3WIOA

Crystal structure of osd14 in complex with hydroxy d-ring
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
265
structure length
265
Chain Sequence
AKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable strigolactone esterase D14
publication title Molecular mechanism of strigolactone perception by DWARF14
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 85
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wioA00
2HA7A 4K6KA 1MU0A 3HYSA 1M33A 4NZZA 2WJ3A 5HF5A 3EIOA 3C5WP 4UHEA 2CBGA 5CH3A 2OPHA 5AIBA 4Y2RA 2WU4A 4GXNA 4UBIA 1SCKA 3WL6A 5AI0A 1U65A 1ZD5A 1QFSA 4W63A 4C6HA 1R1DA 2Z8ZA 3KD2A 2VEOA 1MJ5A 4LYDA 4ZI5A 1LNSA 1CUIA 3FCYA 5JAOA 1DWQA 3WWDA 3DD5A 3SC2A 2ROQA 1W76A 4BVJA 1KEZA 5F4ZA 4L9AA 4INZA 1JJIA 4UBMA 1DU4A 2JGKA 4HAIA 4CFSA 1EK2A 5JANA 4QLOA 3KOOA 3WZLA 1QZ3A 1G42A 2D5LA 2XUAA 4JUIA 5EHNA 2VTVA 1YASA 3EQ8A 4J0GA 3WL5A 1Y7IA 3SK0A 2ACEA 2Z5GA 1CUJA 1ZGCA 1EVEA 3R3UA 1EB8A 1AMNA 2HA0A 4EY8A 3STTA 3CN7A 4U2GA 1YB6A 2Q0XA 4UHFA 2XQFA 1IUNA 1N8SA 3STYA 4ZRDA 5A7HA 4FLMA 2X76A 4BVKA 4LXIA 1YS2X 4P92A 5ALDA 3W2TA 3ED1A 2C5GA 3QM1A 1IZ7A 2X8BA 2WSLA 2AJBA 5SYMA 2C0QA 5C8VA 2DR0A 4ZV9A 2PX6A 3B5EA 3PUHA 3I6MA 3HABA 5AP9A 2HHAA 2XMQA 3FYTA 1IMJA 1IZ8A 4QWMA 3SX4A 1QTIA 4LXGA 5ALTA 3H1AA 3E4DA 4X93A 2CUTA 3M81A 4QDXA 3MGAA 4Y2XA 1YB7A 4OSEA 4X95A 5ALLA 2DCMA 4L3WA 4IH9A 1YA8A 1VLQA 1BEZA 2RONA 4Y2SA 2YH2A 2HADA 5K3DA 1CUBA 4MWTA 1P0MA 4AO7A 1Y37A 2ES4A 5CW2A 5JAUA 4X6YA 4B0OA 3WL7A 5CTAA 2OCLA 4M0EA 2O2HA 2LIPA 5AM2A 2PBLA 3F8SA 4X91A 1H2ZA 3WWPA 2NW6A 4Q3LA 2OGSA 1SCQA 4DNQA 1BE0A 2JGMA 1CUEA 2WIJA 4H35A 3DOIA 5AM0A 4X90A 1USWA 5BWCA 1DX4A 4KYVA 4B0PA 3G0GA 5ALQA 4U2FA 2ZSIA 5A2GA 4XVCA 4EB0A 5ALMA 3ZLVA 2HA4A 1CUFA 5AI6A 1EH5A 2EDAA 1TCCA 1E8DA 4NS4A 3WKAA 2OCKA 1IVYA 4QEKA 1DQYA 5EHXA 5JD4A 1JI3A 1VJ5A 3AZQA 2R11A 3FSGA 5IVHA 1C7IA 4Q1VA 1UOQA 4IHAA 3FAKA 4C87A 3G9TA 2XUIA 5KWJA 5AOBA 2JEYA 1MNAA 1CUDA 3BWXA 5CT9A 4MEAA 3WKDA 1MAHA 3MUNA 2BFNA 3O95A 3G02A 4Q3KA 2WM2A 3F97A 1ZJ4A 5EFZA 5ALSA 2XDWA 3VJMA 2X5XA 2Y6VA 3AIOA 4RE5A 4PSDA 3R41A 4L0CA 1CR6A 2XUGA 4WDQA 4XWGA 1B6GA 1P0IA 4DMCA 1K4YA 3I2IA 4BVLA 1WPXA 4BAGA 5AI4A 3DLTA 1CRLA 5JZBA 5A7FA 3MUOA 3WK6A 1VA5A 2WUFA 4PF1A 5C8XA 3GFFA 3RLIA 3WWOA 4IH4A 3ZI7A 5HFNA 3IVMA 3F9CA 5ALFA 1CEXA 2J4FA 1F0PA 2WG2A 1BN6A 1VKHA 4OB7A 4C89A 4MQLA 3D59A 5E2IA 1UK6A 2JIDA 3WA7A 1CUVA 4M0MA 3WL8A 1UKCA 4UPDA 2VT6A 4C01A 1WB5A 1LZKA 3ICWA 4A16A 1B41A 1SC9A 4U2CA 1VZ3A 5K3BA 5HQ3B 5CXUA 3I6ZA 2HA2A 4PW0A 2UZ0A 1EA5A 2DHEA 1K63A 1LPNA 5EHZA 4HS9A 4GW3A 4MQMA 4X6UA 3DCNA 1WPRA 3W9UA 4CCYA 4WFIA 4WFKA 5FOQA 1TAHA 1WM1A 1AX9A 5LZ8A 4BB0A 2XMRA 1XZMA 3FBWA 4B7ZA 4LYEA 4UFOA 5AH0A 4UUQA 2VAVA 4LKOA 4TGLA 2WLSA 1TK3A 4Y2QA 3WQHA 3PFCA 4HRXA 5AJHA 5CT8A 3OPMA 5AKXA 2JGLA 5JZ9A 4HXFB 1QO9A 4HVTA 3UUFA 1XZDA 1AKNA 2W22A 1AGYA 3QPCA 4FFVA 2PKYX 2OCIA 1VXOA 5ALOA 5AM4A 4CG3A 2XMSA 4KRXA 5T4HA 5E4YA 1ORVA 4BP8A 2ECFA 4P08A 3HEAA 3H1BA 2DQYA 4KAFA 4BZZA 3MVEA 2XB6A 3WI7A 3KXPA 5K5EA 3DEAA 4B84A 5HFAA 3DL4A 2C5FA 2VJAA 1A8UA 4B85A 4CG2A 1LPMA 2QKYA 1GZ7A 4OPMA 3G7NA 2IIVA 4Q34A 3DYVA 2JGFA 3HZOA 4B80A 2WILA 2H1IA 4KAAA 4LXHA 1QIJA 2XLCA 3H04A 5AI9A 4GBGA 5ALHA 3FWHA 3G0DA 3PICA 3N0TA 4O08A 1XRNA 2VT7A 1DWOA 5FLKA 1F0NA 1CUUA 5EHQA 3BJMA 1BRTA 2DQZA 3HLKA 1G4HA 1JJFA 3UUEA 4UBLA 1G5FA 3BF8A 5EIAA 1JU3A 5H3HA 3HC7A 4F5ZA 2PSEA 4UHHA 3VVLA 1MNQA 1XRQA 1ZJ5A 3QBJA 1FFDA 1HBJA 2ZYRA 3IBTA 4CIAA 5LLSA 5LZ2A 2JBWA 3L1JA 1YAJA 4MEBA 2GYWA 3L1HA 4F60A 4EA6A 3H17A 4YPVA 1ZD2P 3WIBA 5T4FA 4H18A 3OOSA 4Y9SA 1CLEA 4G8CA 4KEAA 1VXRA 1L7RA 3R3WA 2WTMA 4H0CA 1CV2A 2JGIA 4I4CA 2FJPA 3WWCA 1Q0RA 1EX9A 3RK4A 5K3FB 3PE6A 4WY5A 1NU6A 2OQVA 1UFOA 4DSZA 2XI4A 5A6VA 3LS2A 2BJHA 4OCZA 1HQDA 3GBSA 2AJDA 3A2MA 4H7FA 4K5QA 4GEGA 1EI9A 1BCRA 2WUDA 5HKBA 4X85A 1QO7A 3O4IA 1DINA 4WDRA 3V48A 4G4JA 2WFLB 4B83A 3BIXA 4Z49A 2WUEA 1TCBA 1GPLA 3QYJA 2GBIA 2WKWA 4S0XA 1S8OA 3EQ7A 1TKRA 1DWPA 4HZGA 4JH0A 4RE6A 5CT4A 2XQIA 2ZYHA 4X94A 3V1MA 1ODTC 3RARA 1H22A 4ZV7A 1YR2A 4WY8A 2QRUA 1W1IA 4PSCA 3FOBA 5ALXA 2FJ0A 5CH8A 4OB6A 1ETHA 3OURA 5AM1A 3IUMA 2CKMA 1WHTA 3LLCA 5AICA 2V96A 3WJ1A 1MTZA 4ZXFA 3M3DA 4Y2JA 2I3ZA 3OM8A 2B4KA 1Z68A 4XJVA 5ALEA 4FOLA 3FYUA 5HKAA 5CBKA 2WUGA 5JARA 1RYYA 4DNPA 5E4TA 2VSQA 3WZMA 3Q0TA 3DS8A 4UFNA 3K9BA 1JMYA 5DWDA 3O0DA 5HF9A 1ODCA 1XLUA 3PFBA 1ISPA 3ESBA 1LBSA 3QVMA 1CUZA 5DYTA 1GPKA 3K2IA 3VVMA 3PDCA 5ISMA 4BDSA 1WCYA 3AUKA 4FNGA 5A71A 3WA6A 4BRSA 4LIPD 1DT3A 4QZVA 4DIUA 2PPLA 3IUNA 2PSJA 4C4YA 3WK8A 4KACA 5I9IA 2Y2UA 5ALVA 2BAGA 3BJRA 2I03A 3OC0A 5LZ4A 2WG0A 3V1NA 4Q3OA 3H0CA 2FX5A 4DSAA 4RPCA 3AIKA 4H7JA 4EY7A 1SCIA 3VXKA 5IH7A 2VF2A 4BC1A 5D3ZA 5AHXA 5AKHA 2I78A 2XMGA 5EGNA 2QXUA 2CJPA 3D2BA 4DNOA 4EUSA 4F0JA 5JIBA 1QLWA 3D0KA 4AXBA 4J0DA 3AZPA 5DNWA 4FLEA 2VJDA 2QS9A 2DFPA 1CPYA 5LYYA 3WLAA 3SWWA 2XMDA 5LP1A 4Y2PA 4WJLA 2W6CX 4DM7A 4MXDA 2WIKA 3IULA 4FWBA 1CVLA 2Y1KA 3FLEA 4ROTA 4Y2VA 4GHWA 3STXA 3WYNA 2OGZA 1C4XA 1YCDA 1XZLA 1L7AA 1N1MA 2XUDA 1LPPA 3WIOA 3H18A 3WKBA 5AKIA 3BXPA 3VJKA 1MX9A 5AIAA 1SOMA 1NX9A 4PQEA 2B9VA 2AJ8A 4X92A 2WHQA 1CFJA 3ZPXA 5AM5A 5JALA 2CMFA 3M82A 5FV4A 3R3VA 1ACLA 4QDTA 5C7YA 2B20A 4PSUA 4BRZA 4W1SA 4UFPA 3I1YA 2HDWA 3DDUA 4QDZA 3WYDA 1C7JA 1CUGA 4FFWA 4KR0A 4KE9A 3AIMA 4E11A 1H2WA 1O6FA 2Z8XA 1U8EA 1XZGA 2VAXA 5HK8A 3BDIA 3BDVA 2BUBA 2RGUA 3QPAA 5D3KA 3C87A 3ANSA 1R9NA 2O7RA 3D7RA 1EK1A 1WOMA 3E0XA 3C6YA 5LIPA 4IQ4A 5JD6A 1K6EA 4I3FA 1UWCA 1QJ4A 4L72A 1E8NA 4AMYA 4FDMA 4U2BA 3C6XA 4EBBA 3DKKA 2RI6A 1A8SA 2GZSA 2Y2VA 1UK7A 5BWBA 3GZJA 1OCEA 1ODSA 1TCAA 3ZLTA 2VJBA 3HRHA 2WU3A 1RP1A 1ZD3A 4UHDA 2RHTA 2G5PA 3ZWQA 1QTRA 4EHBA 3AILA 2OAGA 2RIPA 3ESDA 3LIPA 4ZWNA 2GYVA 3PF8A 5AKYA 2VQ6A 4Q05A 3D3NA 1QE3A 2V9ZA 4BE9A 4DMKA 3VDXA 1QOZA 1XKLA 2GZRA 3C5VA 1PJAA 3ESAA 1KU6A 1LBTA 4UBNA 3I2JA 1UK8A 3E1GA 5HF8A 4MYDA 1HDEA 3B3QA 5JYCA 4AZ3A 3I28A 2IITA 1GXSA 2DHDA 1UOOA 2PU5A 2ZJFA 2PU7A 6YASA 4OU4A 5J3JA 5CRIA 5EI5A 2PL5A 1DX6A 5AM3A 1XZKA 1N5MA 3C8DA 4Y2YA 1J06A 2HFJA 5HCUA 2DSNA 1XRLA 4X6XA 1LPOA 5ALIA 3NWOA 1TIBA 4J0KA 3YASA 2AJCA 1CUHA 1D07A 4MWSA 5JADA 5BV7A 5AOAA 3I6YA 2O7VA 4BTVA 4Y2TA 1XRRA 1W4LA 4CCWA 2ZJ6A 5KREA 4BAUA 5CURA 1BU8A 1IUPA 1EDBA 1VOTA 1ZI9A 3D5EA 5IKXA 1UKAA 1UT6A 2PSHA 4OU5A 4AO6A 1R3DA 3CCCA 1FFEA 2QT9A 2D0DA 1J07A 1QIMA 3FVTA 3BF7A 4BBZA 1E3QA 3AZOA 5E4JA 1XZBA 2G4LA 1E5TA 4UBOA 2J3QA 2Z3WA 5ALYA 3IB3A 4P93A 1QIKA 3IURA 2H7YA 3TRDA 1HL7A 1QIFA 5HQ3A 2H9YA 2QUAA 2WHPB 2IX9A 1EHYA 5AO9A 3O4JA 1UXOA 2QR5A 4CI9A 2HU7A 2OXEA 3Q8WA 4BAZA 1A7UA 3O9VA 1MX5A 2XMCA 4C4ZA 3U1TA 4AQDA 5JAHA 5ALGA 4YK7A 1UOPA 3A2LA 3WMRA 5AKZA 5DYWA 4GECA 1XZEA 3EBLA 2WTNA 2QJWA 4G4GA 1XFDA 4N5IX 5HZGA 2XE4A 3G0CA 5ALZA 1A88A 4U2EA 2GBCA 3D2CA 3G0BA 4JYPA 4H7EA 3VJLA 3FYUC 2JGEA 2HRRA 1XZHA 1GPNA 3STUA 1ZI8A 1L7QA 2C0PA 5YASA 3EF3A 3BE8A 3WK4A 5I7UA 2V97A 2RHWA 3HSSA 4OUKX 2QMQA 1T4MA 2ZYSA 4OB8A 5ALWA 4AMZA 2GBGA 1WB6A 1ZD4A 4EZIA 2WJ6A 1R88A 1AURA 5JATA 4XX1A 4J3JA 5CH5A 5T4BA 2OAEA 1HKHA 1BS9A 4F21A 2R8BA 1HPLA 1ORWA 3W05A 3G8YA 2C7BA 5EIEA 5A7GA 1OILA 2BCEA 5T4EA 1QGED 1JMKC 4A5SA 4OD0A 1X2BA 4I19A 1YSCA 1TQHA 4HTAA 3C6ZA 4H7DA 2RAUA 5C8ZA 2XUQA 1BN7A 5SYNA 2H7XA 5IVIA 1MAAA 5I8PA 5AK6A 1LPSA 2ONCA 4E15A 1JFRA 4ITVA 4GWLA 5AK4A 5JAPA 3ESCA 3AJAA 4P9NA 4MYSA 2ZSHA 1G66A 5AKEA 4AZ0A 5KBYA 1UKBA 2I3DA 4KE6A 1XQXA 1H2XA 2XUJA 2PUJA 4M0FA 2E3JA 1QONA 1EVQA 4AN1A 5LKRA 3RKSA 1E66A 4G8DA 1FFAA 3I2GA 4UHCA 5AI8A 3ILSA 1CIJA 1W75A 3H2GA 4QLAA 3C6BA 3OG9A 4JYMA 1R4ZA 3WKCA 1XQWA 4K6HA 1XLVA 4WCVA 5LZ5A 3BIWA 4N8SA 2FUKA 4N8EA 1QFMA 3F98A 2HA6A 1JU4A 2HIHA 2WHRA 1CUCA 2AXEA 4BTLA 1PV1A 1BCSA 2ORYA 1GKLA 4DYHA 1DQZA 1XZAA 3NGMA 2QM0A 5ALNA 4RGYA 5IVKA 3CXUA 5K3FA 1ZGBA 3QZUA 5FRDA 3WWEA 5DYYA 4G1FA 4BZWA 2CEKA 2XT0A 4QDOA 4IO0A 1LGYA 2BUAA 2WG1A 4B82A 2OQIA 1XQYA 2XUFA 2WFLA 4FNMA 4J0CA 4LHEA 1QIHA 3H2JA 5LZ9A 3C70A 1YS1X 1XZFA 2DHCA 5CXXA 4B6GA 3V9AA 1W6RA 4NVRA 1Q83A 4KE7A 1THGA 1SFRA 2G63A 2OG1A 2V98A 2XUPA 4FBLA 4ARBA 1GKKA 2XMZA 3WJ2A 4UBKA 2H7CA 4N8DA 2QOEA 2VJCA 1XRMA 4KE8A 3WK5A 1K5PA 3I2KA 4U2DA 2XQJA 3IA2A 5DJ5A 1FSSA 3AFIA 3WK9A 3GELA 2P8SA 3TGLA 5C81A 1MO2A 4EY4A 2GYUA 4FHZA 1WHSA 3A2NA 1U4NA 4DTCA 5LKAA 4QA9A 1CUAA 3KSRA 1GQRA 4BCBA 2JGJA 4C88A 4JNCA 1MN6A 2G5TA 5FDFA 3F67A 3W06A 5FKJA 2PSFA 4J7AA 2XQKA 3LCRA 3QH4A 4D9JA 3T4UA 4EY6A 4X00A 5ALPA 5K3AA 1EXWA 3LP5A 4J0JA 4X7BA 1Q84A 1H23A 3FLBA 3O9MA 4DLNA 4BCDA 1LLFA 5FPPA 3V1LA 3NOXA 1DTEA 4QDUA 2XUOA 1OXMA 3FNBA 1W52X 1Q0ZA 5ESRA 4NMWA 2PVSA 2J3DA 3S8YA 2BUCA 2HU8A 3D2AA 1QIIA 4FKBA 3AINA 3EQ9A 1EDEA 2XMBA 3ANTA 1EDDA 5FUMA 4G4IA 2HM7A 5D6OA 3FCXA 1AC5A 1E8MA 3R3ZA 3A6ZA 4XIIA 3X3HA 4BP9A 1CUWA 4GDMA 4YASA 3H2HA 4X97A 4DNFA 4K2AA 4ZREA 5IVDA 1N5RA 1CQZA 4WFJA 3DL7A 4H7HA 3E3AA 1JKMA 1PFQA 1ACJA 1NU8A 1FFBA 1R50A 4BATA 3A70A 1JJBA 2WQZA 4ETWA 4EY5A 4A23A 3KDAA 3CN9A 1GQSA 3W9BA 2C58A 2WFZA 1THTA 3N2ZB 1JT2A 3DKRA 3P2MA 3R0VA 5CT5A 3HI4A 4FTWA 5K3EA 4PNZA 5AK5A 3H2KA 3GROA 4CG1A 1LPBB 5D7BA 3FLAA 3QPDA 1XZJA 4H7IA 5DTIA 2YASA 2JF0A 1VA4A 5CMLA 4B9AA 1UZAA 2QZPA 1DT5A 2HRQA 3TEJA 1GGVA 4FBMA 2ZVDA 3VISA 3QMVA 4IH1A 2C4HA 2WIDA 2QUBA 1IUOA 3V1KA 5JD5A 1ZIYA 4QNNA 2ZYIA 1LPAB 4FMPA 3C8HA 4N5HX 3QITA 1BEEA 2HL6A 4CCYB 3M83A 1P0QA 2XQGA 5JZSA 2O2IA 2HU5A 1BROA 2WIFA 4QWWA 1T2NA 2J4CA 3G9XA 3DOHA 2EEPA 4PO3X 3H2IA 3IDAA 1A8QA 5FP0A 1HLGA 2PUHA 1R9MA 1ZIXA 3RM3A 3I2FA 3HJUA 1H2YA 4OYYA 3O4HA 4H7KA 3UMJA 2OCGA 4W1PA 7YASA 4B81A 3KWFA 4BE4A 4BYMA 1VE6A 2QJRA 4KRYA 3S2ZA 1K8QA 5AKJA 2Y6UA 4B9EA 4HXEB 4FLFA 1FFCA 1AUOA 1AZWA 1CQWA 3QMMA 3KWJA 3I2HA 4DGQA 3WKEA 2HA3A 5ALRA 1GT6A 3L1IA 5AOCA 3O4GA 5FPQA 1YAHA 5AI5A 1Y7HA 3FSGD 4AO8A 2BGRA 3STVA 1EINA 2PSDA 1J2EA 1XLWA 5AKGA 3JWEA 4HRYA 2VA9A 4GLBA 3ZV7A 5EIHA 2WJ4A 4QE3A 5HF6A 1CUXA 2CZQA 1MX1A 1XQVA 4DMHA 5KWIA 1F6WA 3W04A 5DTJA 3STWA 3DYIA 5JASA 1U2EA 2VATA 1ZI6A 4BC0A 4JEIA 4MJ3A 3VKFA 4KJXA 3LIIA 3PUIA 3IIIA 1O6GA 4G9EA 1QIDA 4K6GA 2XUHA 4X71A 5LZ7A 1LZLA 2BGNA 5A62A 4AX4A 4KAJA 1CUSA 3T52A 4AN0A 3R3XA 3HXKA 5DLPA 3GUUA 4G8BA 4W1QA 1J1IA 2BKLA 2AJLI 4PV7A 4J0HA 3H19A 5AKLA 4DMFA 3DJYA 3F96A 1MPXA 3BL8A 2OGTA 4AB1A 3JYHA 1VE7A 3HACA 1UK9A 3ZLUA 2YYSA 3GA7A 1XROA 1XZIA 2HA5A 4HXGA 4UBJA 3I1IA 1QIEA 3PF9A 5ALUA 1WB4A 4TVKA 3NUZA 5FXMA 2B61A 4J03A 3TJMA 3FVRA 4YX9A 3R3YA 3IUJA 3DQZA 5AKKA 4OYLA 1RWQA 1CUYA 3C45A 3WK7A 3PI6A 2XLBA 3JW8A 1KU0A 4BDTA 1XRPA 2K2QB 4TPKA 4C4XA 1X2EA 4G9GA 4GI1A 1TRHA 2WHPA 5DNUA 5AK3A 4E14A 1X70A 3G9ZA 5ALJA 1XZCA 4W1RA 4RNCA 1YA4A 1EB9A 4ARAA 5BOVA 1I6WA 3D4LA 2CB9A 2OLEA 3QMWA 3U0VA 1FJ2A 3OTQA 1F8UA 3DNMA 5ALKA 2JEZA 1P0PA 2QXTA 4G5XA 4BCCA 4ZGBA 2ZJ7A 2WFMA 4W9RA 4UHBA 2XUKA 2EDCA 4V2IA 4Y7DA 5K3CA 2GBFA 2WIGA 4Q82A 1QIGA 5DNVA 3CCBA 2Z3ZA 3C43A 5HK9A 2PM8A 4X3CA 3FYUB 4Y2UA 5CT6A 4E46A 1XKTA 1ZOIA 2HFKA 4CIBA 2O2GA 4J0IA 3K6KA 3G0IA 3ICVA 1AQLA 3G9UA 3IUQA 2QTBA 1ZICA 1E89A 2QVBA 4H77A 1MT3A 3R40A 3B12A 2ACKA 1VZ2A 2YXPX
chains in the Genus database with same CATH superfamily
1ZU4A 2XGGA 2CJWA 5M7EA 4JV5B 1M33A 2NAFA 3LFHA 1AZTA 4NZZA 1GGJA 5CVTA 2Q6TA 1N5JA 3NHJA 4LGVA 1B0UA 5EN4A 3L05A 5MFZA 1KBQA 3NTQA 4WZZA 5HF5A 4DCOA 2A5LA 1RM3A 2CXOA 2H54A 2W4IA 3EIOA 3C5WP 3IP6A 4P53A 4UHEA 4PS0A 1S6YA 2DBZA 1Z4QA 2OPHA 1YRWA 3OF2A 2IVFA 3O1HB 1M76A 5TY0A 4ESEA 1W88A 1ZSVA 4R9VA 3AC0A 3GLFB 3TLGB 1QRRA 4NCIA 2P2DA 2G04A 2CLCX 3USES 1M8PA 3HUDA 2WWWA 2AFIE 2I2CA 3OLCX 1T0UA 3V7WA 5LD2B 3OA0A 1JFVA 5ITZB 3VKWA 4F4CA 1ZD5A 2WV9A 5B2EA 3AI7A 3QWHA 4EPYA 3LQRA 3W5BA 5J47A 3TLMA 1N2XA 1U2PA 3HJBA 1L3BA 5HX7A 3H9GA 4RFSB 1SOAA 4G85A 3MMNA 5CA0B 1DE0A 2ZJ5A 3IE2A 4BO2A 4CDGA 1D4ZA 3EPLA 4LYDA 3H8WA 3G6KA 1WSBA 4RIHA 3X1MA 1NJ5A 4JD5A 2CL7X 5KYXB 1MDBA 1CUIA 2XADA 3FCYA 3LJKA 2WF9A 3VR6A 4QD3A 5JEDA 4XLTA 4J8PA 4JXKA 5EA2A 4BQOA 1GL6A 2X1MA 1S7GA 4N3CA 2QMHA 3DD5A 3DBRA 5CM8B 1SVLA 2XTAA 3AEZA 1NVAA 8LDHA 2ROQA 4N40A 3OM0A 4Q9HA 2H9IA 2NUTA 3PTZA 2GEUA 5EXTA 4FB5A 4U7GA 4CQMD 1KEZA 1GG5A 3N1UA 3PC3A 4DSTA 3LU1A 4ITRC 4I5FA 4INZA 2EQ5A 3PHHA 3K2BA 1LW7A 4FFOA 3H8SA 4P82A 1E2QA 3BREA 3COZA 1EX7A 1T9GR 1DU4A 3CH6A 3GCXA 1KO4A 2JGKA 2R48A 1WMDA 3A05A 3NHFA 4HDQB 4HAIA 2IY7A 3EFBA 4QAJA 5F35A 4CFSA 4CMJA 1KJIA 4YAJA 1U8TA 2D1YA 3PVCA 4S04A 3F4LA 3S99A 2BKUA 4IQGA 3GEDA 1QZ3A 2OV2A 3WZLA 3B51X 1DQSA 2V4MA 3H0EA 3LLVA 4K86A 1FZTA 3PTLA 4LDAA 3UTCA 1LVUA 3QNUA 2GHQA 4QRIA 1ORRA 2HK8A 3A4TA 2EKDA 1QC5B 2IHUA 3K15A 4ETIA 1U6JA 3DZDA 3VNVA 1X8JA 1KEUA 2O0MA 2R87A 2UZIR 2BFEA 1R64A 2VTVA 4YAFA 5EJGA 3WLPA 4LYHA 3K96A 4L2IA 1WUKS 2A9VA 4GOKA 1U3DA 4HFMA 2VSXA 3QUCA 4KIFA 4L0QA 1VHWA 4LA4A 5EIFA 2X2PA 4ZO6A 3UM9A 2J9XB 1Y7IA 2QI9C 4BNYA 2OBYA 5FTNA 2WU0A 1Z6GA 1ZNWA 3HFRA 5FEMA 3OFJA 5LA6B 1ZGCA 3TXAA 2VIIA 3NOVA 1UMKA 4JI0B 4GE0A 1K98A 2FOXA 1CZKA 1PEYA 5EQDA 1EB8A 2PJZA 3AEKB 3S4YA 1AMNA 4HC4A 4GS5A 1BMQA 1Q1GA 3EISA 4B48A 5CITA 2OD7A 1U31A 4HNGA 2W2TA 3IR7A 3CN7A 1ZEJA 2FG6C 5F7JA 3E5RA 1UMBA 4EVQA 3ZBTA 2SCUA 2Q0XA 4B43A 4JJ4A 3U17A 1PQWA 1Q44A 3N76A 4QO8A 1AMUA 2B69A 1XA4A 3GI1A 1XEWY 1TW3A 4D92A 5JCOC 1YTUA 4BGVA 4HBZA 3UGKA 5KSYA 4B2LA 4MQ4A 4WERA 2AX3A 3EGCA 1OUMA 4QU9A 4QVGA 4W5HA 2OBNA 4ZRDA 5CVEA 2E9SA 1YIOA 3JTMA 1CJBA 1CY7A 1SXJC 4IIHA 4QL3A 2YL2A 2R7LA 3L02A 1ZH6A 2V9PA 4UTZA 1KP2A 4B2YA 2Y1OA 2VG8A 1TFRA 3E2IA 4L7QA 1R12A 4BVKA 2CFOA 4LXIA 5CJ2A 1YS2X 2BR5A 3FRHA 3ZCPA 2FW1A 3VR0A 2NTEA 2B5VA 3V4SA 1CXZA 3REQB 4IQFA 5COAA 4CM6A 1A95A 5LUAA 3W2TA 1WE2A 1EK6A 1S89A 2N9UA 1SUIA 2VNKA 3DEYX 4U39A 3UZUA 4HQKA 5CNIA 1ISFA 4IIVA 5JLJA 1G20B 3KKKA 4QATA 3VR4A 1EVIA 4F4JA 5SYMA 1TM5E 4JFAA 5JDIA 2J9FA 1AK2A 1FX0B 4KN8A 1CLUA 3DSRA 3J81A 1RXSA 3MAJA 2O3SA 3U40A 1V5WA 2ZBGA 2QMUA 3DDNA 3KAKA 1RHUA 2A0XA 1NQWA 3AF5A 1YC5A 1N3LA 2VP6A 1BFKA 1JNYA 1OFIA 4BEVA 5C53B 2HHAA 4W5QA 2BE7A 1G64A 2XMQA 3DNFA 2I6SA 5KCMA 4ZAYA 1D09A 4QWMA 1SHZA 1QTIA 3VR6D 4LXGA 4W5NA 4LYFA 3W5DA 5KO2A 1HYQA 1FIUA 2HWXA 2Q1YA 3OC6A 3HKEB 4L8FA 3H1AA 1Z16A 1EG2A 2R86A 3ZBPA 1HDXA 4G5SA 4CKBA 2ZGVA 4L1KA 2HAEA 2QN1A 4HXYA 4WOJA 5TQJA 1EPUA 3NUQA 5DW3A 1FXSA 4YP1A 4EB8A 1XQ1A 3DVAA 4YMUA 2RC5A 2CGEA 4M9ZA 2GZ3A 1PS8A 3TD2A 1LD3A 1Z3IX 3FR8A 3IQWA 3V34A 3WGZA 3A4NA 1YB7A 1O77A 2DWQA 1M1NB 3DXFA 3KQVA 1W5BA 1IJFA 2IGBA 1G7RA 2YVLA 3NWPA 1L5KA 5HIIA 4V0LA 2D74A 1VLQA 1N77A 2FHPA 3HYTA 5K8LA 2GHIA 2PTHA 2VXYA 4QSMA 1TPYA 2VS1A 5KNDA 2YH2A 3B1VA 3BGVA 3O8QA 3TQFA 1JQLB 4FJ0A 1F3LA 3GLHB 1G59A 4DMLA 3LYLA 3T7CA 2ES4A 5CW2A 1SQFA 1XTPA 3TYXA 4RTRA 2VXBA 4CM7A 2CNBA 2O2HA 1M5RA 2LIPA 2QRJA 2BBOA 2ZRKA 5AM2A 1I1HA 1I01A 1UINA 4ITUA 2GKSA 2D5AA 4NH0A 1AT1A 1PTJC 4X91A 1QS0A 2Z1NA 2WC1A 2NW6A 3GCDA 2YMQA 2Z2ZA 5HE8A 4JC4A 5ARBA 2OGSA 4YACA 4COKA 3GQVA 4Z8YA 1PR4A 3AOEC 3ZE9A 1TAUA 1Z08A 5FQNA 4MGKR 5CD9A 5EP2A 1CUEA 4O2RA 2SICE 1B2RA 2FUCA 3OKFA 5A0VA 4ND8B 3RG8A 4X90A 1Z39A 2ZUWA 3AF6A 4W99A 2P4EA 3RGWS 3HWWA 5BWCA 2VYNA 4IWXA 4PG6A 1HNZB 4KYVA 1YL6A 3EN0A 4M1MA 3VZPA 2G0TA 3DMDA 5HZMA 2CWDA 4OOFA 1KH1A 4ZO9A 1TECE 3F7NA 2CMKA 2QK4A 3G0GA 3GPDG 4B0PA 5IYZB 4MDFA 2ZFUA 1LXCA 2D8MA 2JJYA 3PHJA 1Q1NA 4U2FA 5F3RA 2OYCA 4EB0A 5A2GA 3PT5A 2HA4A 1MC1A 5BNIA 5CA1A 3GMSA 1ZWLA 1UDCA 4JSYA 4EI7A 1EH5A 1DHRA 1NVBA 4POAA 1S3FA 2I71A 1UJ4A 3EH1A 2PZLA 1E64A 1FB5A 3HBNA 4ZO4A 4JI2B 3EZ6A 5KX5B 2ZRCA 4X1YB 5ENVA 1J5EB 4HGPA 3SC3A 1SCUA 1VE5A 3CBGA 3QKUA 4DT1A 1UC8A 2ISSD 4C4OA 1GRNA 4NCJA 4Q1DA 2I0FA 3EXEA 2V3CC 2V0GA 1H2BA 1VJ5A 2I6FA 4W8HA 4Q1VA 4EA9A 1SH7A 2I2XB 3VR4D 3I61A 2D00A 2JFFA 4MYCA 3FMGA 3GN2A 3RIHA 2FPPA 3G9TA 4GYKA 2UU9B 4NH4A 2FTKE 4C2BA 3U19A 5AR1A 3SLRA 3OPXA 4D26A 1R74A 3CUKA 5JCOA 4V2UA 4F3RA 1W30A 2VXCA 1P17A 5KC8A 1JHVA 4DG5A 1YE8A 2JEYA 5HOQA 1MNAA 2DUJA 3MM4A 3FDZB 5GV8A 1SXJA 4EHAA 1TDJA 5H68A 3FNRA 4XTRA 4Z9AA 3EXG2 5CT9A 1N3YA 4CUKA 1AN9A 4PYRA 2FSPA 1VQ1A 3AT1A 5H80A 1OE0A 2H29A 4K9LA 1O0BA 1E2GA 1EBFA 1MGOA 2ODNA 4JYZA 1I7DA 2VDWB 3FJYA 2VQEB 2P4HX 3O95A 4KXWA 3DDZX 3NV7A 1MJHA 3F90A 3PSHA 4KDFA 4PGMA 2C2HA 1AKUA 5A4KA 1X7XB 2WM2A 2Q6IA 2JHGA 4IV0A 2X23A 2QJOA 2F62A 1TEVA 3PDWA 1C1XA 3D7NA 2ZRIA 2C9BA 5C5CA 4XUEA 1UP7A 4PHTA 1K3UB 2PL1A 1QDEA 3BJZA 4IRUB 1XU4A 3I2YX 4J7CA 2ZWOA 1S96A 3LT1A 5AXDA 4PFKA 5TMBA 2X5XA 4XRGA 2V4UA 1INLA 2E49A 2Y6VA 2UZ1A 4YDQA 5I7SA 2O9JA 3AIOA 4ATNA 3FPBA 1XVIA 1DRKA 1WUTA 3L0IB 1CR6A 2XUGA 3K0KA 3MRXA 1B6GA 1P0IA 2J0VA 3RT7A 2FW0A 4WA8A 1K4YA 1JLLA 3FSRA 4PONA 4BVLA 2GCNA 1KOFA 1ZLYA 4A92A 2BPOA 1SMKA 2Q07A 1TVKB 3T3PB 1N3IA 2Q7OE 5BV1A 4K9DA 4JU9A 2WAMA 4OHZA 2HMSA 4XVRA 4BAGA 3ZXXA 4QNMA 3D3KA 1KO7A 2PUTA 3SIRA 1KDRA 1WY5A 1U7TA 2YHBA 3KSUA 1JFFA 1PWYE 1GRCA 3U4CA 1Z33A 1BDMA 1UBUS 3Q10A 1SVOA 2C9DA 2FR8C 3BILA 1VA5A 3JYQA 2WUFA 4GM1A 1IJBA 1X8XA 2I4TA 2P2GA 2PCJA 3G89A 1Z47A 1BD4A 3WDLA 5LP6F 5WRFA 5C8XA 3FF1A 4UZEA 1I4DD 1PG2A 2QDXA 3HMQA 2VYND 3IALA 3IBCA 5KKCA 2FPLA 3BXZA 3KE8A 3PNMA 4BEJA 5M2QA 4LNUA 4M88A 3W6OA 4J6FA 3E3OA 3TIFA 3A6KA 4AD8A 4HV4A 1CR1A 3VDMA 5BYBA 2AOTA 1CEXA 4Y6LA 1O6ZA 4UCWA 1M6EX 4WECA 3KKEA 5DLEA 1TUBB 4V0MA 2HSGA 1NVGA 2ZBFA 1OJLA 7ABPA 4CU2A 4B3IA 1V2GA 4PRLA 1TT7A 1EHCA 2BEUA 2I9PA 2YN0A 3IPRA 2OZVA 3FPFA 3IPLA 5JMWA 1MQSA 2IOFA 2VDVE 3JQ6A 4RENA 1JSXA 5B7GA 4F2HA 2P3SA 3ZWDA 2IXEA 3QENA 4JQOA 4DCVA 4WZAA 1WB5A 2LZ0A 3AOEA 1C50A 1NN0A 1IEQA 3ICWA 3ZVMA 4DJJA 1VZ3A 3IO3A 5CXUA 4ABTA 4UTNA 1HEUA 4J1SA 4KBFA 4DXDA 1XLTA 3HSYA 1U3CA 3NC4A 4HNSA 3PGVA 4WN9A 4C0KA 2WPDA 2AOUB 4NENB 4MRSA 4RHUA 5TEWA 2H18A 2QD2A 1NNUA 1F60A 3AERA 4G4SP 4HPJB 3HDQA 4UZFA 4IEFB 2C5LA 1VCHA 1VPLA 1X8LA 3PNQA 4WINA 3ZIAA 5BN3A 3MAAC 1QGDA 3CZPA 3B6KA 4JLKA 4REQA 2OB1A 4FGLA 1D6JA 1L3CA 1MG0A 2CJFA 4OYRA 2YC2C 5IXSA 1NHGA 1GPMA 2C4MA 1XAIA 1SXJD 2DFKB 1LNQA 1PNQA 2ZIGA 3KELA 2HJGA 3ESRA 1WPRA 2RHHA 4GWKA 4HEA6 1F8FA 4IYRA 3W9UA 3GRPA 5HEKA 5JVDB 4YB8A 1TTTA 1P1JA 2EKZA 2B2XA 1BDBA 2BDTA 4EKEA 2HQRA 3O75A 1JMVA 2J9RA 3RE1A 1V3QE 2KM1A 5FOQA 2NO4A 4YJ3A 4RHTA 1II8B 1AX9A 3OH8A 4LTMA 5EYPA 1SAYA 1XVLA 4I14A 5LZ8A 4BB0A 3P4YA 2VSYA 4I5IA 3UJPA 2O0JA 1RBZA 2XMRA 4UTVA 5JWRA 2J0QA 4XUDA 2NP7A 4V1CB 1AKMA 1T9CA 2OSVA 3ETLA 3QPWA 4LYEA 3CX7A 1NI3A 1M6HA 4D9KA 1E3LA 4WLEA 3FWPA 3HGQA 2VAVA 2E4WA 5ADHA 5FH9A 3BE6A 1CQPA 4HGQA 1UT8A 3NRCA 4MVYA 1DAIA 2UKDA 4XKJA 2H1LA 4BXOB 2C0CA 4ICIA 1DXOA 1Z5OA 2E82A 5JXIA 1A0OA 3AF0A 1XDGA 4QDKA 4ZDJA 2ZIXA 4IIJB 4EGFA 3F46A 3AF1A 4J2TA 4UEOA 2R7KA 1T2CA 2X58A 3K20A 3O31A 5BPFA 3OPMA 4EVSA 3IDOA 2J8ZA 4EYOA 1YB1A 4PWYA 5EJ5A 2C84A 4WPGA 2PFSA 3BDAA 3CVXA 2OG2A 4HXFB 1Q91A 4R51A 3RAEC 3SEFA 4BNXA 2OCIA 2RSLA 1DBSA 3WGOA 4BASA 5A4AA 1Z45A 2GN6A 4L4XA 4ZVVA 4KUHA 1Y80A 3ZW8A 3T3IA 1DEXA 2B92A 1P74A 1U3TA 1EXNA 1M34E 3HBMA 1JAHA 1SZDA 1IN1A 1N1DA 1XK6A 1KIFA 1ZD1A 1BIFA 3NXSA 3O92A 2BBSA 3PQDA 5T4HA 5EXXA 5JNVA 2PA0A 1SD1A 2Q41A 3BB4A 4TVBA 4BP8A 2ECFA 2ZT8A 1W8DA 1VCNA 3NIDB 3O94A 1BVRA 4JZYA 1OZGA 3DT8A 4P08A 1H2EA 3QI2A 5F7ZA 3CKKA 2XECA 1RC8A 3TTWA 4HDKB 3IJEB 2VHZA 4D9BA 2FWBA 1G21B 2P2CA 1DJQA 1D2HA 1Z6ZA 3G1TA 5CM2Z 1WG8A 2PYZA 2GN2A 4GLJA 3F6CA 1Z15A 3MVEA 3O4FA 4UHKA 1FDOA 1VRCA 5THKA 4BZZA 3JPWA 3B60A 1YXMA 3FRIA 4LRSB 1HH4A 2H1FA 4KQCA 1ULUA 3HVUA 4C4PA 3T1TA 1U9JA 3DL4A 1M6VA 2QVLA 2C5FA 3C14C 3I30X 3A9SA 4G86A 1AF7A 3C3YA 4MUEA 5EUBA 3PYXA 4BJ5A 4LOIA 4OPMA 2G7MC 2IIVA 3G7NA 1L4LA 3TB6A 4EL5A 5AOVA 4IVQA 3DYVA 5K3OA 4CM5A 2K6GA 2VCEA 3LZDA 1YR1A 5CLQA 5ANRB 2WILA 4B80A 1MABA 3K0AA 3MYYA 1TMYA 1RJDA 1Z06A 4JLSA 1FRFS 1YU9A 3Q6IA 4NJMA 2FR8A 3BSFA 1JWLA 2JATA 1KRXA 1D03A 3DEIA 3FKSA 3VGPA 2RJ3A 5GZ3A 4ZK2A 3RRZA 1OZ0A 1TO1E 3ZQ6A 2WPDD 1LEHA 4Y8VA 1PT8A 4FI3F 4GNRA 1IHYA 3VU8A 4WBNB 1DWOA 1F5NA 1FTGA 2R6JA 5F3DA 3ER9A 1YC2A 1CUUA 5JRZA 3GRVA 3ZIAD 5EHQA 3PHLA 1VLVA 4Q1CA 3THOA 2FMUA 2UZ3A 3BZWA 3OT1A 4FN4A 1P6QA 2BGKA 4R8VA 2OCBA 3ILVA 5BQOA 3WL4A 4AZ0B 3P7MA 1DBQA 3A1VA 3OZGA 4MS3B 4ZN6A 2GD1O 5EE1A 3THSA 5FL7A 1DTSA 1XMJA 4LAFA 2XCRB 1SBZA 1Z5WA 3N2IA 3B9QA 3LC1O 3LX6A 4ZVOA 4CQNA 3NT4A 2YOGA 1JDNA 1PR1A 4UBLA 2ZJ8A 2D2XA 3BF8A 3BXFA 3KSDO 1I32A 4DLZA 1JU3A 5H3HA 3HC7A 2CN1A 3O91A 5EPEA 3ES9A 3T38A 1O4WA 3EGEA 3GMTA 1V8BA 1JHYA 4NOJA 4BNMA 1X0VA 1LLCA 2PSEA 3AVWA 1TI7A 3CTMA 1TB4A 1MNQA 2JFNA 3FTNA 1CJVC 3QBJA 2ZZMA 1EX1A 4BLQA 1HBJA 2N0SA 1C7RA 1QPZA 1KI2A 5AHOA 1TRKA 2AI1A 2R85A 4RPGA 4KFUA 3EGIA 4KKVA 3TIGA 3JSAA 4CIAA 3NWBA 1NXTA 5BXYA 5AW0A 2EGGA 3LKDA 4R40A 4RSGA 2CHVA 3ETNA 4ZJPA 2JBWA 1U0SY 1X3LA 1E7RA 3L1JA 2TS1A 1Y4AE 2O6HA 1D2RA 4MEBA 1GFWA 3FPSA 2IA5A 2ZI4A 4AY5A 3QWAA 4M1QA 2P4SA 4LZJA 1CNMA 4RDCA 3I05A 1JR3A 2BELA 4K8OA 1ZD2P 2A4MA 3KETA 1JHPA 4B35A 1DQRA 1PW5A 1EZ4A 3UC5A 3IUPA 2X9LA 1N8NA 3NBAA 1JF8A 1Z5VA 3RNOA 3TZKA 4BKQA 5LD2C 4G8CA 2CLOB 4KEAA 5FUXA 2A1IA 3PNBA 3UG6A 2CLDX 1V8ZA 3FTQA 4O8CA 4XEHA 4AJPA 1WCIA 4YH1A 1Y3DE 5EKUA 2PH5A 2JGIA 2F55A 4I4CA 3MJHA 3O3NB 3DE2X 2FJPA 1U02A 4HH1A 2J9ZB 1T1IA 3ZV6A 1GNTA 1JJVA 2ZYAA 3CTPA 4QHTA 3EC1A 4Z53A 3UK6A 3GWZA 1OI7A 1M2OB 1IM8A 1L8QA 3WGHA 4ARZB 2Q62A 1EXDA 3J7AC 2EQBA 2EZTA 2XI4A 3DM9B 3LS2A 1IBKB 4GDFA 1RJGA 4X44A 4X62B 3TE7A 4LCBA 3ELDA 5FBVB 3C39A 3ONEA 1CP2A 4HTFB 4ESOA 4ZAWA 2AJDA 2X5KO 5F21A 3BXXA 1D1SA 1J8MF 3NASA 1DG1G 4BBPA 2NYUA 1NP7A 2WUDA 2Q8PA 3ZN2A 4YP6A 1DINA 5IARA 4C7MA 4JI8B 3V48A 1XZQA 3K35A 3V8PA 5B36A 4S1OA 3GFGA 5L7TA 4G4JA 4HDSA 3I34X 4N0DA 1RRPA 1N2IA 2IYAA 3NRJA 2P77A 2SBTA 3VQTA 4KLZA 2J3EA 4NX2A 2CLHB 2N75A 3VJRA 2WUEA 1TCBA 2DC1A 3DZCA 3NOOA 4RJKA 1GPLA 3FKSD 3QYJA 2VHXA 2JHPA 3EQZA 2WKWA 1E5LA 1ZINA 3O6VA 3T3EA 3PBKA 4F86A 5G40A 1WEKA 2LE0A 4D4GA 3SS9X 4LOJA 5CCXA 2ZYDA 3C1AA 3E3NA 1J4AA 3ZKWA 2HBQA 1RQLA 4JX8A 1EFKA 3UFXA 3EGDB 3G8CA 2UXDB 4ER6A 3BG5A 1YJ8A 3B9PA 3UV7A 1FJGB 3BPSA 2XQIA 2ATXA 5CT4A 2G06A 2A94A 4NJOA 1OYYA 2HRDA 3KPYA 5DM4A 3O03A 3D8HA 1H22A 5FFNA 2XYVA 5FL7D 4WY8A 3SR3A 3DBVO 5KU7A 2N3ZA 4FWTA 3Q11A 2QRUA 1OTXA 2WV7A 3F3MA 1U7WA 2KWIA 3G1WA 4HX5A 3KDSE 3T8YA 3C3EA 3SM3A 4URVR 3KT8A 3Q7RA 1RYFA 3ZWOA 1GN8A 3DO5A 5CH8A 4MSUA 1R5NA 3OF5A 3KB6A 2YS7A 1P7ZA 1ETHA 3Q85A 3BERA 4CEHA 4OUDA 1GG2A 3WTCA 5ERGB 2RGDA 5HUQA 4RV5A 2EOAA 2ZU6A 3EAGA 1U0TA 2BSQA 5IKPA 2H11A 4MUJA 4YRFA 2OYRA 3UAOA 3ZXIA 4BX0A 4QUAA 3OMLA 3TAHA 3P9CA 1P1FA 3TW6A 4AZTA 3EDYA 4ZXFA 1BW9B 1UPCA 2AXPA 4CIVA 4UAUA 3BIOA 4YRRA 5FT9A 1ONPA 4D96A 3QLVC 1OI2A 2KMLA 1FTSA 1TTQB 3AMVA 4XJVA 3KT6A 5E6RB 4ZCLA 3LOUA 2P2NA 4R2MA 1FMTA 1NLMA 1PWHA 3NT2A 4FEEA 5SZIA 3T7KA 5CBKA 1O03A 2AR7A 1KO1A 2JLUA 1JR3D 3UKOA 4EG3A 5KVQA 1Y6QA 4RTKA 4ZAXA 1JHQA 1P75A 3I6BA 1EUQA 3T54A 2JI8A 4K6OA 4X3PA 4URYR 3L7LA 1UC5B 5CLLA 5K0ZA 3SXUA 4EUNA 2Y8EA 3QF7A 5F73A 2LD4A 2XBUA 3I8XA 2X8LA 3AYXB 4QOIA 2GCIA 5K4AA 3OZCA 5IWAB 1ISSA 5EPOA 5EMMA 3U26A 3K9BA 3RODA 3C97A 4OQZA 1OYWA 3W78A 2HKIA 3MLAA 8GPBA 3EIFA 3LOPA 4UDYX 1ODCA 3CWQA 4G1CA 3LCJA 4JR2A 3SSMA 2HWWA 3G3EA 2PX3A 2LTAA 1DAOA 4Q02A 1VIVA 2WUWE 3DP9A 3U3ZA 1WSAA 3D6AA 3ESBA 1LBSA 3QVMA 4DWJA 1PN3A 2RB5A 2OV4A 4M7WA 4X71A 2Y1DA 5TQ2B 3CEHA 4AQYB 1UM9B 3HSKA 4BUZA 1IEXA 3D6JA 3GLKA 3IXMA 3TLGA 4BFWA 4R2KA 4QTXA 2A7XA 3RS7A 1XEXB 2WB4A 4BDSA 4K05A 5G0TA 1GTMA 5IS2A 3WA6A 1M8JA 5ITZA 3GVIA 4YBZA 4O2AF 4ER5A 4FWIB 2BFOA 3ROFA 4RFSA 5T8KC 1T5BA 2HBYA 4NECA 1NJ2A 5CA0A 1PBNA 1R6TA 3L7AA 4Q19A 3WFIA 4AK9A 2BTEA 1DQPA 2X8AA 1RE0A 3HLTA 2WQ6A 2BAGA 3IXQA 3PUJA 3QYFA 5KYXA 2NADA 3S2SA 4GOOD 2A9JA 3KVNA 1FSGA 2I6TA 3OC0A 2WG0A 4OFWA 3GDOA 4B3CA 5BV2P 4MV3A 3C7KA 2MJLA 3K8ZA 2HDHA 4FMCF 4Q3OA 2IF2A 3NZEA 4F8JA 4TSFA 4RPCA 2NSYA 5EOVA 1HDGO 3D6UA 3VC1A 3LHDA 2WTBA 1CZNA 2FSSA 3LBFA 5H3CA 2WYHA 4ZTZB 1SEVA 4C4AA 3AP3A 2RHMA 1MIOB 4YDSA 5D3ZA 2MU1A 4F7WA 5EGNA 2XMGA 1QAQA 1L4KA 3UMGA 1FXWA 1X0XA 4ALJA 1PKXA 2A30A 4CFZA 2WABA 1E9RA 4RQAA 4ZVSA 3DZIA 2J30A 3MILA 4EUSA 1I6LA 3AR8A 4QPZA 5EIOA 2JCBA 5EP3A 1ZUWA 1L5LA 2DFLA 4J0DA 1PFUA 4JB2A 4R1SA 2ZSEA 1QC5A 2JL1A 4N7RA 2GFQA 1Y7TA 4ZYVA 1NDUA 1ZY2A 4RFLA 3OCVA 4YREA 4B4OA 4FD3A 2OCYC 5LP1A 2QJFA 3OBIA 4DN6A 1RQ7A 3IAEA 3SC4A 4K9QA 3E8MA 3OVMA 2IJGX 3RS4A 3MMXA 5FLXA 4WXYB 4BNDB 3DHNA 1JHDA 2RJOA 2WIKA 3IULA 2D2EA 5D86A 5LA6A 3JZMA 4DM4A 2FW7A 3L7KA 1FDRA 3ANLA 3SFVA 3ZCUA 2PUFA 4DR7B 5ENZA 3FLEA 5GQSA 2O19A 4DA8A 4WOCA 2P9BA 2GEBA 3AEKA 2PS3A 3H6KA 4Y2VA 1YZYA 1AGNA 2V6BA 4HH4A 5P8WA 3ZCRA 1OBHA 1ZH4A 2EZ8A 3I9JA 3LHIA 4BMYA 4OM7A 2C9OA 3MRTA 5TARA 1U3GA 7MHTA 4FS3A 2XUDA 4OI0A 1H66A 4CI0B 1E77A 2P9JA 3DUFB 3X0DA 3Q3HA 4GMFA 3AHEA 2PAAA 4JAVC 1LJUA 4L95C 5G53C 4CM9A 4TYPA 1KOJA 3WIOA 8MHTA 3H18A 4L78A 3WKBA 4DBLC 4BQNA 3G2MA 1LWNA 2FWMX 5FO0A 3BD6A 4CKXA 3E8SA 3UWSA 1JDUA 3DGFC 5E0OA 3D1JA 1UAGA 1GD1O 1U9IC 2GSDA 4GKBA 3UOGA 1PSDA 1SOMA 3QLVA 2I8CA 3Q88A 1PFVA 2YJ3A 2PKEA 4E07A 1NX9A 4HEHA 4YT4A 1X7ZB 2B9VA 3T4EA 2AJ8A 1STOA 3VZQA 3U09A 3ND9A 3U60B 5IAAA 4R2JA 1D4OA 1PZMA 4OHUA 5E4FA 3R4VA 4NZYA 3REQA 4JP2A 2CMFA 4UAGA 5HMLA 1Y1KE 4RC9A 4L8WB 4HUQB 1NMEA 1LK0A 5L3VA 3ZHZA 2C4VA 1SEPA 2B20A 1EP2B 1G20A 4W1SA 4I50F 4UFPA 2OHOA 2YFKA 3MJTA 3JVDA 2JCGA 1FX0A 2VP3A 3E7WA 4L9RA 3ACDA 1HDCA 1CUGA 1Q19A 2HSDA 4DCSA 4FFWA 4KGZA 4PZCA 4KE9A 2OO3A 3I83A 4EB6B 5KS2A 2IY8A 3Q8XB 5IZCC 2I80A 2O2CA 5FTWA 4YRMA 1OB2A 3OQMA 5LCXA 1YDHA 1JX6A 4R1MA 2VK2A 2QMZA 3AIMA 4PCVA 1GFZA 2QPLA 1OF1A 3BHMA 1B0PA 1YNSA 1ZOOA 3NEJA 4TSKA 3V8EA 1SHJA 4FXPA 1X9GA 3HKEA 1A72A 1XZGA 4WXHA 2L0XA 4KTVE 3JQFC 2WHXA 1QX3A 1NGSA 2BE9A 5SYAA 2V3WA 2RGUA 4B8ZA 5D3KA 2OMEA 4TSFD 1VGVA 5I8ZA 2F3QA 2XDQA 1UEIA 2L69A 2Y1CA 2YZNA 3ESZA 4XSHA 4ZYZA 4LPSA 2B1GA 2IXGA 2O7RA 2YW2A 3KQHA 3O8OB 5JY1A 3TZEA 1G0OA 2ZAIA 2FQYA 4J3FA 3X1JA 3F3YA 3C6YA 2ZRBA 4IW3B 4WNIA 3BQMB 1XTIA 2VJYA 5JD6A 4TYWA 2RBEA 4I5GA 4I3FA 3ROTA 1IM5A 1M1NA 1UWCA 1NBIA 3AJ9A 1QJ4A 2H5JA 4BY9E 4C0SA 3IUBA 2I66A 1NBWB 2C5SA 4XGKA 5ILGA 121PA 3S29A 2FF5A 2PT7A 4U2BA 4CMGA 4R4JA 1GGNA 4FHFA 3OPQA 2W2LA 1HT0A 1KJYA 5D2CA 3OWOA 2QD1A 2LR0A 4X60A 3DKKA 1CQXA 2KPOA 4B33A 3AR9A 3CLRD 2B21A 3TTTA 2QTZA 5LDHA 1J5XA 2GERA 1D0VA 1MB3A 3GLHA 5EQJB 3VVBA 2Y2VA 1QHHB 4CKYA 2HGZA 2RG7A 5J4YA 4HADA 5CB4F 1E99A 2XW6A 3CUWA 4X41A 1HYHA 1NNSA 3TZHA 4PIMA 9ABPA 3SMQA 5JSZA 4QOHA 4MPPA 3DE1X 1ZP6A 1B8NA 1HRKA 3OE7A 4FYMA 4AULA 1YKGA 1EXMA 4LV6A 4L4SA 3KTOA 2BR4A 1BXZA 2H48A 2GK3A 3IBYA 3U6BA 1T9GS 2COUA 1G7SA 1NVXQ 1DCMA 2WWGA 3DAGA 4UHDA 4OXYA 4EHBA 1E9EA 3AILA 2G9RA 2OAGA 4AKSA 4MVJA 4DLLA 3P9YA 2WNSA 4XFKA 2B3TA 3VRHA 4ND8A 2G71A 3IAFA 4KLRA 3TVTA 1AB5A 3TTVA 3UYLA 2O3TA 3PF8A 2CEAA 4BQIA 3AOGA 4EO4A 1WZEA 4MIOA 4CM9D 5DWQA 4Q05A 3ZI0A 1CYDA 5A4IS 3CW2A 3GT3A 2DRIA 5CPBA 3WWZA 4Y98A 4TZKA 2Y76A 3CF6R 3C74A 5IYZA 1VSVA 1XPOA 1H4SA 3F1KA 3V1TC 1ENPA 2YOHA 4G2NA 3PHBE 4GRIA 1XEWX 2V9ZA 1K88A 4DMKA 4MCIA 2JCYA 1OHHA 2P6NA 2VJNA 1BEUB 1HGXA 3M6LA 1CU1A 2ZIWB 3JYNA 4V0OA 3VDXA 1QOZA 1P60A 4HWPA 4GM0A 4X1YA 5TXGA 5KX5A 1A4IA 3OJ0A 3W5HA 2H08A 3GCWA 2HU2A 1AF4A 2AR0A 2OHIA 5K6RA 3K0EA 1KU6A 3ITDA 1L1EA 4MH0R 1APBA 3SYMA 1ID8A 5AW1A 2GTIA 5B4TA 4UBNA 3R09A 1VYUA 4NOKA 3QNMA 1QU2A 2V0CA 5JSQA 1E20A 2O2XA 4IUBS 4UQOA 2H85A 4KMMA 3CG0A 4WNAB 4YUWA 2D5CA 3I37X 1Y98A 5T6BA 3A1CA 3E15A 4OQNA 1GPH1 4MYDA 1I2DA 3BBPA 1M6WA 3QG1A 4CLEA 5C3MA 2EZUA 2PKQO 4MKZA 2O8BA 3P9QA 3CZ5A 4XGRA 5L95A 4LDPA 1UT5A 1P18A 2B5WA 3DF7A 3A3PA 1AV7A 3RFXA 2WTXA 4ZT2A 3FDZA 4WGFA 4Q3DA 1ZOPA 3HXQA 3RJTA 4IZ6A 4LF6B 5DBOA 3FPKA 4ZAGA 5AJZA 4JBHA 5TF4A 2GO1A 2PU5A 4D0NA 3QOFA 1U0LA 5CVUA 1EM6A 3PL5A 3B89A 1Z29A 2V6JA 5J3JA 4KWCA 2VDWA 4MWOA 5C7IO 2C3UA 3ZD9A 4L08A 3GLGE 2CVHA 3BN3A 2IZ7A 2I4RA 1X7XA 1O2DA 2JLWA 3IO5A 4ISBA 1XZKA 2ZAMA 1N5MA 4QREA 2PGAA 1L2TA 1UBCA 1J06A 2J3LA 5HCUA 3T94A 2DSNA 2I1WA 3H5TA 2XAUA 3NKVA 4FZ3A 3WRWA 2FEAA 4V39A 2VUUA 4HATA 1LPOA 1G17A 5IBRA 4AJNA 4CVNA 5KYGA 2WYWA 3LO5A 3PQ2A 2NTYC 4MGEA 6GPBA 3NWOA 1KMHB 3DE6X 4N65A 1COZA 2AMLA 3S2GA 5L3SA 3NEAA 2KHZA 4DJAA 4ZEVA 1S9DA 4I5DA 2RAVA 3HCFA 5IZCA 4RORA 1CUHA 2C1XA 4GZ3A 4MWSA 3ERCA 4CKEB 2FX3A 3X1YA 4W5OA 1L4UA 1VKNA 4TTIA 4CM3A 1U5BB 4F45A 3MIIA 2W6OA 2C3OA 3Q2KA 2ORED 3CEJA 1R6XA 2O7VA 5DPMA 2E5LB 4DANA 1TM7E 1RYHA 4H4DA 1TVKA 1CT9A 2UYCA 1DG9A 3ASZA 1OLUB 3GLUA 3OE7D 4MQUA 4R2LA 4RD1A 2A5FA 1TF2A 1M2JA 2P5YA 1I1OA 4LOHA 1FYDA 1U0RA 4ZV4A 1S02A 5IAGA 5L4LA 10MHA 1SKMA 3FPEA 4R2HA 3OF3A 3GLIB 1NY5A 4BAUA 2PKRA 3LV8A 4BN4A 1QPGA 2I7CA 3INTA 4PO8A 5C9ZA 1CSEE 5FTLA 4EI8A 1VCOA 3NU1A 4JUBA 1VOTA 4MVJD 3N8GA 4QPPA 3SOPA 1ZI9A 3QTTA 1FY2A 2ECKA 2ZIEA 4JASB 3D5EA 3IVGA 1P5ZB 5F78A 3I3SR 1UKAA 2XD4A 4KMOA 5E9AA 2LV8A 2ONYA 2PSHA 3DDOA 2BKXA 4W7SA 5KQLA 1L7PA 3IIKA 5JSHA 4U5QA 1IPHA 2ZCJA 3OOYA 1WW3A 3DW1X 3OJLA 4IHQA 4E11A 3W9SA 5BSWA 5JW6A 4ZP1A 4XLZA 2WWVD 1R0RE 1RAIA 1I4TD 1NFQA 3L49A 4NBNA 1YDFA 3O2QB 1XTQA 1FLAA 1Z0AA 2C82A 4ZOLF 3URKA 4OHKA 5LSAA 1NVVQ 1TUBA 2XF8A 1OHHD 3BF7A 3IEXA 4M0KA 4MVXA 4RIFA 1YF3A 4KVZA 1KKLA 5MGNA 2IODA 3ZGLA 2G4LA 1I4LD 1E5TA 4TT8A 4N6OA 3IB3A 3LZCA 3ZUPA 1CNEA 3V7UA 5CDFE 2IHBA 4P93A 1VG9B 4I9UA 4B6QA 3ONFA 4BV8A 4QUEA 3FFAA 1A96A 4DJ5X 1NNLA 1WMBA 2NX2A 3T3DA 1EIZA 3OY2A 5A5DA 3WHLA 5DV9A 4OQPA 4I08A 4ENUA 4RW0A 1FE8A 1QIFA 1DL5A 2B3DA 2H1WA 4M1EA 4B6OA 5BVHB 1QORA 4YAUA 3VBEA 3HKCB 5TT1A 2BFFB 4AIRA 4F1JA 5CBPB 2CL5A 3UT5A 1WZIA 2AOUA 2GEJA 2GOYA 2AOXA 4NENA 4FE3A 2ZU0C 4JJAA 1NJ6A 4RTLA 1F7UA 2UXBB 2F3PA 4IJ5A 1EUCB 3URMA 1EHYA 1H69A 1J8DA 4HB0A 5AO9A 4UULA 3G2IA 2V5VA 1UXHA 4QNRA 3WQBA 3K9CA 4G65A 3RJZA 4BMVA 3IMEA 3B1YA 3I9V1 3QFFA 1CERA 2G72A 2V7QA 3MF4A 1PNOA 2BI7A 4ND7A 5DGIA 1OI3A 3OZDA 1TYDE 2FEWB 4GOMD 4CQLB 2DWUA 2VDRB 5JVDA 3R6LA 4NMXB 3VC7A 3Q72A 1DIOB 2Q45A 4C76A 1SZPA 4C4ZA 1YZQA 3T5MA 5CTJA 2ZJ3A 2D1RA 3IE0A 1FNDA 5ALGA 1II8A 1OW3B 5IT9A 1NUUA 1XNGA 3PHIA 1JDZA 3C1UA 2BOVA 2BN4A 5DM70 1QFYA 1R8JA 2EFEB 3WIEA 4PTYA 2W2XA 1JA0A 4DM3A 5IMSA 1U99A 3A4IA 1X42A 5EJIA 2P3OA 2GQ0A 2XV1A 1X6VA 4NR0A 1EBBA 1WWKA 2AZDA 3NH9A 2QYTA 4KO4S 4N5IX 4R0VA 4OI4A 3VUFA 4E5NA 3PWZA 4HGZA 5ALZA 3O2SB 1ML4A 3AFGA 4BO4A 1MB9A 4BXOA 2ZVPX 3D2CA 1S1CA 3JVVA 4AMUA 3MELA 5JDCC 3FYUC 3GMIA 2IHZA 1Q0PA 2HRRA 2IPAB 3D4PA 3MWJA 3P0JA 4S1VA 1OU0A 1JVBA 1ZONA 2VTDA 3AYZB 2FFBA 1EFRA 2EJUA 2GTHA 4IIJA 3AM1A 1D5CA 3QF4B 3SZ3A 5DM1A 1QRUA 4JEHA 2HDNB 3EF3A 4LRTB 5GV7A 3WK4A 4G0QA 3VTAA 1LBHA 3C1OA 4BWGA 3GRFA 3KLMX 3KOWA 5ETJA 1S4MA 1SUPA 4EG0A 2P65A 2P90A 2ZYSA 3W5SA 4QUHA 4QUDA 4JLBA 2CKDA 5JLAA 1MB0A 4P32A 5JQGB 1NVTA 3WMGA 4NZOA 5CW1A 5IAKA 3ZEIA 4N48A 4OHXA 1IY8A 2O0HA 2XNJA 4XX1A 5JATA 4CCAA 3HYCA 2VJMB 1Z6XA 5EKSA 1DUIA 3OX3A 4DR2B 1KDTA 4YGYA 5K01A 3WLFA 3PVZA 5J40A 3OZAA 4F21A 1PNTA 4LHYA 5HBGA 1B73A 1WD5A 2CXUA 2HHLA 1JEQA 1FVOA 4R69A 3ZU3A 1I7QB 1XDUA 1HYGA 2GK7A 2R8BA 2HO4A 1XI2A 3IV7A 4MQEA 2JLYA 1UBHS 2VF4X 4JP8A 3N8NA 2OWDA 1FLVA 1DIHA 1JR2A 1ZQ1A 1V1MB 3OE4A 3DHYA 1A5TA 1Q74A 1JLHA 4HDKA 4Q4JB 4YLEA 1G21A 1OILA 1WABA 2TMGA 2BCEA 2VKQA 4QU5A 5EINA 4N41A 3LMKA 1YRHA 1B8OA 2QJTA 1QGED 1EP9A 1A5BB 3ECAA 5BUSA 4MV9A 2C99A 2Y1LA 3DFFA 4K6CA 3BMQA 3E2PA 3AI2A 1PX2A 4I19A 3MSCA 4P3YA 2O7QA 3T06B 1QK3A 1AKEA 2JD1A 1YSCA 3L0SA 4LRUA 1QANA 1KE1A 3C6ZA 3OQJA 1O5IA 2C1ZA 5C8ZA 4DDHA 4O59O 4NBRA 4PAWA 3C3BA 2L42A 3T9BA 4BMXA 3F5DA 4NYMR 2JJQA 3RYFB 3ZCSA 3RVQA 5LU8A 3F2IA 5K8CA 2DM6A 3MGKA 4MAMA 1JFRA 3PQ3A 3RAJA 3U81A 1GQQA 4HFRA 1O5OA 3B7GA 3EEYA 3VI3B 1FLNA 4J4TA 1LK5A 3L6BA 4GWLA 1FA9A 3WX0A 4BMNA 3M4ZA 4JJFA 2DYKA 5AK4A 3MQ4A 2FLWA 2QN9A 1A04A 4GICA 4ZARA 2G3YA 2V6FA 4BGDA 3DTVB 4CMEC 3TD9A 4DQKA 2KBFA 4HAZA 5FUWA 3BWEA 1JTFA 2CFCA 2BI4A 4AZ0A 2V7QD 4KGXA 2J5QA 2VDKB 4MS3A 1GKYA 3KAPA 3B13B 3WP1B 5MN4A 4KE6A 1NT2A 4KNWA 3CRNA 3UHOA 3LVBA 4R8KA 3VTKA 2H3HA 3DT6A 4BX3A 2CYBA 1V1RB 3LXXA 2GEDA 2RGEA 1NBMA 2BCGY 1Z34A 5LKRA 1I8TA 1RWKA 2XF2A 3MINB 5IUKC 5I7RA 3KLNA 2JGDB 3THXB 4GP9A 1T8PA 1UP4A 2P6MA 4RWZA 4BJHB 1L7VC 1ZDMA 2EJWA 2XX3A 3L8MA 3DO8A 3UK1A 1P4HA 2PXXA 3CLVA 3HCOA 3H84A 1ATZA 1CIJA 1LFAA 3ILSA 3QQPA 5AI8A 2VF8A 3V8VA 2IUEA 4NJEB 1U2GC 1V1JA 4EKGA 3KVYA 2K4MA 5FBRB 4D46A 5JECA 1R4ZA 3WKCA 2R79A 3GFSA 1SY7A 2AQHA 1BH2A 1DP4A 4YUAA 1N57A 1EFRD 1SURA 2B7BA 2YC4C 4WCVA 1KETA 3I23A 1O58A 3ZS9A 4EP1A 3ZD6A 3A6DA 4EHNA 2FUKA 3BX1A 2DVMA 4N8EA 1HFKA 1N9KA 1AE1A 4I8XA 1Y5RA 4N39A 3NCTA 3RQIA 3GNTA 1YFZA 2WJAA 1TIPA 1WAMA 3VSDA 3GJ3A 1CUCA 1GGKA 1W0KA 2AXEA 4O4JF 3C7DB 3H5LA 4ENRA 5BO5A 3DC2A 3OQNA 1H9AA 1PZNA 1GYPA 4G9BA 1GKLA 1E1RA 4DYHA 1DQZA 1L8LA 3VOAA 3COYA 1GCIA 4AKTA 4B4UA 3OQIB 4DLRA 2RKBA 3NGMA 4LJSA 3G17A 4JB3A 3I9MA 2ZIVB 4MV7A 2IWHA 3MG9A 4ID9A 3FCOA 3RYCB 5CDTA 4DDVA 2A33A 3CXUA 1X19A 3BXOA 4EARA 1G4UR 2CHEA 5JDCA 4QM7A 4IQ8A 2CUKA 3OP1A 1ESZA 1FUKA 1NG9A 1SG0A 5JFOA 4GAEA 1N3BA 5HIMA 3LQFA 4XM0A 2PMWB 1V48A 1JA9A 3U7QB 3P2JA 4LF9B 2ESRA 3MD9A 3JQBC 4BZWA 5LU9A 3RD5A 2ORIA 3QVGB 3PNKA 4RPIA 5A7HA 3RLFA 4MNTA 4HTFA 2XT0A 1QQTA 4F11A 3BHNA 5KTSA 1Y7LA 5JC1A 1EFHA 4C4RA 3K9HA 4XSVA 5JNTA 1E1MA 1H8HD 1XTKA 3D3JA 3G0OA 1E94E 3K0HA 3DVSX 1P9OA 1VL8A 1WA5A 4KI7A 2ARKA 2ZRMA 2NSJA 3KBOA 5TV2A 2ADOA 4PPNA 5I9NA 4B3MB 1NA5A 1NBAA 3EW9A 2X2OA 1OWNA 2XUFA 4K9RA 3T6KA 3TDNA 2H06A 5C5EA 2XJ4A 2WAAA 3QX9A 1GLVA 3ZD8A 2DBRA 4DKJA 4FNMA 2YXNA 4OKSA 1AM4D 1Z0KA 1CZRA 1V8OA 2O0KA 1CRPA 2WICA 4J0CA 2J07A 2ZPTX 4KQGA 4M1OA 4LHEA 2Z6UA 5C8YF 2R62A 1GPJA 4WLVA 2IBMA 3HGMA 3E0QA 2VF5X 1ABBA 3O8DA 1W9MA 3M49A 2IW1A 621PA 1I3MA 3EGDA 4PAQA 5F2KA 5IZ4A 2EG9A 3SVTA 2DHCA 2NSHA 4G1EB 4TYNA 1XYGA 3GOHA 1V26A 2P0EA 3KT3A 1L5FA 4NZ9A 2BYTA 4CHTA 3GIDA 4EM6A 1WL8A 2ALJA 2WEKA 1BE8A 1Q83A 4YRNA 2O2ZA 2OG1A 1PJ3A 2W83A 3HG7A 4MYRA 3AF3A 3CSDA 1BX3A 1YI1A 4HS4A 4DDMA 3BWMA 5KPJA 3IBGA 1QQBA 2VJCA 5JWHA 1NBMD 2QUKA 2FMFA 2WE8A 4PYNA 5F9MA 4XTCS 3ACBA 3O8RA 1U3FA 2IOHA 2EV9A 2WZBA 4WHMA 3WK5A 4P4GA 4B4DA 4WT7A 3JARB 1MIHA 4P1ZA 4NU8X 5I47A 4QODA 4O2AB 1IPFA 2R4QA 3E27A 4U2DA 5CB0A 3BSYA 1QP4A 3HB4X 3KJEA 1UIRA 2GN8A 4MPRA 3BTOA 2BEWB 1RBMA 1I14A 2HUPA 1BW9A 2WDPA 4V24A 4O3MA 5L7WA 3WK9A 3AHHA 1UBLS 3T4PA 3TQOA 4G07A 4CMEA 4ZC8A 3ZGZA 1LCIA 3TGLA 1ILEA 4W5JA 1N9GB 1ULTA 5E6RA 3KVOA 2IUUA 1Z2NX 4HWSA 3RBVA 3SBXA 5BUZA 4QJ5A 1QFJA 5IJZA 3A2NA 2ZCVA 4FMCB 3DHVA 1U4NA 4L8LA 4LMPA 4RVFA 3SJZA 4ZVTA 4BKOA 4QA9A 4HGNA 1N2OA 3LQQA 2Z6QA 2HJ9A 2VHTA 1KZHA 2WF7A 4BCBA 4C88A 1W0KD 2QP3A 1JZSA 4QG3A 2GCEA 5KOHB 4KREA 1FQWA 4G0NA 2B30A 1I7NA 4W7IA 1MQ8B 5JD3A 1E1RD 2G5TA 4O2LA 4C0HA 1WY7A 2ST1A 3HUEA 1DTWB 3N86A 5ESDA 2NPOA 3PQ5A 4BB9A 1E32A 2PSFA 4ZQGA 4LF8B 4Y6GB 4KYIB 4GLFA 4B34A 1MZPA 1SUCA 1X1EA 2HLNA 3L8GA 1NJFA 1TKCA 2VC2B 4M8LA 3SS7X 4EY6A 2OHXA 3JRNA 1PT6A 2ZRFA 3F4BA 4KN5A 4DHWA 5CIWA 4UKDA 4OI1A 4AL4A 1K7XB 2NO9A 2ATCA 3H8JA 1VI5A 4X7BA 1H23A 2CLFB 3ETGA 2ZK7A 5G3YA 3FLBA 5T41A 4B7UA 4CF3A 3GJTA 4YUXA 1VPWA 5F9HA 5TQ2A 4DLNA 1A77A 1TYCA 2FSGA 1UM9A 4GI3A 5E38A 2FMXA 3TX6A 2DLNA 2N46A 3Q7EA 2HF7A 3WDMA 2NYAA 2PX0A 4WESB 2M98A 2QTVB 3HVJA 4YO8A 1XEXA 1RPZA 1DTEA 2QUHA 1SC3A 5MHTA 5GVRA 5KTTA 4MWZA 1Y3IA 5TGZA 3Q9UA 1BHO1 4TRNA 4PCLA 1GR0A 2OBMA 1D2NA 2N47A 3MQ2A 2W6QA 3AEUB 3PI7A 1OGYA 3K4HA 1ZXLA 1T9ZA 2RBGA 4OLAA 1ADCA 4I4TF 1UADA 2E87A 3MGBA 1CJUC 4R9SA 3S8YA 5L3QA 3PQ8A 1T2EA 2YHSA 4EGJA 1GUBA 1GQ2A 2BUCA 2LW7A 3L7IA 1A9YA 4XAQA 3R3JA 2A0YA 3ANXA 4FFNA 3ZE7A 1ZCZA 4FKBA 1GIAA 1K86A 3UHPA 1NC1A 1D6MA 2VL7A 1K2WA 2ONKA 1EDEA 4A1OA 3JQBA 4W4TA 3ZBQA 2XMBA 2J3KA 3TVDA 5AUOB 1AZSC 4ND1A 4DGSA 5B7PA 5BT8A 4J76A 4PBTA 4LY3A 2P69A 4C3UA 3RH0A 4U7PB 4PR3A 4OHOA 1MIOA 3GRUA 2AKEA 3QLUC 3X3HA 5IM5A 3NBUA 1CUWA 3MW8A 4HLCA 4GDMA 4YP9A 2VSNA 4DNFA 5KNLA 1FFHA 3F5FA 1QO0D 3DYBA 3L1UA 3BGWA 2J4DA 3JPYA 4I50B 4IHKA 4ZT7A 1CQZA 2C5BA 3RFCA 4CL0A 5IUNC 4I66A 1DZIA 3IJ5A 1TYZA 1OH5A 1YVUA 2WE7A 1UQUA 1NLFA 2JNWA 1ZMOA 2BFWA 2ZI6A 3IDFA 2NIPA 2O8CB 4L57A 5CLIA 1NTOA 4B17A 1J20A 2W6NA 3RC7A 1JRLA 1ZNXA 1BS1A 1ACJA 1ZN9A 1C7EA 1NIPA 2YY5A 3DM5A 4F04A 2MMGA 2OT3B 2YWFA 1R50A 4IMRA 4FFSA 1W4RA 1REQB 3SVLA 2LPMA 4AVYA 2Y0PA 5F52A 3GYGA 4BNDA 1GVHA 2Z09A 1NVMB 1ADJA 1H0RA 4R68A 3KYBA 2W2QA 2XCIA 3PC6A 3WGIA 4OSPA 4OK6A 1RABA 1R0KA 4O6VA 1AKVA 3RWMB 1YA6A 4A23A 1Y42X 3KDAA 1NXQA 5KQMA 1DRUA 3OUZA 5A05A 4DBZA 1GQSA 5B1DA 3OX1A 3CLTC 1RC0A 1GZ6A 3DUFA 4E32A 4MYUA 4UOQA 4QXAA 3NBXX 1JT2A 2ABWA 3M5PA 3P2MA 3BGIA 4JLVA 4XIYA 1ZIOA 2RH8A 4FTWA 5I5EA 4HO1X 4N5MA 1CQJB 4MYTA 2D3WA 2I4IA 5B1SA 5KC9A 1J39A 1KVSA 3HEBA 4ZYUA 1L5WA 3GROA 1LC3A 3SLKA 5BR8B 4G5FA 3INNA 4GBJA 3V00A 3FLAA 3QPDA 1EFLA 4JBGA 2Q2WA 5CCDA 1J00A 3J7TA 2ZPUA 5DMHA 1YJ5A 3IOMA 5DTQA 5DTIA 2JF0A 3P52A 4CLRB 1L4YA 4RAOA 3ZHRA 5CB4B 4N0QA 1T0BA 4DRZA 4MLPA 2DP4E 4XW2A 2QZJA 4PSAA 3ON5A 5HKLA 3EEBA 3VZDA 3OTHA 5B58C 2FE4A 4M86A 4HUQA 1RAGA 2ID8A 3DE4X 3DP7A 3HO6A 4B87A 1QVRA 3AKDA 4CLOB 1DXYA 2FSVA 4R5HA 2PMBA 3N3AC 3OWXA 5JS7A 3CNOA 3V4LA 2HRQA 3TEJA 1F6BA 3CLKA 4YAOA 3ULKA 2QSJA 4RZQA 4YDRA 1J2YA 1ZCJA 2HCJB 2EFCB 4YUZA 1OSNA 3ISJA 3PP8A 3C4QA 4M36A 4DCCA 3DPUA 3IKJA 3LSYA 3QMVA 4TTAA 1JIXA 1L5ZA 3QXXA 3FWYA 2Q27A 4FC6A 1P2UA 2PQ6A 4XVQA 3SU8A 3E18A 1MJGA 1GGHA 3PEFA 4HOYA 5LMZA 1UC4B 1ZA2A 2I4LA 1R0BA 2O4CA 3JTEA 3PNVA 3X2FA 1FSFA 1Q0SA 2OP1A 4CV0A 1LPAB 2IU6A 4ARZA 1B6RA 1N75A 1YR3A 3LUKA 4KK4A 2XB2A 1IOVA 1GL3A 2E4UA 1BEEA 2H1HA 4P84A 5EHIA 4CCYB 5H82A 4CR7A 4XPZA 1P0QA 3NATA 2XWQA 4BX2A 3Q5GA 2O2IA 4IUCS 1GO2A 3LH5A 4D9CA 2H2GA 5HDQA 1USGA 2Q6OA 4GGPA 2GT1A 4C43A 2JDIA 1BD3A 2GJ9A 3PQFA 4ZZ1A 4IIGA 3CKLA 1T2NA 4ERNA 1C29B 2ID7A 3O8OA 3DOHA 3LKBA 4XFDA 3KUCA 1I7PA 3RRBA 4D5EA 5LIRA 4KO1S 3V33A 3MTIA 4R83A 5FP0A 1C3OB 3HFGA 3ODPA 2RHDA 1NT4A 4DV3B 2ZXEA 4B32A 2PUHA 2XZPA 4NU6A 3AUAA 4EF4A 5IC5A 4AMVA 4F6RB 1R9MA 1IOWA 2GJKA 3ORSA 2E7ZA 3P2OA 3U1BA 1OQAA 2QAGC 3TI7A 3GXOA 3UHAA 2ZUFA 1E9FA 2WSMA 3E9QA 5LQSA 4C3OB 5TIIA 3W5AA 4L5AA 1XN1A 4D3YA 4GC5A 2AQ8A 4RELA 3AHJA 4YXWA 1S3IA 4ZDKA 4BYMA 1QHHA 1NBME 3PKJA 4ZGGA 1E3DA 2UYGA 1P19A 1XTZA 3LGAA 2OECA 2Y6UA 2WMOB 1W0CA 2Y66A 3LKVA 2GUWA 4A0RA 4NAHA 2EFJA 1EP3B 2GLXA 2RK6A 1KTVA 2G6BA 3UXEA 4XWWA 4JBLA 4QRHA 3I2HA 4DGQA 4ZQFA 2YZKA 1HR0B 2BM8A 1V9SA 5ALRA 3VFDA 1SPBS 3RDPA 1G8JA 2YBEA 3M6AA 3QLUA 3KQLA 3KT0A 5EP1A 4DA9A 3KKOA 4OK3A 2GPSA 3R5SA 1Y7HA 4E5PA 3TZQA 1DOHA 1SKBA 3KTDA 3UMCA 4B4KA 1LH0A 3VPHA 1AGXA 2BRUA 4FHCA 4ESVA 4JVSB 5LXTB 1U0HC 4KI0A 4AO8A 5BT9A 4LEIA 3QU9A 2V8OA 4UZSA 3VH4A 3EXHB 3OFVA 4R8SA 4MCJA 4HRYA 4XSGA 1KJZA 4GPIB 3BOSA 3EF0A 1D4AA 1GZUA 4BUCA 1RJ9B 4GLBA 3VPXA 5A6SB 3TX2A 3S70A 1GFIA 2WJ4A 1LBEA 4EW3A 3BZBA 1ICIA 3G2HA 3MBOA 4PVDA 1RZRA 4QE3A 4BNFA 1UEJA 4P4NA 1M1YB 1R3UA 4MWBA 2W93A 4GUAA 3BTVA 3KM0A 3ZU6A 2V65A 3ELBA 4KSCA 2FWNA 1MX1A 3ESXA 3EUAA 2XTZA 4RZ2A 4D81A 4P33A 3L6RA 3LY9A 4UMEA 4ZOQI 5KWIA 1YZGA 1XCBA 4NAUA 1F6WA 3KTAB 4NKRA 4QO7A 1P62B 2CV1A 4WNAA 2B37A 4L0DA 2O20A 4B44A 3N0XA 4WNCA 5JASA 3AONB 3A1WA 3OIVA 4JODA 1VP9A 1OZHA 1RWMA 2HSEA 4ZDIA 2EL9A 2VH1A 2GM5A 3LYHA 4BC0A 2XZLA 1J1UA 4QQ8A 2IL1A 1NXOA 3DFUA 4I6GA 4MPJA 2P11A 2PL9A 4IXNA 3KLPX 4KJXA 1RMTA 2YY7A 3KR9A 4DC9A 1FU4A 4LXQA 3NDJA 1J8FA 1ULSA 2XNDA 3LLSA 3PZBA 4OK5A 4MARA 1GUZA 1H3NA 1NP3A 4M9QA 4HYYA 1N33B 1EJBA 4TUYF 3ZV5A 1TYAE 5LN1A 3LXUX 1IBSA 3A4VA 1MTOA 2WOJA 2ZQYA 4EI2A 5IRCD 3ACCA 1JQDA 2VUIB 3W2IA 1WXIA 3E8XA 5CB8A 5JXGA 3CT6A 3ZGNA 4C29A 3N7UA 3CPSA 3HXKA 4GKVA 1JXAA 3K1ZA 5LQMA 2A5DA 1AK1A 1R9JA 4YCJA 3V4RA 2HV8A 3OQHA 2PUVA 4JC0A 4PLWA 4MUHA 1BFUA 1XYVA 1VMAA 2Q4TA 2ZSJA 1UJMA 5ESXA 3UJ7A 2HV9A 4M9RA 3KJGA 1XJWA 1KMHA 3CIOA 2DY0A 4M83A 4C06A 4DLAA 4QYWA 2JEOA 3UQYS 3CS3A 2CNNA 3M4XA 1ZAKA 3DJYA 2HJHA 4CKEA 3F96A 4YXWD 1G8GA 5LPNA 3BL8A 2Q3JA 1CZHA 2RHRA 1U5BA 5TMDA 4D74A 4EPVA 2ZXUA 1R0YA 2FPIB 2A9QA 1XA0A 1N4DA 2E4AA 3OCJA 2YJGA 3IRUA 2BKVA 1JBKA 3L0OA 4BO6A 5KU1A 1OD6A 1DAKA 5I51A 1V5EA 3K5WA 5AHWA 5E7JA 4NYJQ 1GN9A 4NNJA 1UK9A 3BE5A 4EVRA 4BNJA 2ZB3A 5J4VA 2PZJA 4DLYA 3GLIA 1SRQA 3AVPA 3U7JA 2J08A 4DV1B 1R37A 1EZ1A 2Z4RA 4TLAA 1DAHA 2R5FA 4GX5A 1VPEA 1UZLA 3D81A 1WKBA 2EJCA 3RSHA 4NLLA 4HXGA 2PT9A 4UBJA 4A0GA 5J58A 5KINB 1ODLA 5EIXA 2QAGA 3ROQA 1E6UA 4UNRA 2FHSA 1SKYB 2QRPA 3DXXA 3IEKA 2F7SA 4TVKA 4YRKA 5DFAA 4HAXA 4CEJB 2WP0A 5FXMA 3ZJTA 4S2EA 1I3OA 4MKRA 4QELA 4P4SB 2FPSA 1GWNA 4MI1A 1RLIA 4PZPA 2B61A 1UAYA 4FCCA 2IX3A 3QUBA 1CJTC 3GHYA 1A5AB 1JIIA 4AZWA 5SY6A 4YX9A 1WP9A 1ISGA 2H6EA 5LVAA 1TA0A 1HMYA 4DXAA 1E63A 3DQZA 4CIYA 1Y5IA 2DAPA 1OV6A 2MSEB 3CVYA 1RZRD 3UVEA 1KU0A 1DKRA 2XY4A 3LPMA 4U4AA 2X0FA 1A71A 4F97A 4JX9A 2QD3A 3G5TA 3PCRB 1JKIA 4Q9JA 5TRTA 2XH8A 4EL0A 2R4UA 4GP7A 2JLXA 1Z2DA 4BNIA 2IH4A 1AKRA 4D8XA 5BVHA 1EFPB 3HV2A 1DHTA 4HLUC 4PFQA 3HKCA 4C4XA 2BFFA 2DBVO 4G9GA 1XAJA 4UREA 2F4VB 3CLTD 3L4SO 3TCXB 5DNUA 1ZM3A 3GQBB 3D02A 1QJCA 4ECEA 2WAXA 3G9ZA 1EUCA 3GRCA 3L92A 1X15A 4FJ1A 4RNCA 2ZYWX 1Z4NA 5AJVB 4FFBB 3WB2A 4F5WA 3VKGA 2C00A 3VR2A 2PLAA 4ARAA 1I2BA 4BMOB 3C3KA 4KYUA 3R0IA 3GZ4A 5CD1A 4ZKDA 3JQEA 2V7TA 5E9JA 1NVDA 5FA5A 1W2WB 1F20A 2BGTA 2PLWA 4IFBA 3WHIA 2X6TA 5AUNB 3H42B 3EXFB 1ULAA 3H75A 5ISMA 1LBQA 2WT9A 2XNDD 1O8BA 3D4LA