3WIOA

Crystal structure of osd14 in complex with hydroxy d-ring
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
265
structure length
265
Chain Sequence
AKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of strigolactone perception by DWARF14
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
molecule keywords Probable strigolactone esterase D14
total genus 85
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wioA00
1K8QA 4UHHA 5D3ZA 5ALRA 2W22A 2WTMA 1H2XA 1EA5A 2HA4A 2DHEA 4QDUA 4BZWA 5AKYA 1TKRA 2QXTA 1JJFA 5AI9A 1BCRA 2VJDA 1XLWA 4EUSA 4WFIA 5AK4A 3QMVA 4ZI5A 1ZICA 4I19A 3E1GA 5AJHA 4JYPA 1BCSA 2RI6A 2ZSIA 2PSEA 5CTAA 1FFEA 1MAHA 4H7FA 5AM3A 5AKHA 3FBWA 1UKBA 5DTJA 2JGJA 3H2GA 5SYMA 1EDBA 2C0QA 1J07A 2GZSA 4K6GA 3WKEA 4H7KA 5JAUA 5AK5A 2HU5A 1XRQA 1MX5A 1JU3A 1SOMA 3H2JA 4BAGA 3F97A 3OM8A 4HVTA 5AIBA 3O4HA 3P2MA 3AINA 5E4JA 5CT9A 4G4IA 4N5IX 2Y2VA 3L1IA 4Y2UA 4X6YA 4DNFA 3K6KA 3B5EA 4XVCA 1UOPA 2WIKA 1TCAA 4PW0A 4X7BA 5AK3A 4C89A 4WDRA 2ZJFA 1T2NA 2OGZA 4UHDA 4MQMA 5BOVA 4B6GA 1X70A 4H77A 3V1MA 4HXFB 3V48A 1AKNA 4J0HA 4DMKA 5DYWA 1AZWA 1HPLA 5CW2A 1F0PA 2XQFA 4QDOA 4KE8A 4BE9A 4IH1A 4QLAA 1N5MA 3PF9A 4DSAA 1DWOA 1ACJA 3QH4A 2VQ6A 3FYTA 2ZVDA 5JASA 1H2YA 4ZWNA 3R40A 1KEZA 4BVKA 2QM0A 4HRXA 1GXSA 4HXGA 1IUPA 2V96A 5AKGA 3OC0A 4J0GA 5CT6A 1CRLA 2DQZA 1CUDA 2XDWA 1U8EA 3WIBA 3VDXA 3FSGA 1XZBA 4H7HA 5ESRA 1E8MA 2WHPB 3EQ7A 4OUKX 2DCMA 3YASA 1YS1X 4B9AA 1QE3A 2J4FA 1BS9A 5E4TA 4BTVA 1MX9A 1GQRA 4RPCA 1CEXA 4GI1A 1WB6A 4ITVA 4P92A 1HDEA 1VKHA 1QFSA 4Y2XA 1GPNA 2ORYA 2XMCA 3HABA 4MXDA 3KSRA 1MAAA 4A16A 5HQ3A 4J0KA 1ZI9A 4OYYA 3N0TA 4S0XA 2PPLA 5LKRA 4OYLA 1KU0A 3G0CA 2GBIA 2CMFA 4KRXA 4IO0A 4OU5A 1U65A 4B83A 2I3ZA 1XRRA 1R4ZA 2HA5A 1LZKA 1VE7A 4Y2JA 4UBKA 4NS4A 3QPAA 5DTIA 1BEZA 2ZJ7A 1G4HA 3R3ZA 1H22A 3MGAA 5AOBA 2WKWA 1X2EA 3M83A 5JD5A 2OAGA 1AURA 2JGEA 5K3EA 5CRIA 4FKBA 5SYNA 3WI7A 1MJ5A 1CUXA 4Y2QA 5LZ5A 1QIMA 3STWA 3FNBA 1XZHA 3WWOA 2EEPA 4P9NA 3R0VA 3V1KA 4CG3A 2J3DA 2WG0A 2XUAA 2HRQA 2Y2UA 3DL4A 2XI4A 1H2ZA 3BL8A 4HS9A 1ACLA 1TAHA 3G8YA 4OSEA 2YYSA 3G9ZA 3S8YA 5EI5A 4X6XA 1CUHA 2JGMA 4Y2PA 3LS2A 1QO9A 3FSGD 3HACA 4J0IA 2FJPA 4W9RA 4L3WA 1R3DA 1QTIA 1T4MA 1CUAA 2OLEA 1JMKC 3WL7A 3H19A 4AZ3A 4LKOA 4A23A 4BE4A 5K3BA 3STXA 5CH8A 3V9AA 4I3FA 5I7UA 2PX6A 1E5TA 5FUMA 3ESBA 4PSDA 1R9MA 4WY8A 4E15A 1VE6A 2OQIA 3TGLA 3HZOA 1QJ4A 2JIDA 4Y2SA 2G4LA 5T4FA 1ZI8A 4U2BA 4QDZA 4PV7A 3KOOA 4X3CA 4C01A 1JMYA 1L7QA 1XQXA 1ZIXA 4FDMA 2WJ4A 3PDCA 1HLGA 2O2GA 5FRDA 1RP1A 3C6BA 5BWBA 3FLBA 1ZI6A 5C7YA 5CURA 3AZPA 1GPKA 4GBGA 4GWLA 1C7IA 2WTNA 4BTLA 3LLCA 4ROTA 4Q3LA 2B4KA 3O4IA 3QITA 3IB3A 1EK1A 2GBGA 1WPRA 3W05A 2Y6VA 3G9XA 3STTA 1W52X 1C4XA 4MYDA 1WB4A 5ALTA 4AB1A 5DLPA 3WKDA 4PSCA 4JH0A 2IX9A 1EHYA 1AX9A 3EBLA 4AX4A 1G66A 2QKYA 3G0DA 5T4EA 4UFNA 5IVIA 4G8CA 2RHWA 4DMHA 3QMWA 4F5ZA 3H2KA 4J0CA 4B80A 4B81A 1DQZA 3A2NA 4GECA 1ZD4A 1EDDA 4LXIA 3E3AA 5HF8A 2ACKA 3ZLUA 2XLBA 2O2HA 2XUHA 3G7NA 5ALUA 4H7EA 2JBWA 3QPCA 2PSFA 1CLEA 1FFAA 1YAJA 4TPKA 3F67A 3KD2A 3WA6A 3C6ZA 3NUZA 1ZJ5A 5C8VA 2VAVA 2EDCA 2X76A 3IULA 3FLAA 5JALA 4CCYB 4G8BA 2C7BA 4AQDA 2QUAA 1EDEA 1XZIA 4F0JA 1EVEA 4XX1A 4UBMA 3R3WA 4Y9SA 2D5LA 4PQEA 4F21A 4XIIA 1A8SA 5LP1A 1K6EA 3VJKA 2BKLA 4DTCA 4ZGBA 5DJ5A 2WUFA 1UT6A 3RK4A 2WIDA 5AO9A 3WK8A 4EY4A 1JFRA 4QWMA 5AM5A 4YX9A 1X2BA 4MEBA 3DQZA 2X5XA 4L0CA 4AXBA 5D7BA 1GKLA 4C88A 5JANA 3H1AA 4P93A 3DD5A 3LCRA 3CCBA 3GZJA 1RYYA 4JYMA 3WJ2A 5BWCA 4KAAA 1IUOA 4CCYA 1LBSA 1B41A 1UKCA 1Q0RA 5AI4A 1O6GA 4PNZA 3ED1A 3HC7A 4KE9A 1DT3A 4W63A 2PM8A 2E3JA 4I4CA 3U0VA 1F0NA 4UPDA 3WK6A 1Y37A 5ALJA 2WLSA 3EQ9A 2XE4A 5AIAA 2QJWA 2WSLA 4BB0A 4DM7A 1CUEA 1CFJA 4BC0A 1LPAB 4UFOA 3FYUC 1XQVA 1CUGA 1XQYA 1E8DA 2VT6A 2OQVA 1C7JA 5ALPA 3QBJA 1GPLA 4EY6A 2OG1A 4BCDA 2WIGA 3IIIA 4IHAA 4YPVA 2CEKA 3WQHA 3KWFA 4UBNA 3BIXA 3DYIA 5JADA 4FBLA 5AI6A 5ALSA 1R50A 4IH4A 5K5EA 3G0IA 2O7RA 2GBFA 4FBMA 2XUOA 4LHEA 4B84A 3KXPA 3JW8A 1HKHA 2FJ0A 1YSCA 3NOXA 5ALIA 1VJ5A 5ISMA 1Q83A 2WHQA 4MWTA 2XQIA 2WFMA 1ZGBA 1OILA 1H23A 3F8SA 3VISA 3C5VA 5IVKA 1VZ2A 1DTEA 2WUGA 1TRHA 4BP8A 3HLKA 1LBTA 1ZD5A 4MWSA 5EIAA 3HYSA 2P8SA 3FWHA 4NMWA 5JYCA 1IVYA 4X95A 3W9BA 3W04A 3GELA 5ALKA 1MO2A 3A6ZA 4KRYA 2JGLA 1UXOA 1UOQA 4KE6A 4KAFA 4H18A 3G0BA 5AICA 4MEAA 3QZUA 3T4UA 4KR0A 1CUIA 3RLIA 4X92A 3H17A 5JZBA 2JGFA 5EFZA 3BXPA 4GXNA 1A7UA 1P0PA 1TCBA 3C45A 5AKLA 3R3VA 4U2CA 4C4ZA 3AIOA 2BAGA 1DWPA 2PUJA 3WWEA 1JKMA 3O4JA 5E4YA 4G9GA 1VOTA 1WM1A 3TJMA 5ALHA 5K3FA 5C8XA 5CT8A 3H1BA 1OXMA 3QYJA 5ALDA 2XMSA 3ESAA 1QIIA 5JZ9A 4CCWA 5LZ8A 2DHDA 1W6RA 3TRDA 2VA9A 5T4BA 3A2LA 3WKCA 4JUIA 1W75A 1USWA 3WLAA 2WM2A 4ARBA 6YASA 1FSSA 2C58A 1G5FA 1WPXA 4YASA 2VJBA 1M33A 3EQ8A 3FCYA 5LZ2A 3DL7A 4EBBA 4U2GA 1XZLA 3IA2A 1UOOA 4K6KA 2ROQA 5EHXA 3E0XA 5FV4A 3KWJA 4X90A 3PE6A 2JEZA 2OCLA 3K9BA 4BZZA 1P0QA 4CIBA 1SFRA 4NZZA 3CN7A 3BF8A 4WDQA 1N8SA 1CUBA 1E3QA 2RGUA 4Q05A 5LIPA 1BU8A 3PF8A 5C81A 3BDIA 1DX6A 3LP5A 5EIEA 4Q3OA 4GEGA 4FMPA 3ICWA 2DFPA 3IUMA 4OCZA 4HTAA 1FFDA 4BC1A 5AKKA 4DYHA 1QIHA 3V1NA 2BUAA 3FAKA 2HHAA 4ZREA 1LPOA 1J2EA 1QIEA 4X97A 1TQHA 3Q0TA 4LIPD 4G1FA 1YS2X 2HDWA 5AKZA 4B82A 1DWQA 3I28A 3WIOA 3D3NA 1NU6A 3H0CA 4BRZA 3X3HA 5I8PA 4ZRDA 3M3DA 4UHCA 1VZ3A 1PV1A 4BDTA 4KAJA 3GUUA 2J4CA 1ODTC 2QTBA 2H7CA 5DYTA 3D59A 1JT2A 4OB8A 1XRMA 1UZAA 1Q84A 4QLOA 2R8BA 5D6OA 4AZ0A 1QIFA 5DNWA 3U1TA 5CH3A 5ALEA 3ZV7A 3FVTA 1YA4A 3O9MA 1GQSA 4H0CA 2EDAA 2XMBA 5FPPA 3HSSA 2VF2A 3M82A 3A2MA 1VA5A 1THGA 1Y7IA 3QMMA 2C5GA 4DIUA 1SC9A 1XLUA 3D5EA 3STVA 4G4JA 2XMQA 1ZOIA 4B9EA 3O9VA 2B61A 1BROA 3PFBA 3OOSA 4GHWA 3AUKA 3IUQA 1SCQA 4Q1VA 3D2CA 3PUHA 5ALNA 2WU3A 4QZVA 3DEAA 3GBSA 3HI4A 3H2IA 5AH0A 2WILA 3ICVA 1UK6A 3I2JA 1CUZA 4G8DA 4V2IA 3D7RA 3WWPA 2AJBA 3IBTA 4TGLA 1XRLA 3DJYA 4LXGA 1MU0A 1WB5A 1BN7A 4H35A 3GFFA 5ALZA 5HFNA 1OCEA 4UHFA 5A71A 1UKAA 3W9UA 2WFLA 3WZMA 1QIJA 2WIFA 2QVBA 4EY7A 4GDMA 3L1JA 4M0MA 1PFQA 4M0EA 3ZLTA 4B85A 2ZYHA 1TIBA 4X71A 4EZIA 2BFNA 2NW6A 1LGYA 4UBIA 1QOZA 2WFZA 3RKSA 1ZJ4A 3DOHA 4FLFA 2JGIA 4W1SA 2CZQA 1UK8A 5A62A 1QLWA 2HA3A 4X6UA 5YASA 4WFJA 4AO6A 2PL5A 3WL6A 5HZGA 5HF9A 1QIKA 1HQDA 2WG2A 4Z49A 2OGTA 4FNGA 1XZEA 4ZV7A 3BF7A 5AOCA 5ALMA 3SWWA 1BE0A 3O0DA 4IH9A 4LYEA 2HA2A 5CMLA 1QONA 5FOQA 3GA7A 4KACA 5A7HA 3H2HA 3STYA 1CQZA 2VATA 4ZXFA 2I78A 1AQLA 7YASA 2WFLB 3LIIA 3I2FA 2VJCA 2BGNA 4C6HA 2B9VA 4BAZA 1CUSA 1HBJA 1ZGCA 2XQJA 2HL6A 2XUIA 4DNPA 3R3XA 4EB0A 3WK7A 3IUNA 5K3AA 3WA7A 3PUIA 3QPDA 3FCXA 4X85A 4YK7A 3AILA 2WU4A 3NWOA 3PFCA 1FFCA 1BN6A 3F96A 3SC2A 1EI9A 5EGNA 2J3QA 3AZOA 2YASA 3DS8A 4DLNA 2Z8ZA 3BE8A 2HRRA 3BJMA 3HXKA 4B0OA 4BAUA 5HKBA 5JZSA 3FVRA 4EY5A 4PSUA 1UWCA 1IZ8A 1EB9A 2LIPA 3RARA 3C70A 3HJUA 1XZGA 3T52A 1YAHA 3B12A 4IQ4A 4Q82A 3ZPXA 2XMRA 4XWGA 2HA7A 3L1HA 5AHXA 2XQGA 2HFKA 4KYVA 4UHBA 1JJIA 4B0PA 4CG2A 3W2TA 3FYUB 3BIWA 1K63A 2IIVA 3PICA 3IURA 4QWWA 4A5SA 4GW3A 4NVRA 4W1PA 2VTVA 4K5QA 1LPPA 2O2IA 2Y1KA 5AK6A 3WYNA 2WG1A 2HIHA 4ZV9A 3HEAA 1QTRA 1DINA 4PF1A 1K4YA 1XROA 1E8NA 2Z3ZA 2K2QB 2HU7A 5AI5A 5FLKA 3VVMA 5ALXA 4Q3KA 4OD0A 3DDUA 3I2IA 2WUDA 1TK3A 4P08A 1I6WA 5CXUA 3B3QA 1A8UA 4INZA 3QM1A 2QUBA 1MNAA 1AGYA 4HRYA 1CUVA 1AC5A 3EF3A 5HCUA 5FDFA 2X8BA 3OURA 5EIHA 2XUJA 5K3CA 3WK5A 1GT6A 4QDXA 3AFIA 3CXUA 4RGYA 5A7FA 2VEOA 1P0IA 1VLQA 2BJHA 4FLEA 1CUFA 2GYUA 3C6XA 2H7XA 3QVMA 1EXWA 4N8SA 2PBLA 2QR5A 1YA8A 1XZKA 4HZGA 2VSQA 2V9ZA 4LYDA 2XLCA 4Y2VA 2D0DA 5F4ZA 4AO7A 1L7RA 1SCIA 5LYYA 5T4HA 2CB9A 1NX9A 4BRSA 4MJ3A 3VKFA 5DNVA 5JAHA 5AKEA 4QDTA 2WIJA 3C43A 2CKMA 1ODSA 1A8QA 5AM0A 3ESDA 2RHTA 4UUQA 1LLFA 1S8OA 3R41A 3BJRA 2XT0A 2C0PA 1DQYA 3WKAA 1CUWA 4L9AA 5DWDA 2WJ6A 3SK0A 4UHEA 5AM1A 4E14A 3ZI7A 4BDSA 4LXHA 5CBKA 5IKXA 1MTZA 5FP0A 2ECFA 1J1IA 3I2KA 4BCBA 2Z5GA 1CUJA 1QIGA 2QRUA 5HQ3B 1FFBA 3JYHA 4WCVA 1CUUA 1MPXA 2HFJA 5KBYA 1VXOA 2ZYRA 2PKYX 3FOBA 2WHRA 2Y6UA 3GROA 1IUNA 2PU7A 3BWXA 2I3DA 2XUFA 4N8DA 2PVSA 2RIPA 5AKJA 1P0MA 5IH7A 5JATA 1U4NA 5EHNA 2O7VA 2VJAA 1CIJA 2DQYA 4BCCA 5JD4A 4AMYA 4B7ZA 4DSZA 2QS9A 3CN9A 2VT7A 4UBJA 1R1DA 2FX5A 4QEKA 2C5FA 1XZAA 4W1RA 1ORWA 3D2AA 1AUOA 3IVMA 1ISPA 1DU4A 1EH5A 4EY8A 5C8ZA 1QFMA 4AN1A 3E4DA 4RE5A 3WL5A 1W1IA 4FFVA 4DMFA 2AJLI 4C4YA 3KDAA 2DSNA 2B20A 1JJBA 4UBOA 1PJAA 3I1IA 5HKAA 2W6CX 4CI9A 2H7YA 1YASA 1QO7A 4BBZA 1IZ7A 3D4LA 1YR2A 3V1LA 3WMRA 4H7DA 5ALFA 4Y2RA 4J7AA 4JNCA 5ALVA 1YB6A 1XZJA 1W4LA 2XMDA 1THTA 3DNMA 3OG9A 2BUCA 1LPMA 3IDAA 2OAEA 1D07A 2Z8XA 1N1MA 3DLTA 1ZIYA 2CBGA 1B6GA 1Q0ZA 1GGVA 3WWCA 4DGQA 1E66A 5I9IA 1MX1A 1UK7A 5ALGA 3I1YA 2WUEA 3ZWQA 3G02A 2DR0A 1WHTA 2QOEA 1LZLA 4RNCA 4X91A 4BVJA 2OPHA 4D9JA 2G5TA 5FPQA 4E46A 1R88A 1LPNA 2VAXA 4AN0A 5ALOA 1XKLA 1GZ7A 2BGRA 4M0FA 2JGKA 2WQZA 2GYWA 1JU4A 3DKRA 2QZPA 1G42A 1XLVA 4Q34A 4OB6A 1FJ2A 2ZYSA 4UBLA 5LKAA 3DYVA 5BV7A 5JIBA 4BVLA 5A2GA 1QIDA 1R9NA 4KJXA 4G4GA 3AIMA 3R3UA 2PSJA 5KWIA 5KWJA 2AJ8A 3O4GA 1XZCA 4JEIA 5A6VA 3I6MA 2XB6A 4FFWA 1LNSA 5EHZA 4BYMA 3R3YA 1ZD3A 1XZDA 2V98A 3I6YA 3I6ZA 3N2ZB 1EX9A 5LLSA 1XRPA 2QMQA 3SX4A 5LZ7A 5HF5A 2CUTA 2RAUA 3UMJA 4CIAA 2WJ3A 5HF6A 3JWEA 4EHBA 1NU8A 3F98A 1XFDA 1MT3A 3VXKA 2CJPA 4FOLA 3AZQA 1VXRA 5AKXA 1VA4A 2C4HA 3C8HA 4J0DA 4DMCA 2JEYA 4FWBA 4GLBA 4MQLA 5K3DA 1F6WA 1O6FA 2Z3WA 3Q8WA 1L7AA 3IUJA 1XZFA 5AM4A 2PSHA 3FLEA 1GKKA 4TVKA 3ESCA 5ALLA 5HK8A 2HA6A 3STUA 5JAPA 4UFPA 4G9EA 5AP9A 3K2IA 1DT5A 5ALQA 1WOMA 3H18A 3WKBA 3PI6A 3MUOA 3A70A 4X93A 3WK9A 2GZRA 4ETWA 1ODCA 2H1IA 3UUEA 4QE3A 2OGSA 5JAOA 2PU5A 1UK9A 2XMGA 3ZLVA 1CPYA 5CXXA 4WFKA 1F8UA 2XUDA 2I03A 4O08A 1WCYA 1XQWA 3DKKA 2ZJ6A 2FUKA 4WY5A 2QXUA 5ALYA 3H04A 5EHQA 4KEAA 4KE7A 4U2EA 2XUGA 4K2AA 2HA0A 5IVDA 3DCNA 3I2HA 3TEJA 1EB8A 1UFOA 1BEEA 3DOIA 3WZLA 5CT5A 4PO3X 4HAIA 1W76A 4N8EA 5J3JA 4AO8A 1ETHA 3OPMA 2Q0XA 4C87A 2ACEA 3M81A 1XRNA 5DYYA 4E11A 5H3HA 3RM3A 2PUHA 1SCKA 1CVLA 2OCGA 5LZ4A 1DX4A 1A88A 1MN6A 2DHCA 3WJ1A 4N5HX 2BUBA 1JI3A 1ORVA 3WK4A 2OCKA 1Y7HA 4WJLA 5CT4A 3VVLA 1CV2A 2ZSHA 1XZMA 2G5PA 2HADA 4BATA 3BDVA 1MNQA 3MVEA 4H7IA 1YCDA 5FKJA 3G9TA 3G9UA 2ZYIA 4G5XA 3WL8A 5IVHA 3D2BA 1BRTA 4OB7A 3D0KA 4OPMA 1EK2A 1CUYA 2G63A 4EA6A 2BCEA 2ONCA 2WHPA 4Y2YA 1EINA 4H7JA 1LPBB 4J03A 4Y2TA 2PSDA 1U2EA 2HM7A 3ANSA 3VJMA 2QT9A 2XQKA 4BP9A 1Z68A 1E89A 3F9CA 4XJVA 2OXEA 2GBCA 4L72A 1CQWA 5HFAA 3C5WP 2HU8A 2IITA 1CR6A 4FTWA 4FLMA 4C4XA 4K6HA 1YB7A 2YXPX 1LPSA 3AIKA 5AKIA 1KU6A 1QZ3A 2AJDA 3C87A 1QGED 3G0GA 2XUKA 2R11A 1CUCA 2JF0A 5AI0A 1HL7A 2QJRA 3LIPA 4X00A 4DNQA 4QA9A 1ZD2P 5AOAA 1EVQA 2ES4A 2AJCA 2V97A 4ARAA 4DNOA 5KREA 3S2ZA 4HXEB 4CG1A 3ILSA 3CCCA 3VJLA 5E2IA 5JARA 1H2WA 4FNMA 4MYSA 4OU4A 3OTQA 3MUNA 1N5RA 2RONA 5JD6A 1IMJA 4QNNA 1RWQA 2XMZA 4FHZA 5K3FB 3WWDA 5DNUA 4RE6A 2XUPA 2GYVA 2AXEA 3C8DA 3NGMA 5ALWA 3ANTA 3HRHA 4J0JA 3W06A 3FYUA 1TCCA 5LZ9A 2YH2A 4X94A 1AMNA 1K5PA 5A7GA 5AI8A 5AM2A 3EIOA 3C6YA 4CFSA 4W1QA 4U2FA 1J06A 3I2GA 4AMZA 3WYDA 4U2DA 4F60A 2OCIA 4Y7DA 3O95A 1XKTA 1WHSA 5FXMA 5HK9A 2XUQA 3AJAA 3UUFA 5D3KA 2H9YA 2UZ0A 5CH5A 4J3JA
chains in the Genus database with same CATH superfamily
1CY2A 1W0KA 1QX4A 3OKPA 4BFZA 3HN6A 4BKRA 4H60A 1JALA 4DIFA 3ZIAA 2XUZA 3KJEA 4EEKA 1T3ZA 2QRPA 4Q4AA 4GYWA 4ER0A 1VPWA 1KO1A 5ADUS 1K5GA 3REQB 4OGKA 3H0KA 2VTKA 4IOKA 4B6JA 1ISFA 3C3YA 1Q0UA 3ST7A 3RTCA 2G4VA 2H31A 1TYCA 2BW0A 3BTVA 2XVZA 5KOJA 2NIPA 4J16C 2X3UA 2DHEA 4ZO6A 3SMVA 1SUIA 1Y7PA 4IZOA 2A5FA 4AZSA 1GV1A 3T7DA 1XV5A 2ZT5A 4BZWA 3L93A 3K35A 2PG3A 5HJ7A 3DFZA 5KJEA 4CF7A 1UEJA 1ECPA 2A0FA 2AIRA 1XLWA 2JFHA 5DKFA 2LIVA 2QNRA 4LYFA 4HJRA 5IH3A 4ER3A 4HXYA 1OD6A 2X5NA 3OO0A 1M6YA 3PDIA 1LF5A 2HT1A 5IRCD 4ZI5A 4U6NA 1NP6A 2H6EA 2HYDA 5EZ6B 2IYZA 1GZVA 3MG9A 2OGUA 1C1DB 4NBUA 1QM5A 2QQ5A 2F4NA 2FUNB 3RYIB 2P1ZA 3QY9A 4ZOQI 3MS7A 4JYPA 2YMQA 1BCSA 2HPVA 3HPQA 2Y1OA 4Z0PA 3FJYA 1QPBA 1UPXA 1IRIA 1I0ZA 2INGX 2JI8A 4H7FA 3OUUA 4HDAA 1PW7A 4KO3S 5DGXA 2MMGA 3FBWA 2VK1A 4OK3A 4JEHA 1LWOA 3THOA 2FR8A 1IULA 2PWYA 3GT3A 3K9HA 4HWOA 4PFSA 4BNMA 4UE2A 4CU5A 4DAOA 2JGJA 5KZMB 4OY3A 5CA0F 1KQOA 2O3QA 3K9CA 4W82A 3VTAA 4JLKA 4YDSA 1LNZA 4IDDA 3UYLA 1I1HA 1QYWA 1W5BA 3K9QO 4HYEA 2A6PA 2YRFA 3IELA 2B82A 2C7PA 4YY3B 2QW0X 3NHLA 4O5OA 4HDCA 3PIDA 3TAUA 1V16B 4WVLA 1TECE 3HJNA 1O89A 3PEWA 2IP4A 1WETA 5BVGB 1I5RA 5K0NA 5KTTA 3K6SA 4QBHA 1I9CA 1T36A 2R44A 2A9RA 4KFRA 2PZKA 1WKVA 1ICIA 2R1TB 1KSJA 3NNDA 4BPRA 1T2CA 1AV7A 2KHZA 4JLSA 3RS8A 3H2JA 3QIAA 4Q48A 2QTVA 4S0ZA 2FZWA 1E3MA 3B60A 1E1QA 2YOGA 4ARZB 3CZPA 4QBIA 1ZMTA 4URUR 1KHTA 3HL0A 4QO8A 3ZXYA 2ZUSA 1KYVA 4ICIA 3P2MA 3TOZA 3O8RA 2WB4A 5H70A 1G8JA 4JT4A 2B8TA 5E4JA 1TYZA 2IYNA 3WIVA 5ARCA 3ZNNA 4CM6A 4G4IA 5M29A 4QPDA 3VAAA 3W5SA 5E1DA 4YMWA 3UCEA 1AG9A 1H8EA 3M6WA 5FYQA 5IM4F 2JA2A 4F1WA 1NLYA 2WWXA 4EQ6A 4DNFA 4IWXA 1SUAA 1WXWA 3O1HB 1CY7A 2WSSD 3U61B 4XVCA 1SZDA 1XNHA 4L5JA 2ATXA 5CG1A 3FHOA 2WIKA 5CVTA 3LKBA 4FYHA 1NURA 5LC1A 1XCMA 2MCFA 4A0RA 2FW6A 2FPMA 2CV1A 3RUDA 1D1QA 1UJNA 2XBLA 1XU9A 5AK3A 3LCCA 5AVWA 4WDRA 5EC8A 1ZUIA 1E2FA 1E2NA 1W1UA 2VF5X 4JITA 1F1BA 2CXHA 4YJDA 4YJ3B 1T8RA 4RFSB 2ZJFA 1T2NA 4I55B 5FOTA 1E4OA 3GZNB 2V4ZA 4UHDA 1P8AA 2PXXA 1NM5A 4PHFA 4HN2A 1D0SA 3PDIB 4LGVA 4P3KA 5ILQA 3R77A 4KRGA 1NBWB 1R6AA 4BMXA 4CODB 4H77A 3P2JA 4RKRA 4Y6PA 1UDAA 1FNBA 4KDEA 3B1KA 3QXXA 3TZCA 4E08A 2XCUA 1YD7A 3P4XA 4BECA 3P94A 3D6AA 1AKNA 3N8DA 1JIKA 3AO0B 3B6JA 4JFRA 4ZALA 1Z56C 3URMA 4BVHA 3F1LA 4IZIA 3HM2A 5DYWA 3OOWA 2E82A 1KAEA 2G0NA 3AG5A 1EQUA 1QQ6A 2J0UB 1XTRA 2OHJA 3E5HA 3OQHA 4NICA 4UNIA 3R8FA 4Q9IA 4DQUA 1P1FA 4RYDA 3VYWA 1P75A 4QDOA 1CP3A 5KOHB 2G6TA 3AR4A 3F5QA 3MINA 3AF1A 3DJFA 1GUBA 1W4RA 2W8ZA 1UBSB 3DBHB 4P4UA 4KI7A 5GVRA 4DSAA 1F2DA 2Y05A 1ACJA 4IXNA 3QH4A 5GM1A 2QLFA 1L1FA 3UB3A 3O26A 1R18A 2VIIA 2BN4A 1P91A 2ZVDA 4RSHA 1F5NA 4GE3A 1KWGA 3E70C 3B5JA 2XWSA 3JAWA 1IN5A 2B5WA 3EMDA 5FTNA 4BVKA 2QM0A 4G0MA 3LT4A 4QXPA 3LY7A 1E4EA 3RFFA 3K5IA 3AR5A 3QY0A 1GSAA 4ZP1A 1E0SA 3HVHA 1YJXA 1RM5A 2E2WA 2PR2A 3ONVA 4KXVA 2WD7A 2DQZA 4MUBA 5DYIA 5C9ZA 2O5RA 2XDWA 4NJOA 2LCQA 3GEEA 1CY6A 1U8EA 3BBPA 2NU9B 4HMPA 4H3KB 3FSGA 4O4LF 1U2DA 1A9RA 4NI5A 5ESRA 8MHTA 4M89A 3NOVA 3NPMA 3GGOA 1YCGA 2HBRA 2P62A 2EP8A 2WHPB 3KJZA 2R6CA 1GCAA 1LI7A 3HGMA 2M1XA 3MJEA 4U7DA 3RC3A 3PWSA 2X9NA 4JELA 1NXPA 2ZUWA 4P3NA 1K7SN 4DLSA 2A8YA 5JCOA 2MSDB 1L4GA 5COBA 1LVUA 5B2ZA 2UZ1A 2I6TA 2FETA 1D8AA 3ETGA 3GX1A 4MHTA 2C82A 1SD2A 2M6SA 1PR4A 1G60A 1P7YA 1VPLA 3DV0A 4ZVSA 1USKA 2IL1A 5J2TB 1RC8A 1JZQA 4RFSA 4WASA 1ZIOA 4DIKA 4J3NA 1BS9A 4LG1A 1Z4KA 4EITA 1TJ4A 2VNHA 3DW1X 5AW2A 1IHYA 1FEZA 2HIAA 3U48A 4K9OA 1XMQB 4JT2A 1BE6A 4C7OA 3NVAA 4RPCA 3BFKA 4RQTA 4POOA 1CEXA 1VFNA 4FE7A 4JOQA 1E1DA 4WQMA 2RBKA 5IULC 3TLBA 3QPVA 2VI5A 1IOLA 1XVVA 1KQPA 2EQBA 2UAGA 3O3NB 1A69A 4M87A 2OBMA 3RJMA 4EGQA 4EI8A 2F3UA 3GLKA 3PIIA 5B55A 3SHQA 2XMCA 4PU0A 1T6BY 2WBLC 4KOAA 2YVAA 3R0QA 4AT1A 1MAAA 3LFTA 3PXGA 2I71A 1DKRA 3NNSA 2DGDA 2FK7A 3C5EA 5DHTA 4A26A 1Y82A 5HZKA 1ZI9A 4ESVA 3UVEA 1TJPB 2X2EA 4G85A 1R7RA 1TZMA 1M2NA 4S0XA 3JARB 4UCFA 2OTCA 4X7MA 4OYLA 5H82A 3W4KA 4F72A 4DUZB 2HMSA 2BSQA 1SCBA 1T8YA 1USGA 3KVNA 1J8MF 2JAQA 3WSVA 2EIXA 3SR3A 5I7WA 2GBIA 4P53A 3AF0A 4R6WA 3SZMA 4MINA 3BMCB 4YDQA 2IDKA 3C41J 3FOWA 2RARA 5AJUA 4H6PA 1XRRA 5J43A 1R4ZA 2GEVA 4NCJA 3UB2A 3VU8A 3R3HA 4N01A 2V6IA 3JQ6A 1PYGA 4LVCA 3G7SA 2AZMA 1NT2A 4I2NA 2YJ4A 4YCLA 4RESA 1ZJ6A 1YE3A 1MDBA 4BUZA 2BI8A 4X8LA 2ZRIA 4JIGA 1E4EB 3QPAA 1XEXA 5DTIA 3OQMA 3COZA 2QTLA 3FPKA 1V43A 3NAZA 5IJ9B 2FPXA 2WF6A 2DY0A 4O6VA 2DXIA 3E53A 2HV8A 5HKKA 1J22A 4R1UA 3P26A 4I50A 4XI9A 3WVNA 5IKMA 3NBXX 1G4HA 4MUHA 1J8QA 3GGGA 1KNXA 3G2MA 2WIAA 3OIUA 3DUFA 3P9SA 1ZSYA 3IE1A 3HO1A 5DZSA 1TB4A 1X2EA 2E4UA 2VNJA 1N2EA 2OAGA 4H15A 4BMZA 5EKDA 1ZSVA 2NM0A 4I2VA 4K0KB 3OCWA 3EIUA 3K15A 3IAM1 1G2OA 3HUDA 4YS6A 1XYGA 1PD1A 2H06A 4OLBA 2IVFA 4FGJA 3OEYA 4F7WA 4QL3A 4H6XA 4WCDA 3BWBA 1VIDA 1GL6A 3BH7A 3PPWA 1J0XO 1RT9A 2JS7A 1ZPDA 4L3VA 1G3QA 4QHTA 2XNCA 2ZJ1A 5K4HA 1WXEA 4ALLA 1NY6A 1QIMA 4NABA 4A2CA 5E3IA 4TYYA 3D8RA 3STWA 4D3SA 3E5MA 3CNBA 5CFRA 1FMFA 2AI2A 1YRYE 4ZMRA 3UM9A 1L5SA 1XKQA 3R4VA 2ZVJA 2HK8A 5CCEA 1ABFA 4TV8F 2BL4A 3NIFB 1KAMA 1N2XA 2VN8A 3UTCA 2FXVA 3HR4A 2W2VA 3UXMA 4YB8A 1ZVVA 2FQQA 2ZRFA 1J97A 2HRQA 3CY6A 3D8SA 3P0RA 1PKXA 5MN4A 3QSGA 1P5JA 5FAXA 3UV7A 2EBWA 3TCKA 3X1KA 4DQLA 3NDBB 1CR1A 1A0OA 1IXSB 1QYVA 1QUEA 1GL7A 2W0SA 5H68A 2F4VB 5K03A 3BL8A 3QFRA 1D2GA 1ACLA 1TAHA 3G8YA 3K0BA 3KJNA 4HK4A 3RE1A 1YRLA 4QOFA 4FFPA 2BSXA 1GGNA 1G3MA 3PYLA 1JDPA 2PT7A 5J2UF 5KNLA 1L5YA 4XYGA 5AD1A 2FPPA 1CJKC 4O4HF 2JGMA 4Y2PA 2R47A 4RZHA 2YZKA 4PS0A 2W7TA 3EVEA 3FH0A 3SSNA 2QSYA 4UEOA 4HG2A 2I76A 4W8GA 2J48A 2FPIA 4QTZA 1O6ZA 1BMQA 1HWYA 1IB6A 1B1CA 3ITEA 3DVAA 2FE1A 4FDLA 3EUAA 3FUCA 1AE1A 4K8OA 3WL7A 3RJZA 1BD4A 1TM3E 1KJWA 1XR3A 4BRUA 3NAQA 4P0PB 5JH7B 1KZ7B 1FK8A 4OM7A 5K3BA 3STXA 1IONA 2QVZX 4U5QA 1KDZA 4JQYA 4YMSA 3UJBA 1H5UA 1Y7TA 4EH1A 5C37A 3DO5A 4RZ2A 5PNTA 3NI2A 4HWKA 5FBVB 1H94A 2PX6A 3KUKA 4OREX 1YWGO 2RB5A 5KTKA 2QX6A 4DLBA 3A0RB 1QQ5A 4DDUA 3SHWA 2R6GA 1L8OA 2GOYA 1R9MA 1Q77A 3K0EA 4PSDA 4WY8A 2A1UA 4BNUA 2HJSA 2J7PD 1U1EA 2VRCA 2XZDA 2ZWMA 3KE9A 4GQAA 3RHFA 3AY3A 3LK7A 4IIFA 3SBXA 2GD1O 4BNFA 3TGLA 5CLQA 1E7WA 5ED4A 5AVKA 1PGNA 1V3TA 1MIOA 3TFWA 4KN9S 2DEUA 3TOVA 3EZXA 3AB3A 2RDMA 3PTLA 2DFTA 4IY1A 3VOTA 2QB5A 3QYFA 4CN8A 2JIDA 4Y2SA 3NEPX 3ZBTA 3VTZA 3WYAA 4PFKA 4DWWA 1WQ1R 1YZLA 4OJYA 2A3RA 5KNBD 3W4JA 2NSHA 4PAGA 1KKMA 1DBIA 4TOIA 2GZ2A 2QLMA 3I6BA 5DYGA 3H05A 2FFRA 4HWSA 2A0UA 2F9FA 1ZIXA 1E9EA 3Q9UA 1O95C 4FDMA 3BDAA 5CVJA 2OVFA 1E1MA 3OVMA 1GKYA 2OY0A 1IUKA 1Y98A 4OOFA 5AQEA 2GD0A 3JASB 1LX6A 3FLBA 4WPGA 3H5RA 3T7JA 4PN3A 3T9CA 5CLJA 1MC5A 1NLZA 1X38A 2JI6A 5EJAA 3S29A 3A9CA 2VDWB 2GDJA 3HCRA 1JA0A 4C0AC 4GBGA 4PYOA 1SCNE 3O82A 4QEZA 1Q0PA 4IUCS 5G3ZA 2PAFA 1PD0A 3L7LA 3QWBA 4BQPA 1V8DA 4RHYA 1VSVA 2AFHA 4BZQA 1RYHA 4KGVA 4BTLA 4ROTA 3GD7A 2DUUA 1CJSA 1FUEA 2PDAA 4FINA 4RABA 1KEUA 3L49A 4XPZA 5AW5A 2P3QA 1ULZA 4G81A 1ZG3A 2JK1A 4KG7A 4JCCA 3EGIA 5KPJA 3PKZA 3AU9A 1DG3A 4UMVA 4LPSA 2Y6VA 2I7XA 2FFJA 4KR6A 3Q10A 2UXCB 3CMMA 3P0HA 3G9XA 4N65A 1K68A 2Q9BA 1R6UA 2ZDQA 4MGEA 5J5VA 2P4QA 3BBLA 4JJFA 1C4XA 3EOAI 3Q6MA 3QFCA 1Y3DE 4MYDA 4I5DA 2I5PO 3T7AA 3QI7A 5DCUA 1PUJA 1KR2A 3A4VA 3CVOA 2PZLA 2REBA 1DCKA 2Q5JA 2UVPA 3WKDA 4OSPA 4JH0A 3MT7A 2IX9A 4WOPA 2OPBA 3JATB 3UMSA 4N40A 1XCLA 2BM8A 3EBLA 4XE5A 1WEKA 2OKCA 4C14A 3G0DA 1DJLA 2C54A 2XKKA 1E2KA 1SOVA 4I4LA 2DUWA 3FNGA 2OYRA 4UFNA 5IVIA 3WB9A 4G8CA 3PXUA 2OBLA 2RHWA 3VU9B 5B30A 3QMWA 5GGYA 2C04A 5FEUA 3DM5A 4HDSB 1O94C 4J0CA 1ZC4A 1FRQA 2E5WA 2BZ1A 3WLSA 4B81A 3ISTA 1H65A 3LL4A 3QA3E 1KORA 5CX4A 4XX0B 1IOWA 3PC7A 1EESA 4B3CA 4DBLC 2JW5A 3U7RA 3JXEA 2RGGA 3AI7A 5A5DA 2R4QA 4PLFA 3P8ZA 5KNDH 2O7SA 1Z0UA 3ZK7A 2RHRA 2IZOA 1RAEA 2C2GA 2O2HA 4CUJA 2F64A 3GUCA 2G9RA 1PQWA 3NBYC 3UMMA 3E7PA 4E03A 4I1IA 1REQA 3TJZA 3UJHA 3QPCA 2AW3A 5EPEA 3PENA 421PA 3ZZMA 4X62B 2PXAA 3E9QA 3U6KA 3L8GA 3W5DA 1SXQA 1JDBC 3DXYA 5EE9A 5KNCH 4P7GA 2D2VA 2IDMA 2IU6A 3BG5A 4QXOA 1YAJA 2YFHA 3QLVC 3TOSA 2J9GA 1HKUA 2TRSB 3OX1A 1NX6A 2NSJA 2YWJA 3F67A 3V8QA 2IBSA 1MB3A 3E58A 2XKBA 5B12A 1YB5A 3KD2A 5KU1A 5LQUA 1E1LA 1Y3CE 3WA6A 2Z09A 4BYGA 3C6ZA 3B1WA 1C3OA 4Q3CA 2HBQA 1EE1A 2XB8A 1T5OA 2GJ4A 2QD1A 2WF5A 4FOPA 1N5DA 1LTKA 4HEJA 3ZJ4A 3CVVA 4IOMA 4ZCPA 1TQ4A 3WAGA 3C6KA 2Y0CA 2X19A 4N39A 2FVYA 2JHAA 4EVSA 1KXZA 3PNBA 4MI9A 1TL7C 1FFSA 3JX9A 5IKPA 3MF4A 3X1XA 3IULA 1KI1A 2VZ9A 4X1IA 3K0KA 2WKPA 1NVWQ 2HMTA 2ON6A 4CCYB 4AQDA 1DELA 2Q4TA 3LE8A 1UBTS 5M2QA 4BY9E 1JG6A 2BKUA 3N59A 3EG5A 2QBYA 1FFWA 1T4CA 2HZ7A 3EDQA 3R24A 4WZAA 3UOWA 2ORVA 2FR0A 5AUNB 4EFLA 3ZV6A 2D5LA 2X15A 2ODTX 3MOSA 1O96A 2KJQA 2B2XA 4XIIA 5AHRA 4B3JA 1A8SA 3IMFA 2HRZA 3D5TA 4UASA 2TS1A 3EG9A 5FTKA 4BVGA 2QZSA 1XMIA 2WJYA 1GN9A 2N1BA 3T15A 3FLMA 2AH5A 1K0UA 2G77B 1WUIS 3AXTA 1KQFA 1RYZA 2GTHA 1AY0A 2AFIB 2QTHA 4FZRA 3HCOA 3PVZA 1KRWA 2XEXA 2WIDA 4EY4A 4GOMD 2V55B 4FKZA 3R7FA 3LXRA 2R0QC 1T9KA 1JFLA 1ZK1A 2W2QA 4MEBA 4RXMA 4D79A 1TUGA 2FCRA 4AXBA 4ND5A 4NBNA 3FTNA 3H8VA 3QIVA 5FL7D 4G0UA 1HOXA 4QUBA 2W37A 5FTWA 3SP1A 3DD5A 4HKTA 2GPSA 2JLUA 3GZTB 1K8ZB 2ZB2A 1CP2A 1CSEE 4II7A 3TAXA 3AR8A 2YS7A 3GZJA 1EKXA 4JBLA 1RYYA 2KBFA 4JYMA 4BVEA 3ZWMA 1UC4B 3L4EA 1WDMA 1Q17A 5LP6C 3UO8B 5MN6A 2BV3A 3COYA 4LF7B 2GO7A 4P58A 2EV9A 1H5QA 2MT9A 1FW6A 1LBSA 4F2GA 4EYQA 1M2KA 4M0CA 3UY4A 2HWKA 3ENQA 2IHJA 2YVQA 4G0QA 4YBRA 2OD2A 1O6GA 4PNZA 4B09A 2XCIA 2E4AA 1DRVA 3PUKA 3CC8A 3NCHA 5LP6B 1OWNA 3VOBA 2YY6A 2G9ZA 2PM8A 3WSTA 2FWIA 3JYPA 2NPOA 3AYXB 1KI7A 3W3ZB 4V2UA 4I4CA 4EUNA 1SPBS 3GB9A 3THRA 1F0NA 2XNDD 1EWKA 2P40A 1RXUA 1Y37A 2NQ2C 5ALJA 2ZUCA 1L7XA 1ZBQA 4HDOB 3HJHA 1P3DA 1YC5A 2I4TA 1EP3B 1KI8A 2FSUA 3S4YA 1WXGA 3JS5A 3TSCA 1Y6RA 3HKCA 3GJSA 4RTMA 1J49A 3LUJA 3WLHA 4IVNA 1Q7RA 1GP2A 2PX8A 8OHMA 1RBQA 3PLRA 3O21A 4YFVA 3VVCA 4IRUB 1LPAB 4EF5A 1IBRA 2PZBA 3M1LA 4AP9A 3DF9A 4MQ4A 4DC1A 1JSRA 4W5WA 4C5AA 2QN8A 1K6IA 3I42A 1XQVA 4INAA 4CIVA 2VP9A 1V7QA 1F7VA 1IBKB 3HFRA 4IQFA 4Z0TA 3WYCA 1Z34A 2GEFA 1E8DA 4IW3B 3I61A 4LF6B 4UUBA 3BD6A 4YMVA 4JUDX 1JXQA 4TKZA 4WZAE 2OG1A 2C29D 3X1DA 4W6ZA 5DASA 4IHAA 5F1OA 3EDYA 1Y1QA 4Q4JA 3UXYA 2O2YA 3KWFA 1RYMA 4DR2B 1YJCA 1CC1S 2VHWA 3PEVA 4RIHA 1M2VA 1UL1X 2FSGA 3T5MA 3AEQA 2V1UA 4EKEA 1UAYA 3A9SA 1J90A 3A4NA 3EUFA 1CRZA 5ALSA 5JYDA 1AQJA 2IJGX 4ND7A 1R50A 5KMGB 2NSLA 5JCOC 2HGZA 4RD0A 1VRWA 2FJUA 4L6CA 1N3YA 5BW6B 2W2KA 3G0IA 3SLRA 3TLJA 3V1YA 1MA0A 5BN1A 1QOPB 1ECGA 2LP4Y 4PINA 3W3AD 4FBMA 4CFYA 3WLTA 3GCDA 2P2YA 5K0JA 4HDQB 1EFCA 5AHKA 3C74A 1Z75A 1ZVJA 3EVBA 3LP6A 1YSCA 1NJ6A 1ZMRA 2ZJZA 3NOXA 5CM9C 4EARA 7MHTA 2FWRA 1L8LA 5I8ZA 2XMPA 5BUSA 4F9GA 4TMZA 4OHYA 3IDFA 5B3LA 3PKIA 4OI4A 1OYOA 3PUXA 1U3CA 1T0BA 4DLUA 4J9VA 3HHPA 2JLRA 1LFAA 1RI2A 1RLIA 4QTTB 1ENZA 2EJWA 4MWTA 4D8WA 4EG1A 3L40A 5JAIA 2XQIA 1FDOA 2ZYAA 2VJMB 1A4UA 2H4JA 4G01B 1SUPA 1H23A 3ROFA 2VK8A 3LHSA 4W8OA 2C1EA 1QHGA 5EJ8A 3I0MA 3JYOA 1NI4A 1U63A 3EF1A 5HIAA 3QTTA 4MTCA 3VPFA 1TRHA 1Y8CA 1JQBA 1MABB 4BP8A 3E82A 1G8AA 1S2NA 2A67A 2RC6A 3OIDA 4XFKA 3ZXIA 4J1NA 1ULSA 4Y1FA 4RVDA 4F56A 2PLWA 5KTRA 2J46A 2OL4A 2X5JO 4BLTA 5FL7A 3B53X 2UZIR 1FU7A 1RKUA 2PMWB 2AZTA 2W43A 3ZHRA 2Q6TA 3W9BA 4J16A 2P9GA 4FOTA 4OHUA 2NV6A 1DHTA 4B6FA 2VDKB 1BX3A 4JLUA 4QPCA 4Z86A 2YKGA 5B2EA 3OPQA 2OVBA 1YQEA 1A5SB 4B76A 5K0ZA 4QGBA 1JWAB 1M6EX 4KWTA 5GGXA 2A5YB 2C0CA 2COUA 3EODA 4IRMA 4KE6A 2LPMA 1W48A 2Z9CA 4XZ3A 4H18A 3V7FA 3VZPA 3ELDA 1L4BA 3OICA 1KZHA 4E1BA 2G67A 5J47A 5AICA 2ZUUA 3TI7A 1HL3A 2HMWA 5BOSB 1WKCA 3B7WA 2B2CA 3FMVA 3HU3A 3IUEA 1YVRA 3PR1A 3K9LA 5FI0B 3IPAA 3P9IA 3QZUA 4INJA 1CUIA 1GGMA 1JHQA 5ICCA 1H93A 4GKAA 3I9KA 3HB5X 3NHZA 3NPAA 4X92A 3QKSB 3OD1A 3L9WA 2VG8A 1KJIA 3NH6A 3BXPA 4QX6A 3RSGA 4K6MA 4GXNA 4QTUB 4LY6A 3NETA 1GSIA 4J7CA 3VR4A 2WA2A 3OZWA 5HQTA 3D0RA 3V8EA 1BYIA 3QVLA 5AKLA 4EFNA 5CDYA 1K9SA 1AUQA 3CBQA 4QM7A 1GQQA 1SJ9A 1JAYA 2K7ZA 4U2CA 4G1VA 4YAIA 3AIOA 1R6BX 4BO0A 4UDXX 1TADA 4DLAA 1LSOA 2EAUA 4RA9A 2J87A 2PUJA 1O94D 1L8AA 3O4JA 4PLPA 5BSEA 3T7IA 5E4YA 4HHEA 4MVXA 3KK0A 1JSCA 1U8TA 5HVNA 4NV3A 1PDVA 1TF7A 1VOTA 5B4UA 2ZKLA 4PLGA 5UKDA 4KXUA 4OHKA 4AF6A 1FNNA 2HCFA 4GP9A 3OPVA 521PA 1Y3HA 3V9PA 1CK4A 4JU9A 4MSUA 4ND6A 3SYRA 1SCUA 2HF9A 4AZWA 3I3SR 3WV4A 3ESAA 4KVFA 3OZFA 4OTZA 3S68A 4PNEA 5MDHA 2FWPA 1C0KA 4Q03A 1W85B 4Q18A 4FIZA 3EZ9A 4ZC1A 2RCYA 1RPTA 3M6AA 4KLNA 1L9XA 4MW0A 5AJWA 3REFA 4KQ9A 3UJ8A 2PGJA 1A2KC 3GN1A 1PQPA 1U8CB 1W6RA 1BHJA 4JBIA 1L5HB 1UP6A 5BRNA 1OC2A 4AUEA 2CC2A 5CDSA 3ROKA 4R6XA 1CZLA 5FPSA 3MCAA 4RPLA 2VYCA 4DEXA 2P30A 2Q9UA 3A2LA 1J8YF 4OKIA 4UAVA 3U1BA 2H3EA 1W19A 4BFVA 4EMTA 5LU9A 3MRSA 1W5AA 2WAMA 1JFVA 4NAUA 4DLPA 5FOXA 1UT8A 5AW1A 3USCS 3MBIA 5K8VA 2XYHA 3LC7O 4NOMA 2C58A 1Z15A 4MKRA 3CJTA 3A6GA 3OU2A 1WPXA 4YP5A 4CL3A 5KS2A 5M5BA 4F97A 2ZROA 1N2IA 3LJKA 2F3SA 3P4UA 1M33A 4EEXA 3MOIA 3EQ8A 3CTPA 4XGQA 2A86A 4Q6BA 3EYAA 2OXFA 5REQA 1N0HA 3DEHA 1PR5A 2DBRA 4AJEA 4XIGS 2WJVA 3LV8A 1PJCA 1O95D 3UNXA 3V2UA 1M2GA 1XPOA 2NTJA 4W4TA 3W2HA 1L7NA 1O5TA 3SDBA 1CZUA 1M2HA 2I6FA 3EFOA 2C59A 1AKEA 3FMGA 1JPVA 2W00A 3AVPA 4NQRA 4TXLA 4JL6A 5B58C 4NSNA 1QAQA 1OT5A 3IA2A 2IOQA 1U28A 2NUTB 2V6JA 1M75A 5EQDA 3SC2B 4FEAA 3BHJA 2ROQA 4LBYA 3G0HA 1NXQA 1WP4A 1KJ8A 2PUWA 3IOMA 3E0XA 3ZGVA 1FTSA 1T13A 2C9BA 2NPIA 4FUTA 5C4MA 1N2BA 4PG5A 4ARCA 1EP2B 1UBLS 2WTEA 4PZAA 1MUUA 5AVUA 2A9OA 1XN4A 1FMLA 1PNTA 5HW0A 2OCLA 2QVCA 3G5AA 3RABA 1DC5A 2QUHA 1EFRA 3HYCA 5DI3A 2IPNA 5KWEA 2Q8PA 3HCNA 4TLDA 4XWTA 3A4LA 3CE6A 2FLVA 4R2LA 4B3GA 4JC4A 1ONSA 5D3MB 3BL5A 5LXTA 4CIBA 3DOFA 1NVBA 2Z08A 3EFHA 5ILOA 1CUBA 4UXJA 1SBYA 4HUTA 5C4IA 1PSDA 5HWSA 1UKZA 4EKIA 1KVQA 2VRNA 3UB4A 1KP3A 4BLSA 1A5AB 1BU8A 4XYLA 4LQLA 1JB1A 3HNRA 4MB0A 3U26A 5JSQA 2CN1A 1LRLA 3RT1A 4DG5A 5FFFA 1MXHA 2WT9A 3LP5A 4IYRA 1B26A 4B75A 2UUBB 1KFJB 4Q3OA 1JGTA 2H4ZA 5CBPB 4FMPA 1NP7A 2X0FA 2DFPA 2WV9A 4XH9B 2BGLA 4JASB 1UF9A 3WL3A 1UC8A 1ZMOA 2C4VA 3QV1A 3DMDA 3ZIUA 1M6HA 1PJZA 1BG6A 1U3FA 3IQFA 4OBEA 4OCZA 2BJVA 2G40A 1JSLA 3DBOB 5IANA 4JLOA 2XVYA 1E9BA 4N54A 2BI4A 1OZFA 1KJJA 1QIHA 1W4ZA 2DPLA 5FNVA 4D25A 5K8IA 3M6MD 4G56A 4DRXB 2V3VA 3UPDA 5TF0A 3QF4A 3IQHX 4X1KA 4ZCRA 4F8EA 7ABPA 1YZQA 2WU8A 4MV0A 3VMMA 3ZCSA 4IG4A 3NGLA 3V7UA 3AV0B 3GUHA 3UMGA 1J2EA 2JI7A 3UV3A 1AGXA 4X1OA 4X97A 3SMQA 3NJ4A 3OCYA 1QORA 1DO8A 3UCFA 3ZCUA 3Q0TA 5AVSA 4JA0A 5HPYB 1JNYA 1HTBA 2OXTA 2ZYDA 5IM5A 2FQ1A 3MMZA 3DL0A 3HCWA 4UPVA 3SEFA 3L7NA 2Q0SA 3LXXA 2CYAA 4IF4A 2EG5A 4AO6A 2XGSA 3ADKA 2B8EA 3BFPA 5EWJA 4MIOA 4NYMR 4EHLA 2QV7A 1UJ4A 5KPDA 4Y30A 2EKBA 3RVJA 4X54A 4H3VA 4WGFA 3SZOA 4BRZA 3X3HA 5CA1F 3V4VB 3ZHXA 3OZIA 1T6ZA 1FJHA 2IYOA 4ER6A 3D7SA 4TL8A 2IKSA 2ZI6A 5A5EA 1NBMA 3DLIA 2B36A 1PFYA 2V6GA 4M55A 3NTLA 2XDQA 3EDOA 5B57C 3HFSA 2QLTA 4LFCB 3UGQA 1BXZA 3OETA 3ZG6A 3VR6D 1UC9A 2BMDA 1T9GR 1K8YB 1PJSA 1ZWLA 3MPUA 3VBEA 3OKFA 5BMOA 1DRUA 5EZYF 4P81A 1H2HA 4O2BA 4V0LA 1CDOA 4O0LA 5KHAA 5CM8B 1IZZA 4CM5A 4UM5A 2H7CA 1ORRA 2AOTB 2V74B 4BFUA 4RQBA 5FB3A 1JT2A 2V59A 4B7AA 1KEKA 3L84A 1TOAA 1C4OA 4ZOEA 3RQIA 3RRZA 3MM4A 4L4XA 4JQZA 1P77A 2QL7A 3KR0A 3LH5A 2EZUA 2HK7A 2R8BA 2Z5FA 4JX8A 4AZ0A 3EE6A 3AEKB 3ZDZB 3EVGA 1QIFA 1ADBA 1MF7A 3I58A 3LBFA 3GMTA 3QOYA 2QRZA 2PA3A 2WSBA 1QR2A 5ALEA 3FWYA 1OREA 2I2AA 3PVSA 3W7AA 4QHSA 4DDMA 1NVUQ 1CFZA 3HSSA 3IXQA 3MXOA 2RD2A 2XIJA 5L6MB 2VF2A 3M82A 1HT1E 1T15A 3EGEA 3I45A 2Q1YA 3Q5DA 4OYHA 4BL5A 1BNCA 4TM8A 9LDBA 4AKSA 1Z6XA 1Z5UA 3IEMA 4D97A 1DAOA 3T9EA 3U4AA 1X3SA 4P4GA 3ZV4A 4KWHA 2JDID 2BRUC 1N5LA 1CS4C 2C5GA 1NNI1 1ZJZA 2VSOA 4I8XA 4BKPA 5JNSA 3KIPA 4YUXA 5I7HA 3V32A 2XMQA 3P0EA 1ZOIA 2HAEA 2AOXA 3GG2A 3ZVKA 1CE8A 3PFBA 4GHWA 2MMCA 2BTEA 5IT4A 1F48A 1L1RA 1JB9A 4UOQA 3ZY4A 4C2AA 3WDMA 5AVXA 4O4LB 5IUKC 2IDZA 4U7GA 1ADCA 3N8HA 4R2JA 3OOHA 3RUCA 3T7KA 1CU1A 2BFEB 1Z0IA 2WFAA 4QJ5A 4DEYA 2GRAA 4ZMBA 2GAJA 2H59A 3PJEA 4W7HA 4C4RA 1GFIA 5AK0A 1H6BA 3HI4A 3G2QA 3WBKA 1FRZA 4X84A 4ZYTA 5A5VA 3IQXA 2D5BA 1UK6A 3NR2A 2X8LA 3IIJA 3I2JA 4A8JC 1K5DA 1U5BA 4Y6SA 3C4JA 4L95C 5JPIA 3VMFA 3EXHB 3OTWA 3M1AA 2ZZMA 2WD7B 5I9TA 2DHRA 4DNXA 2GVNA 4N6NA 1IK6A 4KSBA 2EBHX 3ZBQA 4YLYA 4NAVA 4WCFB 1UQTA 4QHYA 3CNHA 4G8DA 4IJKA 5DXFA 3WWPA 4AUNA 2XCSB 4O2RA 2AJBA 1QRTA 1C7ZA 1IHOA 2IWRA 2X0KA 5I47A 4ENWA 4URVR 5DNYB 3SXUA 3QHAA 3CHYA 1G7TA 3I52A 1XRLA 4PRZA 2DB3A 3DDNA 1QF6A 1B6SA 3UHOA 3DZJA 1J33A 1NVMB 1MU0A 2NU7B 3JQFC 3JSXA 4JOSA 4OHMA 5D87A 2JI9A 3R9XA 3R5KA 3GFFA 2P2CA 5ALZA 5I7VA 3QLJA 1KXJA 3T61A 1JQKA 1U31A 2D1QA 3QVSA 3QYPA 4HOYA 4MS4B 1X15A 3QUSA 4KGDA 1XXHE 3ENVA 3NKFA 2WVHA 1ISSA 1RFLA 3AI3A 4O2BB 4Q1CA 1AQ6A 2XDAA 4LF9B 1W94A 2RJ3A 3T7EA 1XF9A 4J0EA 3TEFA 2G88A 2Q6IA 4I1PA 1VJDA 4DXHA 4EJSA 2PGOA 2XOKD 4N82A 3QXCA 1AH2A 2FWMX 4GDMA 2FPRA 4M0MA 4COKA 1PFQA 2PWAA 5D5PA 4QSHA 2BH9A 1DDIA 4MW9A 1TZBA 1KE1A 2EX0A 4DM4A 2GN2A 3L7BA 5BQ5A 2EJBA 3DZGA 2Z83A 4HFNA 3BWDD 3T1TA 1A9TA 3NANA 3KDPA 2GBLC 3GAFA 3CF0A 3L6OO 5ANRB 1U7HA 4X71A 1Z63A 2BFNA 4TMKA 4AX8A 3TVDA 4YJ3F 1Q2UA 1IY2A 3ZWCA 4ECEA 3PNLA 4AQYB 2YN2A 1QR6A 3NDRA 5BN3A 3R7SA 1F3LA 3ORFA 1PTJC 5SYAA 4K87A 3OEED 2HCBA 2NTNA 1Q1NA 2OUKA 2X5OA 4KN5A 2IEIA 2JAHA 3S2SA 4FLFA 4BBJA 4XD7A 4RCZA 1DG1G 1B8OA 3C3JA 1Y8RB 4IQ0A 1FNSA 2B5OA 1MRZA 4L5BA 5EWMB 1VIVA 3F6RA 3G8BA 2A57A 4KW7A 3J80A 6NULA 3UWMA 3BMCA 1CDDA 1QLWA 3G7UA 4EG3A 2AF3C 2HA3A 2IZ1A 1EYZA 3FMIA 4X6UA 4OUDB 4V03A 3ELBA 3JWJA 3JWHA 2E48A 3MJ4A 4FS3A 3OBBA 4PO8A 4Q21A 4MKGA 5HF9A 3SG0A 5K0EA 2JFXA 1KSHA 3K53A 5LA6B 1HY3A 1HQDA 1QIKA 3FR8A 3IUYA 2PGAA 3JVDA 3JVUA 2OGTA 4FNGA 4L9SA 1P7ZA 1W4BA 2LBPA 4LY0A 4TV8A 4ZAYA 5IJ0A 4YMGA 4EHNA 4YRLA 1L8XA 1WDWB 1XEXB 3BF7A 1W36C 2C9OA 1GTRA 1TVKA 1JKFA 2QUZA 5CNIA 2UUPA 3O03A 1TEXA 2BF7A 4KCGA 1WDKA 5L7YA 4D2IA 4EO9A 1XQ6A 4R40A 3C14C 3V1TC 1M8FA 1F4LA 2AR7A 2UYOA 5HNKA 3O0DA 4IH9A 4Q12A 4LYEA 1FJGB 1E63A 1OTHA 5KX5F 2GM3A 2PX3A 4ZA2A 4EL0A 4W5OA 1A4IA 1DJNA 2ASVA 1DAEA 2IV2X 3HBFA 3T7RA 3FCUB 4B48A 3NDIA 2P8JA 2ZJ2A 3KP1A 2EGUA 2PBFA 3ICEA 3U37A 1CQZA 2IV3A 4AJPA 1EWRA 1XU4A 4BN4A 3GFTA 4IEIA 1CRWG 3AJDA 4GZ6A 2CLKB 3IR6A 1YJQA 1X7HA 2AYZA 4HLNA 1SXPA 1AQLA 4J0QA 1NXSA 1R4MB 2EOAA 1L7VC 2IIQA 3RVRA 1Z62A 2VJCA 1TFUA 2R48A 3C3WA 4YRIA 1ISHA 4ZAFA 9ABPA 2W8BA 3G2NA 1HE8B 1P1IA 4UTOA 5JMPA 9GPBA 1DMRA 3BA6A 3FN4A 2J3KA 4F71A 4DPLA 4I5FA 5CFPA 3IPXA 4JI6B 1Q14A 4B6QA 4LJRA 2LDXA 1ESEA 3RTGA 3EAGA 1NNSA 1UZUA 2GILA 2XQJA 2OYCA 1K7YA 2QI9C 4J1SA 4DNPA 1FYVA 1XLTA 2F1JA 1WHTB 2P2ZA 4ZTBA 3V8BA 4PZCA 4TQAA 5AT1A 4EB0A 3WK7A 3AF6A 4PLYA 3T0FA 1KBOA 1X86B 3FYHA 4PPYA 3IO3A 5AMXA 3RU9A 3UA4A 1EGMB 5K3AA 1WY5A 5DPMA 4G23A 2J5KA 4KHZA 1DL5A 3WA7A 3PUIA 2D3WA 4KSYA 5AR1A 2R8YA 5BN3B 3COSA 4R81A 1N6NA 1O58A 4YK7A 5LSAA 1EMDA 2AK3A 2WU4A 1NUUA 4RC9A 4IF6A 3UAOA 4B6PA 4MK4A 2PFSA 1AQIA 1R16A 1SN7A 3NWOA 3RSCA 4KO2S 1T1SA 2V7TA 3MB8A 1NUSA 4Q3NA 3DPSA 1Q3HA 3F96A 5JYEA 3R23A 2KW5A 3AZOA 1SBQA 2CMDA 1LQ2A 3CZ5A 1KDOA 3D54D 3MXTA 1CT9A 1N57A 3QFSA 3S1AA 1UMCA 4D3XA 1SU8A 4UU1A 3HXKA 4OUDA 1NBIA 1ENOA 4ZZIA 2F8TA 4BV9A 1U0GA 2UVDA 4EY5A 1JX6A 1XTSA 4PSUA 3E1KA 4GMKA 3GLIB 2YN4A 3ONDA 1IZ8A 3H4VA 2HDHA 1FTNA 3AEZA 4J3JA 1UH5A 2LIPA 3C70A 3SHTA 2OGWA 4WLUA 4D45A 2GWHA 2DBZA 3QBEA 2QAJA 1NPDA 4JI1B 3T52A 5L3SB 4S04A 3BUSA 3IH5A 3FKSD 1OF1A 4HPXB 1Q1AA 2G08A 3PGMA 4XGKA 4Q82A 3ZPXA 1QK5A 2H1CA 1ITZA 1RPAA 1M2OB 3F3YA 3H1FA 2XMRA 3OQBA 3WDSA 6LDHA 1RXYA 1WZEA 2HA7A 4ZOLF 3CRVA 3I72A 3L1HA 4YT5A 1H9CA 3OTHA 3PFHA 3K9NA 3ZDAA 2HFKA 1LDYA 3IDQA 3CF2A 3H86A 4UNPA 4URWR 3CRRA 4KYVA 2Q2WA 4TYWA 4QJBA 4B0PA 1RAFA 4CG2A 2XNSA 1VDZA 5LNK1 1WSAA 2GR9A 4DW8A 4A8JA 3BIWA 5HRAA 5T67A 4CGYA 1PYOA 4QYIB 3SC3A 1FXUA 4HLDA 3L8EA 3T8YA 1KS9A 3OLXA 2C4UA 4Z4CA 2W2XA 5ESDA 3LTNC 4PAWA 3VR2A 3G49A 5HKLA 1MGOA 4FNAA 2JCXA 1FSZA 4TRMA 2ZTLA 4XGIA 4E31A 5AK6A 1SELA 1RSZA 1MV5A 2FHSA 1NVDA 3P9CA 1UJ2A 3C16C 1SVLA 1C9MA 3WNZA 4L8LA 4N3AA 3FCEA 1V37A 4XUGB 3IMEA 2DT5A 1W4AA 1VYUA 1Z4QA 4CKBA 3UJ9A 3HEAA 5A4JA 3IBYA 3VX4A 2PUTA 2L0XA 3B7GA 3CEJA 1DCFA 2IELA 3HCFA 4IJQA 3HLTA 3UHJA 1NBHA 4F9TA 2QL6A 1V39A 2EFHB 3GJRA 1SQ5A 4N0DA 4UZEA 5FWNA 4JYZA 3WYEA 4QUHA 1XPUA 1V5WA 1QK3A 4MQ6A 1JXAA 3V34A 2F9LA 3OPYA 4DCMA 1DKUA 1YGYA 2EXXA 1QGDA 3FDFA 4QNMA 4B45A 5FLKA 4C9BA 3LC2O 2IX3A 3A4YA 4EKGA 1FRNA 2Q8QA 2QNIA 4ZDWA 1MB4A 4DV7B 2JBAB 5B1DA 3Q88A 2ID4A 1WVIA 3I2IA 3ML1A 4AIRA 2R1VA 4FEEA 2BSAA 5TEWA 3WLKX 2P6NA 2TYSB 4OQ4A 1OGYA 4P08A 1V7ZA 1EFVA 1F6DA 2GJSA 3B3QA 1KZYC 1OASA 1WABA 3S7TA 1JAHA 1P5HA 1DAFA 3DBIA 4YQFA 4U1RA 3S1AB 1DS6A 2AN4A 4DMMA 5IDYA 4C7VA 1OJLA 4YRAA 1AGYA 1BRMA 1F14A 1RRMA 3EULA 4CM3A 3EZ6A 1GRRA 4HLUC 1Z7BA 2OE2A 4HRYA 4ER7A 5C34B 4JFAA 4MR7B 3GN2A 4R54A 2D8AA 2VFAA 3AY7A 3C8ZA 1CUVA 3WMEA 5CNMA 4KXNA 1MO4A 5J40A 1JG3A 5EIHA 2XWPA 4JGGA 4LYAA 4A73A 5G40A 4MV8A 1I30A 4BFWA 1APBA 5CNKA 1T8WA 5K3CA 1TLLA 2QSZA 4O2LA 1D6NA 1YS6A 4JR1A 4RKWA 3FGOA 1VMKA 4TLCA 4QDXA 4CM9D 1IQPA 2VT3A 5HHTA 3CXUA 3BXZA 5CGQB 3TPZA 3N1UA 5HTOA 1C8LA 1PS9A 1GITA 4M76B 3KQVA 1XF1A 4EG6A 1DRKA 3T7CA 5JXWA 5K0SA 2C4NA 1P0IA 1PK8A 2Q4EA 2R5FA 3C3BA 1C3VA 4B6OA 2QGFA 3A9TA 3AEYA 4TLLB 2ID9A 1KR5A 4NYMQ 5TF4A 2C3UA 1QG2A 4PGMA 1TK2A 2JKYA 3KYIB 3LYAA 4GLJA 2B4AA 1ZUNB 2GYUA 2QP3A 4HAOA 4BQQA 5B6IA 3S2EA 2PWBA 1HDGO 3GBPA 2OCBA 1EXWA 3QVMA 5SICE 4N8SA 2WKSA 3LP8A 5FPKA 4PC6A 4A0SA 3RAGA 3U4CA 2DHQA 3FPSA 1J20A 3VKHA 1DCMA 4NU8X 1YA8A 5DXAA 1O8CA 2YQ4A 3LQKA 1JDTA 2CBXA 1N92A 4AU1A 3IUSA 4LXTA 3V8NA 3V8VA 2K5UA 2RI1A 3GEMA 3GIDA 2W6PA 3DP9A 1CS0B 2LV8A 5U1PA 1AXGA 4AO7A 1G7SA 3OUZA 1SCIA 5E1BA 5H02A 4IIVA 5J9FA 1C3OB 3UFXB 4FHEA 3WGOA 2CB9A 3L01A 4K3VA 1NX9A 4MJ3A 5EMMA 3PITA 1L7DA 2GCOB 3DTVA 3PTZA 3EEOA 1A27A 2ZBGA 3PCTA 4IYJA 1M54A 3DZKA 3SKXA 5A4MS 2DFLA 2QEQA 4EB6A 4OSOA 5AJVB 1WZUA 1ODSA 2CKMA 3ABQB 1Y9AA 1PL8A 4H27A 4IVPA 1H8HD 3OM9A 5NULA 3SLKA 2D13A 1XCGB 1ONPA 1JBQA 2CCKA 2YYZA 3JTEA 4P7FA 5EJ2A 4JI5B 1X9GA 2LVBA 2RJNA 1HYQA 2P6OA 3ZIDA 3IXLA 1T24A 2XT0A 3GLHE 1GG9A 3LWZA 4WVFA 4DIEA 4R2WA 2EL7A 5A02A 1K1EA 3HU1A 1S5PA 1M1YA 3WKAA 4F2WA 3H5IA 1E5XA 5I9NA 1YVPA 2H3HA 4FFBA 4MUXA 1JKIA 1GGFA 4GQIA 5DWDA 3I12A 3H8WA 1NQUA 4RMGA 2RHCA 2JJ1D 1KDYA 4DJ5X 2E5LB 3DOCA 4CKYA 3CLRD 4IXDA 3FWPA 1D9ZA 1QH1A 4BDSA 1JHYA 1R0RE 5CBKA 4QODA 2AOWA 2ECFA 1CR2A 1DKNA 1SH7A 2X23A 2W2OA 3M6VA 4Q02A 4QOHA 3SAJA 1F17A 2P9CA 5TPWB 4EL5A 2Z2IA 4BCBA 9LDTA 1QV9A 1Y1PA 2COEA 3LX6A 1QIGA 3K9WA 4Q1DA 3HEBA 2QRUA 4CLRB 3P1JA 4RZ3A 1QJCA 5HQ3B 2YHBA 3F47A 3UMCA 4Z7NB 5TB5A 3GLSA 3CFYA 4CR7A 1SIOA 4QUEA 2HFJA 1SWWA 3DCJA 3VKGA 3TL6A 4J75A 4HF7A 3VSCA 4UTRA 5C80A 2ZYRA 4XUCA 3FOBA 5IABA 2C4TA 3HXMA 1VLMA 1WWKA 1JQEA 1TU4A 4DV5B 5FLEX 3T3GA 3GROA 4QT0A 2O7QA 5EG5A 3AKZA 4OIFA 4V0ME 2W6IA 1QSGA 3KS9A 1WXXA 4QTXA 2C4WA 5ENVA 2I3DA 5C5DA 3COPA 1XKXA 2FEAA 3UWKA 2GLUA 2R25B 3A4IA 1P81A 4NENA 4TWAA 1ZH6A 2PJDA 3E5NA 1Z6YA 3OZGA 2BMAA 3WG9A 4KR7A 3WY9A 3GRVA 3QX9A 4URFA 3ZJVA 1E2HA 1AD2A 1ONOA 1VHQA 3OIFA 4FFRA 5JD4A 5JJBA 1VJCA 3PZRA 4O2AA 4B7ZA 4DSZA 4MV1A 4HEHA 4MMYB 5JXIA 2XVMA 3UMFA 1JH8A 3AEUA 4NARA 4NK5A 5E0OA 2YHIA 4QEKA 5DM1A 2QMHA 4D0RA 2C5FA 1XZAA 1TPYA 3EPRA 3LBYA 5ITZA 2IQ5A 2F55A 1XN1A 5G2OA 1BZYA 3DZCA 1KTIA 4LZWA 2UYQA 4YAOA 4ZPXA 1AUOA 1Z2AA 1ODKA 1BGXT 1MZVA 3QU5A 4WERA 5I9SA 1Z0AA 3D8TA 1DUVG 1NBOA 3MT8A 1IM5A 1YMQA 3N8NA 3ESRA 3L18A 1RYDA 3Q3EA 5CR9A 4AN1A 3E4DA 1UM9A 2Q3EA 2EFEB 3OQ1A 3ZI4A 1DE0A 2ZIVB 2B1GA 4DMFA 1BTOA 2FF5A 2IWHA 3OF5A 3CLVA 3IHTA 3RTEA 4HL6A 3E6AA 1IPHA 3L0YA 4M1OA 4JBYA 1ULHA 4Q93A 5I48A 4DV4B 1KOJA 4RIEA 3QWIA 1Z08A 2GM5A 1WV0A 1KVSA 1ARZA 3PU6A 3AHEA 5K51A 3Q72A 3ZU6A 3ILXA 5EAIA 3SIPA 3U3OA 3VR5H 4UBOA 3H42B 1DADA 1BYUA 4CI9A 4KV9A 5FO0A 5IBRA 2W6JD 1G5RA 2QORA 3QELB 3TFQA 2Q5IA 3SDZA 2VVTA 2QL5A 2IH4A 4V0QA 1JLLB 2CK3D 1QO7A 2BVNA 2B98A 1NW7A 4OMCA 1XDBA 3D4LA 3ZDEA 4WCFC 1I6KA 1VPDA 1T34A 2EF0A 2YWEA 2ZAYA 3PQDA 5JAOA 2HY7A 4RM2A 4H7DA 3U7IA 1I7PA 4NJMA 2G4CA 1CVRA 1Z2PX 2GBLA 1JDSA 4YO8A 4HDRA 3RS0A 4J7AA 4LX8A 3UKOA 3R2JA 2I1VB 2QM8A 1YB6A 2P5SA 2H1WA 1D2NA 1W4LA 2XMDA 3UEOA 1QHFA 2VSFA 4MARA 2Y1DA 2WC1A 3JQGA 1ZOOA 2O59A 5E6UB 4XEHA 1SPXA 4PZLA 4UNNA 1AJEA 4BV2A 3ROTA 3DLTA 3KOWA 1TU3A 4HB3A 1FU4A 5DISB 2ACWA 1M6VA 1HZZA 2IXTA 2OMEA 4MICA 3F71A 1B6GA 1KMIY 4YUVA 1EQ2A 2XNJA 4A8HA 1FF9A 1OBFO 3LPCA 4GWKA 4JB0A 3UWOA 3UJNA 3TUIC 5A0VA 2FAXA 4BMDA 5AVOA 5KNBA 4IS2A 2XOXA 3LQ1A 1G5QA 1YRBA 2ICAA 1RPZA 4YR7A 1VI6A 4LY3A 3I1YA 2CJWA 3KQQA 4L27A 2A0YA 2Y4NA 2WUEA 5DNDA 2J7KA 5M7EA 2JD1A 4I6JA 1ABBA 4Q1FA 4BLOA 3WAKA 5KCZA 2PLFA 1P2GA 3PGXA 2QOEA 5ESXA 3CLUC 1DVRA 5FBLB 1UBCA 3TN7A 2OPHA 1LS6A 2YMLA 2EJVA 1KDTA 1QRAA 1FSFA 2VPIA 3L0DA 3M5CA 5M3BA 4E46A 1LPNA 3QVJA 2W6JA 4KUEA 5IKOA 2DMRA 4HAXA 4NNOA 2J3JA 2EJTA 2A58A 2VNAA 1PLKA 5HDBB 2CDNA 3REGA 4M0FA 1I4LD 2V7XA 2ISQA 2JGKA 4MWEA 2Q1TA 2GXQA 5LQSA 3RIYA 3WWYA 1BMFA 3DKRA 4M98A 5SY4A 5A5GA 1P9OA 4ZOLA 3FPFA 1A71A 1XLVA 2O0JA 3OH8A 3QKUA 4I6GA 1QVZA 2OG2A 3BK7A 2P2NA 4OBWA 2OCAA 2ZM6B 3A58B 1TQ8A 4UBLA 2E1RA 4PG6A 3EPHA 3K7EA 2QENA 1KFKB 1G8YA 1SVIA 2GPNA 1KYZA 1U7WA 3QUAA 5HX7A 1M8PA 3G5MA 4D8YA 1RZUA 3ZXXA 621PA 2X4GA 3QP9A 3PQ5A 4KJXA 4NZPA 4U39A 2H1VA 1W59A 4G4GA 4K9LA 1X80A 3E3OA 4WXEA 4BASA 3ZW8A 2J9FB 1CRQA 2AJ8A 1NC1A 1VSUA 4GPBA 3KC2A 4FMDF 1JDZA 2VWGA 4JEIA 3SY8A 4UVHA 1Y3BE 1UINA 1J7KA 4ALKA 1X7XA 2RHGB 3NBMA 4DMGA 4KYTA 1Y8QA 2Y3IA 4R3WA 3T3DA 2E37A 1D9XA 1U0LA 2P9JA 1GNPA 3I6ZA 3DC2A 5C8DA 3N2ZB 4M36A 2OV1A 3KWLA 1E7MA 2GEDA 1OJ7A 1B7GO 1RJ9B 2V7VA 1EX9A 4G3XA 1GFSA 1CJVC 1KI3A 2SECE 1Q91A 3PJFA 3V46A 2QMQA 4QOIA 4YJ2B 2PGLA 4NONA 3COVA 2FYTA 2BZ0A 2JG3A 4DRZA 2ZJ0A 2OV3A 2RAUA 3UMJA 3I3OA 4C0JA 1WQ4A 1FE8A 4PZPA 3U16A 1MO6A 3JWEA 2VRWA 3T3HA 3GLGE 3ZZTA 2X8WA 2OHGA 4KJZA 3JU3A 5GZ6A 2POCA 1TGYA 4YRJA 1E0DA 1FP1D 3JRXA 3TL3A 2G07A 4LJ8A 1NU8A 1TMOA 4P7KA 1K89A 3LWBA 3V4FA 3S28A 4R84A 3GLQA 3O8OA 3R7LA 4TS3A 3VXKA 1PQYA 4MRAA 4FOLA 1BWSA 1CZNA 1NVVQ 2GWRA 2BR5A 2VHEA 5JSYA 3VRHA 2ZM5A 1UWKA 2UYGA 3BREA 3BVPA 4G1MB 4JJ8A 2H1FA 4R7TA 1EFAA 4GLBA 3U49A 4M8NE 4YXWD 1NC3A 4MP8A 1F6WA 4X63A 5K3DA 2HRCA 1R0WA 1L7AA 2VP2A 3B36A 4PR0A 3KEMA 3O7MA 1NVTA 4MWOA 4DQKA 2RE8A 1TTHA 3AL3A 1Y63A 3OLCX 1JG4A 1FPQA 2VAPA 3BSSA 3R5FA 5BURA 2GCEA 2C2OA 3CWCA 3MQFA 5FWXB 4TVKA 4JB3A 3NCTA 5DLEA 2OAQ1 2Z8YA 2YW9A 1G8HA 2VBIA 3O3OB 5G0VA 2G7ZA 1GZSA 2PVPA 4ER5A 2GA8A 3WLLA 3H9GA 1XI2A 4PX9A 5KX5A 1EVIA 1WOMA 1JHDA 3DO6A 4EHJA 3H83A 3D7NA 2I3GA 5JSHA 3MUOA 2XY4A 1NG9A 3WK9A 1QANA 1VYTA 1UXGA 2BGTA 2Q1WA 1EE9A 1RE1A 2R00C 4INOA 4MUNA 1EGQA 1GAQA 4R1MA 4OAPA 1JJAA 4AN4A 3AVYA 1E2UA 4M1SA 4GX0A 2NU8B 2FEPA 4ADSG 5CDFE 3PHJA 1Z5VA 3OAAD 1G2QA 3UUEA 3WYBA 1P4AA 1RQLA 4KAXA 2ZSDA 3W5CA 3GZNA 4HNHA 2OGSA 1XIVA 1CDZA 3C7AA 4N7JA 5HIJA 2ERXA 3GLUA 3M6LA 2XMGA 4S24A 5MF6A 5EEHA 3O8QA 4BBPA 2I8AA 3ZNOA 3HJRA 3DTYA 2FDRA 4BJ5A 4RZIA 1RI5A 4LQCA 3EPJA 1ORTA 5HCNA 2WY2D 3TRKA 1OR8A 2I03A 3AEXA 4CKEB 4O08A 5AW9A 3E3LA 1AN0A 4AKTA 1KEPA 1YJBA 4LV5B 2Z57A 3L7CA 3OE1A 4M1MA 4UAUA 4J9UE 1HX7A 1NT4A 2HOQA 2YIMA 4R8VA 4S2UA 3ER9A 2WQ7A 4JP5A 2QXUA 1DFGA 1DSSG 4I0WB 1XE3A 5J2UA 4I1SA 2LGJA 5BR7A 4XJTA 5K3OA 1NOJA 3KOUA 4G1UC 3WHLA 1FDWA 4XQ0A 2NV0A 3CW8X 5I4BA 1R5JA 1W0JA 1YFZA 3ITKA 4FW9A 2QUJA 3AJ9A 3AVUA 1VL0A 4JI8B 4UAGA 1CQIA 2XXBA 5A4DA 1BEEA 1C1XB 2WM3A 3DOIA 4RJKA 3K2EA 4QDKA 2ALJA 1DIBA 5TT0A 3WZLA 4LDRA 4C4PA 5LQKA 3A1VA 3QTBA 3KPUA 2WD9A 3W2EA 5KJCA 1G2IA 1J25A 2ODBA 3ECAA 4NV1A 5FNVB 5G1PA 5JBIA 1HYGA 1QFXA 4CEJA 5AJZA 2HC9A 2PT9A 4X1KB 4G5YA 5FO1A 1R27A 4C87A 1NAHA 1Z7WA 1XQ1A 1UKVY 3FDJA 3PE3A 3SF8A 1DX9A 1VCMA 3LY5A 4LBVA 1EFKA 5BRJA 3DMPA 2C2MA 5CB6A 5L6LB 4MDEA 5J4KA 2I6XA 4OQDA 1RDFA 1OBHA 3F4BA 2H85A 3OFND 2DLNA 2J67A 4MUKA 2VBGA 4G09A 2REOA 4NKRA 3O4RA 4HYYA 1N5OX 5DF1A 2P4SA 3RU2A 5JAZA 3M4JA 5EVCA 3WSWA 3PR2B 2DWPA 4ZGWA 2WSMA 4H1HA 3BMQA 4RQAA 4MQ5A 4TS9A 3JAKA 4YP7A 4AULA 3ZDRA 3TB6A 3GJYA 3T35A 1UAGA 3S40A 2ZSKA 4KQFA 4ABTA 2O8EA 3A1EA 3LZ6A 2ZU0C 4HGRA 5DHUA 2BUBA 4HAZA 3WK4A 1GY8A 4IO1A 2V6FA 3OA0A 2OCKA 1BKDR 2JVIA 4P4TA 5C8YB 1MJFA 1NR7A 2BGUA 3H84A 1US8B 2Z2XA 4FU0A 3AL2A 4HZUB 2ZRQA 3PV0A 3ORYA 5B3JA 3ITNA 1ZYUA 3LXUX 1AKWA 4GL4A 4PE5B 2UZ4A 1NQXA 4FM9A 3EMVA 2BM0A 4BATA 3BDVA 4I46A 3H5AA 2O2EA 5J2TA 1YS4A 3MVEA 4V0OA 1BE8A 4L50A 3LK6A 2AD5A 1XDGA 2CHFA 5L51A 1FYXA 3KCNA 3FRHA 4YJKA 1OHHD 4LVUA 3HXOA 4MUMA 4DC9A 1HG1A 1G7RA 1U02A 3MQ2A 5IBPA 3ZJTA 3WRXA 1CQPA 1NYQA 2WVJA 3CX6A 5EMHA 2JJYA 1D04A 4QPPA 4V0MA 1XMXA 1Q7TA 5EOVA 3VH1A 3VZCA 4KPUA 1PFUA 3K0CA 4YEDA 2ANCA 3D0KA 3PFGA 5EXTA 4N5MA 2R66A 3RUIA 3KB2A 4GC5A 1CUYA 4CV2A 2IV7A 5E6SB 5ES3A 4B5LA 1P1KA 3K73O 3ZNQA 1KA9H 1WMBA 2LDBA 2PBZA 3VUEA 5G1OA 3ZHQA 5BV1A 1EINA 1Y4UA 3HMKA 3MMXA 1SUSA 3AF2A 3AW9A 4H7JA 4I81A 1EAYA 5LBTA 1BOOA 3ENWA 5FLYA 2Z5LA 1NY5A 1T4BA 2OP0A 2PLRA 4J03A 4Y2TA 2YC4C 1Z2NX 3ZW7A 2PSDA 4M9ZA 4B1FA 1E9CA 2BHLA 3WMWA 1U2EA 1ZRSA 3QEMA 4QDJA 3VFDA 4WOBA 1XFAA 2BM1A 2Q6LA 1XZNA 4Y0VA 5AJTA 5ILGA 5F1KA 4PCAA 4G5RA 4TWRA 3LBIA 2QT9A 3ZH9B 4LC1A 4QQNA 3T3NA 4RL6A 4DVJA 4W5QA 3BK2A 3T34A 2OXEA 3RIMA 1UANA 2QYHA 4QREA 1V11B 2VUTA 4L78A 4E3WA 5KSOA 1PUXA 3SXPA 4QJIA 1V3QE 2HU8A 2CHQA 2MSKA 1OFIA 2MINA 3KXKA 1JWLA 1CR6A 1MTOA 4FTWA 4MRMB 4ZI7F 1U5BB 5LDGA 2Y92A 1E2GA 1S9DA 4OLHA 3T94A 1YB7A 3IERA 4MI3A 1OXSC 4ZJYA 3AIKA 3KO8A 3PD0A 2ZBFA 4HJXA 3MLEA 4ETNA 1G3IA 5AKIA 3IOEA 1KU6A 2AJDA 2ILTA 2DPGA 3T5PA 2GKSA 3E9CA 1MGPA 4KQCA 2JGDA 1IOVA 1TX4B 2R11A 3NTOA 1XNGA 4RY0A 3T5BA 4BU0A 4BBAA 5A06A 3NFYA 2MYTA 3RK0A 4QOJA 4D6PA 3D1VA 3LIPA 2YWGA 4DNQA 2X40A 1DGQA 1KPHA 1W0CA 2CVOA 1JG7A 3BJIC 2Q3JA 1EUCB 1JUDA 3WZ2A 3HDQA 2EERA 2H54A 3KYCB 5EJ6A 3B9QA 3M5PA 4B4UA 3KPVA 1OHHA 4LGMA 4DREA 4DNOA 2C00A 4DR4B 4YDRA 2FQYA 2QMYA 4HZUA 4E5MA 4WGGA 3WOHA