3WIOA

Crystal structure of osd14 in complex with hydroxy d-ring
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
265
structure length
265
Chain Sequence
AKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of strigolactone perception by DWARF14
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
molecule keywords Probable strigolactone esterase D14
total genus 85
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wioA00
4C6HA 3I28A 3WK4A 2BAGA 4FLFA 5E2IA 4N8DA 1JJFA 4AZ3A 5ALKA 4ZV7A 2HU5A 4A16A 2XMZA 3R3ZA 1BEEA 3VDXA 2C58A 3C6BA 2ZJ6A 3GA7A 3JYHA 5AOBA 2RGUA 3D5EA 2RHTA 3C5WP 3Q0TA 4M0EA 5J3JA 1YA8A 5EHXA 1H22A 2VEOA 1QGED 3O9MA 4PO3X 3IUMA 3SK0A 1LLFA 3RK4A 1LPSA 1XZIA 5D3ZA 5ALHA 1DWQA 1CFJA 4B9AA 2BUAA 3FVTA 2ORYA 1LPAB 4E11A 2WTMA 4IO0A 2XLCA 1FFCA 3T52A 4L9AA 3GFFA 5K3CA 1LBSA 1DQYA 1GQSA 4BVJA 4DLNA 4AO7A 4EHBA 5LYYA 3BL8A 5AM3A 2AXEA 4H7FA 1GQRA 3WJ2A 5ALWA 3FYUB 3MGAA 3E0XA 4MQMA 3H2KA 4DTCA 2DHCA 2R8BA 1XKLA 1QLWA 5ALTA 3HSSA 1HQDA 1QIMA 5K3BA 2OPHA 3FYUC 3QMMA 4PSUA 4CCWA 4IH9A 1K6EA 3IULA 1ORWA 4QA9A 3WIOA 4LXIA 5FXMA 4B9EA 1Q0RA 2JGJA 3LS2A 4X95A 3W06A 1TKRA 3BF7A 1XZGA 3WZMA 4DMHA 4H7HA 2C4HA 1BN7A 4U2CA 3I2IA 5JZ9A 1XRNA 2WJ4A 2WHQA 2JGEA 2V96A 1QO9A 1ODCA 3A2LA 3HC7A 2J3QA 2JEZA 3DL4A 4KE8A 3STXA 1SCIA 3IA2A 3DEAA 4BCDA 5BV7A 3BWXA 1QO7A 2XMRA 1QZ3A 3F67A 4KAJA 1P0IA 3O9VA 3HZOA 2HADA 1MU0A 4MYDA 5HFNA 4HXGA 4MQLA 1A8QA 3WK8A 1XKTA 2CKMA 2ZSIA 5ALGA 5DTIA 3D3NA 1BEZA 3HJUA 4UBOA 1AGYA 5IVDA 5DTJA 4DMKA 1TQHA 1MAHA 3QITA 4NZZA 2QKYA 4DGQA 4MWTA 1U2EA 4FNGA 4X93A 2C0QA 1E66A 2PUJA 5AKGA 4XVCA 1LGYA 3ESAA 4P93A 3ESBA 4G8DA 2WG1A 1YB6A 5I8PA 2PX6A 4C4XA 4JH0A 2WSLA 5DYYA 4U2GA 1C4XA 3DL7A 3W9BA 1XRMA 5EFZA 3H2JA 3PICA 1QIJA 5DWDA 3OG9A 4HXEB 2HRQA 4J0KA 1AC5A 4H7IA 2K2QB 2GYUA 1XZBA 3QMWA 2WUEA 4HVTA 3D2BA 2JGFA 4FTWA 5SYMA 1JI3A 2J4FA 4ETWA 4Y9SA 1LNSA 1UKBA 4G9EA 1L7AA 1C7IA 4UBKA 3BIWA 4CG3A 3QZUA 1ZD3A 3G9UA 1MX1A 4F0JA 4PQEA 4NMWA 3P2MA 1BE0A 1WPRA 3O4IA 2QMQA 1GPKA 2CJPA 1MT3A 2B9VA 2FJ0A 2Y1KA 5A2GA 3BIXA 1QIGA 2QM0A 4Q82A 5T4EA 4KRXA 1EDDA 4I3FA 5CT4A 2HIHA 5AKKA 1N1MA 1AKNA 4G4IA 1CQZA 1OCEA 3S8YA 4HRYA 4CCYB 1TAHA 4BE4A 1G42A 1ZD4A 5HK9A 4LXGA 5AKZA 3PI6A 5AJHA 7YASA 5JAOA 1SCKA 3B3QA 4PV7A 4DNFA 2JEYA 2WILA 2WHPA 4UFNA 3FSGD 3W04A 4FHZA 2JF0A 3BXPA 3ZV7A 3WL7A 4OYLA 4DM7A 2D5LA 3AILA 3WKEA 3R3XA 3DDUA 3ZPXA 2QT9A 2VT6A 1EVQA 4M0MA 1USWA 5CT6A 5LKRA 1TCBA 4U2FA 2ZVDA 4X00A 2BGRA 2ACEA 3WWOA 4AXBA 3QPDA 3SX4A 5BOVA 4BVKA 3WL8A 2OLEA 2G5PA 4X90A 3RARA 2GBCA 2BFNA 1DT5A 3H17A 2LIPA 4X71A 4G5XA 2XE4A 3BE8A 1CUVA 2XUDA 1TRHA 3O4JA 1LPOA 3PUIA 2XDWA 2RIPA 2ZYRA 4UHCA 3C6ZA 2OCGA 2FJPA 1GPNA 5ALRA 2OGSA 3FOBA 1HL7A 2PSEA 3AZPA 5LP1A 5LZ9A 4UUQA 3M82A 1PV1A 3WKBA 3H2HA 3QH4A 4BTLA 3VVLA 1VOTA 1VE7A 1LPMA 3AIMA 3A2MA 5AKJA 3G0DA 1H2YA 2WIGA 1R1DA 5JD6A 4W1QA 1M33A 3L1JA 1H2XA 4Q3OA 5DNUA 2WUGA 1EDBA 4DIUA 1EH5A 2ZYIA 4V2IA 2DR0A 1HLGA 2XMCA 4U2EA 1VZ2A 4P9NA 4X6UA 1MN6A 2JIDA 4OU4A 2HA4A 3QBJA 1CRLA 3C6YA 4G9GA 5AM0A 4K2AA 1U65A 2BGNA 1FFEA 5SYNA 4RGYA 1WOMA 2PPLA 5CXUA 6YASA 2DQYA 5ALMA 2XI4A 2QOEA 2FX5A 5AIBA 4LXHA 2E3JA 3UUFA 2OG1A 5KREA 3WA6A 4EY5A 5FKJA 1CUBA 3IBTA 4X94A 1F0NA 1J2EA 2VA9A 1W75A 1A88A 4C88A 1GXSA 2WTNA 4BYMA 1RWQA 1A8SA 5ALNA 4X85A 4GEGA 5EIHA 4CIBA 2DSNA 5K3EA 1EB9A 1QFMA 4NS4A 5E4JA 5A62A 4HRXA 4RE5A 1E5TA 4PSDA 3FSGA 2Z8ZA 1ACLA 3WZLA 1VZ3A 5CH5A 4PSCA 3C43A 5EGNA 4UBNA 3WLAA 1Q0ZA 4QDUA 4HZGA 2H1IA 3DNMA 2D0DA 4KE9A 5T4HA 3HACA 4QNNA 1QOZA 3VJMA 4Y2PA 5DNVA 4DNOA 3IUJA 1MJ5A 5C7YA 2OAGA 2X8BA 3CXUA 3HRHA 5CT8A 2WIDA 3B12A 1YASA 2QR5A 4ARBA 4AO8A 5AOAA 3TRDA 5FP0A 1CPYA 3WKDA 5ALSA 3IURA 2VJAA 4WCVA 2GYVA 1XFDA 3X3HA 2XQIA 1CUJA 3OM8A 3STWA 4DNPA 2OGZA 4JYMA 3TGLA 3OC0A 2V97A 5AP9A 4IH4A 3H2GA 2DHEA 5CXXA 3OOSA 4W1PA 4UPDA 1T2NA 4J0GA 4UHHA 1VLQA 1HDEA 3A6ZA 1PJAA 4F21A 3WQHA 3VVMA 3HLKA 4QLAA 5JASA 4IQ4A 3WWCA 1ZI6A 5ALPA 1BROA 1ZI9A 3BF8A 4QWWA 3D59A 2OCIA 1ZIXA 1BCSA 5AM4A 4YPVA 2P8SA 3PUHA 2QS9A 3UMJA 5I7UA 4DSZA 5AK6A 3N2ZB 4B0OA 2VJBA 3FWHA 1EB8A 2QRUA 3BDIA 3RKSA 1B41A 4BC0A 4AZ0A 4QDZA 3EF3A 1Q84A 4C4ZA 3G9TA 1YS1X 1THGA 2VATA 1ZICA 2GZSA 1HKHA 3WWEA 2YYSA 3LLCA 3AFIA 3D0KA 1JKMA 1UKAA 4PF1A 2O2IA 1DWOA 3LCRA 1J1IA 1WB6A 3U1TA 3MUOA 2WUDA 5AO9A 1U8EA 4S0XA 2AJ8A 4ZV9A 1CUDA 3DQZA 4N8SA 1XZCA 4B81A 1QIIA 5JZBA 2PSFA 3PF8A 1Y7IA 5D7BA 1FFBA 5JAPA 2WFLA 4FBLA 4OD0A 2DHDA 1BS9A 5AHXA 3PDCA 1XZDA 1LBTA 5K5EA 3I2HA 4H7EA 4GECA 3E3AA 5IH7A 1X70A 4A23A 2HA5A 3D2CA 4FMPA 1IZ8A 2CZQA 1L7QA 4E15A 1AZWA 5JYCA 5FV4A 3VXKA 3ZLTA 1FFAA 4RE6A 1XRQA 1DTEA 5DYTA 1DX4A 2X5XA 1WCYA 5AI8A 1X2BA 5HF8A 4Y2RA 3STUA 4MYSA 3NOXA 1LPPA 5CW2A 4D9JA 1S8OA 1UOQA 3I2JA 4Q3LA 5AI9A 3HABA 1MNAA 2H7YA 5JAHA 4WY8A 2VSQA 4ZXFA 1XLWA 4LHEA 1UK7A 4AN1A 1L7RA 3FCYA 4DNQA 4MEBA 1YAHA 4Y2XA 4Y2QA 3F98A 4J0JA 3I2GA 1IMJA 2QUBA 3R3VA 5CURA 5ALIA 3ZLVA 2XUAA 5LZ4A 1CVLA 3V1NA 4O08A 1B6GA 3A2NA 5AKXA 4GWLA 1E3QA 1KEZA 3D7RA 1ZGBA 1K4YA 3I6YA 5K3AA 4K5QA 4XJVA 1LZLA 1AURA 5HF6A 3R3UA 1R3DA 4W63A 4QZVA 1XROA 2XT0A 3EQ7A 4BZWA 1JU3A 4AN0A 5AOCA 4UFPA 2ACKA 2VTVA 2HU8A 1EHYA 5AI5A 1GZ7A 3DYIA 3PF9A 3R0VA 3M3DA 2WM2A 4OYYA 5A6VA 2Q0XA 5HKAA 4KE6A 2V9ZA 5CH3A 4XX1A 1D07A 1VKHA 3KWFA 1ISPA 4TPKA 3K2IA 3C8HA 2B20A 2PBLA 3G0IA 1XZJA 5JATA 5JD4A 1CUUA 1XRRA 4Y2YA 1DT3A 5C8ZA 3H19A 4DMFA 4FFVA 4OUKX 3G9XA 4Q05A 1E8MA 2VT7A 5FPQA 4UBLA 5HF9A 4X97A 5C81A 3F9CA 1LPBB 2J3DA 4Y2TA 1IUNA 3I2FA 1UKCA 1WHSA 3FCXA 4MJ3A 3STTA 2XMDA 2WIKA 1J06A 5FRDA 5AK3A 5HQ3B 3E4DA 2Z3ZA 4LYEA 5YASA 1XZEA 1QFSA 4EY4A 4KRYA 3KD2A 2HFKA 4W1RA 1UOOA 2OCLA 4EBBA 1AX9A 1W4LA 5FOQA 2CB9A 2Y2VA 3JW8A 2PU5A 1G4HA 2DQZA 4BDTA 3WWDA 2OQVA 3F97A 4H7DA 1CQWA 3WK5A 2Z8XA 2CMFA 4BC1A 2QZPA 4WDQA 3I2KA 1K5PA 1YAJA 3V1MA 4N8EA 2IX9A 2HRRA 2XUIA 4C01A 2G4LA 4KACA 3TJMA 1G5FA 1XQWA 2PM8A 4FOLA 1FSSA 1IUPA 4NVRA 4QE3A 4X3CA 5HCUA 3DLTA 2ZSHA 4MEAA 3IB3A 3T4UA 1VA4A 4UFOA 5KWIA 3VKFA 4QLOA 1XQYA 4J03A 3TEJA 4KAFA 3F96A 4FDMA 3C8DA 4G8BA 5AM1A 5AK4A 1XZKA 1XRLA 3NUZA 5JD5A 3GELA 3VJLA 4DSAA 1EI9A 3IDAA 4GXNA 4BCBA 5HZGA 3RM3A 1E8DA 4BTVA 5KWJA 3I6MA 1UOPA 2QXTA 4Y2VA 5JZSA 4OB8A 2Z5GA 5AI0A 3FLBA 3O4HA 3D2AA 2I3DA 2Z3WA 2XUFA 2QVBA 5LZ7A 4H77A 1UK8A 5AI4A 2GYWA 3G0GA 1CUZA 5AKYA 2C5GA 3C70A 2WUFA 4EUSA 2WKWA 4H35A 1AQLA 3HYSA 2HA7A 1E89A 4FBMA 1VXRA 2G5TA 1JMYA 4L72A 4QDXA 3Q8WA 2B61A 1QIHA 3WJ1A 5IKXA 1K63A 1N5MA 5HK8A 2RONA 3I1YA 3GBSA 1GKKA 4Y7DA 5AKHA 1XZLA 3M83A 2HA0A 2XQFA 3AINA 3ESCA 2XB6A 3C45A 1BCRA 2OQIA 3ESDA 5ALOA 4AQDA 1OILA 3G0BA 2CBGA 1SCQA 4M0FA 2WFLB 4KE7A 4U2BA 4ZRDA 5K3FA 1XQXA 4FKBA 2PKYX 1QIEA 1YA4A 4OU5A 4BB0A 3HXKA 5C8VA 2ES4A 4TVKA 3H0CA 4LYDA 4WDRA 4AMZA 1EDEA 2AJBA 2O2HA 1EX9A 4WFKA 4B80A 2UZ0A 3QPCA 2XMSA 2I3ZA 5EI5A 3KDAA 4MWSA 4BZZA 2W6CX 5F4ZA 2VF2A 5EHZA 5FUMA 1CIJA 2C7BA 1O6FA 2PU7A 1EK2A 5HFAA 1QIDA 4E14A 3PE6A 3LP5A 5ALUA 3OTQA 4YASA 1CUIA 2B4KA 1CR6A 2BKLA 3WK9A 3VJKA 2PUHA 1SC9A 4AX4A 1RYYA 3EQ8A 1A8UA 1MPXA 5EHQA 4F5ZA 3CCBA 1KU0A 3WMRA 1UFOA 5HQ3A 2XMQA 2WFMA 1F0PA 3WL5A 4J0HA 3QVMA 5ALFA 4H18A 3MUNA 1R9NA 1AMNA 5CRIA 3O4GA 2WIFA 2WHPB 3AZQA 3R41A 4QWMA 1JJIA 5LZ5A 5CBKA 1K8QA 1XLVA 3C6XA 5AIAA 5BWBA 2XUHA 2GBFA 5CTAA 1IVYA 3ED1A 2VJDA 2JGLA 3ICWA 1I6WA 3FNBA 5JAUA 4I19A 3U0VA 2XMGA 2O7VA 1VXOA 1ZJ5A 1MAAA 2V98A 5DNWA 3H04A 2XUJA 3QMVA 3H18A 4OCZA 1CUCA 5AKIA 3FYTA 4FFWA 2HFJA 1DWPA 4E46A 3A70A 1CUAA 5CH8A 2PVSA 2O7RA 4MXDA 3OURA 1EK1A 3V1KA 1W6RA 3G7NA 2AJCA 5AK5A 3CCCA 4I4CA 4B82A 1QIKA 4EA6A 1UXOA 1LZKA 2XQKA 2HU7A 4Y2SA 5ALXA 4HAIA 1MX5A 5DJ5A 3WKCA 2ROQA 5JANA 4U2DA 1BU8A 2R11A 1SFRA 4AO6A 4KEAA 5E4TA 2IIVA 2VAXA 4W1SA 4ARAA 1IZ7A 3S2ZA 2GBIA 3O0DA 1THTA 3BDVA 1R88A 4ZREA 1JMKC 5T4FA 4ITVA 3ZWQA 5AKLA 2PL5A 5LZ2A 5LZ8A 2XQJA 2XUKA 1GKLA 4UHBA 1PFQA 4B6GA 1JFRA 2EDCA 2AJDA 1UZAA 5A71A 3RLIA 4PNZA 5D6OA 5EHNA 4CG2A 1W52X 2J4CA 4J3JA 5AICA 3EBLA 3GROA 5E4YA 2ZJFA 3R3YA 4OPMA 4BATA 5A7FA 4BBZA 4BE9A 1ODSA 1P0PA 2HA6A 3E1GA 1NU8A 2RI6A 5ALZA 2HA2A 2C5FA 5ALVA 1N5RA 4XWGA 3QPAA 2RAUA 3DCNA 4B0PA 4CG1A 2BCEA 4G1FA 5HF5A 2QUAA 3ZI7A 4TGLA 3B5EA 1E8NA 1Z68A 3M81A 2PSHA 2WFZA 4X6XA 1XQVA 3G8YA 5EIAA 2HL6A 5AI6A 2RHWA 3NWOA 3R40A 5DLPA 3JWEA 2ZYSA 2HA3A 4GLBA 4WFJA 4BAUA 1HBJA 3WIBA 4ZWNA 5IVHA 4UHDA 1NU6A 1ETHA 2WJ6A 4UHEA 2NW6A 4EY8A 1ODTC 3LIIA 2WLSA 3FBWA 3WWPA 5CMLA 5AM5A 5IVKA 4J0DA 1SOMA 1EINA 4C4YA 3KXPA 4XIIA 1DX6A 4FNMA 5CT9A 1DU4A 5K3DA 5FPPA 4CIAA 4WY5A 3H1BA 2H7XA 2OAEA 1DINA 2OCKA 1TK3A 4JNCA 3KWJA 4JEIA 2JGMA 4BP8A 4UBIA 5A7GA 5ALDA 3WL6A 3WKAA 3DYVA 3V48A 1QONA 3G0CA 1BN6A 2IITA 2XUGA 2OXEA 2Y6VA 2CUTA 3N0TA 4BAZA 4DYHA 1ACJA 1OXMA 4Q3KA 5ALYA 3BJMA 2XQGA 4K6HA 2HM7A 4BP9A 4AB1A 3V9AA 4LIPD 4BCCA 1U4NA 4QDOA 4Y2JA 3OPMA 1Y37A 3C87A 3G02A 2O2GA 3HI4A 5ISMA 1CUSA 3VISA 1YCDA 1GPLA 4N5IX 4GBGA 5JIBA 1NX9A 4YK7A 4IH1A 2X76A 5D3KA 4UBMA 1C7JA 4L0CA 4X7BA 2WHRA 3F8SA 4GW3A 4C87A 3DKRA 1H2ZA 5ALQA 4KR0A 1AUOA 2XUOA 2JBWA 2HDWA 2XUPA 5AKEA 4B7ZA 1R9MA 1A7UA 2I03A 4CFSA 3H1AA 2YASA 4G8CA 4B83A 1W76A 4OSEA 1JT2A 1QTRA 1H23A 1UT6A 5JARA 4EB0A 3K6KA 2DCMA 4F60A 5LLSA 3PFCA 2JGIA 5CT5A 5FDFA 4HTAA 4G4GA 4FLMA 4CCYA 4K6GA 1XZAA 3UUEA 3AUKA 1YS2X 3FLEA 4H7KA 1Q83A 4JYPA 3WK7A 5ALJA 4X91A 2QXUA 4GHWA 4JUIA 1UK9A 4HS9A 3AIKA 4AMYA 1WPXA 1CV2A 2ONCA 4BDSA 1ZD2P 4UBJA 3I1IA 2HHAA 1CUYA 5HKBA 4ROTA 3CN7A 3STYA 4FWBA 5T4BA 4EY7A 1ZIYA 1ZGCA 4P08A 4BVLA 1BRTA 4Q1VA 1ZJ4A 3AIOA 5IVIA 1JU4A 1ORVA 3WYDA 3FLAA 5JADA 2QJRA 1UK6A 2OGTA 3DS8A 3NGMA 2WU4A 1RP1A 3KOOA 3C5VA 3WI7A 2Y2UA 1WB4A 1F8UA 2WG0A 1F6WA 1CUFA 3DOHA 3DOIA 4KAAA 1J07A 3IUQA 2WQZA 4G4JA 1ZD5A 4KJXA 4Z49A 1VA5A 4ZGBA 4B85A 1XZFA 3IUNA 4J0IA 3PFBA 4Y2UA 4GDMA 4CI9A 3ANTA 2EEPA 2Y6UA 1WHTA 4WFIA 1HPLA 1N8SA 2AJLI 4B84A 3WYNA 2FUKA 1CUHA 3QYJA 1H2WA 3MVEA 4OB7A 4BRZA 2VJCA 4X92A 3HEAA 4EZIA 2BUBA 3QM1A 3LIPA 2XMBA 1CUWA 5ALEA 5JALA 4P92A 3FAKA 3BJRA 2PSJA 5BWCA 2PSDA 1CUXA 1IUOA 4PW0A 3W9UA 3ILSA 1MX9A 3ANSA 1TIBA 3D4LA 1QIFA 5DYWA 4EY6A 2ZJ7A 1XZMA 3DKKA 1R50A 1QTIA 1O6GA 1DQZA 4H0CA 2BJHA 2QJWA 5LKAA 3CN9A 1YSCA 4X6YA 1FFDA 2GZRA 5FLKA 3O95A 1CUGA 1QE3A 3AZOA 3WK6A 5A7HA 4J0CA 1CEXA 4J7AA 1XRPA 1VJ5A 4ZI5A 1YR2A 4IHAA 3FYUA 3EIOA 3V1LA 4A5SA 2XUQA 1MO2A 1TCAA 2YXPX 1ZOIA 2QTBA 5LIPA 1GT6A 1LPNA 4Q34A 1R4ZA 2WG2A 2C0PA 5AH0A 2ECFA 4LKOA 2G63A 3L1HA 3STVA 5KBYA 1YB7A 1ZI8A 3FVRA 2WJ3A 3GZJA 3AJAA 4UHFA 3EQ9A 1Y7HA 4RPCA 1T4MA 3DD5A 4H7JA 1EA5A 3GUUA 4YX9A 1CLEA 1P0QA 4QEKA 5ALLA 3WA7A 1EXWA 4QDTA 1P0MA 4BRSA 5C8XA 3K9BA 3IVMA 4N5HX 3H2IA 3KSRA 3SC2A 1MTZA 3I6ZA 1CUEA 5K3FB 3W2TA 2XLBA 1G66A 1UWCA 1VE6A 5ESRA 2VAVA 4C89A 2YH2A 2W22A 1EVEA 3ICVA 4L3WA 4RNCA 2H7CA 3R3WA 1TCCA 4DMCA 3L1IA 2DFPA 2I78A 1GGVA 3YASA 3ZLUA 1XZHA 2H9YA 3IIIA 4HXFB 1FJ2A 4FLEA 2CEKA 4KYVA 1XLUA 5I9IA 4W9RA 1MNQA 3DJYA 4INZA 1QJ4A 4GI1A 5AM2A 2WIJA 1WM1A 3G9ZA 5EIEA 1X2EA 2WU3A 2JGKA 2BUCA 4WJLA 1WB5A 4BAGA 4OB6A 3SWWA 3W05A 1W1IA 2ZYHA 1KU6A 2GBGA 2EDAA 5H3HA 1JJBA 2VQ6A 4K6KA
chains in the Genus database with same CATH superfamily
1E2HA 1NDQA 4OXYA 3QEBZ 3WK4A 1XBTA 4EX6A 2OGWA 5HBGA 1JJFA 1RBMA 1JR3E 3LCJA 2AEJA 2XOKD 1BTOA 4HI0E 1FS4A 4EMSA 2J08A 1IXZA 2ZROA 3JQ9C 4ZV7A 5K4GA 4DV7B 5DM0A 1LBEA 4ZYZA 2N1BA 3HB4X 4P83A 4A16A 2XMZA 3R3ZA 4IM7A 1D7OA 2D2FA 3M6VA 2NMVA 5LCXA 1BKDR 1XTJA 5CLJA 3M6IA 3RG8A 4DV3B 3Q6NA 1RXWA 2O3TA 4I3GA 1YV9A 2C04A 3DQQA 1JJVA 1FJHA 1QBGA 3JQAA 1IY2A 3UKDA 3LUAA 4EG5A 1NJFA 2DULA 3Q0TA 5DYNA 1E4YA 3UGQA 2PZ8A 2ZSJA 1OY1A 3KTFA 4D79A 1Z7WA 1JSLA 2ZJ4A 2AG6A 4YN3A 5G2OA 2NYRA 3U3DA 5H3LA 2ZR0A 3CX6A 3HHPA 3SQXA 3HWSA 4DLAA 2C5LA 2OHIA 3DPIA 4PO3X 5I5GA 1R8JA 2ODEA 4PINA 3L3BA 4X63A 3PR1A 1XA3A 4QXMA 4JP3A 1KIFA 1RJ9B 1LY1A 2QM8A 3PXEA 5I4BA 3BTOA 4IP0A 1DWQA 2ZIVB 4OHWA 4PVDA 5TQJA 3RROA 3A9CA 4A15A 3QEAZ 2IS1A 2GPBA 5CCDA 1G98A 2VO1A 4TRJA 2CGEA 1PNTA 1JE0A 5CGQB 1ST2A 3KB1A 1TGVA 3OFKA 4OQYA 4EW1A 2CZGA 5EOVA 2XLCA 3KQOA 4BGUA 3OQOA 1FFCA 3GNSA 2PNJA 2J48A 4DA6A 1ZGHA 1VPDA 2WOJA 3GFFA 4HGRA 1GZHB 1J09A 2GHTA 3TW0A 3R7FA 4RZIA 1HT0A 3KEQA 4XGNA 3REQA 2W6OA 3GJQA 3FF4A 3UG7A 4BVJA 1RLJA 4X60A 4FINA 1TZBA 4JYAB 1Q0HA 5LYYA 3RUPA 3GJXC 3WJ2A 1DTWA 1UMDA 2I6XA 4O4LB 5ALWA 5DRYA 3A4VA 5D3QA 3W1WA 2P7HA 1WTAA 4DCMA 1DIBA 3QV2A 1ZN9A 1AD2A 1K27A 2CDCA 3O8DA 4MUGA 5L8VA 4OEHA 4RESA 2K7ZA 3HSSA 1ML3A 3MJSA 5ALTA 3LVQE 4OKNA 3CRW1 2JJ1D 2VNKA 4L76A 5K3BA 2OPHA 3WOVA 1DOAA 1EWVA 2NGRA 1YF3A 2BEVA 3VI3B 4EQZA 3BORA 3VR6D 1MJNA 5DNDA 3M3HA 1CRPA 4WW0A 3S5JA 1RKXA 1CF2O 2A30A 2WYVA 4J4TA 4U3JB 3UV6A 4P58A 1HZJA 5KVCA 2CV2A 1XCOA 2WKPA 1XYYA 2QE7A 3M2PA 3LLUA 4LXIA 4EEZA 4GKKB 4WMLA 4ANFA 3GJ5A 1Q0RA 1K7YA 4Y9DA 4RLHA 2BH9A 3PNSA 1KY5A 4WLVA 2ZB2A 4YAJA 4Z5XA 2BE9A 2C95A 3QKRB 4I5DA 3B3FA 3VV3A 1ZC3A 1H2BA 2D0IA 1Y5NA 2VRWA 1XZGA 3WV5A 3NBFA 4G84A 4I46A 3L43A 1B00A 2ZJBA 3H97A 4NPHA 4CR8A 3FCUB 4IFIA 1WSBA 5KAMA 4JI1B 1FP2A 2DUMA 1UPUA 2I87A 2YNMA 3OOJA 1R0LA 1DJOA 1B6SA 4JJ8A 4E5DA 1K0UA 2QMHA 4IIUA 3FKJA 3PENA 3GQBA 4TYPA 1FQKA 1QHHB 2Q45A 2SKCA 4GVLA 1C3OA 4Y2HA 4X62B 5KO2A 1QO9A 4PLGA 2JD0A 3ISVA 3GZNA 3VKGA 1LK7A 2J3QA 3BUSA 1B15A 3HVUA 5FI5A 3S81A 2AQKA 2N9UA 3NT5A 4RQUA 1SIUA 3THWB 2RH4A 4KE8A 4BKRA 4PC3A 2EJVA 2VHYA 3EZGA 4F91B 3HDHA 1CHDA 1U8FO 3T9BA 4GZ6A 4DB4A 2ETVA 2LR0A 3ENWA 2IIPA 4ZT7A 4ZKDA 1NN0A 1W87A 1CK4A 4Z9XA 4MIEA 4O29A 1C30B 2JARA 4B6PA 5HIJA 4EG4A 4M1MA 3ZGXA 2AS0A 1ZXLA 2H1WA 4YV2A 3L6OO 3HDVA 1GN9A 4QBIA 4BBJA 2C8VA 3ND7A 4LVCA 1P0IA 2UUAB 1PL0A 4HGNA 1T5LA 1MU0A 2Q3BA 1WXDA 4MQLA 4N3CA 4M89A 3N9IA 4P3KA 5DTMA 4MHTA 2F9MA 4PBTA 3WK8A 2CKMA 1P73A 2EWVA 5LQAA 2PKQP 3MYYA 2PUTA 4JP5A 1H5NA 2NYAA 3NTQA 2H5JA 3QFHA 4R2IA 1E6KA 5JWHA 4A6XA 2IEZA 2QQGA 3D3NA 5CDFE 1BEZA 3HJUA 1WUKS 2B9EA 1SQ6A 4HVAA 4L9WA 1T1RA 2C61A 3W8EA 4BWVA 4DCVA 2GSWA 4X61A 4CM9A 1W25A 1QKIA 5KNDH 3UO8B 4YP5A 5F9FA 3AKDA 4V03A 3RVOA 1L8AA 4UQLA 2O6HA 3IELA 1CBUA 1NASA 5TMPA 2GN4A 2ODTX 2I4LA 4IY1A 1TQHA 4G01B 1CIPA 3QITA 3ESXA 5FOSA 4A9AA 2X6RA 2Z43A 2ZUFA 3T9CA 2CFTA 4I4TF 4DADA 5I7VA 1K4MA 1YR7A 1I8TA 4FNGA 2AI3A 1I1NA 1TT5A 3GT4A 3T0GA 4A8JC 1QZZA 2V7BA 2FNAA 4C0LA 4DDUA 2VXCA 4JFAA 2X0DA 4XVCA 4QXRA 2O8DB 2B0JA 3J7TA 1I36A 1OYYA 3ENZA 4DSOA 4XXHA 2AOTB 1P2FA 4G8DA 2F1OA 2Z2ZA 1NURA 2WG1A 3CRQA 1D0IA 3DYBA 3GLTA 2X3UA 1YB6A 4ZC8A 4I55A 3W6PA 2PX6A 4JJAA 5H8WA 1E61A 4JH0A 1LUAA 1KK3A 3HR8A 1JEYA 1I9GA 1DDGA 1NVDA 2HT6A 2XJ4A 4OLJA 5E9JA 3SOZA 4NOLA 2HWXA 3LY5A 1E9DA 1UC4B 2Q4TA 5TVGA 2FFBA 1VKRA 3KZNA 1D2MA 4NV3A 1IL0A 4U00A 4QGSA 5FUWA 4OX9Y 2F4VB 1KI6A 3T7EA 3K0HA 5F1OA 2GZ3A 4PC7A 1ECCA 5LA6F 3WGLA 1QHYA 2IUYA 3UCFA 4AY3A 5B64A 3ANYB 3GWGA 2VHJA 3OEYA 5JSYA 2RE8A 2BEKA 2AG1A 4BFTA 5FFMA 3PICA 3C5EA 3PFWO 1SR8A 2G4VA 1VRCA 2PANA 1ISSA 4KQEA 4PZDA 4V2UA 1ZKMA 4WLOA 4HXEB 2NO4A 2O8CA 4Y1FA 5EZ6B 3FTNA 3LRXA 4JYBA 5BN5A 3TX6A 1AZSC 3OZXA 4J0KA 1AC5A 1KVTA 1H4TA 3K0BA 2FKAA 5CCXA 1BD3A 1E3JA 2ZE5A 2C5BA 3E9RA 3I42A 3ZQ6A 3VJRA 2GYUA 5KQRA 3AVTA 4CUZA 4A4DA 1XZBA 4ZC1A 3QMWA 4M98A 1ULTA 1Z4PX 2P2SA 3D2BA 1ISRA 2VUTA 4IEEA 3VTAA 3ADCA 1G41A 1ZY2A 2ET6A 3L82B 4DCUA 4RTSA 2VQEB 2FQ1A 3IEPA 4XGIA 4Y9SA 3OQPA 2PKQO 3ZWAA 1PF7E 3UMYA 1UKBA 2GBPA 2P5YA 3A1VA 1KDZA 3O8NA 3ABOB 4JU9A 5FHQA 3E5RA 2JS7A 5IT0A 1Q7TA 1QNFA 4IDAA 4S2UA 4UEWA 4BP1A 1EJBA 1CR0A 3G6KA 5C9ZA 4KI7A 5DHRA 5JPCA 1KH3A 3BIWA 4BEBA 4JI8B 2I54A 4LZWA 4CMJA 2CJXA 2NSLA 4LC1A 3UJAA 4G26A 1OZAA 1YZUA 2D5BA 2FZVA 3ZNPA 3C3MA 4GLFA 3ZHBA 1E6CA 2P69A 1ZD3A 3DE1X 1U2RA 2BBWA 2Z3VA 3T94A 1MX1A 4BGEA 4PQEA 1FDOA 1G18A 3P2MA 3QE9Y 4KLZA 4WLFA 3M9LA 3O8OA 5F1KA 3DE5X 3RVJA 2NQ8A 3ENVA 1FXUA 1B2LA 2J3JA 2CJPA 1AA6A 2DBVO 4ATNA 4GMFA 4XX0A 2XOKA 3VH2A 3AQIA 3EIWA 4YJKA 3CRMA 1U8XX 1HYGA 3I4LA 1CZNA 2PX8A 3HUUA 5AK0A 3I9V6 4DAEA 1NNEA 4LWOA 5KMGA 1Z6XA 1YU6A 4LWZA 2G0AA 3OEWA 2QM0A 1G7SA 3RC9A 4YQEA 3QVWA 3KOMA 1HLFA 3EJ6A 4YDHB 2RGNA 1NVGA 2J3EA 3H5LA 1MB2A 3HBAA 3SC6A 1TKCA 3OF5A 4G4IA 4MS3B 1CQZA 2W2VA 4MOWA 3RREA 5BN5B 5TXGA 4ZOQI 1SZDA 5HM6A 3S8YA 2OQRA 2IODA 1AVTA 3PFIA 4TKLA 1G5RA 3E53A 4HRYA 2P3SA 4HH4A 3BB1A 3G2NA 4GLJA 3PFHA 2EV9A 4OQEA 3RVRA 4DANA 5FI1B 2RI1A 1SKYE 4F38A 3ESZA 3AU9A 3DM9B 1ICIA 3P9ZA 4B32A 2HMUA 5DHUA 1XDGA 2QNIA 4ERNA 1UZMA 4U7PB 1GIAA 1SCKA 3PLNA 4LZLA 2HUPA 5J1TB 4R41A 1R0SA 5DNCA 1G2IA 1WXGA 3MTJA 2RB5A 3JQ7A 2ZLBA 1WB9A 1SOUA 1ND6A 3S0JA 4C3UA 4AKEA 2FE4A 1E58A 3O4RA 3DKIA 3FSGD 4K40A 4RJIA 3W04A 3FCCA 4FHZA 1EA7A 4OI2A 1QS0B 3N3BC 4E21A 4N65A 4OYLA 1TUEA 4X6LA 1QRSA 3ETEA 2D5LA 1SVOA 4K0KB 2FPIA 1KRWA 2VPTA 5F73A 1L7PA 3AILA 4RIGA 4L4SA 4AROA 3Q3GE 4C29A 4D43A 3AVVA 3MCWA 4N0PA 1HDRA 4PZZA 5GZ3A 1NQWA 1CVIA 1WW2A 3WKEA 1U0FA 3H3JA 2HIAA 1Y0BA 2HKIA 1OZFA 2OOSA 3L4BC 4KMMA 3WFZA 4E03A 4NZYA 1GCOA 2VT6A 2AH5A 1Y3IA 4FD2A 4LBYA 5HDBB 2ZS8A 3T8YA 1USWA 1QV7A 2DPMA 2XB9A 3VR2D 3DA8A 3EMDA 1DKRA 4A26A 5LKRA 2NN3C 2ZVDA 3FUXA 2E6KA 3OLQA 4XJSA 3F3SA 3HJBA 3UJDA 4XKJA 2XD9A 3IMCA 3SX4A 3MNFA 1CT9A 3WWOA 4C5BA 2ISSD 1FFYA 3M8KA 4WD3A 1U6JA 3RBZA 4BO9A 1TEVA 3NETA 3WL8A 1BW9A 2OLEA 5E6SB 3WRWA 1DBPA 3PSHA 2YXDA 4J75A 2QD4A 1U7UA 1UFVA 1HE2A 2FN4A 3AFGA 4QBHA 2G70A 3HVKA 3E58A 1JXAA 1RRFA 3D8HA 4GI3A 1N92A 1YR3A 2AA3A 4IZHA 5IK2A 5PNTA 5TGZA 3V7WA 5F7XA 4Q24A 2AL7A 5SV2A 2L2QA 1T5HX 2C82A 4H60A 3SHQA 4ER0A 1PHRA 4LF7B 4X71A 4DQUA 3ZUGA 2CVHA 4RSGA 1VQ1A 1G21E 3K6SB 4ZOAA 1CUVA 4D81A 3VC1A 1C1HA 3DFIA 1IBRA 3ISJA 5LM3A 3OWOA 2GRJA 2D7JA 2QVGA 4MWZA 3AW8A 2IHKA 2ZDQA 3O4JA 2UYOA 4R1SA 5BOSA 5TPZA 3RRNA 2WLTA 2XDWA 2CFSA 4FS8A 1R6DA 3W77A 3UB4A 2BN4A 1E1RA 1OLUB 2VTKA 4RM2A 2ZYRA 4DLSA 2ACWA 3H87A 2RK4A 5TX7A 2A5FA 3II6X 1REQB 3P52A 2OGSA 2B37A 5ALRA 1VL6A 4L5CA 5LQRA 3FOBA 4D3SA 3AW9A 4FFNA 4QTZA 3NV7A 4Y3UA 1UXKA 3Q5GA 1EFVA 3EW9A 1OI7A 2O2DA 4B44A 4CG0A 1R6TA 2P41A 3OLWA 4UUQA 1C1XA 3VR1A 2W93A 2WNIA 4RK6A 5LP1A 3NR2A 4N3GA 4N39A 5B3JC 5IABA 1PV1A 3WKBA 1PD1A 3T54A 3D0RA 2EGGA 4I4NA 3DFKA 4IFEA 3VI4B 5D84A 4BTLA 4JEMA 4V0QA 4JAVC 1PYOA 2Z83A 3AIMA 4IJMA 2YMPA 3A2MA 3I61A 4IXNA 1JG2A 2H4WA 1H2YA 1PEDA 5LUAA 1GR1A 3HDTA 3ZDFA 1G0NA 3G3EA 4IDBA 1R1DA 1NDHA 2CN1A 4C3ZA 1Z5OA 1VKZA 3O3CA 3VR5H 3KE8A 4LF9B 1NLYA 1SY7A 4C4RA 2BPOA 3K0SA 1JB9A 2R1TA 4Q3OA 2C9ZA 2MYTA 2ZATA 1Q1NA 1EDBA 1RJGA 2VK4A 4TWBA 2DTXA 1JLRA 4QGBA 2V54A 3E22B 3HWX1 2B82A 4ND1A 4ITUA 1PZMA 1QVZA 1V9LA 4JT8A 2DYKA 4V2IA 4KFCA 1Z12A 1Z6ZA 5JCJD 4B3RB 1WP9A 4MK4A 3VNAA 1WHSB 2XMCA 1SCBA 2O2XA 2EFDB 1P9LA 4KITB 4MKZA 4P9NA 4F6CA 3CZ4A 2HA4A 3DTVB 1WCIB 2UZ1A 3AHHA 3F5QA 4MRPA 3HN6A 5F5NA 1NBMA 3DZ8A 3ND6A 2DT8A 5CIWA 3UK7A 4D0SA 5JCZA 1CRLA 4AJIA 3AMVA 1K97A 1V2HE 3HN2A 1KI8A 1UPFA 1NV8A 2H11A 2I80A 4ZQBA 1KQOA 1Z18A 2ZSUA 4MGZR 5I9MA 3RASA 3RT9A 1N0HA 4JX9A 1FFEA 2H4FA 2VWHA 3PCXA 4K3VA 1WMEA 5JFTA 3ADPA 5M29A 2VRBA 3I30X 4OQFA 4BO1A 3MT9A 1NUUA 5SYNA 4R81A 1VL5A 3EDYA 3REQB 1Z4LA 4YMTA 4N5DA 1P0FA 2OHOA 3WZ2A 1C41A 2EJBA 2PPLA 2VHXA 4GQAA 4OUDB 3S8MA 4PANA 4ACAA 1E99A 5KJ1A 1CRZA 3KYBA 5TQ2A 2QM3A 2WWHA 4I9HA 1CJBA 5IKEA 3ZWOA 1R15A 1KC1A 2OYSA 1TOAA 3I39X 5GQSA 3WQBA 2DQYA 2OBXA 2VSNA 2XI4A 3GJ7A 4ZQHA 3AM5A 3ZE8A 5AIBA 1Y3CE 1FCJA 1CIVA 3H05A 2YWHA 3B51X 1Y9ZA 3UUFA 4YRJA 4ARUA 5DWQA 3U4QB 3NHYA 4N41A 3R3SA 3KAPA 1NSFA 1RJDA 1SHJA 1DP4A 2G0TA 2J8ZA 3E9YA 4MR8A 4UNIA 3TVYA 3KKQA 1T3HA 2R85A 4UAUA 5AUQA 5C2JB 2GWHA 3K1ZA 3NPMA 1HK7A 1NHWA 1XKQA 1J2EA 1FRZA 1YWGO 4TMVA 4Q4AA 2BMEA 2P40A 5IMBA 3M6LA 2FP3A 1CQXA 1FYFA 4KDRA 1VBNA 2OQ2A 2VAWA 2O0JA 4MVJM 3GLFB 2FMHA 2ZB8A 3CUYA 5BN3B 2WTNA 3PFNA 1M1XB 3JQ6A 2PNFA 5ULLA 3UMSA 3C3WA 1I5EA 4XASA 5DM4A 5ALNA 2FOXA 4X85A 2VNHA 3G1UA 3NANA 4CIBA 3GGGA 4ZO7A 5K3EA 1V7ZA 5ER9A 1WP4A 5KNCD 1XDBA 2QN6A 2WKRA 2A9QA 3HUFA 4EFMA 4NS4A 1PVOA 1YE8A 2PT7A 5A62A 4BWGA 2EKDA 3NHBA 1F2UB 3U4HA 2QTCA 1E2LA 2BM0A 3DEIA 3N0VA 1R5OA 3BJEA 5GVRA 2CLCX 2Z8ZA 1EQUA 1NKSA 3B1XA 1WQ3A 3BRWA 3N0WA 4TXJA 3WZLA 2C3OA 2J0VA 4PXSA 3L6UA 2VJQA 2IZOA 2QD1A 3GP5A 4GL4A 4YLYA 1YTUA 3OF2A 4LHZA 5AD1A 4F45A 2Y99A 5B1HA 1BZYA 1HG1A 5EGNA 4Z7QB 4UBNA 1HZZA 2P6OA 1MC4A 2W2KA 4FS3A 2XE8A 1JL3A 3EDMA 4QDUA 3T3NA 2H1IA 4I08A 2OMEA 4WADA 3FVWA 3ZD9A 4LRYA 2IU3A 4KE9A 4J7XA 1MDFA 3DR5A 5T4HA 4R1QA 2B2NA 1FP4B 3HACA 1FZTA 2X22A 3NIDB 5HILA 4UMDA 5BNFA 4M54A 3UWOA 3QVKA 3SQNA 4W5QA 1UQUA 2ODAA 5FUYA 1L4LA 1HMYA 2I33A 2ZT8A 3DZCA 3IKLA 3R7AA 4B3HA 1CCWA 4MLZA 2GHIA 2H63A 3VOTA 3EULA 2YKGA 1DJLA 3PQ4A 4QVKA 2HI0A 4EFDA 3BE6A 4M2LA 1N0IA 5HUHA 5CB8A 2BFOA 3B12A 1YASA 5B30A 1SBHA 1K6IA 1YB1A 2QR5A 4GI5A 2PMBA 4IHJA 3DMTA 1FLNA 1T1SA 5KEIA 2O8VA 4HVLA 4MVJG 4GOMD 5JXHA 1S4QA 1KO8A 1QPBA 1N8KA 4N82A 1SVLA 1IK4A 1PGJA 3IURA 2PGJA 3WJ7A 3T1VA 2AR0A 4BNHA 3EC2A 2WABA 3K16A 1RWPA 4FDAA 2JD1A 1U0OC 3L79A 2TSYB 1Z5ZA 1YULA 4KVZA 3TSOA 4KCGA 5A5GA 2ZXUA 2XQIA 4KRFA 4GPEA 1TU3A 3V8MA 2ZREA 3ETCA 5CAEB 3STWA 4AS1A 2V8OA 2FWAA 1OUMA 2OO3A 4IV8A 5JEDA 3OC0A 3P9NA 4JVLA 5AP9A 2OR3A 4MS1B 5BURA 1UIMA 2E89A 1BIFA 3RS9A 4FMBB 4MAMA 1X94A 1JHYA 1HRDA 3OOSA 1OXXK 2X40A 3ZV5A 2HHHB 4GMHA 5FFNA 1T3GA 2EZUA 5FNVA 3IMEA 4DRXB 2QY9A 2H54A 4WK4B 2WWIA 1VLQA 3M33A 4IQ0A 1UBEA 2I29A 3N74A 3PIRA 4HWKA 1A9ZA 2WZQA 1XO1A 4HK4A 4QHSA 4EPYA 1RAAA 1M1UA 3HLKA 4IKOA 4IQ4A 4TT3D 4A92A 2OD7A 4K6CA 4B3XA 2ZIGA 5KDDA 3H7AA 3DMHA 1Y48E 3V4FA 1RYDA 1QVRA 3DGEC 5TRTA 4A7PA 4EKEA 1BMDA 4JUCA 4KYTA 3V5NA 5HGXA 3DWIA 1D04A 4QWWA 3D59A 5L3ZA 4C30A 2X2PA 4YREA 5IJ9B 3U44B 1SXPA 2UXDB 1AO3A 2H52A 3IDZA 1BSVA 5ENVA 4YPVA 2CXHA 3PLAE 2P8SA 2E55A 4MUEA 3ELUA 1WUYA 3PUHA 1O77A 4FGUA 2QS9A 2YQZA 5DLEA 1EGQA 3UMJA 1N2EA 1X80A 1PQUA 3COYA 4TSFA 1MKYA 2JLCA 4Q3NA 3JR3A 4H1UA 4P7GA 4B0OA 3ZLBA 3MHTA 3KUUA 4XIGS 3E84A 1ISMA 3FDIA 1H66A 4MQBA 1Z36A 5FWXA 3E9CA 2QRUA 1PLLA 4NCXA 3S3TA 4IG4A 1D5WA 1NUPA 1QVVA 1B41A 3AFNA 3AEXA 1IZ9A 1JVBA 1GEGA 1VE5A 1UBUS 4KH0A 4A2CA 1F8GA 1DWUA 3QEMB 3QX7A 4UU1A 4INOA 5C18A 3K8YA 4DIBA 3IHWA 4LRUA 1YIDA 4O1IA 3AR7A 2FW8A 4BB6A 5JWRA 2QQEA 3T12A 3U3MA 1Q0UA 3B9RA 1DKMA 1Y9EA 1V5IA 1UMKA 1YQWA 2LCFA 3X2EA 4CM1A 5KIAA 1KGSA 3FHOA 4N0EA 2DQSA 1QGAA 2CZCA 3AUXA 2RK3A 1CQJB 2C88A 3P0FA 2J5QA 5ADUS 2DKFA 3RKRA 3GUZA 2R1VB 3ITNA 4PZUA 4R5HA 4NP6A 2GZSA 2OPBA 2PYIA 1JYSA 1YZYA 2Q6IA 2UZAA 2YFKA 1BVHA 4QTUB 1E3EA 2YYSA 3BTVA 2FB9A 1JKMA 2IV7A 2O2IA 2C99A 3MELA 1JIKA 1HNNA 1XWFA 3JRXA 1J1IA 1GOTA 3HADA 1KQPA 3N59A 3NBAA 3NDIA 3ZQ4A 1WB6A 4X1YB 4H59A 2BTQA 2RBGA 4E5VA 4BEWA 3HCAA 3PXBA 3ETHA 4CM5A 4QQ8A 1MB9A 4J94A 3MUOA 5IHPA 2NO7A 1QK4A 2WUDA 1KI9A 5JHHB 1H4QA 1F7UA 5JW6A 3IOYA 2EVWX 4KQFA 5LJIA 4MCIA 3HCOA 3CZCA 2NU6B 4RTQA 1BDJA 1U8EA 2J5BA 4OAQA 3L07A 4BKPA 4TLCA 2WV9A 2YMLA 3BYZA 4F5WA 1QMGA 2CK3D 3G7UA 5CG1A 5K99A 1CUDA 4W5OA 5GONA 3KUCA 4I5FA 1XZCA 5I4CA 3HKDA 1YE5A 4XOUA 2GPNA 4BKMA 3CNOA 3EB9A 1TK2A 4N4AA 4PG4A 1C9MA 2ILTA 2A1IA 5E6RA 1T15A 2G5CA 3AY7A 1K08A 3OM9A 4WCFA 4AY5A 1VCOA 4F2DA 1QUEA 1PJRA 1Z08A 2C8LA 4HZUA 4RQTA 5J2TB 2ZI9A 1BS9A 4CN9A 1KSGA 5AHXA 1VKJA 3PEYA 3CM0A 2W70A 3AGQA 4PZPA 3UWPA 5AR1A 3L1KA 3PDCA 2CB0A 1EFHA 1LBTA 1CTQA 1O58A 1QYXA 2HXYA 3MTGA 2HBRA 4H7EA 1MH1A 4QOFA 2CY0A 4CMHA 1E2FA 1GTSA 2WHYA 3PEVA 4B31A 2WSMA 2AQHA 2FPGB 1L7DA 1F3OA 1GL7A 1DFGA 3WLIA 4FMPA 5K51A 1P1KA 5F2KA 4HPWA 1EFTA 2QV0A 4PYQA 3ZX5A 4NBVA 4F12A 2WF7A 3M6XA 1Q2UA 1F51E 1KYVA 2CZQA 3WIDA 4GLLA 1OAAA 1MO6A 4HBZA 4CZ2A 2HPZA 3ONFA 4KIGA 3VXKA 1LDBA 1FYVA 3DUWA 4K05A 5G02A 3K2EA 1SMKA 4LJ9A 5CB6A 3UK0A 3ZLTA 2QSUA 1XNQB 2HF8A 1ZH0A 2W5UA 4ER3A 1A8IA 3LF1A 4CIVA 2HSDA 5L4LA 4YAOA 4DUPA 2CNWD 3TI7A 3B1KA 4FKZA 1XRQA 1SB8A 3VVBA 4CMIA 1GGFA 1DX4A 2IPAB 1RJFA 2X5XA 4X41A 4RFSB 3E2MA 3S7TA 4B4UA 1RW4A 4PTYA 5AQ1A 5LQNA 1GADO 1ZS9A 3A11A 4TMYA 2QN1A 4MKXA 1GL6A 3AF2A 5CW2A 4D9JA 2QNRA 3H9BA 1UOQA 1FE8A 4UREA 2QX8A 4Q3LA 5AI9A 3HABA 3LOPA 1TMKA 3ICOA 4W7SA 2B1RA 4NEGA 3F6SA 4HS4A 1W0JA 1RP7A 2X7XA 1Q0LA 2QL5A 3VRHA 1W94A 1YA6A 4LHEA 3VUFA 4X24A 4BIIA 1I80A 4FFDA 1NF2A 3PU6A 1L7RA 3RRZA 1GUYA 4M49A 3A9VA 1Z22A 3KQSA 4KV7A 4TRNA 4DDKA 1LF5A 4KFRA 3KQNA 3CPJB 4R7GA 2GZAA 3GDOA 1YZLA 3EISA 4UEOA 4OI0A 2IS2A 3VJMA 1KDVA 5ARBA 2XNDA 4Y2GA 2GAIA 4CGZA 3FPEA 4RVOA 1HE4A 1Q1ZA 3KDPA 1HYHA 1OU4A 1DDIA 3V2GA 4G65A 3EQ2A 1IMJA 4HEA1 1F8FA 3VO2A 1SBQA 4MLDA 1N5LA 3OZFA 1QS0A 2AN1A 2FEOA 3GVCA 4MWOA 2IYEA 2HBYA 5EMMA 4HEQA 4YBRA 3RC3A 2KE5A 1V1JA 3R77A 3NHUA 1CVLA 2XCOA 3OOHA 1H8ED 4WNAA 3JQ8B 4PS0A 3T6KA 3N58A 3Q7QA 3WB9A 3WLPA 3V7FA 2X6QA 3RU2A 2JVJA 3H4IA 3WHPA 1P9WA 1E0KA 1B74A 1T0PA 1ABFA 4B5LA 2HDOA 4D9EA 2I99A 3FSEA 1TYBE 1TMYA 3AF5A 4Y1GA 3BH7A 3IQGX 1CZLA 2AGVA 1EE1A 4K5QA 3IT0A 4F93B 6REQB 1S9HA 1U1DA 3RODA 2G9VA 1FYXA 1YVEI 1S8FA 2FWNA 1U2ZA 4HYYA 4FX2A 5AVYA 1AURA 3ZKAA 2ZZMA 3VUEA 3R3UA 2YWGA 3UJBA 4EUEA 5ED0A 1S2GA 4D9BA 4RWZA 1OVMA 1J24A 2VL7A 5B2EA 1PWHA 3WGYA 4I4LA 3B6IA 2PWZA 1DO8A 2WJYA 1ZL0A 2X42A 4V0RA 1MRNA 1PT9A 2B30A 2P9QA 1UBTS 2C4VA 3FMOB 4GPAA 5JTUA 1BVUA 1BOOA 5E6UA 1PK9A 1EHYA 1QH1A 1SBCA 1VGRA 2Q5OA 2YWBA 3D3WB 1RQ2A 3EUFA 3GEGA 3PF9A 2WM3A 4J91A 5HHTA 1H1TA 3N6VA 3QEKA 3T1HB 2ZJ2A 3M3DA 5DTEA 1W36C 1VP3A 2JVIA 2WM2A 5E1MA 1YFZA 2R96A 1GTZA 1H1LA 2JFQA 1ZWLA 2CWWA 3A9UA 5IAOA 3EC1A 1A77A 5T57A 3VPGA 1I7QB 1EWYA 1SXHA 1OPRA 5DBGA 4MR7B 2EHJA 2V9ZA 3MRTA 3GLHE 1VHWA 4KK4A 3ZY6A 3SQDA 2NUPA 3KELA 4F9TA 2IZZA 2JJYA 3JAWB 3KXKA 1VKHA 4XJXA 3T99A 5I51A 2IT1A 3EGVA 3DEKA 3GGCA 4US1R 5KX5B 2JI7A 2RGGA 3WLKX 2ZYGA 3EVEA 4JB0A 3FTFA 4F3TA 1OTHA 4H3HB 1U28A 2IY9A 3TPFA 5BWOA 1A9RA 3IMFA 4L0MA 3ROMA 2FUNB 2QVCA 4LDZA 1BC5A 4FGWA 3S28A 3QWAA 1U5AA 1CUUA 1NBHA 2W4IA 5FUVA 1ZOLA 2ECPA 2YN2A 3MA0A 9GPBA 4QPDA 1Q7BA 3CUTA 2C5EA 4MR9A 5I7EA 5LIRA 1ZHOA 3HGMA 1JUDA 3QXGA 4N76A 5F5XA 3HXMA 1O7JA 2IOQA 4BX9A 1V26A 1XHLA 2I7DA 4DMFA 4KNYA 1LSOA 3OZEA 2IHZA 3OOWA 4R0VA 4ZD6A 1J70A 2P2ZA 3COPA 1ZFNA 3H5TA 1OASA 3CRZA 4Q37A 1E5VA 3WADA 4HRVA 1W581 4CR6A 4PZYA 1WW8A 5JH7F 1LC0A 1ZSNA 2BM8A 3FIJA 4B3IA 3W3ZB 1PV4A 1LPBB 3ESQA 4HDRA 2CNNA 1GNSA 2J3DA 4LSZA 4OP3A 5BR1A 1E1DA 3QYFA 4P7FA 1L1QA 3E8MA 1UWLA 3QKWA 2PVCA 2HWWA 1UKCA 3KO8A 5MDHA 4HQNA 4F3CA 4YP1A 3GXOA 4RTNA 1QWSA 3LDFA 4MJ3A 1ZRNA 1NRJB 4NU0A 1IY9A 3LDGA 1MOZA 4OOFA 4WKBA 1G5PA 1SG6A 1PJ4A 3FNRA 1LVUA 4QTTB 3B2QA 3KIPA 2YTZA 4UDXX 4G4SP 1AQ6A 3KJFA 4MW5A 4CU5A 2HFKA 4MEJA 3U3ZA 1UXHA 4W1RA 4JB8A 2VSXA 2GZ2A 1SBTA 3B3AA 3P4XA 1JYEA 1P5JA 1E63A 2VBIA 4A2QA 3T4PA 1Z0DA 4RTJA 3P0HA 2ZJ0A 1AX9A 1U0JA 3Q41A 2R62A 3AHGA 2J3LA 3GLFE 5JJLA 4IHQA 2HIGA 1YHYA 4IKPA 4AM8A 2HZ7A 2I1WA 4FEGA 7ADHA 4GKAA 2Y2VA 1VGQA 4FYWA 2CXTA 2PU5A 4I8IA 3VR4A 2FUG6 3MJVA 2E82A 1SUFA 1T3TA 3EUAA 5JCXA 1N78A 1JJ7A 2GTPA 3WWDA 4PG5A 3FOWA 1NJ5A 1L7XA 3RSOA 3VX3A 4IX9A 4HGPA 1OZGA 2FW9A 1NW8A 3GQVA 3V8RA 4MAAA 2XIJA 3PNMA 5FJJA 3DMFA 2ZDGA 2VLIA 3C24A 4ND5A 2Z8XA 2CMFA 1D09A 1I2ZA 2GXUA 3MJCA 4I50B 2ZAMA 2B3DA 2Q0SA 3GAMA 2IYSA 3OFNA 1OBHA 3SDBA 1QQBA 1RQXA 4CQLB 4PC2A 1BE8A 1R5JA 1VE1A 4AS3A 3T3DA 3QI7A 4OQXA 1Z2OX 1K5PA 2AC7A 3RJ9A 5H4GA 4K0RA 1QFYA 2CVZA 2PS9A 3IRUA 4LJ7A 1Z34A 1XF9A 4N8EA 3V1MA 1AXRA 4D9MA 1CEQA 2GLUA 4U3JA 3LLVA 4Y1RB 4X9XA 4CV0A 5BV2P 3NP7A 2ZRMA 3TJMA 3PX2A 1Y8RB 4ZCMA 4N5LA 4EENA 2DUNA 5KNBD 1IUPA 3WLMA 3V55A 3ONWA 1T2UA 3CONA 3F8TA 4QE3A 4MVJP 2AN3A 2YY7A 4MPJA 4RJLA 1TC2A 3MIIA 4EJ2A 3K53A 3WTCA 1V35A 2NQTA 2ZWAA 2GF0A 4LGVA 4BIMA 3DLTA 3IRVA 2IU6A 2R65A 3DBRA 3NWJA 4K2HA 1NX6A 4AQYB 3S44A 1FTSA 1VA4A 3H8JA 4XD2A 4WL0A 4D80A 4TZ6A 1ZRSA 4PIMA 2JEOA 4UTZA 4XYGA 3C97A 3OJOA 2VDKB 3F96A 3HHEA 1LA2A 3UT0A 3C8DA 4EUHA 4F8YA 3OU7A 3LECA 5T8KC 3ZWXA 4DBVO 3SF8A 4V1CA 3A04A 1OXTA 1XZKA 1RJWA 2XJ9A 1XMOB 4JI0B 4P81A 3ZIAD 1Z0UA 1BMFD 5JQGF 5JD5A 4JROA 3VJLA 2BZ0A 2N1MA 5HDQA 5BMOA 2INGX 1O6ZA 1XHFA 1WD7A 4FJ2A 5HZGA 2PL9A 1E8DA 5KWJA 1UOPA 3OLVA 5KVQA 5K20A 3U9SA 3GEPA 3IUYA 4HNGA 4WNYA 4ROSA 4YRZA 3ER9A 5AI0A 1T5DX 5TT0A 3PE4A 4WOKA 3MCVA 1HE3A 2GZ1A 2Q5HA 3BPSA 1FZQA 3AR5A 5ANRB 5JE8A 5KNLA 2NO5A 1B16A 1BWSA 1DS6A 1XMJA 1XWWA 2C1XA 2ZS9A 3PDHA 2ANBA 2BZGA 4NBSA 4AO6A 3IR6A 5KSZA 2I3DA 3I4FA 4GQIA 5IDXA 3LHIA 3RYHA 3EXG1 2QVBA 1R16A 5KSWB 4LDQA 1OI4A 4Z86A 3TMYA 2PWPA 5CYPA 2GZDA 2H1FA 3BDAA 1JE1A 2HJHA 2O8CB 4WPGA 3Q40A 3IERA 4JS0A 5BSMA 3H11B 1GNVA 4R8SA 1UK8A 2F9LA 3ZVNA 5CIQA 3RIYA 4DM4A 4MV9A 4EJ6A 5K0ZA 3TW6A 5EZYA 4R16A 3C70A 5HJ7A 3QLEA 2ZPAA 2IBSA 4EUSA 3EVDA 3PYMA 4HQKA 4DR2B 3NVKI 2WKWA 5FAXA 4KTTE 5KCMA 3RYIB 4CQJA 3AWIA 5IYZA 1N2GA 5LMZA 1OT3A 4HF7A 3CZ9A 1SCNE 2HA7A 4PR0A 3TBFA 1J8FA 3P94A 3JQCA 4R7ZA 1PQPA 1CJSA 2G5TA 2YR0A 1QZUA 4G5YA 5IHXA 4KUEA 3OU2A 3AL0C 5DCWA 1NYQA 1NP7A 4TMKA 5G0UA 1BHO1 1FB5A 3PQDA 1HDOA 4YJHB 4ETIA 1UDRA 1LWOA 4KJZA 4JI2B 1NRIA 2HV8A 1EK6A 2D54A 4GX0A 4A6PA 2A88A 2MSEB 3Q8WA 2J5KA 5TEVA 3ZE2B 4QQRA 3GPLA 4TN5A 1NW6A 2Q62A 3M9WA 2A33A 2D7CA 2EGHA 1UBFA 1QHGA 1NVBA 5AW0A 2O8DA 1M2WA 4N7BA 1K63A 4XJTA 2XWJI 2VYCA 3O1HB 3BFPA 2XRFA 2I0FA 3GRKA 3Q3IA 1WUHS 2OVBA 5BN4A 3T1YB 3VR5D 2HTFA 4ZJYA 3I0NA 2UUCB 2A7XA 2CHEA 1FXWA 2HA0A 1W48A 3BL6A 3NHAA 4JKOA 3UVEA 1E2NA 2QXYA 2QAGB 3SIPA 3E9EA 1CETA 4RJKA 2VYNA 5HEKA 2XB6A 3EZ7A 5BR8B 2EEZA 5D00A 4BVGA 3HLTA 5DFAA 1GYRA 3QF4A 3TQSA 2W00A 1BCRA 4W8GA 1EDOA 1I2AA 1ODLA 1N4AA 3ZWPA 4CETA 1GGHA 3U7FB 4PZ0A 2QQFA 3EQ6A 1MB3A 4DUZB 1DIRA 1SCQA 3QTBA 3MJDA 1Q22A 3TM5A 5EGSA 3B13B 4ZRDA 4OP2A 1EXMA 3T5MA 2WHXA 1HDCA 1HSOA 3V42A 4BFUA 4BMYA 4BZPA 3E5MA 4QQKA 1WXIA 2CJWA 2ZI5A 2AFRA 4ZQEA 4JP1A 3S2FA 1L7BA 2Q6LA 1EBBA 3VPHA 1WRBA 3K32A 4DPMA 4EB3A 1I0LA 1YA4A 4OU5A 4D8WA 2XA2A 4FOOA 1N34B 4C0WA 1Q5PA 3GFQA 3TIVA 3V4RA 3RAPR 1IC6A 1Y9AA 3NNNA 2V65A 2EBHX 1L5GB 4QULA 4E2FA 3MD0A 4KQ1A 1L7EA 1XZNA 2DBYA 1Z4IA 2QLTA 4IFBA 4RKEA 2QVXX 1T0UA 1FU8A 2YIJA 3W4KA 4AMZA 4WZAA 5G1NA 4JMLA 4BQQA 1T34A 1VCHA 2NAPA 2WMDA 3AEZA 3B2EA 3OPNA 2NUTA 2J6IA 5AVSA 2JDID 4PYMA 5BO5A 2AVDA 3GZNB 1RXIA 4IIJF 4WUTA 1SC3A 4GX5A 5DBEX 4M1SA 4GYKA 1M6VA 2IXEA 1RXCA 3EVTA 3SEFA 4G1EB 3VPFA 4D9KA 2CNLA 5EI5A 3KDAA 3QW4B 4J0EA 1YQ9A 1YS6A 1B8PA 4HMPA 2XXAA 5I7AA 4CLDA 4AF8A 1RWMA 3C8ZA 5F4ZA 4RL6A 1JDSA 2D1RA 3NBKA 4M7OA 3UXEA 2HMAA 5EMNA 2BEUB 4RMJA 2A9VA 2AT1A 3CVYA 4WK0B 2C7BA 4XTRA 3SYMA 2QTGA 4WAUA 4WVFA 2ZJ5A 2O5EA 1AUPA 2IY7A 2QENA 3GEHA 3OMXA 4J4BA 1EK2A 4NPCA 4CTJA 3VH4A 4ZRNA 4I6GA 1L5RA 2IDMA 4AVYA 4EL5A 3RV4A 5EQJB 3CLSD 3F7TA 3N8KA 3T0IA 4ZQFA 1DOHA 3I83A 1U11A 3PHCA 3LP5A 5ALUA 1LW6E 1VHJA 5G0SA 3R0XA 4QKQA 3ZHRA 1X1BA 2ZRJA 3GVXA 4O5AA 1H9AA 3KYDA 2AG5A 2B4KA 5GM2A 2PUEA 1CR6A 2HBQA 1EUDB 3QPWA 3K8QA 1NI3A 4HLQB 4MUAA 5CP8A 4F3RA 2VJMA 5FUQA 3D8SA 4DCGA 1QF7A 1F8XA 1SC9A 2EX4A 3SBEA 3C41J 3FRJA 4HY3A 4LMRA 4W9NC 4PYKA 4D0NA 4KVFA 1JN0A 1TZJA 4XVUA 4B48A 1BOFA 1EVKA 1IZ0A 3K15A 1L5LA 3GK3A 3V3TA 3L8MA 1C14A 4MV4A 2B25A 1ZJZA 2JCSA 1TO2E 2M1XA 3TPCA 4H6PA 5HQ3A 4GZLA 2QTWB 3EEBA 2IZ5A 4RY2A 3I8OA 3LYAA 3IAS1 3ZHXA 2QW1A 1OWOA 4ZEMA 3ZLJA 2XADA 4O4JB 3JU3A 3ZQKA 3MUNA 3WDLA 4EHFA 1DKPA 1YXMA 4LJYA 3P1JA 4X66B 2FPSA 4I1YA 4YB8A 2WIFA 2IYUA 1UXGA 5IJ9A 3OEEA 3U44A 3VO1A 3R5JA 5M34A 3R41A 4MV6A 4LWPA 4QWMA 4B35A 3EWNA 5DW3A 2VCEA 5JO9A 4BFCA 1IBLB 3HB5X 2JVKA 4MRVA 3DZJA 4C78A 1K8QA 1Y42X 2HSWA 3C6XA 1A5TA 1Z8DA 2HGZA 2GM9A 1MENA 4UUAA 4A6DA 4K1LA 3BMOB 3DP7A 2HSZA 5C8YA 2ZI7A 1M6VB 3CZQA 4IQ8A 4LC9A 5FA5A 1O4VA 1L4YA 4FSXA 4NIMA 5BWBA 2GBFA 3LX4A 2V0CA 3HM9A 1G3UA 2IBTA 3GIWA 5CTAA 4V1CB 2P9CA 1PX0A 3I01M 2VHUA 2YWJA 4FX5A 4O2BA 2W2TA 3PHJA 3RS3A 3DP9A 2VJDA 1HURA 1PFUA 1RQPA 1RE0A 2IDZA 5CYOA 4HLDA 2FWIA 1ZH2A 3ICWA 3FNBA 4QJBA 4JI5B 3GEMA 3LVRE 2XCUA 2YW9A 3GJ8A 3RFVA 5IFLA 1Y3FE 2J07A 3PC8A 3DG9A 4W9MC 4J0FA 1KPGA 2AD5A 1ULUA 5G1OA 3R75A 3U0VA 5I6DA 4J3NA 3TRHA 1BD4A 1VKOA 2Y05A 3I5MA 4J7UA 4NAVA 5EFOA 4IJ6A 3VNQA 1GPDG 2H1SA 1XAGA 3HU1A 4I6JA 2V98A 2VJNA 3CEHA 4LOHA 3EPHA 3WSVA 2IEAA 3L7CA 3L7YA 4WNCA 3O92A 1CUCA 5AVQA 5F7JA 4HDMB 1A2BA 1JSCA 3IAHA 4TWJA 1LK0A 3A36A 2ZIWB 3JQ8A 4RADA 1RHKA 1Z25A 2HFJA 4Y0NA 4MROA 4E46A 4FD3A 2PMDA 4HNHA 2UZ4A 2I3GA 2P62A 2PVSA 4K9NA 4F4HA 2RHHA 3QVSA 1CLUA 5KYYA 4GDFA 4TV8B 5JDIA 3OPYB 2I65A 4DY4A 1KYTA 3G7NA 2P65A 5JUWA 3AY6A 4RGBA 2FFQA 2BFFB 3OEHD 2GVNA 2CT8A 3AY0A 1TZ2A 4L75A 5EESA 1CX9B 1ZJJA 1M10A 1ECPA 3BC1A 3CKKA 3WP0A 3TTVA 3KJZA 2NZVG 4O1HA 4UM5A 3HDYA 3JD4A 1PS0A 5D8DA 2E1RA 3L7DA 4I4CA 1IB0A 1SKAA 3SXJA 4M38A 2FRXA 1YKGA 3FPGA 3NYIA 4MIOA 1YK1A 3ZGLA 4B82A 2QJTA 4OJMX 4A0QA 4ZHQA 3WFJA 3L92A 4PLTA 1OKKD 3MN1A 1RWXA 3OZGA 5DJ5A 4ALLA 1RHJA 1QP7A 4OX9B 1BU8A 2QTVB 2VHWA 4ILEA 1FDRA 1TLTA 2JZNA 2R11A 3BHJA 4P3OA 3UENA 3ZBQA 1DIOB 2RJ3A 2YBEA 1DLJA 4K3UA 2IIVA 3RFTA 3L7LA 2QVYX 4JFRA 4QAJA 1MHPA 2ZYDA 3LKDA 4M0PA 4O59O 4O2BB 1DRWA 1D2RA 1SM4A 3PA8A 1THTA 5AJUA 1A9YA 3RFCA 3I04M 1XTVA 1ENZA 2IUFA 2NV6A 3NWBA 2HRZA 3I9NA 4OXRA 1AUVA 3BDVA 3HU3A 1FLAA 3L0BA 2UZIR 4NRDA 4ZU1X 5AUOB 3DTYA 1R88A 2KWIA 3HKCA 4PLCA 1BXGB 1QCYA 2PLAA 5KTYA 4MR7A 5GJBA 1CB7A 4PSVA 4ZREA 3ZWQA 5LZ2A 4GXQA 1KDPA 4UEJA 5LZ8A 1EUCB 2WYIA 4C4PA 1E7WA 3G5MA 1D8AA 2XUKA 5G0TA 4UHBA 1W1WA 4JVOA 1HEUA 2DFKB 1NAHA 1DQPA 2FW7A 3A1TA 4PX3A 4LGYA 3RLIA 1S3SA 1SUCA 1ZCFA 5YASA 4EKDA 1ZEJA 4HG2A 1QQ6A 3T5TA 1XL1A 1TW3A 2WMOB 5AJVB 1NLUA 5CDFA 3GLGB 3BT7A 1LBHA 5FPKA 2FA9A 1UMBA 3R44A 1WL8A 5CLQA 1ZCBA 1RPNA 4LTNA 1W52X 4URUR 1EE9A 1SHUX 5DCLA 4ENSA 1M5RA 3UTCA 1CRQA 2IE0A 5EJGA 2OKGA 4CKBA 2PZAA 2YFHA 1E59A 1H8HA 4V3BA 2AOWA 3FMVA 5KSPA 2DB3A 1RQRA 4UCXA 2FGKA 1VMIA 5HG0A 2WUVA 2QUJA 5JSHA 3MJFA 5KOYA 2ZW9A 3KZXA 5A7FA 2JCXA 3TKLA 4AN4A 2QMEA 4KIJA 4L4ZA 1IWPB 1TA9A 1G9TA 1W4CA 2FP4A 3WDSA 4MYTA 3E1GA 3KLBA 2RI6A 2QX6A 3OQIA 4TLMB 3RJMA 3TIGA 2C5FA 5K0TA 3WFIA 2FMUA 3OX3A 1P8AA 4KO3S 5ALVA 3W6UA 3KQYA 5JVDB 4L1KA 3MT8A 4TZKA 2RKWA 1OVGA 3CX4A 3IT3A 4HNAB 1W35A 2WA1A 4QJ3A 1SBIA 5AVRA 4FCVA 2XIQA 3PC4A 1P9NA 2P6NA 5AXBA 3KEMA 4UC0A 3DJFA 1E32A 2NO1A 3DSRA 3PXAA 4JR0A 4KO4S 1XJQA 2B5VA 1GRRA 5EZYF 2QUAA 1V5GA 2BFDA 3ZI7A 2BMDA 4B3CA 3LZDA 1QJCA 3MJHA 1GPH1 3C8UA 1WCIA 4C4OA 3C3YA 3M81A 3OVMA 2ERYA 2I71A 2V3VA 3UWMA 1L5QA 3UOWA 3UT5A 3K1AB 2NU8A 4C2BA 4DWVA 2DHRA 3GJ4A 3PT5A 3GMTA 5KDOA 4PQYA 1GRQA 3FNQA 4AL4A 2C7VA 4JMPA 4URYR 2XTMA 5AI6A 3U3RA 2XVZA 3EZXA 2F3SA 1IYZA 3PQ8A 1HV8A 2OSBA 2NPOA 3NBMA 3KB8A 3SBOA 4D3ZA 1JKJB 2FQQA 4NCKA 1VMEA 4P32A 2CXUA 4ZU6X 2JNWA 4RC9A 5IT4A 1OU0A 2HQOA 1DBQA 1HBJA 3R5HA 2KM1A 1EK0A 2E4YA 3MRSA 4UVEA 3DAFA 1WF3A 3OIUA 3LKZA 4XRRA 5KI6A 3TLXA 5MFPA 3HXQA 1SU8A 4EG7A 3GAAA 5FTNA 5FEUA 5IN5A 1HNZB 1CY2A 2ZVPX 4R2HA 3DWGA 1BYUA 1O87A 4EY8A 2NW6A 1J2TA 1UT8A 1KJZA 4U7TB 1N9KA 2WLSA 5LSAA 4G0QA 1C3LA 2WHEA 5COQA 3DMYA 3DKVA 4X1OA 4DA7A 2F17A 3AUAA 2GS9A 5KC9A 3MGCA 4JZYA 3L0YA 5HKKD 3FDXA 2ORWA 1C3VA 5IVKA 4UNQA 4F85A 1AB6A 4D6XA 3OICA 1EINA 1T1EA 3NAQA 3W5JA 3G8AA 2FG6C 4FUTA 3X1KA 1TT7A 4XIIA 4C4YA 2IYRA 4IX1A 1OW3B 4YUWA 1DQRA 1JA0A 2E7ZA 2EQBA 2IOFA 3OFVA 4WZBA 1WMBA 3BD9A 4NATA 2CLHB 5IAAA 5DISB 2FJUA 1P29A 5IM5A 1C8VB 1F0KA 3DL0A 1KDTA 3U9TA 4DFDA 1VLMA 2ZJ1A 4WY5A 2Q9CA 3TLJA 4R01A 3MCUA 3OAAA 4N7RA 3PC6A 2Q3DA 1JI0A 1DXOA 1AK9A 4WGGA 3UN1A 4BO4A 3ZXYA 3RADC 3PNLA 5L3SA 1MQSA 1J0AA 2OVFA 2VK1A 3ORRA 1J8YF 2Q9BA 3ET5A 3KAKA 4GE3A 4HLCA 5FOVA 3M89A 2WKSA 4E0BA 2R00C 3LP6A 4Z9YA 2OCKA 3IPLA 3LK6A 4L15A 1T6NA 5BMVF 4L8LA 4FYPA 4XA8A 3B36A 4N9QA 2JGMA 1FVHA 3K1AA 1JBKA 4UBIA 3GLFA 3DNPA 3KL2A 4HRAA 5A7GA 2QLBA 4ZDJA 4M1OA 4Y9RA 4WTOA 5JZMA 3OKAA 3I4CA 2HRDA 1YFLA 3DV2A 3KJQA 3TQHA 3P9PA 1KZ6A 3WL6A 4L8GA 3SZGA 2HX1A 3V48A 1YJAA 4R8KA 1DC8A 3RUFA 3PXCX 4PR3A 1DIAA 3KS9A 1L4EA 1BN6A 1QCCA 1T8UA 1Z2NX 4FCTA 4JJKA 3RU3A 5KS2A 2FXIA 2QPAA 3S2EA 3DZFA 1I3CA 4YAIA 4DV6B 2AK2A 3I6IA 3AEKB 2CUTA 1XCLA 3N0TA 1CR1A 1YK0A 2GMWA 1GLGA 4BAZA 2A14A 1CNFA 2P7IA 3D2LA 3K9FC 2QL7A 3T38A 4IXMA 4F92B 4K6HA 4BLTA 1ARZA 2C9MA 1UC9A 5GJCA 5MF6A 2FWPA 1FUYB 4WRRA 4MP6A 1GNLA 4Y2JA 3Q7SA 5EG5A 4AUNA 2OXIA 3TAUA 3O03A 5H3CA 4OL0A 1RLMA 2GPJA 3EA5A 2ZB3A 4G1UC 2O2GA 4RHTA 3OZAA 5AYVA 5IN4A 1ZCJA 3C0KA 5G53C 1ILEA 2R00A 4CUJA 1RQLA 4LQCA 5E2AA 2FEKA 4Q7JB 3ROEA 5JIBA 2FPLA 3ZGOA 1PUJA 3TEMA 2IXTA 2OD2A 2WJIA 4LYAA 1JIQA 2R44A 4M53A 4YK7A 4WEOA 1HC7A 4Q3BA 3VU3A 4WCFB 2HGSA 1G291 4DIKA 3AI3A 4IRXA 1AKWA 2NTYC 1W5FA 1RKQA 3N87A 3EXIA 4NH0A 1Y82A 1A4IA 3PHBE 3VHQA 1JVSA 4X7BA 5JC8A 2WHRA 1UJ2A 1PE0A 5A05A 2HSGA 1FNNA 2X86A 2FSVC 3OJXA 4IUCS 4Q3CA 4MB0A 3AL3A 2UVQA 1JDZA 3PNPA 1T1JA 4XW2A 4BFVA 1H2ZA 1WQ4A 3GVHA 2CL6X 4KR0A 2XUOA 1WU7A 4V0KA 3TKAA 5KYGA 5EPEA 4WCDA 5AKEA 3CLUC 3D6NB 3NATA 4B7ZA 4BMOB 3UPTA 1A7UA 3C1AA 1C1DA 3PDIA 5IPFA 1U3TA 1RWOA 1X77A 3H1AA 3QVUA 2H51A 2H2AA 3ZC3A 1T6YA 3ZDAA 3P0IA 1PJBA 1CP3A 2VDRB 3EXEB 3VO9A 2QT0A 5LN1A 2MT9A 3PQ7A 1IXYA 1DI0A 1J0BA 3R6WA 2QLJA 3S2IA 2BP7B 1G8KA 2XXBA 3BMOA 4X54A 4JDPA 4ZDKA 5JARA 3Q8KA 1G4AE 4J9VA 4EB0A 1LNQA 1Y6FA 3KXIA 2GCPA 4WLNA 5U4XA 4F60A 3AB7A 4E33A 3L9WA 4D3YA 2P9JA 2QTNA 1IBMB 2YY6A 2BEUA 2WAOA 1LJUA 3PFCA 1D2HA 2IOYA 2OZKA 2XA1A 1UP4A 2BGMA 4UQPA 1SVKA 3LOUA 4EABA 1VHLA 1BVRA 1X86B 1XCJA 3CW2A 5ECDA 4MUJA 5BQFA 5CT5A 3IJPA 3V3KA 1X8LA 1ZQ1A 4OSOA 3X1YA 5FDFA 2B92A 5KOHB 4HTAA 1XB2A 2JAUA 3WE7A 1Z4MA 1VJ1A 4CCYA 1P7ZA 1E1CB 1R6VA 1XZAA 2HF7A 3GVIA 3ZNQA 1VL8A 3TSCA 2IWHA 1P7VA 4EATA 5C7LO 2POCA 1QQTA 3N8DA 4CCAA 3UK6A 2ZBQA 3FLEA 4EHHA 5FWAA 4JBIA 3M5CA 3SM9A 5E1OA 3ZTTA 1CY8A 4C7KA 2ZUBA 3O8LA 3I6QA 1UPCA 3OA2A 1AB5A 1D2CA 3AH8A 4KIWA 4B46A 4B3FX 4XQ9A 2UYQA 3KR9A 4X91A 5CJJA 4REOA 4GHWA 3WGKA 1UK9A 5CG2A 2OTCA 1MXHA 1Z8NA 3AESB 5H9VA 2QYTA 3AIKA 2E4XA 3Q9LA 1NVKA 4UOEA 2NV0A 2OY0A 5AWFC 4XDZA 1W2GA 1CV2A 1NBAA 2ONCA 2VSYA 4EFNA 1WXQA 3GO4A 1CY1A 5TIIA 1P1CA 1KEKA 2DXIA 1OIVA 2CLMB 1WMSA 4I50F 4EFKA 3NMUF 3TXYA 4IOJA 3PT9A 1WD5A 2H00A 4UBJA 1RKUA 2RKBA 3QJGA 4AW9A 5HRUA 1C7FA 3G0HA 4I1IA 2B5OA 2HHAA 4CKEB 1CUYA 1TE2A 2HYIC 4RJTA 2ZWIA 5SZKB 4ZYTA 1DIGA 4Q03A 1JHOA 3CN7A 4C5AA 3O8QB 4TXNA 5ABPA 4YDSA 1W2WB 2N3ZA 1Q1AA 2AG8A 3G59A 1E1QD 1USKA 3DBVO 2R25B 2P79A 2CXRA 3A1CA 4YUYA 1JECA 4I66A 3KBBA 1J2RA 4TX1A 4NENB 2IHBA 4P08A 3HYCA 4JASB 3SBDA 2PGLA 3RS5A 3NRJA 1VG1A 2MDTA 4Q9DA 3T3MB 2OYCA 2ZR9A 3BIFA 3ZU3A 1EFRA 1QKKA 2HSEA 1JQAA 2VTEA 2YQ4A 4Q4HB 3PK0A 2EOAA 5IVIA 2J0QA 2O8FA 2F62A 4IYRA 2CCGA 1AV7A 3IFSA 4Q6BA 5ES3A 4RXMA 3WYDA 4B8WA 5GVSA 1APBA 1DG1G 4LE1A 4RYLA 5JADA 1PL6A 5LWQA 3KXDA 1RWBA 3T35A 3IH5A 3DKPA 4L9SA 1CJCA 3DS8A 4PS1A 2WU4A 4J1NA 2OZLB 5L6MB 2IVZA 3GH3A 3WI7A 3GEDA 2Y2UA 1WB4A 1NG9A 3TPZA 3WS7A 2X19A 4NI5A 4I9FA 1GAQA 1F6WA 1ZK2A 2VP5A 5CNJA 1J5PA 1IEQA 1N2JA 3KU1A 3A14A 2RHRA 4QO8A 4R1PA 1NBME 3VNRA 5KAPA 2FK7A 3ML1A 5CVVA 1J07A 2DBRA 2WQZA 3IUQA 1ZD5A 1V7QA 4GFDA 3S5UA 2XRMA 3O8RA 4CHTA 2V5AA 4EOGA 1N3IA 1U9YA 3KOXA 4XE5A 3VU9A 1KRHA 1M66A 3HKDB 2OCYC 4RXUA 4ZPJA 2R1UA 2I8LA 4EG0A 3P96A 2V03A 2VSOA 3BILA 4P22A 4Y2UA 2IL1A 3IEMA 3P9YA 2YRFA 4AS2A 4JNKA 2EEPA 2KB0A 4G67A 5KX5A 3ODGA 1PS8A 4G4SO 2IUSA 2WD8A 4WFIA 1QFZA 2YHIA 4PTLA 1MFPA 1G55A 1RWVA 2ATEA 4UTOA 1N8SA 2AJLI 4B84A 4CJXA 5AW2A 5H68A 4BGDA 3RQSA 2Q50A 4JEUA 3U4QA 4HP8A 4WA7A 1KFBB 3TFQA 2NP6A 3LVFO 3QYJA 2M6KA 3CW9A 1HE5A 3UWDA 3NGXA 1AE1A 1NW3A 1U98A 3OLZA 5JSQA 3IEVA 3LWNA 4OB7A 3DVLA 2FGJA 3F5MA 4RK4A 4XUDA 2VJCA 4M9XA 4BRZA 4XYMA 1K0FA 1Q2XA 1TXGA 1Y6RA 2GEJA 3NEYA 3IP3A 2FMXA 3LQQA 1IN5A 1YUNA 2BUBA 4EZIA 2PH3A 4RMHA 2NXEA 4ZT4A 4B3TB 1UDXA 4JIMA 5JALA 1DEHA 4Z3OA 2ZWPA 4XUEA 4ZJUA 4JB3A 5I45A 4BJHB 4UAGA 4DCNA 4E13A 1PX2A 2PSJA 2ZSAA 4KP7A 2WNSA 3I5UA 3SJUA 4OGKA 3ZWBA 4DA9A 3W9UA 1NF9A 4DPKA 5IF9A 3IUEA 1Z0ZA 1MX9A 3ILSA 2GAFA 3ANSA 4G0NA 4Q19A 1UODA 4MAFA 4QVGA 1NPDA 5EPOA 3TFWA 4EUKA 1JEOA 1QIFA 2JCBA 4EY6A 4YMGA 1B0UA 1FUEA 2WP0A 3K4PA 1CEEA 4MGIR 2FSHA 1R50A 2RDMA 4X1KB 3DDCA 1DQZA 1N6RA 4H0CA 2BJHA 2QJWA 1I6LA 2YHBA 5LKAA 5DCYA 4CFZA 5K8IA 4GZ5A 4G0XA 1OXBB 2GKSA 2JASA 4TXLA 3I05A 1E1KA 1T6XA 2WJGA 1WUIS 2IDKA 1IJEA 3ZK8A 1USIA 3E1KA 3GUYA 1EZ1A 1DC7A 3ZX4A 4CM8A 1G3MA 4NONA 2VUIB 3LE8A 4HGYA 2Z9BA 5IXSA 5LMCA 3NQ41 3WK6A 2PK3A 3K94A 3A58B 5K8LA 4OJQA 5A03A 1CEXA 2C92A 3ZDYB 2K87A 4EY3A 1X1AA 2QPOA 2YL2A 3FHCB 4Q7MB 5LQSA 1KZ1A 4BNXA 4D4KA 2AZTA 2LCIA 3RNLA 3KUDA 5IASA 3CTPA 5INTA 1XTZA 2AV6A 2YN0A 3VDMA 1F06A 1AGXA 3MWKA 4WESA 3OP1A 4KQIA 3PRYA 5CD9A 4G3XA 2XUQA 4OV6B 3WISA 4H17A 4D5EA 4IBOA 3FKSD 4G0OA 2GN6A 1I1HA 1MC5A 5JNLA 1E6EA 4HCJA 1ZOIA 2QTBA 1O95A 3F3YA 3E7PA 4GBJA 2O8NA 5JI2E 1O6CA 4DMUB 4LXTA 3DZBA 4IF4A 1TKAA 1LPNA 2GFHA 1ESZA 3TOZA 1FFHA 2VPYA 1HQKA 2WG2A 4QGHA 4JENA 2C0PA 3A28A 4OLFA 1VCMA 1Z8HA 5LOVF 5JNTA 2FDCA 3ZZUA 4AU1A 1KWKA 2JHCA 1KI3A 3NONA 4BO8A 3FPAA 4MQEA 3MWDB 1MP0A 1XD9A 3BAZA 1ZI8A 3LC1O 4KPFC 5CVDA 1K5GA 1QX3A 3J81A 4JJFA 3Q9NA 1YZFA 4K9PA 4YRNA 3NZEA 3OZUA 3F1LA 3GAFA 5DLQC 1PJ3A 3ZEIA 2IXAA 1T4BA 1C9JA 4F5DA 5DCUA 4HDKB 2BGWA 1ZH4A 2BJWA 2OBNA 2E48A 3OCWA 1UDAA 4DC1A 1G9XA 4UHFA 4HO1X 3U49A 1Q0TA 3SS9X 3BK2A 3I1FA 3AX6A 3TQIA 4RPCA 5CJPA 3FUUA 3W8RA 4F4JA 3W4IA 1IY1A 3Q3CA 2X0IA 3JATB 1EA5A 1T43A 2F7SA 3SC4A