 3V7MA 2ITDA 5AWNH 1ZHBB 1W72H 5JHDA 3U6RB 5E5UB 3AU1B 1IC7L 4NHCH 3RY6A 5CIPH 5MEPB 2H41A 1A0QL 1WBYA 5DHYA 1MELA 1XF4B 5FUZH 1EA9C 4CU8A 5EIIB 4J6RH 4Q58C 2VN7A 4HUWB 1NAMA 2DKMA 1AQDB 1O7VA 1AGFA 4X8JB 1AJ7L 3IFLL 1EFQA 5FYKD 1PG7L 2J2ZA 4A6YB 1MWAL 4R4FH 4XAWH 3T0VA 1TZHB 3B6SB 4AH2A 1YQ2A 3PQYB 4HKJA 3ZDYF 1NCUA 4LCUA 2IANA 4DW2L 4YNYA 5GS0C 2QSVA 1FZMA 1YNTA 3Q0HA 1MFAH 2VTFA 4KDTC 2QL1A 4Y4KC 4G8IA 2IQ9H 2CKBB 5C0CA 4LVNB 4PLNC 1DQDL 4UV7H 4Z0XA 2LTQC 3TWCL 4YHZL 1AC6A 4IOFC 1RY7B 4K3JL 1MIEL 4HMCA 4JM4H 4ZUTA 2DWEA 2FEDD 4HCRA 2JELL 5F89B 3ARGB 5I73B 5IHZB 3CMOH 3UCRA 2WMPA 1FFRA 1EEQA 2ENSA 5TE4L 2G60H 3GSWB 3MA7B 1QR4A 4OQTH 5E00B 5FGCE 4O58L 1CGVA 2VL5A 2Y07H 3QI9B 3MBED 5DQJA 3VI3E 1ZT1A 2EIZA 3P9LA 5DTFA 4PRDB 3V4UL 2DQGL 4ELMB 5DDHA 1NMBH 3VRIA 2FD6H 4P2RE 2QQNL 1KC5H 1QYGH 3E1F1 1HIMH 3O0RL 3H3KA 5E8OA 1EAPB 2VQUA 1JRHH 1AD9B 3TYGL 2AXFA 1SM3L 3KYKH 4GOSA 4HS6B 2UWEB 1MLBA 2BHYA 5C0AD 3S96A 5CEZE 1YMHA 5GRVK 4ZMAT 4JQXA 5JA8B 1RJLA 5FV1L 5KSBB 1FVCB 5IVXF 2CGRL 1KN4H 1BQLL 1HINH 4Y2DB 2LU3A 3C6LC 3ARUA 3MACH 1RZJC 1FZKA 1OTUC 5JOEA 1M7XA 1U8IB 3BKJH 3QXTA 5IB2A 5T1MA 5HGHB 4HHAA 4LVEA 3BKMH 2AV1B 5IHUL 3OSKA 5GHWL 2HN7B 3HN3A 4Y5YB 4O2CB 3G5YA 1EJOL 3SGDI 2DBLL 1FE8H 4F9PC 2P8LA 1IQWH 4AM0B 1YA5A 5JW4M 5FM5O 1FN4B 2NX5B 4KVCH 1Y18A 1JWSB 2FEDC 3O6LL 5F7HA 4MJIB 3B5HA 1QEWB 5H2BB 5HVWA 3U82B 5KVGL 1T20B 1W0WA 4LLQA 4TNWK 3RWDA 3LS5L 2HMIC 2G9HA 3WS6C 3EW3B 4UZGA 3MUHL 3ZO0A 4F2MB 3P4OB 4KY1H 3CH8A 3DRQA 1XIWA 1QR1B 4Q9RL 1GPOH 1L6XA 5D1QD 2MKLC 1YEDA 3O4LE 3P40A 1RZ7L 1MI5A 2WP3T 1D9KB 1S5HB 1VADB 3SDCB 4HMEA 2QV2A 3ORJA 1VEOA 1CGSL 4JHAL 3MRRA 3GDBA 5MEOA 2AEPL 2Z8WC 5CIPA 4P46D 4P23A 3JWNC 4NRYA 2B2XL 4XVUC 5D7KE 5TGBA 1YY9D 5I2IA 4F33A 4QOKD 2HFGH 4FZEH 4NO0B 3KPQA 1I3RA 5IHLB 4POYA 3UTQB 3KVQA 4TTDD 4M6NL 2PUQT 2WLYA 1KLUA 4KMTL 1YDPB 4QT5A 5F7MC 3BZEB 1JK8B 4NQEE 4RAVB 4NKQB 4O2EB 5DWUH 1SVZA 2HA1A 4Y16A 5ID1A 1AGBA 2WUCH 4L9LB 3ES6B 3UEZA 4AY0A 1OT1A 1I1FA 2WK2A 2ICCA 1F13A 1JTPA 4LCIL 2FX9L 3R06A 1CICD 1J0HA 3GSRB 4XP6H 1TZGL 3NABL 5C0FB 4YE4L 3PWPD 2HTKD 1RVFL 4LQ1A 3T0EB 5A16B 5FK9A 3C08H 3EGSB 1X9QA 5EA0L 2DM4A 5DJ8A 2X42A 5CD3A 2BMKB 4GO6B 1QKZL 1JNLH 2VLRA 3MREA 2DOCA 1BOGB 2ARJQ 4WHDA 4YDIL 5F3BB 3WN5B 4E42B 3HNTL 2C9AA 2XWBB 4S0TD 4K3GA 1LILA 5ANME 2VDPH 4XB8A 1UKQA 1S78C 1DEDA 3AC0A 5MERB 4U1KB 3X17A 2BDNH 1UC6A 3QT2A 3PE9A 3VWJB 4OZ4A 3ULUL 4BQBA 3LKSA 3CLFL 5CZXC 5CCKH 1FJ1A 1OAQH 1KCRL 3I3EA 2EYSB 4IRJD 2DQFA 2XWTB 1EGJA 2A73B 3C5SB 1EDQA 4OV5B 4YBLC 4ALAL 5D7SH 3CPLA 4Y1AD 4DKAA 1DBMH 1KPUA 3KXFA 3B9AA 5EORH 4HT1H 2I60L 4ODSH 5DK0B 3V0VB 1YY9C 4JG1L 3PNWA 1FL3A 3BZ4A 4PP2A 3V4VL 3C8KA 4OLWH 1NGYA 2X44D 2JCCB 2CJUL 4U3XA 2HLAB 4KQ3L 4R0LA 4TTDC 4G3YH 3CFBB 3IKKA 2AJ3B 1HZHH 4JFEE 2EECA 5CSBA 5EIQA 3GMOA 4TSAH 3K4AA 1X5AA 3REVA 1MCEA 1TXKA 1YN6A 3MV9D 3MV7B 2H2PD 4NWTH 4NWUH 5I8CA 3ZE0F 3SPVB 1N3NB 4B5EA 4LPUA 1AKJA 2F54B 4R8WL 5D93B 4Y5VB 4JLRB 2XRAL 5CGYD 1CXFA 4PJHA 3IETA 5TQ2H 1CD1A 2AEQL 1KXVC 4TSBL 4LDEB 4MDIA 1G6VK 2AABL 2WLZA 4R7NB 5TFSL 4BZYA 1PG7W 4GKZB 5DRNB 2CRYA 4GJTB 2D3VA 2KQNA 1XGUB 2YSSA 3LN4B 4OT1H 5F6IB 3RVTD 3L3IB 3QEUA 3S5LA 3ECBA 4I3RL 1NAKH 4KQ4H 1D5XA 1MCPH 3PQYE 5F97E 3QIWA 3S4SB 1VACB 3BJLA 5E0QA 5BS0D 5EBMA 1MLCB 3GJFH 3FONB 4LKCA 2YUVA 1ZHNB 4OGXL 5DT1H 1I1RA 3R1GL 4K3HA 3VXRA 3PDOA 2ADIA 1BPVA 3ARYA 4XBGB 3CFIC 1DUZA 4QY8B 3TIDB 3BWAB 3TBVA 3V5KA 3U36A 3HLAB 4LOUD 4PJGB 1MEXL 1GZPA 1G7QB 1Z9LA 3PG2A 1U95B 5CSGA 5HDBE 4D3CL 5LGHL 3SE4C 2FX7H 3PJSB 2KBGA 3JTTA 3OJMB 4MA7L 1WT5C 2CDEB 4FABH 3LEXA 5GRJH 4P2OB 5H94A 3V0AC 5IB4B 4NBZB 4R7DB 3X3FH 1RUQH 4U1JB 3BP7A 2V2WB 4GS7C 1VGKB 2ED7A 2NY3B 3QCTL 2MOVA 4R90H 3J8F7 5FA4A 2VZ1A 2VLKB 3L3GB 3BP4A 2ZPKL 2H2PC 2E6JA 4NCC2 2GW5A 3MNVA 2P24A 3K2UL 4IRSB 3FQWB 3S6CA 5T3ZE 4YH6A 2B8OT 4LP5A 5CJOH 3VFOA 5D72L 2BCKA 3WO4B 2ZNXA 4YWGL 1C08A 2UWEE 1K8DB 4TRPH 4QRRD 4UU9B 3RUGB 4NKOA 4G9FB 3OKNB 4AL8L 3VXPA 5EWIL 4NKMA 3MRPB 2CK0H 5KSBE 4JVWA 4OZIF 3OB0H 4KFZC 2PYEB 1YJDC 3FHAA 1CDIA 3EOAB 3BD3A 5BZDA 1IAMA 1Y6MR 1R5IB 3F5WB 1DQMH 2J8UB 1CVSC 3U0PA 4L8CA 2NR6C 4DKFL 3D39B 3RFZC 1H8OA 2GHWB 3F7VA 2FBJL 2W65B 3VFSB 1YMMA 5C0DB 1JIBA 3F62A 3PHSA 4Z7QF 1BGXL 5DD5L 4JDTL 1CXLA 3BSZH 4XP9H 2AK1H 3QUZB 1CFTA 4QYOB 3LKNA 4JFQB 3VA2C 3L9RB 4XMPL 2DF3A 1KPVB 3B9EA 3ESUF 4M62H 4PJAB 4PGBB 3RY4A 4ZD3L 1B90A 1NBQA 2NX5E 2X5PA 2EYTB 1UKSA 1WC7B 1NGXA 4MJIE 4OAWB 3IGAB 3TIEB 5ID0A 4QTIL 3DRTA 4BH7B 3OAZK 4U7SA 3VXUE 5J6GA 1UXWA 2OQJA 1H3PL 1KCVL 2VZVA 3ALPA 3DPBA 5I8OL 3A6BL 1BM3L 5GSVA 2RFXA 2J88L 1RUAH 5M94B 3QIBD 4U0QB 3D1MC 1K5NA 4DN4L 4WUUB 2X1QA 2HYMA 1ED3A 3C60C 2YPLB 4RDQF 4RQQA 3FRUB 1EERB 4FFYH 4AT6B 4LCWB 5I1CL 2DQTL 5GGTA 3H9SA 4ZFOA 2V7NA 3SBWA 1QLEL 3L6FA 3TH4T 1U8KA 4X98A 3U2SA 4I18A 1FQ9C 4YFLF 4LHUD 1NC2B 3QUYD 5ITBL 1ZVSA 5CJXA 4IMKA 1A3RL 1CLZL 1BEYH 1JL8A 4I48A 4HUMB 1ODAA 2J6EH 2PO6B 3F12A 5CEZL 4XVSL 4Z7VF 2B4CL 1R3KB 1FNLA 4MLIA 4N0FA 2EDNA 1Z0MA 1PSKH 2EDEA 3QWRD 4FQPA 4Z5RA 3OR6B 4W4OA 1CFNA 2CIKA 4V1DB 1T2QL 2YOCA 1BECA 4OLUL 4L4TB 2OSLA 3H0TB 3S4SG 1N59B 5ILTH 1ZOXA 4L8SC 4TUOA 4NHUA 1JGDB 3EO9H 1EHAA 3QIUD 4BJLA 1MPAL 3WLWD 4KKCC 2IBBA 1FVDB 1JHTB 5EOTB 1MAJA 4Z7WF 2ADGB 4YGAB 4F9LA 1JZ3A 5B39A 3T0EE 2BZDA 1I8MB 4KI5D 35C8H 1Z3GH 3WE6B 5IM7A 1O7SA 1KENL 1R3LB 2AI0H 4R26L 5L7XL 3NFNA 3PGDB 3H7LA 1SJHB 1A6PA 5JORB 3DETD 4PUBL 1F58H 4N8VB 1J1PL 4W70A 2E7HA 3C6SA 1RK0B 5DQ9B 3ZDXE 2Q8AL 4F15C 5BRZB 4X5XB 4H1LH 4O2FA 5D2LA 2KZ1B 4WU5A 3CMGA 1NL0H 3VG9B 2A6JA 2IH3B 3QUYC 5D1XB 4CKVX 1JGLH 1SEBA 1XGTA 5CEXB 1JZ7A 4Q7DA 4CNIB 4KI5F 1BZ7A 5E9DD 5MP6H 3VA6A 5FYJD 1F11A 5LG1A 1WWAX 5DJYB 2JCCE 4HFWB 4P9ML 4PJIB 5FKPB 2ZCLH 3L3DA 3V52H 5JHLH 2AK4D 1Q72H 2BNUB 1QRNB 2B0SH 2BJMH 5HI5C 5HHOA 1T5XA 4GG6F 3MV7E 3OAYH 4N9OB 4YHPB 4AK1A 1IM9B 3DROB 4Y5XB 2E7CA 3KYOA 5EUOA 4ODTH 2PR4H 4ODUA 5B3JF 3MCKA 2FX8H 4PRAA 2AJXH 5FO8B 2XN9D 2YPKB 5DXWA 4JAMA 4LRNH 1RJZA 4C56D 3S88H 2BSSB 1E28A 2ESVA 1RUPH 1YEIL 1YN7B 2V5MA 4Z7UB 4KI5C 3FJTA 1L0QA 3GI8L 3W2DH 5GRZA 4JDVB 4XP1L 4F7TB 2QQKL 2YZ1A 3DETC 3QFJB 1N7MH 2GAZB 2XQBH 1CIDA 1DVFA 2EEDA 1YY8A 4PB0L 4WW2F 1FNHA 2C3HA 4N8PA 2Q3ZA 4JHBA 4DCQB 2BNQB 2ITCA 2NY0B 3DO7A 3RKDD 5C3TA 1Q1JL 4WI4A 1FNAA 4ZODA 2AQ3A 1RUKH 3UZQA 1HXYA 1QSEB 2R0ZL 2OX5A 3RBGA 2R2EB 4HF5H 1T89A 4U1MB 5ITFA 1D5IH 5E5MB 3QDAA 4Y0GA 3KLDA 4S2SA 3OF6D 3ZKND 5FHBL 3RWHA 4CMHB 5LWYH 1JYVA 5ICYA 1UACL 3FO0H 2IMMA 4GRWF 1U2HA 1Y0LB 1CL7H 5B3NA 2WINA 3O3EB 4U6HB 4WW2C 1G0DA 5D7LA 4EJ1C 2BERA 2VLKE 2MQ3A 4KHTL 3HS0A 4Q6YA 3MO1B 3WLBA 4EDXB 4OFYA 5HYJD 2OZ4A 1BD2A 2FZ3A 5ISZB 3QNYA 4OZGB 3RX8A 4PRIA 2DDQH 1N4XH 4R2GC 1FFNB 1AI1H 3GJFK 5FGSA 4CN4A 3RUGE 3JV6B 4G9FE 3A67L 1KIPA 2AJZA 5F9JA 5JW3H 1X3DA 2BVQB 2PYEE 1MF2L 5C86A 4X9BA 1P9MA 2APVA 1I9RL 4PRPA 1P4BH 5HGAB 3SKUD 1OT2A 2HJFB 4IDJL 1WBZA 4LK4A 3O3AA 4TUKH 2B5IC 3WIHH 5IBTL 2OP4H 1JHLL 4N8VG 3WHXB 3VRJB 4RFNB 1I9IH 3V0WH 4JB9H 3OKKB 3EYVA 4LSUH 3KPRD 5KG9A 3SJVD 1ZHLA 4AMKH 4CVZA 1G7PA 3EYSL 4H1LA 4PS4L 2VDQL 4O02L 3TPUB 3DMMB 4OIIH 1WJ3A 4KV5F 4PG2C 5TQ0H 1W8NA 3RPKA 3OKEB 5KOMC 3U46A 3F6LA 4DAGH 2V2TB 4YX2L 1GGIL 3LKQB 3ZSTA 2DLIA 1IBGL 3FB5B 3CXDH 3FAWA 4X6CA 1KG0B 3QEGL 2GSGA 2ITDB 3C5ZA 4FMFA 4NZRH 4LLAA 4QHKJ 3O6FC 4EKXA 1EVTC 4OD2A 3PWUA 4ONGL 3TO2A 1WBYB 5DHYB 4BSWA 1J9CT 3CNKA 3LN9A 2YPLE 2YXFA 1ACZA 2YUWA 3WMSA 4JKWA 4LCWE 5T3ZL 1NAMB 3UDWC 1AGFB 3I6LE 1VFUA 3JXAA 4Y4FC 2NXZD 1JNNL 2AAVA 4ZSOE 2IBGA 3IFOB 4HIXH 4AH2B 3ARBA 4HKJB 1AE6H 4YEEA 4LCUB 2IANB 3RQ3A 4YNYB 3VG0H 1G6RL 1Z9OA 1FZMB 4P4KA 2JJUA 1YNTB 3LKPA 5E8PA 3CFCH 2PN5A 5E6ID 2JJSA 4JR9L 1K2DA 4G8IB 3T4YA 5C0CB 5JIIA 4V1DE 2ZCHH 3ULSA 2P46B 2UYLA 4L4TE 1NBYA 2OJZL 2NY6B 1E6OL 4Z0XB 1HNFA 2UVEA 4WTZA 3C09C 3K8MA 5DC0A 1AO7D 5IVOA 2HT2C 4I77H 3MJ6A 2DWEB 4ZUTB 5FO7A 4NQCA 5TE7L 4NNPH 3MRIA 3MOBL 2D7TL 2Y6SD 1EBPA 5C71A 5HHNA 4EOWH 4Y8AA 4MNQD 5DUPH 2H8PA 4XMKL 5JDSA 5KSAD 2VL5B 3VGBA 5IFAH 5DQJB 4KAQH 2IF7A 3HE6A 1ZT1B 2EIZB 3P9LB 3WCYA 1NCAH 5DTFB 1H3WM 5DDHB 1G9MH 3VRIB 1Z0NA 5FUCE 4EUPB 4MA8L 5E8OB 1D3CA 3K80A 4UILL 1I85C 5LCVL 1V3JA 5IT2H 2P48B 2AXFB 4GXVL 4UAOB 5BRZE 4KDWA 3S96B 4Q97A 1TFHA 1YMHB 3WL9A 5C2UB 1RJLB 4OKVA 1CFVH 1K4DA 1F2QA 2DTMH 3WXWH 5CZVH 3ULUD 4EQ2A 1VHPA 3D0VB 4RAUA 1FZKB 2XZCH 3IXAA 3TA3C 2ATKA 2VAJA 5IB2B 3UXFA 5T1MB 4HHAB 4PJIE 4PJEF 1KTKE 4WI7A 3WKML 2QBWA 1QRNE 4YGVA 3G5YB 3TYFA