3WIOA

Crystal structure of osd14 in complex with hydroxy d-ring
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
265
structure length
265
Chain Sequence
AKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable strigolactone esterase D14
publication title Molecular mechanism of strigolactone perception by DWARF14
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 85
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wioA00
2B61A 4J3JA 4B83A 4FHZA 1F0PA 1MX9A 4EHBA 2W6CX 5KWJA 3ICVA 2W22A 4HVTA 5BV7A 3I2IA 3CN7A 3IDAA 3DLTA 4PO3X 4Y2JA 5A62A 3DQZA 2DSNA 4WDQA 4ZREA 1XRRA 5K3AA 3ESBA 5DTIA 3DS8A 3WMRA 2D0DA 1XROA 3L1HA 3WKEA 2VJBA 5LZ4A 2HIHA 4BZWA 5ALXA 4GHWA 2IX9A 3LIPA 4AN1A 4KE8A 3RLIA 1BE0A 1TCBA 4Y7DA 4K6KA 3R3UA 5A71A 1VJ5A 2V96A 3S8YA 5JD4A 4GXNA 1ZGBA 3WZLA 2ZJ6A 4G5XA 4HZGA 4I4CA 4O08A 1YA4A 1N5RA 2OLEA 4DTCA 2QM0A 2WKWA 3V1MA 3WKAA 1UZAA 1LGYA 4H7KA 3AZQA 3UMJA 4F60A 1K6EA 3RM3A 2HHAA 4U2DA 3QBJA 5AKXA 2AJDA 5E4YA 3VKFA 1W6RA 4EY4A 1VXOA 1QO9A 2BUBA 2CEKA 4LXHA 4NS4A 3EQ8A 4ZI5A 1AC5A 5ALIA 1T4MA 4BRZA 5KWIA 3PUHA 1CRLA 1H2ZA 2QKYA 4EY7A 5T4BA 4NVRA 5K3BA 1SC9A 4OPMA 3F98A 3HABA 2WILA 4MWSA 2XQIA 3JWEA 3DKKA 3IUMA 5CBKA 2XQFA 1UKAA 4CG1A 5EIEA 4W1SA 1AZWA 1CUAA 4HTAA 2AXEA 2Y2VA 4UBLA 4YX9A 1BRTA 1WPRA 1YA8A 5CT8A 1HL7A 3G7NA 5AM5A 4B9EA 3SK0A 5ALDA 5FP0A 1BCRA 5DNWA 4D9JA 1XZHA 5HF5A 4ZWNA 2IIVA 4JUIA 5ALYA 3NOXA 1QOZA 1ZD3A 4Q3LA 1W4LA 1ORWA 2B9VA 4MXDA 2BUCA 2CB9A 4FKBA 1YS2X 3C8DA 2WHRA 3FYUA 5HFAA 3STYA 4AMZA 4A23A 3G0DA 2QUBA 2QMQA 3HXKA 3W9UA 5HF9A 2K2QB 3WWOA 1ZOIA 4QWMA 1MO2A 2R11A 2HRRA 4Y2PA 1JJBA 1UK8A 2BUAA 2WIDA 4X94A 1QIEA 1MN6A 2J4FA 5DYTA 2OPHA 3C6ZA 1SCKA 5EIAA 3WL6A 2WU4A 2BFNA 3G0GA 1P0IA 1LPMA 1XZDA 4BC0A 1JT2A 3GBSA 3KXPA 2XMDA 5AHXA 5IVIA 4TGLA 2BKLA 2HFKA 4M0FA 4X6XA 4H77A 1DX4A 1ZIXA 5FPPA 4KJXA 5DJ5A 4Y2VA 2OGZA 1WHTA 2OCKA 1EDDA 2JGFA 3H1AA 5LZ2A 5ISMA 1YS1X 2QRUA 5HZGA 1EB8A 2WIGA 2H7CA 4W9RA 5IKXA 1EDBA 4U2GA 3H2IA 2PBLA 2VF2A 3QM1A 3DL7A 2DCMA 1W76A 4W1PA 3IURA 3LS2A 1GPKA 4C4ZA 3L1IA 5C8VA 2CMFA 5FPQA 4K2AA 4B80A 1FFCA 1XZBA 1UOQA 1XRMA 3HJUA 3BJMA 2RAUA 5SYNA 3WWPA 2AJBA 3QZUA 1L7QA 1RYYA 3D0KA 1DU4A 2HM7A 3I6ZA 2JGKA 2PSFA 1MU0A 2OGTA 1Q0ZA 2XUQA 1QIJA 4UBIA 3RARA 2ROQA 2XUIA 4QDZA 3V1LA 1CUCA 2WHQA 3FCYA 3MGAA 2OCLA 2YXPX 3CCBA 1E8NA 5IVKA 3IUJA 4AO7A 4I19A 1JFRA 1XRQA 4XIIA 1QJ4A 2JGLA 2WJ3A 4WY5A 1XZJA 4BVLA 1L7AA 3H2GA 4MQMA 1LNSA 4PF1A 4UHBA 4A5SA 1WCYA 2WUFA 4J0GA 1K63A 1A7UA 2PU5A 4WJLA 3H17A 4BATA 1F0NA 3TJMA 3AFIA 3A70A 3STVA 3AINA 2OAGA 4H7IA 2ZSHA 1UXOA 1EINA 1H2XA 4YPVA 2V9ZA 1X70A 3AIMA 4IHAA 4B7ZA 4AZ3A 4BYMA 1UWCA 4N5IX 4INZA 4Q3KA 5AI6A 3H1BA 5JARA 1WB5A 4ZXFA 5I7UA 1R9MA 1YASA 2HA7A 3C6YA 5K3EA 1A88A 2VATA 5AIAA 5C7YA 1CV2A 4HRXA 3VVLA 2I03A 1W75A 1A8QA 3DYVA 2B20A 2WU3A 5BWCA 4KE6A 2ZSIA 3GELA 3HZOA 4KEAA 2QUAA 1LLFA 5CXUA 2PUJA 4GW3A 4UBJA 3Q0TA 5H3HA 5LIPA 4KE7A 1AQLA 2Y6UA 2XDWA 3ILSA 3WZMA 1QZ3A 2ES4A 3FBWA 4OD0A 1RWQA 1UFOA 5AP9A 5EHZA 4F5ZA 3E1GA 4HS9A 4KRYA 5DYWA 1JI3A 3VVMA 2ZYHA 2GBFA 4X97A 2C0PA 4ETWA 4ZV7A 4DLNA 5CT5A 1A8SA 5BOVA 2QR5A 2XMZA 3WK5A 4U2BA 2WHPB 1XQXA 1CUXA 2H1IA 5AKKA 2VT6A 4KR0A 5D6OA 3O4GA 3OM8A 1X2BA 3QVMA 1OXMA 1TRHA 4J03A 3PDCA 3WA7A 4J0KA 4LXGA 1WB4A 5CT9A 1U65A 5E2IA 4FOLA 1VA5A 4EB0A 4N8EA 3D7RA 5AJHA 3WIBA 4UPDA 3EIOA 4G9GA 2HU8A 1KU0A 7YASA 1G5FA 5KREA 1HDEA 3RKSA 4V2IA 2HA6A 5JALA 2WFLB 3O95A 1XKLA 2GYVA 3W05A 1W52X 4MQLA 2D5LA 5AK6A 4C01A 3CCCA 1BN7A 4J7AA 3E4DA 3WL8A 5A6VA 4DM7A 3DL4A 5ALPA 3V48A 3STTA 2DFPA 1YB7A 5HCUA 2XUOA 3D4LA 4L3WA 4GEGA 1VZ2A 1EXWA 1QIMA 1C7JA 2O2GA 4OU4A 3EQ9A 2PSDA 4J0IA 4DSAA 3LCRA 1QTRA 4TPKA 4B81A 3WKDA 4BTLA 1H2WA 1RP1A 1THGA 2WIKA 4S0XA 1QGED 1EDEA 1R4ZA 4EA6A 5D3KA 1JJIA 4UHCA 4OSEA 5AKGA 4KRXA 4HRYA 5AOCA 1ZICA 5HK9A 1VLQA 2XI4A 3W06A 1P0MA 2XQKA 5FLKA 5K3DA 3WJ1A 5AI5A 5HKBA 1G42A 2YYSA 4IQ4A 2H7YA 2XMCA 3OG9A 1MT3A 2JGEA 2PSEA 1ZD4A 3RK4A 3QH4A 5FV4A 4CCYB 3NGMA 1FFEA 1XZKA 1CUUA 4YK7A 2XLCA 2QZPA 4JYMA 4H7HA 5FKJA 3DEAA 4FFVA 4G4JA 4GI1A 4BRSA 2Q0XA 5ALFA 3I1YA 1XZGA 1U8EA 4B84A 4J0CA 4ZV9A 4UBOA 2XE4A 3WYDA 5A7FA 3FYTA 5AI9A 1GZ7A 5JAOA 4H7DA 2OQIA 2Z5GA 1LPNA 1TIBA 2Y2UA 2UZ0A 1WHSA 4KAJA 1LZKA 1ACJA 1YCDA 4Y9SA 2Z3ZA 1IVYA 2WIFA 4EUSA 2VJAA 2GBGA 5AK5A 2HA3A 2VA9A 1FJ2A 1X2EA 2GBCA 2OAEA 1G66A 4Q34A 4Q82A 4M0MA 4OYYA 1SFRA 5ALSA 5JANA 1IZ7A 4OB6A 1CFJA 3A2NA 5LLSA 4UFPA 2DHCA 2DQZA 4P92A 1LPPA 3WKCA 5AKHA 4FNMA 1XQVA 3STUA 1UT6A 4CCWA 3FLEA 2WHPA 1QTIA 2JEZA 1XZIA 1BU8A 2PX6A 3T4UA 2VEOA 1DWPA 5HF8A 2RGUA 3KD2A 4H18A 1JKMA 1TCCA 3I28A 3LIIA 2ZJ7A 1ZJ4A 2HA0A 1ZD5A 5D3ZA 6YASA 4OB8A 2WFLA 3GFFA 4P08A 1AX9A 2JGJA 1FFAA 3VXKA 4CI9A 2E3JA 5ALZA 4BB0A 3QPDA 3E3AA 5JZSA 1CUGA 2C58A 5EHNA 3PUIA 3R41A 1UK9A 1ZI6A 5LZ7A 1T2NA 1Y7HA 1XLWA 4FFWA 4KAAA 2BJHA 4FLMA 1SCQA 3ESDA 3BIXA 2Y6VA 3EF3A 5AO9A 2WJ4A 5AOBA 3Q8WA 3WK8A 3AJAA 5ALUA 4QDUA 3YASA 2OG1A 2AJLI 4B9AA 4C87A 2WUEA 3ICWA 3VJKA 4BZZA 4X91A 1CUVA 4Y2YA 3KSRA 1WM1A 4DNPA 3N2ZB 5JASA 4C4XA 4E46A 3K2IA 3QMWA 4NZZA 4BAGA 4B0PA 1IUNA 1DX6A 3FVTA 4PV7A 4XX1A 2V98A 2OGSA 4WFJA 1C7IA 2ZYRA 4C6HA 1E3QA 1DINA 5J3JA 2WIJA 4X93A 4YASA 3M83A 5ALMA 1GPLA 4C4YA 2EDCA 3DKRA 4CCYA 2ONCA 4X6UA 3M81A 3HLKA 3FYUC 4PNZA 2X5XA 1MX5A 4H0CA 5AIBA 2XLBA 5LKRA 1FFDA 4OU5A 1TAHA 3O9MA 2WG2A 5EIHA 3I2HA 3H0CA 4K5QA 4BVKA 4RE6A 1ORVA 4UHDA 1OILA 3HYSA 5C8XA 1GXSA 1W1IA 1XZMA 3W9BA 2I3DA 2XQJA 1PJAA 4IO0A 5JIBA 2JF0A 1IZ8A 3F67A 5DNVA 2ZYSA 2O7VA 5CTAA 3BJRA 1HLGA 5JZBA 4IH9A 2O2IA 5ALHA 4JNCA 5AH0A 3CXUA 4LXIA 3WK9A 3A6ZA 5ALQA 4DMFA 1TCAA 1AUOA 3TGLA 4KYVA 2GZSA 4X92A 3WQHA 1K8QA 1CVLA 3G02A 2VTVA 3HI4A 4P93A 1R1DA 1USWA 5E4TA 1DTEA 3A2MA 3TRDA 2DHEA 4FWBA 3W2TA 4AZ0A 3LLCA 4QNNA 2VJCA 4LYEA 5A7HA 3OURA 1EVQA 1GQSA 4MYDA 4G9EA 1N1MA 3WL5A 3ED1A 1LBTA 2PL5A 5KBYA 4U2CA 3I6MA 3R3YA 4QLAA 1F8UA 2G5PA 3F9CA 4C89A 1TQHA 4LHEA 1BCSA 2QT9A 3VJLA 1BS9A 1CIJA 2FX5A 3O0DA 2AJCA 2FUKA 4Y2RA 4W1RA 4Z49A 5AKJA 4A16A 1CUYA 4AX4A 2RHTA 2YASA 2WJ6A 4RGYA 2PSJA 3E0XA 3IIIA 4BP8A 3DNMA 1MAHA 5K3CA 5JD6A 2XQGA 1CUHA 2WFZA 1GPNA 4CFSA 4BC1A 3F96A 5CT6A 2OCIA 4MEBA 1R50A 4Q3OA 3B12A 4MYSA 1DWOA 1VA4A 3FAKA 1QFMA 2OCGA 1XQYA 3IUQA 5CW2A 4UBNA 5DYYA 4PW0A 1EHYA 4EY5A 5ALJA 4DSZA 4BCCA 4CIBA 5JD5A 4DMKA 1GGVA 2QXUA 4UUQA 1J07A 3PE6A 3WIOA 3ZI7A 1KU6A 3IB3A 3VJMA 1ACLA 1DWQA 2Z8ZA 5HK8A 1GT6A 5F4ZA 5JADA 2GYWA 4E11A 1S8OA 2C0QA 4DNOA 5EFZA 1YR2A 3G0BA 1EX9A 1CUDA 3EQ7A 3M3DA 4IH4A 1I6WA 1HKHA 3PF9A 3QITA 3DDUA 3IA2A 1UKCA 4QA9A 3DCNA 1QIFA 1VOTA 4G8BA 1EK2A 5T4HA 2XT0A 4WDRA 3H19A 4DNQA 5C81A 1JMKC 3I2JA 1DT3A 1AKNA 2AJ8A 3G0IA 3H2HA 1Y37A 2ZJFA 1CUBA 2GYUA 4H7EA 4J0HA 5AI4A 2WM2A 5E4JA 4GWLA 1YAHA 5AOAA 2HFJA 4BDTA 4X95A 3WI7A 2G5TA 2JEYA 5HKAA 4LKOA 3C45A 1EK1A 3ANTA 5K3FB 5CXXA 1O6GA 4H7JA 4Y2XA 1UK7A 1XKTA 1CQWA 5JAPA 2HA5A 1AMNA 1LBSA 2XB6A 2BGRA 4G8DA 4N8DA 4FMPA 5AKIA 3BDIA 5ALNA 4BBZA 2ACEA 3MUOA 1CUZA 3M82A 1MJ5A 3D3NA 3DJYA 2C4HA 3R3XA 1B6GA 4EY6A 1Z68A 1CQZA 1MNAA 5CH3A 5SYMA 3WL7A 1UKBA 4WCVA 2Z8XA 5ESRA 1EH5A 4E14A 1LPOA 2WLSA 3C6XA 1QLWA 2GBIA 1XRPA 2PVSA 3QMVA 3VDXA 3C70A 4DGQA 5AK3A 1XFDA 5JATA 1M33A 1IMJA 2CBGA 3V1NA 4B85A 1C4XA 4ITVA 4BE9A 3A2LA 2XUAA 1DT5A 3F8SA 4DIUA 1Q83A 3VISA 5ALVA 4FLEA 4BP9A 4HXEB 4U2EA 1MNQA 4N5HX 5LYYA 2PM8A 3BF7A 5FOQA 1XLUA 3N0TA 1CUWA 5IVHA 1PV1A 4DYHA 1Q84A 3ZV7A 3U1TA 2EDAA 3I6YA 2I78A 1NX9A 3FSGA 4HXFB 2XUKA 2C5GA 3V1KA 4G4GA 4MWTA 3SWWA 4P9NA 2XUFA 4QDTA 4W63A 1H22A 1Y7IA 2XMSA 3MUNA 4K6HA 4H7FA 4XVCA 3IBTA 5IVDA 4UHFA 3FLAA 3AZPA 4BTVA 2XMBA 2BCEA 5ALGA 2XUPA 2ORYA 3I2GA 1R3DA 1R9NA 1BEEA 2YH2A 4B0OA 1YB6A 2J4CA 5A2GA 5AKZA 1JJFA 1G4HA 2RONA 5EHQA 3PF8A 3H04A 5AI0A 3S2ZA 1LZLA 1J1IA 4AXBA 1H23A 1XRLA 4X90A 4GLBA 3O4HA 2C7BA 1N5MA 4ZRDA 4EBBA 5I8PA 1QO7A 2HDWA 2WQZA 5I9IA 1CUFA 1DQZA 4K6GA 4Y2TA 1BROA 1PFQA 4G8CA 2DQYA 1HPLA 3C6BA 4DMCA 5ALKA 3NUZA 3G9UA 3QYJA 4HAIA 1HBJA 3JW8A 1FFBA 2WTMA 2WTNA 4AO6A 5HQ3B 5FXMA 3R3ZA 2CUTA 5AKYA 2VAVA 5ALRA 4BE4A 5D7BA 1ZI9A 5AICA 1CEXA 2CJPA 4DNFA 3O4IA 4ROTA 1QIKA 3ZLUA 5K3FA 3FOBA 1QONA 4QWWA 1XZFA 5CH5A 1O6FA 4CG2A 1QIDA 2ECFA 4UHEA 2Y1KA 4AQDA 4HXGA 2OQVA 3IVMA 3C5VA 3ZLVA 5CH8A 3H18A 4RE5A 4QDXA 3WKBA 3IUNA 1JU3A 4RPCA 3R0VA 3IULA 1JU4A 5JAHA 5LZ5A 4WY8A 3O9VA 4Q1VA 5HFNA 5HF6A 4UBKA 4F0JA 3C8HA 4X85A 1TK3A 2VQ6A 3QPCA 4C88A 3UUEA 5FDFA 3ZLTA 1WOMA 5ALOA 4IH1A 3AILA 2HU5A 1OCEA 2JGIA 3OOSA 5ALEA 3X3HA 3W04A 1IUPA 4FDMA 2WFMA 3HC7A 2FJ0A 3OC0A 3WLAA 4LIPD 3K9BA 2HA4A 5T4FA 4G1FA 4G4IA 2V97A 2HU7A 5LKAA 4QEKA 4BCDA 4TVKA 2FJPA 5T4EA 4EZIA 3PFCA 1XZAA 5DNUA 2CZQA 2JGMA 1CUIA 1D07A 2XMQA 4AN0A 1BN6A 4PSCA 2RIPA 5AM2A 4CG3A 3NWOA 5CT4A 3QPAA 3KWJA 3HACA 5CMLA 1TKRA 4OCZA 3D5EA 1Q0RA 5CRIA 4GECA 1AGYA 1QIIA 3F97A 3DOHA 2XMRA 3D2BA 3PICA 1H2YA 3WWEA 1P0QA 4FNGA 4PSDA 3HSSA 3R40A 4B82A 5DTJA 4X7BA 4FBMA 2C5FA 2QTBA 4BCBA 4FBLA 4WFIA 1VZ3A 3R3WA 1U2EA 4FTWA 2DR0A 4QE3A 2H9YA 5AM3A 2PSHA 3B5EA 1XZCA 4QZVA 2ACKA 2IITA 4JYPA 2HRQA 1MPXA 1R88A 3HEAA 1UOPA 2WUGA 1SOMA 2H7XA 4WFKA 4UFNA 3GZJA 4N8SA 3WK6A 1E8DA 4L0CA 1LPBB 2EEPA 2XUJA 3OTQA 5JYCA 1ZIYA 2G63A 2PKYX 2GZRA 3HRHA 3DOIA 1E89A 1MX1A 5DWDA 1JMYA 5JZ9A 1CPYA 1ZD2P 2O2HA 4KE9A 1E5TA 5DLPA 3WA6A 1ZI8A 2PPLA 3FCXA 1HQDA 2VAXA 2JIDA 2O7RA 1CUEA 2BGNA 3KDAA 3OPMA 4BVJA 1SCIA 4F21A 1ETHA 1KEZA 1UK6A 4UHHA 2VJDA 4OYLA 3D59A 2X76A 3FNBA 4ZGBA 3BF8A 1ODTC 3WK7A 5HQ3A 3ESAA 1P0PA 2QJRA 4GDMA 1QFSA 4NMWA 3AIKA 2HL6A 1QE3A 1CUJA 3DD5A 2XUHA 4RNCA 3G9XA 3D2AA 1ODCA 3SC2A 4XJVA 2G4LA 5LZ9A 4J0JA 2WG1A 4J0DA 4MJ3A 3P2MA 3WWCA 5YASA 1K4YA 3GUUA 1N8SA 1LPAB 3MVEA 2J3QA 4X71A 4QLOA 4M0EA 1THTA 3U0VA 4KAFA 4X6YA 4ARAA 3BDVA 3TEJA 3KOOA 1UOOA 3FLBA 3ZWQA 5EGNA 1QIGA 4B6GA 3K6KA 4X00A 2JBWA 5K5EA 2X8BA 1VE6A 1DQYA 1F6WA 2HADA 3WYNA 4CIAA 2DHDA 2QS9A 5LZ8A 4H35A 5AKEA 2QVBA 2XUDA 3BE8A 5A7GA 4OB7A 3D2CA 1XQWA 4DMHA 1AURA 3STXA 2HA2A 5EI5A 2QOEA 4XWGA 4Y2QA 1GQRA 3DYIA 3KWFA 2WG0A 5EHXA 5FRDA 2QJWA 1BEZA 3QMMA 3V9AA 3H2JA 3JYHA 3PFBA 4GBGA 5ALWA 5ALLA 1NU8A 1MTZA 2XUGA 1YSCA 5ALTA 2R8BA 4Y2UA 3WJ2A 3BXPA 5AM1A 5AM4A 3L1JA 4I3FA 1ODSA 2PUHA 3GROA 5JAUA 1GKKA 1E66A 5AI8A 1XLVA 3C87A 4UBMA 1EB9A 2B4KA 2NW6A 3G8YA 1EVEA 1NU6A 1CLEA 2OXEA 3GA7A 3C5WP 3CN9A 2J3DA 5AM0A 3AZOA 1ZJ5A 4U2FA 3G0CA 1EA5A 5BWBA 2BAGA 2XMGA 4UFOA 3WK4A 4BDSA 4AO8A 3BL8A 3AIOA 3H2KA 3I2KA 1J2EA 3LP5A 5C8ZA 1GKLA 4L72A 4FLFA 4AB1A 1LPSA 4MEAA 4BAUA 1E8MA 3ESCA 5AKLA 2ZYIA 1CR6A 3BWXA 2CKMA 4AMYA 1FSSA 3I2FA 2RHWA 3PI6A 1VE7A 1B41A 4PQEA 2ZVDA 1WB6A 3AUKA 3FVRA 2PU7A 1EI9A 1CUSA 2RI6A 3ZPXA 3C43A 1YAJA 4L9AA 5IH7A 4LYDA 1WPXA 1IUOA 4JH0A 2VSQA 3FYUB 4ARBA 2WSLA 4EY8A 5FUMA 4QDOA 1J06A 1VKHA 4KACA 5CURA 1L7RA 5LP1A 1A8UA 4E15A 3EBLA 3FWHA 4BAZA 2QXTA 3FSGD 2Z3WA 3R3VA 1XRNA 4OUKX 4Y2SA 4PSUA 3WWDA 3I1IA 3UUFA 2P8SA 3STWA 1K5PA 2LIPA 1XZLA 3T52A 5AK4A 3O4JA 1ZGCA 3ANSA 3G9ZA 3BIWA 4Q05A 4X3CA 2I3ZA 3G9TA 3B3QA 1XZEA 1QIHA 1U4NA 3SX4A 2WUDA 1ISPA 4JEIA 1MAAA 1VXRA 4W1QA 2VT7A
chains in the Genus database with same CATH superfamily
4J3JA 3VR5D 3T34A 4ZU6X 2AMJA 2H1WA 3VNRA 1KMNA 2Q62A 4ZEMA 1F0PA 2FZCA 4CV0A 1MW8X 5MN6A 2J3HA 4J43A 3F5FA 1YVRA 4V24A 3VU0A 4W5TA 2W6CX 2WJZB 1PWZA 3L01A 1E2IA 1RMYA 4HVTA 1AXRA 2AKAB 5B4UA 2QM8A 2G09A 2IS4A 1T36B 4QARA 1R18A 4IZIA 4ABYA 3T06B 4DCGA 3QKSA 5A62A 2IIBA 2IEAA 1U0OC 3E7XA 3RRJA 2RHJA 4X8OA 1F6BA 3FPFA 2ESRA 3AEUB 3EPPA 121PA 1TI7A 1ZUD1 3FPSA 2IS1A 4HNAA 4ZJPA 1YUNA 3WKEA 2QTZA 2VJBA 2YNMD 1N7HA 3HCEA 3ENQA 1A77A 4QAQA 1PS0A 3G1TA 4AN1A 4X44A 1HE8B 3DCYA 4PR0A 3BXEA 2D3WA 3IEXA 3CH5A 5FBLB 2AOUA 1VIDA 2B1GA 2G0TA 3RLIA 3KHUA 1MRNA 2WA2A 4B74A 1BE0A 1T25A 3AXSA 2I71A 1SKYE 1CG6A 1LK5A 3CKLA 3R3UA 2IRWA 3ETGA 1IHUA 5K99A 2V96A 1JDSA 3DTYA 1KP2A 3C3WA 5LA6A 3U7EB 4Q5IA 2V59A 3NHBA 2NAFA 2A84A 2H54A 4D9CA 1AMOA 2IKQA 5B6IA 3HMQA 2J9GA 4HGYA 2ZE5A 4JLKA 4UVIA 2SHKA 1RE1A 4CG0A 4COOA 2Q9AA 1FDWA 4AK9A 4J16C 3R9WA 2B1JA 5CA0F 2PJUA 4IDDA 5JSZB 3S8EA 1VE1A 1YA4A 2OLEA 1OBVA 3S6JA 3A9WA 2IYRA 5FOUA 3B6JA 4H7KA 3KT6A 3KYIB 4L5BA 4CM4A 3ABRB 2BFWA 4TS1A 1A4RA 1JBQA 1RQNA 1U80A 1VLHA 2JLBA 3BRCA 4H16A 4EH1A 2ETXA 1AS2A 3JD3A 3MHTA 1FP7A 1E6KA 4L0QA 5JRZA 3R6TA 4JASB 2I76A 4E0BA 2VDOB 2PZBA 4LNUB 2ERXA 4FK8A 1N3IA 5LC1A 1ZH0A 1AHHA 4EY4A 1U7ZA 2BUBA 1EUCB 2QL6A 2VYVD 4LZPA 4MV4A 4LXHA 4NS4A 1NV8A 2GZMA 2Y1DA 3GLHB 3P9RA 4R2WA 4JVOA 1EUQA 4D3SA 4EGJA 4EX6A 3ZXYA 1AC5A 1RXUA 2H59A 1H2BA 4M55A 1U1GA 1EVLA 2RHGB 2ZBEA 3KJEA 2QUKA 2HREA 3PA8A 1TMKA 4GI3A 3ZI0A 2QVGA 1XVTA 4RORA 5IUNC 1GWNA 1T1GA 3DZKA 2QZ4A 3OP4A 3P9CA 1AA6A 3T1HB 3GPLA 3R7FA 3VPGA 4JL5A 1Y1KE 2ZIVB 3G2QA 4J7CA 2VRCA 1VKRA 2JLXA 2CVQA 4XGQA 4G65A 2A5FA 4MRVA 2HO5A 1TPZA 3OUUA 3MRSA 2AFIB 1YZKA 4WZZA 3ADOA 4N0EA 5LM3A 5DLQC 2NVUA 1Y7LA 4EMSA 2VNJA 3WLOA 3N0WA 5BRJA 4W5QA 3JWEA 1KO5A 4BXOB 3RUEA 3K70B 2BEJA 1VHQA 4BNWA 2O6HA 1J0BA 4KQFA 1ZINA 4KQCA 1VFPA 4KNYA 2PIDA 3MT9A 2WRZA 1MKYA 3R5XA 5JCOA 1FYWA 2Q9UA 4MCHA 2ASEA 1KI2A 2GEBA 2KPOA 3DXFA 3TZEA 3VOSA 3ZOZA 3WGLA 2AXEA 1FQKA 3G89A 4BX2A 3GV0A 2PL3A 1SC6A 5I3ZA 4YX9A 4NHEA 1UKVY 3WYEA 5CT8A 5TMDA 2CXTA 1JSRA 3M1LA 3I9FA 4AG6A 3IQIX 2W5UA 4JFRA 5KSOA 1JIJA 4R1SA 1CSEE 1EK0A 3AK4A 5MHTA 4EQ6A 2NO1A 1E77A 3KFVA 3MTAA 2G7MC 2VPYA 5DNWA 3NYWA 3WHKA 2QL9A 3T3DA 1SKQA 1VDMA 1T2FA 1C7EA 4NBKA 2IIVA 1GQYA 4JCOA 4A0QA 1Q11A 3Q2KA 3NOXA 2Q3MA 2IZ7A 2OV8A 1SCDA 4NJEA 3MWFA 5C1IA 1X7YB 3ZY5A 4FFMA 3TCNA 1WP9A 2X4DA 2YHSA 1OPXA 3CNBA 3QUAA 4M54A 3QTLA 3ZJ4A 1CDZA 2NM0A 5A5EA 5HBRA 2BUCA 2CB9A 4FMCF 5I4BA 2YWEA 5KHAA 2GD1O 1YS2X 3QLVA 1IHPA 2MOKA 1I2MA 2HSGA 4YAOA 2O54A 1T2DA 1Z3CA 4P36A 2AEFA 2WHRA 4O4JA 4QG7A 3NWPA 4UVHA 2WUVA 4GYYA 1ECFA 3WOVA 3STYA 1BFDA 2BFMA 4AMZA 1HRDA 4EP1A 3TPCA 1ZSVA 1YL6A 3G0DA 4CMEA 3PUXA 3C1TA 4WZBA 4CEJB 4NENB 4TQUS 3JCZA 1GNRA 3ZCUA 1XPOA 4LHYA 2RHLA 1FU4A 5HF9A 5JVDA 2Q1UA 3NHMA 3COWA 4I2VA 5EINA 1ZVKA 1ZLXA 2AW5A 1D1TA 3U26A 5L4LA 5IJWA 2C8LA 3GO4A 1Q7CA 3WWOA 1ZOIA 3SQOA 1K7FB 1MO2A 4RVDA 3TQIA 1DCFA 2AMFA 5JQGB 4ED9A 4L7QA 1CXZA 1K08A 1Z15A 1KSGA 2RCYA 2OBYA 3KPYA 2CFTA 1VIYA 3RC9A 5I7OA 3BZWA 3HXTA 4OBBA 4ROSA 3ZOKA 2PUGA 1G0OA 3IGFA 3Q7SA 1AHNA 2X5OA 2WIDA 1QMPA 4NP6A 4X94A 2ZRMA 2XXJA 4ZO7A 3ML1A 1QIEA 4YLEA 4D4HA 4MRSA 3EUEA 4LGMA 1UBEA 2R751 2QN8A 5DYTA 1HXHA 2VF7A 1IPEA 2XA1A 3PFNA 3TW8A 1S3SA 1SCKA 3G7UA 1PJLA 2AVDA 3IESA 3ESRA 3ONFA 4UW9A 5ECYA 2VH2A 3KEQA 3QXHA 3WL6A 1HYQA 2GFQA 3A14A 3TPFA 3PS9A 4WNAB 4O4HF 4Q4DA 2FSUA 5BYKA 4UMVA 4IEFB 1E2FA 1J9GA 2REQA 3K6JA 3ZNPA 5HOEA 3KTDA 1VSTA 4LJ6A 3C48A 4PIVA 2Y93A 3L4SO 2D2IA 2QJOA 4MKRA 5J4LA 1A98A 1F06A 2GD6A 2ODNA 1MJNA 2ZWMA 5AJXA 5D5HA 2JBHA 3WLJA 3G5AA 2HAEA 4E3WA 1ZIPA 4RL4A 3QVTA 2DPMA 1RXSA 1AV7A 3T4PA 3TRKA 3U80A 4NAVA 3GRFA 2XMDA 2W6PA 1KERA 2UAGA 3F6BX 5I48A 2O2XA 2BBWA 2FF5A 1I0LA 3ETDA 3OFNA 4CL0A 1DUVG 3C41J 4W9NC 4M0FA 3VC3A 4FIZA 2DE0X 4X6XA 1SA0B 3NLLA 4CV2A 5CLLA 2ZJ0A 4D9IA 2QV0A 2I8LA 5CVEA 2QY6A 4GRAA 4H77A 3UOAB 2H16A 1DX4A 3JYQA 4JUBA 3NC0C 4Q9KA 1C3OA 1ZIXA 4HG2A 3U3KA 1XELA 1DOHA 2D62A 2P41A 5FPHA 1XCGB 3W1EA 2OGZA 1UPUA 2P91A 2YS7A 3EEFA 4J0QA 5CJ2A 3G59A 3P9ZA 2Q3CA 2V6JA 3H1AA 2EYUA 3A4TA 4R54A 4DLRA 5ISMA 3X43A 2CBXA 4Y0NA 1S8NA 4E5YA 1PV4A 1YUBA 2D54A 1PJBA 2QRUA 4HNTA 3ONDA 3N7TA 5JG7A 1EB8A 1YFLA 1ZWKA 3EZ7A 3KT3A 2C2XA 4G0PA 4JN6B 3ZX4A 1IHDA 5ICSA 5CG1A 2AUNA 4LF4B 2VBGA 1A9QA 3ASYA 3GP8A 3DBLA 1L5OA 2VF2A 1G6KA 3DM5A 1Z0KA 1V11A 3ZCPA 5ABPA 3BORA 3QM1A 2R1ZA 2OSVA 4I81A 5E8JA 4EJ6A 3HTXA 3EF0A 2AZTA 1XAGA 3TSYA 1JXQA 3P0JA 1W76A 2OP0A 3LS2A 5ER9A 3X1WA 1E9BA 3MRVA 4HAXA 2CMFA 2QM3A 4AWXA 4JJ8A 2Y1EA 5IBRA 2VSXA 4F3TA 5BOSA 2IU4A 1E2MA 3W8RA 3N86A 2AKEA 2PLNA 4YXWA 2P5UA 1XZBA 3SMVA 2EFDB 1B8VA 4QNRA 1KL7A 1PI3A 3TQHA 1PR2A 3DKPA 1X7ZB 1PSWA 3PYMA 5KSYA 4YRLA 4AJ2A 1CEQA 2BWJA 2P90A 1NMZA 5IKPA 3AUTA 2ZT8A 1B7GO 4LYAA 1YOBA 4UTPA 3ILVA 4Q4HA 3FMFA 4RX1A 5TPZD 3EF1A 1EIZA 4TLCA 4LE0A 3F8WA 4GZMA 3G8AA 4PONA 2GCNA 4XQGA 3Q2IA 4TXNA 3NETA 1ST3A 1VPLA 5ES3A 2OD7A 3L93A 1J4AA 2J67A 2VHTA 2XUQA 4MW9A 5KINB 1J22A 4YO7A 3DUFA 4YI5A 4ZHQF 5FTWA 3FOFC 2QP4A 3WLRA 5FD8A 2RD2A 3HY3A 1QV6A 3ROFA 2ROQA 3PKJA 3QNUA 2LV8A 3R3HA 2XUIA 4XR4A 4AWBA 1SZCA 3ZS8A 5L40A 2WHQA 2C2BA 3MGAA 2ZS9A 2Q0QA 3QBDA 4FP9A 2W6NA 3PIRA 3RJMA 1YR3A 2HIMA 5DSXA 4RMNA 1QHYA 3K8QA 1NIJA 1ZKMA 1UZUA 3A0UA 1GEGA 3IUJA 3L41A 4RVNA 1PVVA 2IX3A 5AQ1A 3IQWA 1RQRA 3KELA 4RCZA 1RKVA 3ENWA 5ES4B 1DUSA 1Z5GA 3TTTA 1U2TA 4BVLA 4R84A 1L7AA 1J2UA 1QZXA 1JPVA 1Z4IA 2ODBA 3CVWA 4Z4IA 1XFAA 1K8XB 2ZSBA 2H07A 3AOGA 1QQTA 3H2GA 3M3HA 4GEKA 3RYTC 5K3OA 1ES9A 3IP3A 4LSZA 4JYZA 2CLDX 2J07A 1WCYA 1PFGA 3NZEA 4J0GA 2LD4A 4ENSA 1IBRA 4YJGB 3NHRA 3LWNA 5IKMA 5AUQA 5BQXA 3QEBZ 4BLVA 2H8KA 4L02A 5DWVA 3EGIA 3U13A 1B14A 2XNJA 2PL1A 4QUJA 1Y6JA 4DJFC 3N6VA 3ZDDA 3FCCA 1EM8B 4UNIA 3EOBI 2C00A 4WNCA 3R7WB 3HFSA 4LCBA 2D5CA 1NF3A 2WAOA 4PYKA 4I99A 2OR3A 1EINA 4G6ZA 2PTHA 4DWOA 3WQQA 2V9ZA 1S2LA 3MCWA 4LRTB 3U61B 2UDPA 5MGBA 1FY2A 3C3DA 1A71A 4WH0A 4K86A 1ONNA 2PUVA 1AM4D 2SKEA 2HF2A 3H5VA 3PZBA 4Q1CA 3AR2A 4Q3KA 4U0KA 3UFXB 1EWQA 2CXHA 4BIIA 4YROA 5LDHA 3FBGA 3GT7A 1UOEA 3RYFB 2NU8B 2ZYUX 3GQBB 4EFKA 2Q6TA 1Y9JA 4AICA 5LL6P 4YRFA 2XADA 4EHIA 2FYTA 4CF3A 1H9AA 1BXGA 4EB0A 4R8MA 1I24A 4DJJA 1YDGA 1Z0SA 2YL2A 3OT5A 3T9BA 1NQWA 3UK0A 3UHAA 1ND6A 4IKEA 1ABEA 4BQPA 2ECOA 2G8LA 4M83A 5C7YA 4XWOA 1O0SA 2DTDA 5GONA 4C7XA 3OKFA 2I03A 2OOKA 1NZFA 1W75A 2A3RA 4L76A 2ZW9A 1Z2EA 1RLIA 3HKEA 1DHTA 3FNFA 4YY3B 3KV1A 1E6CA 2AUMA 3OZVA 3VPAA 2WWYA 4J1TC 4X20A 4YRTA 4P81A 1I5EA 3GH3A 4HLCA 4MRMB 4DQ0A 5BWCA 4KE6A 4ISCA 4F56A 3H97A 2YMPA 3GELA 1NBMA 4M8NE 3I5UA 5D87A 4NR0A 3MG9A 1R6VA 5FHQA 1SKUA 3FNRA 2MIIA 1DEXA 4F3CA 4UHJA 3TFQA 5CXUA 4NCAA 4NFSA 2PUJA 3H0EA 1X8JA 3PEVA 4CNBA 3PRKE 4KQ9A 2NUPA 1TZMA 3Q0TA 4NG4A 3OFSA 2GN2A 5DK4A 1E59A 5H3HA 3OEWA 2HSDA 5EUCA 1OA0A 3GJ5A 1R8JA 1WHSB 4UXHA 3RJ9A 3PLAE 5EZYB 3G13A 1XZ8A 2BRUC 3L07A 1X7HA 1AQLA 4R8KA 3RC7A 2Y6UA 3RQSA 4MVWA 1WR8A 3SXJA 4WXEA 5FHRA 2ZRCA 3PQ8A 4X45A 4ZMSA 3MCZA 4QUKA 3EMKA 2IPXA 1IU9A 1F1JA 3N2EA 5DK6A 1GA4A 1TO2E 1Z39A 5B6PA 4RMHA 3W5DA 3MAJA 3MUFA 2EGUA 4HEA6 1OHHA 3NNDA 4XUEA 5HDBB 1FTSA 2JCBA 5EHZA 3Q3GE 1WCWA 2D3TA 1XDWA 2VYND 1L4NA 1L7VC 5AVWA 2I3GA 1KH3A 4XD2A 4FR2A 2RKWA 3MFQA 1K6IA 3WGQA 4DLNA 5CT5A 1U2RA 3L3BA 3RVQA 5BOVA 4EPWA 1SUPA 2Q6OA 4D3XA 2MYTA 5FYDA 4JT4A 1PNVA 1R5BA 4QDJA 3QW4B 2X2FA 2BHRA 3KC2A 3WK5A 3RO7A 2C1ZA 2V7GA 2WHPB 4E4RA 3VC7A 3JD0A 2BM1A 3D7LA 5REQB 3LPDA 4LQDA 3KNZA 5FWNA 1PT7A 5D86A 9LDBA 1CUXA 2IBSA 1JP7A 5AKKA 3JS5A 2ZANA 1K86A 3RB8A 5H8WA 1ZMBA 5D6OA 5E1MA 1KMMA 4H0FA 2KQUA 3JWJA 3OM8A 1X2BA 3T7RA 4DSTA 3E2PA 1KVRA 3SZGA 3EH2A 3V33A 1AQNA 1LRJA 2AK3A 3OOWA 4H15A 5BN5A 1NLZA 4CODB 5BYBA 3WA7A 1Q22A 3ZJYA 2BBOA 2XYQA 1XTVA 5L7TA 1WB4A 4XJSA 1YCHA 3RBAA 1WAMA 5KMGB 3U2QA 3QWFA 4TT3D 1P19A 1Z7EA 3N7UA 4I5DA 4N8EA 4QQRA 3AG5A 1Y1SA 4BEBA 1IOLA 3OPNA 3PFKA 1ZUNB 2EOAA 3ZZUA 4BU1A 1RWNA 2PMCA 3GDOA 3WIBA 3PRYA 2VG8A 4RPJA 3EIOA 4PLPA 1H5QA 3I53A 4C22A 4REMA 5F5NA 5AUOB 2UU9B 3OCCA 1HLDA 3OIVA 7YASA 4UUNA 4I55B 5KCMA 3I1FA 5KREA 4GICA 4JEMA 3PE3A 1NUUA 1INLA 1UPBA 2DC1A 4V2IA 1X9IA 2VKTA 5JALA 5TE9A 4XLLA 1DPFA 4P82A 2ZP1A 2Z2IA 3ZVRA 5ECWA 4XVHA 2D0IA 1XTTA 3PNVA 2RH5A 4MQFB 2XNCA 3UOWA 5IT4A 1C4KA 2HQSA 5AJYA 2O2SA 3E8XA 3Q10A 5IEBA 3ZBTA 3ZUPA 4BQIA 1SVKA 1P1BA 4XYGA 4PG7A 3OQJA 1IUKA 2GWRA 2W11A 5T64A 2IPAB 3JQ6A 2PUEA 4OJYA 5ECDA 2B9EA 1PZFA 3WL8A 5B55A 2P4UA 4CGZA 3NHYA 3R0JA 2GILA 5ALPA 2OXIA 1AO0A 4ARIA 2XA2A 3AUFA 2YOHA 3VOAA 3OOYA 4FFBB 1BQEA 1YB7A 5L45A 4UAGA 1SOUA 3C24A 1ZD1A 3LW7A 4ZANA 2QRQA 1K2WA 2V4MA 4GEGA 1Y80A 2G9VA 1Y4SA 4BUCA 2W6ZA 4U9HS 4XPIA 4YQYA 3EIEA 2UXCB 3NWJA 2O2GA 3HHEA 4OU4A 3ADDA 4P31A 1XVUA 4S0ZA 1SAYA 1UT5A 2CXOA 1RM3A 3UF0A 3UT5B 2O8CA 2TYSB 1J49A 4DSAA 1QPZA 1OLXB 1QTRA 5JR3A 4E2YA 3S28A 2HN9A 1AHIA 2X8AA 1GDTA 3VPXA 5DH9A 2Q2WA 2WIKA 3SJAA 1C9JA 1TVKA 2I4LA 4A8HA 4RFSB 1JAHA 4N1AA 2HIAA 4AIRA 4DE5A 1EDEA 3PGMA 1R4ZA 1KAOA 1PV2A 3HY6A 3HHPA 4TMXA 3P9YA 1EVJA 3VKUA 5E1OA 4FZVA 1P18A 2PMEA 4IIJA 2BGUA 4UHCA 5DLEA 4KKVA 4HYTA 1E62A 2PGJA 5AKGA 3CUTA 5E6RB 1MIHA 4Z3DA 1BXKA 4KRXA 5K4AA 2C92A 1JKIA 1KP3A 1NL3A 2JI8A 2WWFA 3OLQA 3TD9A 4EKIA 4YR7A 1RP7A 5CHEA 2ZT7A 1ZICA 2P69A 3AETB 4C7JA 4OSOA 3UV7A 5IPFA 2IS6A 4KGXA 1U1EA 4XIFA 4RGQA 2RHBA 3D3KA 2P9BA 5CD9A 3AESA 5C3UA 1HNXB 1TO1E 1N5KA 4N76A 1FFSA 2XQKA 4LRUA 5HHTA 1MVLA 1Y3IA 2I66A 3FTCA 3OD1A 5CVJA 2CDRA 4U9IS 1IB0A 2NXWA 1LY1A 3CLTC 2OILA 4KYIB 3OCYA 5K3DA 1Z0IA 1U7OA 2PBRA 2O2ZA 3ZHOA 1SHKA 1WETA 3G2LA 3L7KA 3DQQA 1OX4B 3TZBA 4K05A 4MP3A 1KZ6A 2GRAA 3WJ1A 1XP5A 2H7YA 3DWFA 4GG1A 1XTSA 4NMHA 3U17A 2K2WA 1R8SA 3EDYA 4D96A 5HUJA 3KUXA 5IH3A 3OG9A 2JGEA 1GNTA 2ZI6A 1DEHA 4EFMA 1TA0A 1GT91 2C9ZA 1ADJA 2IYLD 2H0AA 3K8OE 5EXEA 4BMOB 5I45A 1RWVA 1VCOA 2R8PA 4KNVA 4FFLA 1GCGA 1RWOA 4PPQA 3EG5A 3ILHA 3OMLA 1H8EA 1GQOA 1GG5A 3PWKA 4JLWA 5DOVA 3UMSA 2GEDA 5FV4A 5BN4A 1WSDA 2FFQA 1O1YA 2XIQA 1E9AA 1XZKA 2IXAA 3R20A 2HMSA 1S9HA 5IEJA 4QYWA 1IULA 2V74B 3HZZA 3JZDA 2XLCA 4L2IA 3MC1A 4TKUB 1I7SB 3EBOA 4IHJF 1EXDA 1N32B 3I04M 4H7HA 3KYDB 2W6IA 5BR4A 2CDCA 3P0FA 3QF4B 4G4JA 1ESZA 2WD8A 2YVUA 4AMVA 3IA7A 2XRMA 2Q0XA 2ZJ3A 1YS7A 3JVEA 1O77A 2AYXA 4LSGA 4KWTA 1VHLA 3CVXA 1RCTE 1OU0A 4U00A 1TF7A 3S3TA 4I46A 4Y8VA 1A9TA 1ETUA 4B84A 2J31A 1FLDA 1CRPA 3N7AA 5T3YA 5JJKA 2O19A 3DMDA 3D4PA 1Z26A 4IF6A 4F9FA 1WPGA 3PNMA 5K05A 2QMEA 1DOAA 3NU1A 1ID8A 1SG0A 2ZUTA 2PA3A 4F9EA 2Z0MA 4BWGA 5EFOA 4E5KA 1QRSA 3GDGA 4LDZA 2OYRA 3WP1B 3H9CA 1PGJA 1C1XB 4PLFA 3T9CA 4IX1A 1V1MA 2NO9A 2XOKD 4C4AA 3REFA 2Z5GA 5IJ9A 4G41A 1G4AE 1H0RA 1P1RA 3SEQA 3O7MA 1T9CA 5CFPA 1DIRA 2WAAA 5F1OA 4RJ2A 4O02B 4ZK2A 1O03A 3CSUA 5JFOA 3FWZA 3NPAA 4D4IA 4B76A 3KJIA 8ATCA 3SXUB 1M5UA 3EASA 3FDZA 1ECCA 1Q7EA 4D45A 4ZJUA 3ZDRA 3NOVA 4RDCA 5C7LO 1IPHA 3JQGA 3QVKA 2I7DA 4I55F 1X3LA 1T6YA 4L4ZA 4TZTA 3E53A 3U60B 3DC7A 3QTTA 4RZUA 4ENVA 3N07A 1CP3A 1DIHA 3FHOA 4WIAA 1FJ2A 3DBVO 3TXXA 3HPRA 3W2IA 4I50F 3ZI4A 3FRJA 1C81A 1JAIA 1E3EA 1X6VA 3FCAA 3IT1A 4ON9A 3HB7A 4UAVA 4OLFA 2GHQA 1ZMRA 5ITWA 1U3CA 2NVOA 3NHLA 1QFJA 1HFWA 1IL0A 4LZNA 4KXNA 4DDKA 3AJDA 3CJQA 3DE2X 3NEPX 3C97A 3MS7A 5A04A 3NB0A 3PX3A 1CRQA 4NMMA 3G2HA 1XQVA 3CVJA 2ZUCA 2ZIZA 4HDOB 4FZRA 1SBZA 1NWCA 4DLSA 2GZ1A 1ABBA 3DVSX 4RF4A 5E6SA 4V0NA 4QPNA 4E6PA 2R8RA 3CVVA 4O8ZA 1J8DA 2JEZA 2PZLA 1XZIA 5F4BA 3VR1A 2G36A 3ICCA 1BU8A 3ZC3A 4B7AA 1W6UA 5J2UA 3TLJA 1Y5MA 4G0VA 1Z07A 4N12A 2JFNA 4DIEA 3T4UA 3UG6A 1GSHA 2OUIA 4ZYYA 2VEOA 2IYYA 5HF8A 3T15A 5LWQA 4EMTA 3DR3A 3W6PA 3IQZA 1Y3BE 1ABFA 3JVVA 3USCS 3FNHA 2PX8A 1M2JA 2O0JA 3GEHA 3PPVA 4H18A 1TQ2A 3ZYZA 4RU1A 1JKMA 3OQ6A 3WOHA 3I28A 2YBEA 3DZBA 2ZJ7A 1MQSA 1PG5A 2J9FB 4Q24A 1PBTA 2ZTLA 4QGBA 2HA0A 3A04A 5BMVB 1MOQA 1XEAA 2FPXA 2J32A 1FF9A 3A11A 3N05A 5A4DA 1EFKA 3D43A 1WLSA 1XSEA 3VO2A 3TDKA 3A4LA 1EWKA 4JOCA 4G9BA 1M2VA 1Z4MA 3K09C 2FQWA 3LH5A 2H1RA 2WFLA 3STHA 2QN2A 1GY8A 1JR3E 4L4RA 2D1RA 4P08A 2YJ6A 4QOEA 3NV9A 3UG7A 3MMSA 4POAA 4EJSB 4PNEA 3ORSA 1EE1A 1GRCA 4M6WA 4NYJR 4V2UA 2A9OA 3GXBA 3A26A 4QVIA 4B7CA 3OAAD 1FFAA 5EJEA 1JEQA 4PCUA 3W2EA 1UDAA 3KAJA 2FDCA 1P17A 4S3MA 5DOZA 2Q5EA 1QDEA 2ONYA 3WRXC 5KNDD 4ZVOA 3LLSA 4JYAB 2XGGA 2YRXA 2X8WA 1GTJ1 1ZG3A 2O06A 1FB5A 2C78A 1CUGA 3E3AA 1D2GA 3LK7A 1HMYA 3NBKA 3RT1A 5JZSA 2C58A 4YRMA 5TC4A 3FZQA 2OHHA 3PUIA 4WPGA 1GYPA 3NG1A 3HB5X 2I80A 4DG8A 5B36A 1PQ4A 4IEEA 4F9TA 3IB6A 4GGPA 4TWBA 3RU3A 4TT8A 1V25A 5MGNA 1FNMA 5EESA 1VSVA 3V32A 3ZU5A 3EVFA 5JRDS 2CWDA 1ZNQO 3E58A 5FPYA 5C2JB 4WTOA 3AUYA 3K1YA 4FFWA 1HFJA 1DP4A 5KU7A 3HBAA 4GPEA 4YVFA 1QHXA 1KORA 3RIEA 1SCQA 1BH2A 3T9EA 4F4UA 1XNJA 3EF3A 2ZB4A 4GZ5A 5JW6A 1NRJB 2P3OA 3UPUA 4GBMA 1HYEA 5HGJA 1H0KA 5EWJA 2WJ4A 3O2QB 4Y6SA 3QE3A 5I7EA 2OG1A 3BCSA 4B9AA 5CXQA 1KBQA 4C87A 3LVRE 5JI3E 3VJKA 2PT9A 1E64A 2AI1A 3NM4A 5BV8A 1J42A 3D2LA 4LMAA 4MIYA 5EJIA 3RW9A 2RHRA 1AY0A 1COWD 1WM1A 4XYMA 2ZATA 1KF0A 1EFVB 5K8UA 5F98A 3OF5A 4MVJA 4DNPA 4RQUA 3EGDB 4BLPA 1NFFA 2GM9A 1WY5A 1UM9A 1NKVA 4G67A 1C30A 2XQVA 3FPAA 4N3CA 1EKXA 4AJ4A 1MEEA 3G2KA 1JJ7A 2DFVA 1Y82A 1H65A 4RD3A 3SYLA 4V39A 4DLKA 4LZLA 4E46A 4EENA 2BZGA 4P2BA 3MQFA 3F6SA 3QUTA 4NZZA 3PDHA 1M8PA 3N0VA 1XU7A 5EJGA 1K7YA 4PTYA 2ZIXB 2YV3A 1IUNA 1D1PA 1XIVA 3OE5A 4I9UA 4RSGA 2BFFB 5JJBA 1EBBA 3FVTA 2FRDC 3AERA 4WXRA 3OIDA 5TS2A 3OY7A 3VPSA 1KIAA 4Q02A 3VR3D 1RFLA 5HBGA 3C2QA 3ISVA 1TPYA 3L06A 1C7IA 4OQLA 4C6HA 1IG3A 1X42A 4IS3A 1IXSB 8ADHA 3GGPA 2ID8A 4Y67A 3TZCA 5TT1A 2BEVB 1ZN9A 4YASA 1DKOA 2OAP1 3QXGA 1RM4A 2RHOA 4XA8A 1RAIA 1TAGA 1BJRE 3W6NA 3DKRA 5FF9A 3EEOA 4DNXA 1NZJA 2PH5A 3CO0S 4QFBA 4F12A 2NZWA 4KJZA 5A4AA 5KTOA 3KKPA 4CCYA 3WBJA 5AW7A 4RM3A 3H5IA 4HUQB 1UAGA 2GK7A 3E9DA 3NAMA 4QJ4A 1RXVA 3HLKA 4CV1A 4ZGGA 3FYUC 3LT2A 1UQRA 1WXWA 3MGBA 4YH1A 1NX6A 3FMPB 3RTAA 2JPDA 1GYQA 2JNWA 4K8RB 1NIPA 5DBHX 2OL4A 1E1MA 2AS0A 4CWAA 2X5XA 3LY7A 1NHGA 1NNI1 1P1KA 3M2PA 2CF5A 3TFWA 3KLMX 3PCRB 1W96A 2VOEA 4F5WA 2FY8A 2R48A 2IHBA 3RF7A 3RUFA 4PAOA 1AN9A 2AMVA 2GUGA 1TAHA 1U7TA 2WAXA 5IRCD 3VDMA 4G81A 5IDXA 5LOVF 4BO3A 4Z0TA 2FZVA 4BO4A 1Z4PX 1NT2A 1EFTA 2MSKA 3QVGB 4B6FA 3LCUA 1W35A 3Q11A 1A9OA 4K5QA 4V0KA 3AOEC 4EVRA 5IJXA 1TGVA 5BPHA 5KQMA 2VI5A 3E9QA 1J2YA 2WT4A 4IYJA 4N0MA 4BX8A 5LUAA 2JS7A 2WIBA 2W2XA 3R6WA 3WDMA 4M0KA 1UFRA 4O0MA 1I14A 3AONB 3NHAA 1AQ6A 1OILA 3HLYA 3HYSA 3HM9A 3T1TA 1OAOC 3K53A 3T5TA 2CHUA 3UWOA 3IC5A 1JS1X 3E5MA 1KXJA 1FC0A 2XQJA 5E2BA 5JIBA 2JF0A 3H5AA 3P4YA 1IZ8A 4FKMA 4FR5A 4LVUA 4UEWA 1XDZA 3H9EO 4OEHA 2VKQA 1N34B 1U31A 4W5HA 2Z2JA 2PKQO 2WB4A 5AHWA 5AJTA 3W7BA 5KTNA 3BD7A 1RYEA 4I8XA 4NOJA 4BNDA 4JP5A 4ARZA 4OLBA 2WT9A 3BD8A 1U8XX 3GZ4A 3ZXIA 3IOCA 3GLHE 4JY7A 1TVEA 1XD2A 2QMUA 3FF1A 5H7XA 3PENA 2JDID 3RSGA 3E3NA 4DLAA 4Y6RA 3RSSA 3DTVB 3JARB 2QTCA 4TL8A 3SHTA 1HG1A 1YCFA 3C3BA 4JNCA 4OP1A 3RS0A 4IP0A 1ZK4A 4LXIA 1Z0AA 1ZW1A 4N5MA 4PAMA 4Q00A 5CIQA 5A03A 3P9XA 3ZDQA 4UHKA 4YMHA 3TGLA 1PFUA 1H2RS 5DM4A 4D6YA 4YIHA 3WQHA 3CLRD 4IVNA 4FN5A 4UU7A 1NXSA 3AFMA 4ZC1A 3JALB 4DA0A 3K0HA 4NOLA 1M2FA 4QG3A 4G0QA 5CPBA 5B4TA 1SU8A 2I87A 2Y92A 3DWEX 2V7TA 1MAVA 3JD2A 3TTVA 1N2OA 1VP9A 2ZWIA 1LI7A 1UFQA 2GXQA 3EFOA 3H0KA 1NN5A 2AFIE 3NYQA 5I47A 1EFDN 2JIQA 4M4SA 4TV9F 4G0MA 4B17A 2FQ1A 4MWGA 3H5LA 1F51E 2HHLA 5UKDA 3A2MA 3RJ5A 4DLTA 2I4RA 3MWGA 3OSUA 4FWBA 3HNRA 4RV5A 2BONA 4KN9S 1OW3B 3FETA 4LYJA 1ANKA 1EGMB 2VBCA 1EFUA 3BJIC 1Y4AE 3DW3X 3QPVA 1NVKA 4MR8B 1P3DA 3V4PB 3V3KA 4QNNA 4ZQCB 1RTTA 3GJQA 3ACBA 1Z75A 1YGPA 3EFHA 4RTSA 3GA5A 3QOXA 1TLLA 2PRSA 4W8HA 4LYEA 2RAPA 4X3OA 5A7HA 2P35A 2PH7A 4F06A 2B98A 1N1MA 5H16A 3WL5A 2RJ3A 1Y3CE 4C0JA 4YUZA 1FW8A 1NQOA 1QORA 5ENVA 4QBIA 4GFDA 3FOZA 2BR3A 3AR5A 2D5AA 3GJ3A 3HVUA 4MULA 4US2R 2PL5A 5DNDA 2MINA 1JWBB 3GVPA 4HPWA 5EZYA 2QUJA 3H4TA 3UT6A 2BM0A 1U5BB 4MQBA 3NHKA 3OEHA 3GPCA 3EFEA 2BTOA 2Z08A 4RAOA 2G25A 3FLMA 4ZV4A 1KAEA 5CTJA 2P79A 2G5PA 3VR4D 2R1TB 4C89A 1IQRA 2JH9A 2O9JA 3PPWA 4O4LA 4ATNA 2OORA 3HI6A 4PWZA 4NKRA 5FEMA 1A5BB 1Z28A 3U3JA 1WVIA 3CM0A 3WICA 2F9FA 1YDWA 4CR7A 1M7HA 4A3SA 2AC4A 4JI5B 2B0JA 2VIIA 1BS9A 1FUEA 1F1BA 2YX1A 4EL5A 3ZQ4A 1F48A 2FUKA 4Y2RA 1ZXXA 4XYLA 3VAAA 3VV2A 4YRNA 1FFYA 2AFHA 4US1R 2IU3A 3EXG1 3REOA 4A16A 5AVZA 2X0JA 1F7VA 1CUYA 4K9QA 3FDIA 1FDSA 2ACVA 2RHTA 1ZMOA 2YASA 3LOPA 3OZFA 4G1UC 5EKXA 4C4SA 4Z1MD 4ZZIA 5I01A 1B3BA 4C20A 2WJ6A 1R6XA 1UWKA 5A3JA 2JAUA 5HG0A 2GHIA 1R27A 2R7MA 3HWRA 3DNMA 3S5JA 1V71A 1J39A 2QRVB 3KXIA 4LOJA 4S1OA 5K3CA 5A3QA 1LLUA 4MUHA 5HRAA 1KI3A 2J0UA 1VSBA 4TTTS 1E9SA 2V5VA 1VPEA 3R23A 1GPNA 4CMKA 5CAEA 1ZHFA 3BIFA 1DRVA 1MBZA 4LX8A 1NA5A 4WN9A 1PJTA 2JEOA 4CFSA 2YZMA 4EKYA 4YV0A 2A0XA 3E9EA 3FKSD 3ORRA 1IK6A 4MQEA 3UMRA 4OLJA 1E2BA 4Q3OA 3JAKB 4US0R 3B12A 1GNPA 1T9GS 4MYSA 4U0JA 1Y6GA 5F5XA 5BO5A 1YR7A 2F7SA 4HQ0A 4JVNA 4L73A 5DNEA 1QFMA 3C6QA 4CDMA 4RJKA 2FUEA 1KFKB 3OX1A 1A69A 2O4CA 5FWYA 3CLVA 4P4SA 2QAIA 2ZUEA 3JATA 4KX3A 1EHYA 3TKLA 3KVVA 4KDFA 5DPMA 4C5AA 4B5KA 4DSZA 4CMIA 3DYBA 1WW2A 1WULS 3BK2A 4I7EA 5TPWA 4I4TB 2PQ0A 4MIOA 2ZSFA 1OGIA 3NHFA 3OZCA 3UHJA 5KIAA 1AXEA 1OZHA 5J4HA 1KGSA 3IPCA 2FXIA 5JNWA 4JJEA 2B6NA 4EW1A 3U44A 1WBDA 2ZAGA 3PWZA 1Z2OX 2F3RA 3DEKA 5LQKA 1X1RA 1V4BA 4WSOA 3UJ9A 1IM8A 1F6DA 5M7EA 4Q6WA 4KXFB 1LLCA 1JDZA 2NU9B 3H8JA 5JADA 1JLKA 3MIIA 4RSMA 2GCEA 1ZRNA 2C0QA 3K0CC 1I32A 1WXFA 1ISIA 1ITZA 2E4VA 2OENG 3OA2A 3O8OA 3ZN2A 4N82A 1M8JA 2FR8A 3L9XA 1QHNA 1G20B 3SFTA 2WAYA 3G0BA 1D4ZA 1EX9A 1MA0A 4LTDA 4EW2A 1WABA 1MC1A 2JAHA 3LAWA 2JC3A 3IKMB 3S99A 5SZIA 4BRWA 1CC1S 1S4QA 4C0QC 5JDCA 1KAGA 1CETA 4FNAA 3PJGA 4QHTA 1JBEA 2D2XA 4NWIA 1R5JA 1JG3A 1KDOA 3DDUA 5E0KB 3A7EA 4FOTA 4M3NA 1G3IA 1GOTA 1UBKS 2B7CA 4QA9A 4Y6GB 4FYJA 4F5DA 3EEIA 1TC2A 2O50A 4G8BA 1IC6A 2YJZA 2VFAA 3D5QA 4LC0A 3T3OA 3NKLA 1X94A 4C3OB 2DB3A 3RVLA 4WDRA 3JVUA 4MUBA 4G4SP 5I7RA 2JI6A 1JNXX 2VTKA 4DZTA 3DCJA 3H19A 3I2JA 2EKDA 2O1XA 2DWPA 2AJ8A 2EBUA 4FJ0A 4CM8B 5AVYA 5KNDA 1Z2NX 2Q5FA 4JEHA 4S1NA 1K1EA 5KKAA 4RM2A 4B47A 3H86A 2ZUSA 4LECA 4WRRA 4AAYA 1RRCA 4A0SA 1GG8A 3E7DA 1ZKDA 1CHDA 4QM7A 3BN3A 4ZHSA 1QGUB 1E7SA 2FW0A 5DGDA 6REQB 2VPTA 2C2ZA 1T9KA 2EKQA 1HETA 1TJ5A 4OHPA 2QGZA 3E7FA 4KQJA 5EGSA 4XRGA 4IO1A 1UMBA 5B2FA 1OXVA 3KR2A 2A1IA 3R6LA 3GN1A 1DKMA 2Q3JA 1DAOA 1C0PA 5JXJA 4AZVA 5J9FA 5ED4A 3R7BA 1RS0A 4L4SA 1VBNA 1MJGM 1XT6A 1R15A 2KWIA 2O1WA 1U7UA 2W6OA 4TWJA 4IQ0A 4BDTA 4HB0A 5JWHA 2J4DA 4ESEA 1HZZC 2M2IA 2VHXA 3MJHA 1CZUA 2Q27A 2FFJA 2G5TA 3WB1A 3OPXA 2RB4A 3GMSA 1W88A 4LKOA 5EP4A 4GQIA 3LL4A 4NESA 3TG8A 5DM0A 1US8B 4XD7D 3C45A 5I8WA 4ZODA 4TSFA 1F5SA 1XD9A 3RAGA 2DFLA 3C4QA 1M2NA 4IGEA 1YBHA 1ESEA 1OXBB 3OIUA 3BHIA 2GN1A 3DB2A 1BRMA 3P27A 4JA2A 4F2WA 5KYUA 5I4KA 3PEWA 4C78A 1HYHA 1RBQA 1U0GA 1NZDA 4NU6A 3M4ZA 3C1AA 2P30A 2OBMA 3UUWA 3V2IA 2I2BA 2WE8A 4TMZA 3L4EA 4XLTA 3S81A 1J2TA 3NRBA 1KJQA 4M22A 2HA5A 1Q44A 3R4VA 1P4SA 1U0TA 1JQBA 3KP1A 3CZMA 4R2KA 3VKWA 2CVFA 2QD3A 2DERA 3E27A 1R0XA 1L5NA 1EBUA 3VYTB 4FMPA 4RVGA 3TLBA 1L4HA 1SURA 2XNDD 3TUJC 4F91B 4I1PA 1NW3A 1ESMA 1U4SA 1EFRD 2AEEA 1P39A 3OTWA 4KOAA 1RJ9B 1NSTA 3P5SA 1CUZA 3MWDB 3M82A 1F9EA 1QQBA 1SD2A 2F48A 4RSHA 1V6AA 3DAYA 4P0QB 3K9LA 1C4OA 2G4VA 4EABA 3H1GA 2HJGA 2WU1A 4QTZA 1S7CA 1C9MA 1B6GA 3AHJA 3U3ZA 4M9CA 2CUZA 3HMKA 3P96A 2X9NA 4M0PA 4G5FA 2VF8A 3GFGA 5GJWC 5ILQA 3SVLA 2HH9A 3EWNA 1MNAA 2A9VA 3IILA 4HNSA 3WL7A 4E21A 4DUZB 3AY3A 4HL6A 4ALLA 2NTYC 3IHKA 2A1TR 1GPYA 4IILA 4KAXA 3C6KA 2QSYA 3M5WA 3CSDA 4TUYF 3RVOA 3W3AA 1JWAB 1FP6A 2EP8A 2WLSA 3B9QA 3LKBA 3M5CA 4E14A 4BPBA 5BNFA 1I3OA 4L6CA 1TEVA 5FO0A 2AFRA 1TZCA 2QAGB 2WDZA 2FVXA 3IT2A 1H4VB 2QMOA 4MOWA 3HU5A 3DJFA 1KI6A 3L7AA 1QB8A 3QMVA 2W90A 3C7TA 4F9GA 2NX2A 3VDXA 2I4NA 2W98A 4DGSA 4WBNA 3BFPA 4OP3A 3ZKWA 3GEEA 2PA0A 1XFDA 5IDVA 5F2NA 1LX6A 2CBGA 4IEIA 4NK5A 3RNOA 1C4XA 1VKNA 3BXOA 3LYUA 4DDVA 1A72A 5JNUA 3E5NA 3O5AA 4NE7A 3SHWA 1A5AB 1KK1A 1LX7A 1W85A 2R47A 4G36A 1PD0A 5FNVA 4ZVSA 2B2XA 3TNDA 4B43A 4HLDA 3ITKA 2BELA 2Q5HA 3RVDA 3KUUA 3SN6A 1WBBA 3B6IA 4BP9A 1T0IA 4HXEB 3SLRA 4ZYWA 4XQ0A 2V6FA 3U7IA 5LYYA 4PC1A 1FS4A 4BUZA 3RAPR 2PM8A 4HAVA 4CQLB 4J16A 4ZEWA 1K0FA 3BF7A 5DBIA 1Z7WA 1YI1A 1E20A 2CJFA 1V35A 2X9VA 2HHHB 2Y71A 1O94C 1H1LA 4O4IF 4PYIA 4H1UA 3VU3A 4EGQA 2C5LA 2CJXA 2G83A 3ZGZA 5J2TB 4QFCA 1M54A 2W48A 3QJGA 2GSDA 3RS2A 3UGTA 4R8RA 1ZK2A 4CMJA 4NEGA 1NE2A 5AW6A 1IM2A 1KQGA 1JQ5A 2QQ0A 1NLMA 3BWBA 1SRRA 3DCIA 4O2AB 4KXWA 2J33A 1SCNE 3DMFA 4HX5A 3O3OB 4HQKA 1FS6A 5FA8A 5J4KA 4PCLA 3DLCA 1W2HA 3RYIA 3UZUA 4JBXA 2WHXA 4GU5A 1ZUIA 1U6KA 1TW2A 3WGIA 2C5GA 3QX3A 2PNFA 4WJKB 3H8SA 2GPNA 3WMWA 1ZK0A 4MWTA 4YT4A 3AX6A 3TLMA 1C7RA 3WGOA 5LFAA 1G2IA 2DGDA 1AHPA 1TTTA 2Q21A 4O0LA 2VLBA 2YJNA 3QHPA 3QOWA 4AYWA 2NXEA 1FFGA 2XUFA 1L4EA 1G1MA 4KYTA 1O96B 1ULZA 2GM5A 4XDHA 4WZ6A 4F8YA 3HZHA 4B2LA 4QD3A 2HLDD 1W47A 3IV9A 3QVUA 4ZI3A 1EGAA 1J70A 4V0ME 4YWHA 4RJTA 3VNUA 1P2TA 4K6HA 4XVCA 1H6AA 4WA8A 3NBQA 3KKMA 1XR3A 3U48A 3IBTA 3AHFA 2QI9F 1UKYA 2Z2ZA 5IVDA 1YZNA 4KR9A 1K6JA 4FONA 5DI3A 1TM7E 1BNCA 1TQDA 2YRWA 3SYMA 3CNHA 2B83A 1PP4A 4ZVLA 1G7SA 3F2IA 1BX1A 5IXYA 5MFZA 2B4RO 3LDGA 4TTAA 1XX6A 1V1RB 4DHEA 4QYIA 1KXZA 2F55A 1DJMA 2RHCA 2OO5C 4O1HA 1T4DA 3CEJA 2PRZA 3DH0A 4CLOB 4ASUA 1LDMA 1R3DA 1HV8A 1F2VA 1XHEA 3LX5A 1HQCA 2NV2B 4YPFA 1VRCA 1ECJA 3HB0A 1G5PA 1YZLA 1YB6A 4R1NA 2GK4A 2KLHA 4TL7A 4ZVTA 2O8BB 2C2KA 3WZ2A 3BRSA 1BHSA 4MDHA 5K01A 1I3NA 2CHEA 5KPDA 4AP9A 4WUTA 1U0NA 1MRSA 1F12A 4KGZA 4Z8YA 2F6RA 1G4HA 2PD4A 2ZBPA 2H1OA 4QJIA 2OY0A 3BXZA 1OOEA 4U02A 2JK1A 4C7OA 1ADFA 5BMOA 5FI5A 3BA6A 3KKKA 3OJWA 5AI0A 3S2ZA 4DXDA 1LVUA 1UXHA 5AWFC 3LZCA 3MINA 3OEEA 1LTQA 4NFYA 3TQFA 1EJ0A 3T3HA 1P61B 4EG1A 3TAXA 1XJ5A 2DCUA 2F17A 4KPUA 4YBZA 3HJGA 2C7BA 3BDAA 3IEPA 3O4HA 2QMYA 3BSSA 4B75A 4OQYA 2OFXA 1KWKA 1JGTA 5AOVA 1WRBA 1P9OA 2Y1OA 1JYSA 3KJHA 3DT8A 5LQMA 4DV3B 3K9NA 3JQ7B 5ED0A 3L8HA 1V6CA 2HDNB 5I9IA 1CUFA 1H4SA 4K6GA 2QHXA 4I1OA 1BROA 4M1MA 1PFQA 3H13A 2VH5R 1YS6A 4Y2TA 2EQAA 3U7FB 3GPBA 2YWCA 4YQZA 2X6QA 5IFKA 5K45A 1EDZA 1ZD8A 5IUKC 4I3HA 3CX7A 3ZGNA 4DMCA 3VU1A 4AU1A 2C4WA 4OHBA 2C9YA 5F3DA 5IT9A 1JDTA 5L3SA 5JFGA 1ZPDA 2ECKA 4RKQA 3I4FA 3OZGA 1I7PA 1URPA 4HWRA 1NM5C 3FSEA 3FZGA 1LXCA 2I6UA 3V7FA 1FYDA 1P2BA 1VE3A 4H1TA 2PH3A 2Y0EA 4WBSA 4B33A 1QVZA 3GJTA 1RI2A 3EZYA 3ZR4B 2OWDA 2CD7A 3DWIA 4AJKA 5FIUA 2BKVA 5CA0A 1OR8A 1UC4B 2VAVA 3HVKA 1OH8A 2PT6A 1M3SA 3RAFC 1I3MA 5DO9A 2OBBA 2CJPA 2VDWA 2OVBA 2NO4A 3E9NA 3U3DA 1BVHA 3ZLUA 3I39X 2ZULA 4UTVA 4Q9IA 5A4MS 4ZQGA 4D9NA 1QONA 4DCVA 4EJ2A 3T95A 4CKXA 3F5DA 1P3Y1 4RF3A 1JA1A 1MQ9A 3DAHA 3LY8A 1VE5A 1L5KA 1EIWA 3GGGA 4YN3A 1U9YA 1ZN7A 5EYPA 1ZXLA 1CDEA 1XN1A 1CY8A 1O6FA 1DELA 2Y1LA 1KEPA 4JHXA 4MX8A 4Q4AB 4PZCA 5CB6A 4DV6B 1M6VA 2Y1KA 2HPZA 2R4TA 5K03A 3QEMA 5AFSA 1YQQA 4BMPB 5AVOA 2QMZA 4C4TA 3FVWA 4D8VA 4EA7A 3GDFA 4XARA 1E94E 4U3JB 4BQRA 2XTAA 3OJFA 4KDEA 4RE5A 4CIXA 3L82B 3MMNA 1T8TA 3CF2A 3C3YA 3Q7IA 4GVXA 2QX6A 4NX2A 2WU8A 4RPCA 1EP3B 2OGUA 3IO5A 3P9NA 4W9NA 3ZHZA 1JU4A 1NW9B 5D5PA 1JEDA 5D3QA 3DBHB 1VIAA 2ATEA 2DFTA 3LOUA 3OFND 3HUUA 4MVXA 1E3DA 4Q1VA 5HFNA 3ZHXA 2YN2A 4EHFA 4F0JA 2QI9C 1T9BA 2QJTA 3C8HA 5KYWA 2J5XA 2HK9A 4C88A 5LQDA 1ZN2A 4C76A 2EKPA 5BSKA 5FDFA 1NYLA 1U9ZA 3AEQB 2CL7X 1YRLA 1AF4A 2A5LA 2JFPA 2JGIA 2Q3DA 3OOSA 2H08A 5JCJD 1L5QA 4Q16A 1ELOA 1U2QA 5ALEA 3R9XB 4NCNA 4HH1A 4YFYA 3ITEA 2E82A 2FJ0A 3Q6NA 3VNSA 4Q15A 2NQ2C 4F71A 2WINI 4PWYA 4IDFA 2EFHB 4FCVA 4RJIA 2HA4A 5T4FA 1L5FA 3HDTA 4FHFA 4DLVA 1X0XA 5EXXA 2G88A 1T5OA 4G1FA 2Q4RA 2H11A 2XWSA 4G4IA 3KD3A 1P9WA 3GEIA 3TI7A 4IOLA 5TQ0A 4QEKA 2COUA 3LF1A 4BNZA 2HF7A 1H66A 2FJPA 2WD7A 2FG6C 2KMLA 3PGKA 2B36A 4TVKA 4A4DA 1J00A 4HT3B 3ZZNA 4NCIA 1SU6A 1D2HA 3MD9A 3LVFO 4DLBA 1X1CA 2CZQA 2JGMA 4WW0A 2FLVA 1HM5A 3QI7A 1D07A 1R6TA 4AN0A 4EHDA 5LPNA 2QBYA 2FCRA 1QVAA 3KM0A 3TBHA 3GP5A 5GZ6A 1T13A 2RIPA 1S2MA 4CPDA 1WXDA 3O90A 3N2KA 5AM2A 5FV7A 2FZ5A 3D64A 4UMDA 2IP2A 2DT5A 4YXWD 4MAFA 3QPAA 2H65A 1E2KA 1D6NA 1DSSG 1T1SA 3QELB 2BFPA 4X41A 3HACA 4XSHA 1YZYA 1TM1E 2G17A 5DX8A 1E3JA 1L8LA 1LWNA 3BM5A 2GFIA 3V7YA 3W79A 3PUWA 5EQDA 1GTVA 1NPYA 2CVPA 4OCZA 1BVRA 5DEOA 2HXYA 2Z1MA 5LMZA 5CRIA 3E5RA 3R7DA 2A5JA 1AGYA 3AO0B 1A8HA 4XLZA 4R7GA 4BNLA 2ANCA 3OOJA 2PUTA 3PI7A 3WGKA 1QIIA 3RAEC 2CXNA 4HXYA 1RBMA 1WXIA 1YQ9A 1M75A 3AUSA 2LVBA 2QQFA 4PE5B 2QNRA 4B32A 4BJ5A 2HTFA 3OU7A 2R8YA 3OZRA 1Z06A 2AYYA 4OGGA 3TH5A 3OPYA 4Q48A 4OQEA 2HX1A 5BSWA 3EODA 3F5QA 4IUCS 2KM1A 1UEJA 3SP1A 3VPHA 3UO8B 2Q6LA 5FCDA 3LC1O 3UAWA 2RI1A 3I01M 4AL4A 3EMVA 2GPAA 3UXMA 1HNZB 4AS1A 5FR2A 1GTSA 2WR8A 3C5CA 3EWSA 2IA5A 3BK1A 1S9DA 3HYCA 3EXHB 4RKRA 1XEFA 4A8PA 3JAMA 5IAEA 3O1JC 3VDRA 3B13B 4L4YA 3BBPA 4FBLA 4MKGA 4XWTA 3EVTA 3P2OA 4EG0A 5A4FS 3ZV6A 3LX6A 2MSLA 1JR4A 2X8JA 2RC5A 2XB8A 5DGTA 3JQRA 4XR9A 3ZWMA 4Q47A 4NCXA 2EGHA 5CEFA 4UMEA 1AZSC 1DQNA 3GP3A 4L5IA 5ADUS 4KFSA 4V03A 1P5ZB 2ZT6A 4FKZA 4N3GA 5IDWA 1GTMA 4QPDA 3G85A 4Z0PA 5FAKA 1L7OA 4H1VA 4JI7B 1J33A 3H9UA 1ORDA 2GN8A 3L92A 4HWOA 4PO9A 5F1PA 2K7ZA 3RVSA 2O8EB 2RH8A 3WJ7A 4RCYA 4O4HA 4YHHB 3RADC 2ACKA 4INOA 1KK3A 1R88A 3HEAA 4BUJA 4LA4A 4LVOA 1DTWB 1SOMA 3FRIA 4GX5A 4UFNA 3TF5A 2A0FA 3TTUA 1VJTA 3U1BA 1GG9A 4F38A 3ZGOA 3KQOA 3SJBA 3KLNA 2UUBB 3A32A 2EEPA 3A1FA 1NASA 2XUJA 2CSXA 1QRDA 3MD0A 5JYCA 3GJ6A 5B6JA 2V6MA 3CWZA 2CLHB 1JSLA 1AN0A 1AQJA 3MWEB 4GP7A 3RS8A 2R62A 2IYWA 2PKYX 2TS1A 4M53A 4UNQA 1JVSA 5HFJA 1SO8A 1GD1O 1KSHA 5SY9A 1OZGA 4HMQA 1GRNA 4UUAA 1E89A 1MX1A 1UR5A 2IZZA 3K9GA 1PQPA 4LCJA 5DWDA 4EFNA 3CVYA 2CSUA 3V00A 2VDVE 3IIEA 5L7YA 2HO4A 5CLQA 1R6AA 1P9LA 1OT3A 2PL9A 1QKKA 4EF6A 1DEAA 2WSSD 1YC2A 2FZ4A 5D8DA 3FCXA 3PK0A 3SR4A 4OBEA 1FUUA 3MIZA 5JO9A 1V16B 5LVAA 2GPTA 2HQBA 4YAJA 3LC7O 2L82A 4AUEA 1ULBA 3ROTA 3E1SA 3WNVA 4EJ0A 4LF7B 5KOHA 1K7EB 2QPOA 3KLPX 1RI1A 2FW7A 3FFAA 3DO5A 2HWXA 1SCIA 2PCLA 5LD2C 3R5TA 2Q3EA 4RZHA 3DC2A 4MV0A 5KEIA 1BHQ1 1H6CA 4MDFA 2HDHA 4M0CA 4D8UA 1IK4A 4DR1B 1UK6A 3L6BA 4UHHA 1A04A 3AR3A 4P1ZA 4RL6A 3H2BA 1NQUA 4V3BA 2VDPB 1L2TA 2J0EA 4Y0VA 5FBWB 5FOWA 2Q4OA 3D59A 3A4VA 2A86A 1NW4A 5IZCC 3BRWD 2BEWB 3PIIA 3EEBA 4WV3A 2O5VA 1JFFA 4B3JA 1Z9BA 1XNQB 2MJLA 1B6RA 2VHWA 3NIGB 5KO2A 4Q7EA 4TLDA 3SR0A 4Q0MA 1CF2O 4PPYA 1NBMD 4NMWA 2I2FA 1DV2A 1XTQA 5CLGA 1QE3A 3J80A 3KSMA 1LC3A 2UZAA 2O3TA 3LM8A 4HDMA 3N0XA 2YY6A 1DL5A 3VSAA 3I5AA 2XUHA 1JE1A 3G9XA 3W8FA 3VAZA 1S2NA 4U1RA 4LRXA 5JAIA 4GYKA 2BRUA 4MGKR 3TTYA 4XWKA 4ZARA 4GR4A 4OHCA 4QBKA 3HH8A 3LO8A 3R0ZA 5DYGA 1ADGA 3J81k 5YASA 3V97A 3GUUA 3CURA 1WEKA 2R44A 4RBNA 4XI9A 3ZWXA 3W2GA 3LT5A 9ABPA 3ERCA 3IS3A 3FMGA 4X71A 5T67A 4QLOA 2WNSA 3GGJA 4ZHQA 3FRHA 3C4VA 4ALNA 1ZM7A 2Y27A 2PMKA 3EVBA 1NBWB 4KGVA 1OHHD 4XGIA 3DV0A 4D1YA 3OJ0A 4FGJA 3UCEA 3UW1A 4D3YA 2VWQA 3I34X 4QU8A 4URZR 1Z29A 2Y1FA 4FYVA 4YMIA 1J0EA 2P2ZA 4QHSA 3R09A 2OCYC 5FPKA 4G1MB 1WUIS 1RWPA 2OCDA 4I8DA 4U6SA 3WS7A 4RADA 3QKSB 1L4KA 2DHDA 4CIAA 3G9QA 3U56A 4RIHA 2E21A 5LZ8A 5AVRA 1GCAA 1FJGB 5DI9A 5B30A 1FE8A 1YXMA 2OYSA 2JRCA 4HNAB 4II3A 3D2CA 4YQEA 4MGEA 10MHA 4DMHA 1ZR2A 1YR1A 2W4IA 4U7JA 3STXA 4JGIA 3E03A 3ZU6A 4OBXA 4XWWA 4Y2QA 4WY2A 3TNLA 3QRWA 5DEIA 2AOUB 2GOYA 3DYIA 4HDKA 4JMLA 1U81A 1T0HB 4YT8A 1NDHA 4E30A 4IZ6A 3C6MA 2JFQA 1W5SA 3KVYA 5FUQA 2XUZA 1ZISA 5BYAA 4L28A 1BYUA 5LA6B 1JB1A 4GBGA 1LF5A 4QELA 1LD3A 3H9GA 2PKQP 4IWNA 2X2OA 1T2AA 3AV3A 3C15C 5IMSA 3KQYA 1JDUA 1T3LA 1GL3A 4FVTA 3I8OA 3L77A 4L5AA 5HM8A 1DLIA 1E1CA 1KVUA 1YK0A 5THXA 2P9HA 2I7XA 3D6FA 1FDTA 5H9WA 5K2OA 1GQFA 3RIGA 3SDSA 2X7JA 1MTZA 1RBZA 5KJFA 1NP7A 3N3BC 1HMPA 4JQOA 4NMLA 1XDSA 4XQ9A 4X65B 3BTOA 1FRQA 3KS9A 5K4HA 4AVYA 2HRCA 1E5XA 1KO1A 4IHKA 4KQIA 2ZYGA 4CM4B 3O31A 4R2LA 4YA6A 4GKAA 5AM4A 4B4KA 1JVNA 4NU0A 2EARA 4N3NA 3OESA 4N0PA 1DS6A 3IR7A 4M1TA 1OLUA 3ND6A 2VAMA 3U0BA 1NVDA 1T5SA 3GUCA 5L53A 3RBZA 1DC3A 3GROA 1GFWA 4WGGA 2QQ5A 3OT1A 1ZJYA 3B1WA 3ZJ5A 4AWAA 1FSGA 1SY7A 2A30A 2DQSA 2J9ZB 2IYAA 4NOMA 3X1YA 3THWA 3EYWA 7MDHA 2LRHA 2UZIR 1M34A 4OMDA 2VDNB 4ISBA 3JQQA 3BB3A 2AN5A 1PFYA 1H0SA 1V5GA 3TAHA 1QG0A 3F3KA 4KQGA 3G8YA 1S6YA 5IULC 3A2KA 3CLUD 4FI3F 4TTPA 3ICQB 4Z7NB 3WXMA 4ZMBA 1MGOA 4DMMA 2FMUA 2NO6A 4RYDA 1PJCA 4U2FA 5TDHA 3M6FA 4ER3A 2BAGA 2FN9A 5LSAA 1F3LA 2PZKA 3UB2A 6GPBA 2FWNA 4HGOA 2LR0A 4HAOA 4BV2A 2I9PA 2ZR8A 1I3CA 1J0DA 2GPSA 1OI7A 3LI2A 3IELA 4AO8A 1N6LA 3M1IA 4RMJA 2OYCA 3BL8A 4D4LA 4LHZA 5EC8A 3AF1A 2NVUB 3HDVA 9LDTA 2X40A 5G40A 2V6BA 1GVNB 3M1YA 1WVGA 1WU7A 1XYGA 1J2EA 1UPTA 4DPMA 1GITA 2VK1A 2YVAA 2DBVO 1NAIA 1Z73A 3SEZA 1BA2A 2L18A 2Q2QA 5E1BA 4YCLA 2L17A 1Q91A 4L72A 2Y67A 1LSSA 1OE0A 1MB4A 1VRVA 4FLFA 4HAZA 1T6ZA 4LXUA 4N5DA 5E7QA 3T4XA 3TVYA 3ZWNA 4B48A 4BAUA 3HFJA 4R2JA 4RKWA 4WASA 4WT7A 5AKLA 5B1SA 1SHUX 1T5LA 2YOGA 5FWXB 3ZWDA 1NFRA 1G0NA 1TCUA 3WGNA 4EGSA 1BYIA 3FNQA 1DAGA 2I6GA 2IY7A 2JA2A 3DMRA 4KXYA 5EWLA 2X19A 4AMYA 4FUQA 1FSSA 2NYRA 2TMKA 3I2FA 3IRUA 3SS9X 1UBMS 3LYLA 1GTL1 3KIPA 1Z7BA 4ND1A 3ZY3A 4EUKA 5A9SA 4EQ6B 1G21A 3K1ZA 1ULSA 2ZVDA 4LF9B 4Z1MA 2P9FA 5HEKA 4MICA 1WB6A 1D2NA 4M0UA 1Z17A 2Z5FA 1NG1A 1U2SA 3CWQA 4Z2YA 1IJBA 3AKCA 4NJEB 3LXRA 2WABA 3LWBA 3PQ7A 3WLIA 1P7PA 1WJGA 4GC9A 2ZRFA 1I4OA 2JI4A 3ZPXA 2R00C 1ZA2A 1SD5A 2DLDA 4KCGA 2YJ5A 2XPCA 2BW0A 4FPXA 2ZE7A 4CIWA 1AKTA 4V0SA 2V7UA 1FSPA 1LKZA 2R60A 2H2GA 1IBMB 4O4JB 4YCBA 5G3YA 1EA7A 2R3SA 3I4LA 2R2GA 1NKSA 2IUFA 2IXEA 3C3CA 5IJZA 5CEEA 2ZZMA 2F43A 3GVHA 3S2YA 1CQJB 1W0KA 3E22A 1Z8NA 4WD3A 2NACA 1PR9A 2VZLA 1YDEA 3BWDD 4WOJA 4WZBB 1N57A 2W6ID 4YMWA 4BRUA 2C20A 3D4BA 4PGFA 1H9BA 5JVDB 1OB2A 1RD4A 4OGWA 5FUBA 4F72A 3FTPA 3K9QO 3L8MA 5FADA 1TEHA 4Q3CA 1KDRA 2ZR9A 3WIVA 2FWBA 2C3YA 3G17A 3VSEA 2JBAA 1HI9A 1Q14A 3MS4A 4XQEA 4B4WA 1ZUHA 2G76A 4XB1A 1RJFA 2ZTMA 1L7RA 2YZ7A 5D5QA 5C1BA 3THSA 1A8UA 1FFHA