3WIOA

Crystal structure of osd14 in complex with hydroxy d-ring
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
265
structure length
265
Chain Sequence
AKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of strigolactone perception by DWARF14
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
molecule keywords Probable strigolactone esterase D14
total genus 85
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wioA00
2OAGA 2YXPX 3WL7A 1AQLA 1ACJA 1EDDA 1IZ7A 5AI5A 4P9NA 1I6WA 2CEKA 3BIWA 5LZ2A 2G5TA 2ROQA 3C6BA 4P93A 3VVLA 4MWTA 4BVLA 2EDAA 4P08A 5AKLA 4W9RA 3QMWA 2HU5A 5DLPA 2O2IA 5ALRA 3WWCA 2PUJA 1SFRA 2OXEA 4WDRA 1XZBA 2G4LA 1DINA 1UOOA 3AZQA 2R11A 3JYHA 4KAJA 3JWEA 5CRIA 3STTA 3AUKA 2HDWA 2VATA 4Y9SA 4BE9A 4CIAA 5HK9A 1AZWA 1TIBA 5ALWA 1C7JA 1QIEA 3OPMA 2XUFA 4UBNA 4Y7DA 3N0TA 4OSEA 2WIKA 5LZ5A 1HPLA 2B9VA 3C8HA 1F0NA 3E3AA 1XZFA 2GYVA 2WM2A 3R3VA 4FOLA 1CUCA 3PUHA 5HF8A 5T4FA 4NZZA 3BWXA 1WB4A 1MO2A 1LNSA 3ESDA 5BOVA 4L9AA 4QA9A 1SCIA 5ALDA 4M0FA 4AN0A 3F97A 2WSLA 2WILA 3ZLTA 1GPLA 1CUDA 1K4YA 5DNWA 4HZGA 5AI4A 2H1IA 3F67A 1CQWA 3F8SA 4J0KA 3FNBA 3WL6A 2PSEA 2D0DA 1XRLA 1VXOA 5ALFA 2XQFA 2VJDA 3EF3A 5EIAA 3A70A 3ESCA 4BAZA 4BRSA 1Q0ZA 2E3JA 1XLWA 5KBYA 4EY4A 2Z5GA 1ZD2P 2WFZA 3H1BA 2GYWA 3FVRA 4FKBA 4RGYA 3D2AA 1GZ7A 2O2HA 4C4ZA 5AK5A 4YX9A 3ZLVA 2WUEA 2Z8ZA 2XMRA 4FNMA 3WIBA 4BCBA 1JI3A 2W6CX 4I4CA 4AXBA 3OURA 2B61A 4B85A 1SOMA 5SYMA 1IMJA 5C8XA 2CBGA 1J06A 3AFIA 1OXMA 3VDXA 1LLFA 3D0KA 1SCQA 1VZ3A 3RM3A 2PPLA 4LXHA 6YASA 5AM0A 4F21A 1GGVA 1BEEA 4RNCA 4EA6A 3KWFA 3KOOA 4F60A 4UHBA 3WK5A 4DSZA 2RONA 4H7HA 4BDTA 4H7FA 5DYWA 2HA2A 2O7VA 1JU3A 3RLIA 3T4UA 1JU4A 1M33A 5ESRA 3V1KA 1XLUA 1XQXA 2RHWA 3EIOA 1L7RA 5CH3A 1GQSA 1ZD4A 3LP5A 1CUBA 1LPSA 3WK8A 1T4MA 1LPNA 1HKHA 4PNZA 4DGQA 3H2GA 1WPXA 3PDCA 1RYYA 3I2KA 3UUFA 2H9YA 3C87A 3PI6A 3DQZA 2VT6A 5ALIA 5K3CA 4BBZA 3FLAA 2D5LA 3LCRA 4QDOA 4UPDA 2CUTA 1EVQA 4WY8A 3C43A 1PJAA 2OGZA 5CT8A 1H2ZA 1R9MA 1G42A 3IB3A 4QDZA 4UBJA 4KEAA 1E8DA 1FJ2A 3D2BA 4L0CA 2QOEA 5JZBA 3OTQA 4LIPD 2ACKA 5A7GA 2J4FA 3IUNA 4U2EA 3AINA 5FPPA 1CLEA 2WJ6A 1RWQA 4B80A 1BROA 1ZI8A 3G0CA 4ZV7A 3FBWA 3HI4A 2O7RA 1T2NA 3H04A 3IUJA 5AP9A 1BRTA 1HBJA 2OLEA 3HJUA 2WU4A 5AM3A 4OYLA 5C7YA 1LPOA 3T52A 1YB7A 3S2ZA 1Q83A 4F0JA 2C7BA 4BCDA 1DQYA 5HFAA 4BC1A 4IH9A 3NWOA 3R3WA 1W6RA 7YASA 5D6OA 1VE7A 4NVRA 1C4XA 4N5HX 1WCYA 1UKAA 1YSCA 2HADA 3D2CA 3I2FA 1EK1A 1UKCA 3G02A 3R3XA 1XRRA 3VISA 2OGTA 1JJBA 3EQ8A 5LP1A 1P0PA 3H2JA 1DTEA 4AO7A 3W05A 4O08A 2V98A 2JF0A 5AICA 1ZICA 3HYSA 4KRYA 4WCVA 1KEZA 5AM2A 3B5EA 3R0VA 4FWBA 2ZJFA 3SK0A 3PFBA 2ORYA 4Y2RA 5AJHA 3WK9A 3L1JA 3SX4A 1TCAA 5H3HA 5AIAA 5JARA 1XKTA 1N5MA 5T4HA 4N8EA 5FXMA 4QWMA 5A71A 3I6MA 1GQRA 3M83A 2AJCA 1EB9A 2C0PA 4Q82A 3STWA 5C8VA 2DHDA 4BP9A 2GBCA 4BVKA 5ALJA 3G0DA 4PW0A 2H7YA 2RGUA 4J3JA 2G63A 1R9NA 1K63A 4INZA 2CKMA 4X6XA 2PL5A 2EEPA 1ODSA 4H0CA 5J3JA 5DJ5A 3GA7A 3BF8A 5HZGA 4TPKA 1EH5A 1WB6A 2DR0A 3W2TA 5E4JA 4DMCA 1UKBA 4ZGBA 4BZWA 4LXGA 1DT3A 3R41A 3Q0TA 5ALHA 2WIFA 3F96A 4P92A 3WK6A 3CN7A 3QYJA 1S8OA 1JJIA 1LBTA 5CBKA 2QXTA 4X95A 3PE6A 1OCEA 1C7IA 1VE6A 5ALMA 5K3DA 1UZAA 1XQYA 4W1PA 2PU7A 4XVCA 5EHXA 1CIJA 3KD2A 2GYUA 2R8BA 1YAHA 4ZWNA 4K2AA 1MX1A 5JALA 2DSNA 3G8YA 1YA8A 2CZQA 4BP8A 1H2XA 1FFAA 3WJ1A 4K6KA 5D3ZA 4Q3OA 1UWCA 2RHTA 4FLMA 2HA4A 2ZJ7A 2OPHA 1AURA 2BUBA 4ZREA 3STXA 1BEZA 1LGYA 2FUKA 1CUJA 5I7UA 4UUQA 3LIIA 3EQ9A 4DNPA 1CUEA 4G5XA 3WZMA 2XLBA 3WL8A 4EHBA 4C87A 4H35A 1Y37A 4X6YA 4L72A 4J0JA 2QUBA 4B9AA 3I6YA 3C70A 5ISMA 1CUXA 3MVEA 3ZV7A 1BS9A 1KU0A 3DJYA 5HF9A 1ISPA 1TK3A 2I3ZA 3BJMA 4ZXFA 2VJAA 2BUCA 3O4GA 5CT9A 5ALEA 4W1SA 2C4HA 2Z3WA 5JAHA 2AJBA 3D3NA 4KE7A 1YA4A 4G8BA 2XI4A 2BAGA 2DFPA 1A7UA 4OPMA 1NU6A 4J03A 4B0OA 2XUQA 4G1FA 5JAOA 5BWBA 1ZI9A 2HFKA 4FLFA 2ZVDA 1A88A 1BN7A 5AK6A 1B6GA 4JYPA 1E89A 3BXPA 2QKYA 2XQJA 1ORVA 1EVEA 3ZPXA 5HF5A 3WWPA 1ZI6A 1U2EA 1QO9A 5AKZA 5FP0A 3TEJA 1UOPA 5FLKA 1EX9A 3FYUC 3L1IA 3WLAA 4PO3X 5AM1A 4EY6A 3ED1A 3K6KA 3HRHA 2XUAA 1WHSA 2Y6VA 4OYYA 2W22A 1N5RA 2XT0A 2Y6UA 1DX4A 4Q05A 2WQZA 1AKNA 4ITVA 1IUNA 2PU5A 1H23A 2OCKA 1QIHA 5CT4A 5AKHA 3R40A 4NMWA 2RAUA 3E0XA 1W1IA 4X00A 4OB6A 5E4TA 2OCIA 1DU4A 1UK9A 5CT5A 4G9EA 1E8MA 1P0MA 2RI6A 1X2EA 4C01A 2QMQA 4H7EA 1THGA 2JGMA 2XUJA 3PFCA 5FRDA 1CUGA 1BCRA 1E66A 2EDCA 5HKAA 1ZOIA 3FAKA 2ES4A 5ALSA 3N2ZB 5CMLA 3IIIA 4JUIA 2XUHA 3WKAA 3O4JA 1EI9A 2DQZA 4K6HA 1MU0A 2X5XA 4N8SA 1LZKA 1QIMA 4A5SA 4B6GA 1BN6A 2ZYIA 4GLBA 1K6EA 3V9AA 4X7BA 3GUUA 3BJRA 4AO6A 3QMVA 3QZUA 1XZEA 3I1IA 5HCUA 1NU8A 5AK3A 3OOSA 1EXWA 2GBFA 4AMYA 4AMZA 1JT2A 5ALGA 4UBLA 4IO0A 3L1HA 1CUZA 4PSCA 4KRXA 2Q0XA 1E8NA 2WFLA 4QWWA 3D59A 1EDBA 5K3FA 2IIVA 3G0BA 5IVKA 4BYMA 1H2YA 4KACA 4KE9A 4GECA 5IKXA 1EDEA 2X76A 4L3WA 2XE4A 1XRQA 2GZSA 2BGNA 2C5FA 1XZAA 3W06A 5FKJA 1B41A 1F6WA 2QS9A 5ALOA 4ETWA 4AZ0A 1EINA 1QIFA 4QEKA 1CUUA 4XX1A 1WM1A 1CUVA 1CVLA 3QMMA 3V1LA 4MJ3A 4DIUA 2JGEA 3ESBA 2OGSA 1BU8A 2XUPA 4I3FA 3U0VA 2IITA 2GBIA 4BCCA 1IVYA 2DCMA 3FLEA 5LZ7A 3G9TA 5ALTA 4ARAA 4HTAA 4ROTA 5AOBA 2YYSA 5A62A 4W1RA 5JZSA 4QE3A 3QITA 1XZDA 5C8ZA 4GBGA 5ALQA 3B12A 1USWA 1JFRA 3WZLA 1SC9A 1FSSA 4J0GA 1DT5A 3FYUB 1L7QA 2XMSA 3GBSA 4YASA 3FSGA 3DL7A 2BFNA 5CXUA 5HQ3B 3C8DA 1CUHA 1XZHA 1Z68A 2JEZA 3STVA 3O4IA 1CUIA 3WYDA 2JBWA 1A8UA 3KWJA 4U2BA 5D3KA 3H17A 4KR0A 5K3EA 1FFBA 2DHEA 4F5ZA 1QIDA 5KWIA 5LZ9A 3Q8WA 1J07A 3F98A 4IQ4A 5JYCA 1MAAA 2PSJA 4GI1A 3QH4A 2CJPA 2AJDA 1QGED 5JATA 5IVDA 3ZI7A 4E46A 2WU3A 5BWCA 4X85A 3D7RA 5BV7A 2HA7A 3H2HA 5LZ4A 5AO9A 3A2LA 3W04A 3LLCA 1WPRA 4BTLA 2AJ8A 3DKRA 4J7AA 5CH8A 3D5EA 3K9BA 4UHCA 5FOQA 3WYNA 4GWLA 3AIMA 4UBKA 2PX6A 3JW8A 1HQDA 5DNVA 1XROA 1U8EA 3FVTA 3CXUA 1DWPA 3W9BA 4AO8A 4D9JA 2WLSA 2QM0A 1N8SA 1EB8A 2PSFA 1AC5A 2AJLI 3CN9A 3GZJA 5ALUA 4IH1A 1MX9A 4BTVA 2C5GA 1MTZA 2ZYHA 5A6VA 5IVIA 2VAVA 2XMQA 5K3AA 3AZPA 2C0QA 3V1NA 5JAUA 2OQIA 4Y2TA 5CW2A 2XMCA 4Q3KA 2VJCA 4EY8A 3H19A 5HFNA 4JYMA 2OCGA 1UFOA 3MUOA 4Q1VA 2VTVA 2OG1A 3DOIA 4U2DA 2VT7A 4FLEA 3H2KA 1MX5A 1E3QA 3H0CA 3WJ2A 3D4LA 3FCXA 2WUFA 1XFDA 3O4HA 5I9IA 4Y2UA 2QUAA 5YASA 3O0DA 5ALZA 2HRQA 1XQVA 3G0IA 4X92A 3FYUA 3STUA 4B84A 2WJ4A 1K5PA 5JIBA 2XMBA 2QTBA 4Z49A 3FLBA 1ZJ5A 4C88A 4KE8A 4Y2XA 1ZJ4A 3QBJA 3GFFA 3W9UA 2O2GA 4DLNA 2FJ0A 4X94A 5CXXA 2LIPA 1K8QA 5EFZA 1CUYA 3H18A 3BF7A 4TVKA 3O9VA 1H2WA 4GXNA 4Y2QA 2Y2VA 5K3BA 2ZSIA 2BGRA 1XZGA 4MYDA 1QFSA 5EI5A 1BE0A 3P2MA 3UUEA 1QIKA 2XQIA 1TRHA 4FBLA 2HIHA 1J1IA 3E1GA 4DYHA 2X8BA 3WIOA 5EGNA 2BUAA 5HF6A 2ACEA 1OILA 3FCYA 4H7IA 2CB9A 2B4KA 1QOZA 5AH0A 4BVJA 4QDXA 4X97A 4W63A 5AKXA 3DOHA 4RE6A 3YASA 3KDAA 1TQHA 1VZ2A 2HU7A 2JGJA 3IUQA 2XDWA 1XRMA 1QTRA 3AILA 5FV4A 3ZLUA 5JADA 2VAXA 1GPKA 3LIPA 1CRLA 1Y7HA 1LPPA 5CTAA 4DM7A 2NW6A 1DX6A 1IUPA 1U4NA 1AX9A 1KU6A 4KYVA 4MEAA 3DNMA 4C4YA 3ICWA 3WMRA 1F0PA 1QONA 1LPMA 3G9UA 5AKIA 1MT3A 2Y2UA 4ZI5A 2HFJA 2HU8A 1CV2A 2HM7A 5ALYA 3A2MA 1HDEA 1G66A 1AGYA 1EA5A 2YH2A 3BIXA 3BDIA 3WKDA 4JH0A 4UHHA 1W4LA 4G8CA 1QO7A 1XZLA 1XZKA 1HLGA 4H18A 4FTWA 4UHDA 3F9CA 2HRRA 1YCDA 4HAIA 4Y2SA 4EB0A 3IULA 4FHZA 1ZGCA 2XMGA 2H7CA 4EZIA 4DSAA 2FJPA 4M0EA 4CCYA 5JZ9A 4U2GA 2Y1KA 2B20A 1ZIXA 3TGLA 1TCBA 2VJBA 4DNOA 5AKGA 5DNUA 3CCCA 4CG3A 1G4HA 1CQZA 3FWHA 5KREA 4QDUA 1ODCA 3G0GA 1CR6A 3IURA 3VJMA 3I6ZA 3R3YA 4X6UA 5LLSA 1XRPA 1THTA 4J0HA 1UT6A 4LYDA 3G9XA 1GPNA 2VSQA 3GELA 3ILSA 1J2EA 2JEYA 5JD4A 1D07A 1QTIA 2HA6A 4FMPA 4H7JA 5AI0A 3R3UA 4G8DA 1ETHA 3V48A 1TAHA 4B9EA 4EY7A 5CT6A 3GROA 1ODTC 1MPXA 4MXDA 3DKKA 2ZYRA 4YK7A 3VJKA 1YB6A 2Z3ZA 3I2JA 1W75A 2YASA 2AXEA 4U2CA 4PSUA 3ICVA 3K2IA 3BDVA 4H77A 4A16A 4BE4A 5LKAA 4EY5A 4LKOA 1VKHA 2PUHA 4HRYA 3PF8A 5T4BA 1YS2X 4J0CA 4WJLA 1W76A 1JKMA 2WG1A 2CMFA 5AKYA 4GW3A 4DMFA 1UK7A 2QVBA 3WQHA 2WJ3A 1X2BA 3IA2A 5ALPA 3X3HA 4U2FA 5C81A 2JGKA 4KE6A 1DWQA 4MYSA 4CIBA 3RARA 3WKCA 1AMNA 5ALVA 3EBLA 5AK4A 1HL7A 3QPDA 4PQEA 4B82A 4K5QA 1MN6A 4UFOA 2VQ6A 3WK7A 4WY5A 2I03A 1R4ZA 2DQYA 3LS2A 4DNQA 2PSHA 1O6FA 3IVMA 2FX5A 4PSDA 4X71A 5IH7A 3DDUA 4X90A 2OAEA 1MAHA 2ECFA 1E5TA 3HABA 4J0DA 5LYYA 2J4CA 4B7ZA 5FUMA 4E11A 3DYIA 3FOBA 3QVMA 5DYTA 4GHWA 4OB8A 5ALKA 3C45A 4UBMA 4ARBA 4G4GA 3A2NA 5CH5A 4V2IA 3HZOA 1R50A 4RE5A 1JJFA 4PV7A 3DS8A 2QRUA 3WWEA 4OCZA 5ALLA 1GXSA 2XB6A 2GBGA 3WKEA 1GKKA 2QXUA 3CCBA 5LZ8A 3C6XA 4QLAA 3ANSA 1NX9A 2XUOA 5JD6A 1VXRA 2V9ZA 2XLCA 3ZWQA 4JNCA 4OB7A 1W52X 3ESAA 1CUSA 3SWWA 4FFVA 5AI9A 4EBBA 1XZMA 4CG1A 4LXIA 3HXKA 4ZV9A 2XUDA 4QDTA 4CFSA 4BAGA 1ORWA 1WOMA 4XIIA 1QJ4A 5FDFA 1QZ3A 2ONCA 1CPYA 2JGFA 4C4XA 5AOAA 4BAUA 2ZYSA 3MGAA 3I28A 1IUOA 1MNAA 1UK6A 2HHAA 4CCYB 1CUAA 5AI8A 2XMDA 3I2GA 4IH4A 1MJ5A 4AZ3A 3E4DA 5DYYA 2K2QB 2PM8A 4UBOA 4MQLA 1R3DA 3C6YA 5SYNA 1BCSA 2WFLB 3M3DA 1QFMA 4RPCA 1H22A 5EHNA 2WHQA 2XMZA 5DWDA 5EIHA 4I19A 3DLTA 3WWOA 1PFQA 3FSGD 4E15A 4QNNA 1TCCA 2VF2A 4H7KA 4FBMA 3IBTA 1Q0RA 3HC7A 1QIIA 4XJVA 4BZZA 2DHCA 4X91A 4HRXA 4AQDA 4BC0A 3DYVA 2XQKA 2H7XA 4S0XA 1F8UA 2GZRA 4EUSA 3WWDA 3RK4A 4GEGA 3VKFA 4OU5A 4QLOA 3HEAA 3UMJA 4N8DA 5CURA 4DMKA 5A2GA 1XQWA 4H7DA 3DEAA 3WA6A 5I8PA 1VJ5A 1YAJA 1YS1X 4UFNA 4LHEA 3I2IA 1YASA 4DMHA 1P0IA 3AIOA 2P8SA 1XZJA 1VLQA 3C5WP 1LPBB 4IHAA 1QIGA 1EK2A 4HS9A 4JEIA 1CEXA 3I2HA 5JANA 4C6HA 5EIEA 3QM1A 2PKYX 5LKRA 3G9ZA 5F4ZA 2UZ0A 3O9MA 4Y2VA 3WA7A 4WFIA 1ACLA 1QIJA 3AJAA 2IX9A 1QE3A 3SC2A 1DWOA 1XZIA 4G4JA 1R88A 1JMKC 1X70A 1ZGBA 5T4EA 4GDMA 3HLKA 2HA5A 1U65A 4Y2PA 5AHXA 1VOTA 4J0IA 5IVHA 2XUIA 3OG9A 4FFWA 2BKLA 4B83A 1L7AA 4UHEA 5E2IA 3WL5A 1TKRA 4OUKX 2C58A 4Y2YA 1GT6A 1WHTA 2WHPB 2V97A 3NGMA 3C5VA 3G7NA 3S8YA 5AIBA 4KJXA 1N1MA 5E4YA 4AB1A 1O6GA 4PF1A 2WFMA 3QPCA 4G9GA 2I3DA 2WTMA 5AKKA 4BRZA 4Y2JA 1QLWA 5DTIA 2QT9A 2QJRA 2I78A 2WHPA 2JGIA 4TGLA 1YR2A 4LYEA 3RKSA 4M0MA 5JD5A 2BJHA 3DD5A 4HXFB 3OM8A 2J3DA 4MQMA 4E14A 2ZSHA 5HKBA 4HVTA 4WFJA 3DL4A 4HXEB 3TRDA 1XZCA 1CFJA 4B81A 1UK8A 4A23A 5JASA 3QPAA 2VA9A 2XUKA 1LBSA 5A7HA 3PUIA 2RIPA 4BB0A 2OCLA 4XWGA 4NS4A 2WIGA 3FYTA 2QR5A 3BL8A 2WG2A 3M82A 3PF9A 5HK8A 3B3QA 1VA4A 3HSSA 5JAPA 1DQZA 3C6ZA 1RP1A 1PV1A 4B0PA 1JMYA 4C89A 2G5PA 1AUOA 3VXKA 4OD0A 3BE8A 3NOXA 5DTJA 3EQ7A 1A8SA 5AM4A 1LPAB 2WTNA 1MNQA 3TJMA 2WIDA 4BDSA 3AZOA 3NUZA 4UFPA 5A7FA 4X3CA 4CG2A 3H1AA 1EHYA 4N5IX 2OQVA 4DNFA 2WIJA 5K3FB 3WK4A 1FFDA 5LIPA 2WUGA 5AKJA 3A6ZA 5D7BA 3DCNA 5HQ3A 3I1YA 2PBLA 5FPQA 4KAFA 1CUFA 4MWSA 2VEOA 3KXPA 4KAAA 2XUGA 1ZD5A 3ANTA 3U1TA 5ALNA 4G4IA 1IZ8A 1FFCA 2V96A 1UOQA 3WI7A 4X93A 1R1DA 5AKEA 5KWJA 4DTCA 4ZRDA 4AX4A 1Q84A 5EHZA 4WFKA 3STYA 2WUDA 1XLVA 3HACA 4Q3LA 4YPVA 2WG0A 4FNGA 2QZPA 1Y7IA 1CUWA 5K5EA 2WKWA 3MUNA 3VJLA 1GKLA 5ALXA 3OC0A 4CI9A 1XRNA 3IUMA 2BCEA 1LZLA 3VVMA 2ZJ6A 3KSRA 4UBIA 4UHFA 4FDMA 3IDAA 1FFEA 2QJWA 4WDQA 1A8QA 4BATA 5EHQA 2JGLA 5AM5A 2HA0A 1XKLA 1G5FA 4QZVA 2HL6A 2PSDA 1ZIYA 5AI6A 3O95A 4W1QA 4Q34A 1ZD3A 3M81A 2XQGA 1WB5A 2WHRA 1P0QA 4AN1A 4CCWA 2PVSA 5AOCA 2JIDA 3H2IA 1UXOA 2HA3A 4HXGA 3R3ZA 1VA5A 4K6GA 1SCKA 2J3QA 4OU4A 3WKBA 3PICA 4MEBA 3V1MA 3AIKA 2Z8XA
chains in the Genus database with same CATH superfamily
4E21A 3K8ZA 3CZQA 3HI6A 2CLCX 3F78A 2NUTB 3AI2A 3JSAA 4CNBA 4EQ6A 1QRRA 4D81A 4ZI7A 2YJGA 4IDFA 1FDWA 4QTZA 3DQQA 1Z2CA 3HM2A 3TSOA 3KZCA 1GT91 2HN9A 1ATIA 4RSHA 1AUVA 3T94A 2X9NA 3ZNNA 1YRBA 2AUMA 5I9SA 4P9NA 5B1HA 5KC9A 3S1LA 1NJ2A 4NTZA 4RY0A 1LB1B 5LZ2A 4UJ3A 1H4SA 3TTUA 1T2AA 3LUJA 1I1OA 3VU0A 2WB2A 2F1IA 3C6BA 3VVLA 3DMTA 1RPTA 4BVLA 2R0QC 1UH5A 1B43A 4KLAA 2JGNA 3D3KA 2ZT7A 3OQHA 1Q2XA 2VOJA 2NGRA 4P08A 3MGKA 4W9RA 4B32A 2W6ID 4DQVA 1WVMA 2PUJA 2QUIA 4JI5B 4QM6A 4PX3A 5DW0A 1QH1B 1E3DA 1WW2A 4NAUA 4BWFB 5B37A 4I55A 3K8YA 5K1ZA 4YBRA 2C2KA 5CK4A 2WINI 1P3Y1 1YZKA 2IUTA 4YWJA 5CRIA 5EHIA 1Q1NA 1ZXXA 4IX9A 5COAA 4HO1X 3T8YA 1PZFA 1AKWA 1M3SA 4RW0A 4A0SA 1HG1A 1EVYA 5J2UF 1PZMA 3W3ZB 1YBFA 1SCUB 1M8PA 3R5SA 1BMDA 1N2JA 4ZYUA 2W98A 2QVLA 4BE9A 1KEKA 3FVVA 4UVIA 3WHKA 1AZWA 1TIBA 2J30A 5DI9A 1TNDA 2O1WA 2QU7A 5ALWA 3S2GA 1QCDA 1IHDA 2AV6A 2GTPA 3ZWYA 4TWZA 5JNLA 1V16A 4KLRA 3FHLA 4MKIA 1PNQA 4KI0A 4MH0R 3U9TA 2BFFA 4YQFA 1DUIA 3V8EA 2VDVE 2WMYA 2VYNA 3G2QA 4LF9B 1PYDA 5F3WB 2B9VA 3JWPA 1TM4E 5E3JA 3C8HA 3GFRA 2VL7A 2XB9A 3F5QA 5EIBD 3FGZA 4YRTA 3CRNA 1SCBA 4G1MB 3R3VA 4EL0A 3HVUA 1Z4IA 3LPCA 2ZI4A 3BXGA 2B8WA 3NP7A 1G9SA 1F8YA 1CUCA 3PUHA 1DO0A 5D00A 4I8XA 3WQRA 5CB4A 2VP5A 3OLZA 2VRCD 3V3TA 5FWAA 1IFXA 1CQIA 1XYVA 1ZS9A 3FRHA 1WZ2A 3EF0A 4JT2A 5ELXA 2V3WA 3LUFA 2WWYA 3PENA 3HK2A 2C4NA 5AJZA 1A5SB 5EZ5A 3CEMA 1L4LA 1FLDA 2BHLA 3PDIA 5H68A 2IE0A 3KEMA 4PSKA 1P3JA 1Z5NA 2AD1A 2X0RA 4FNAA 3K1YA 4LDZA 3HA2A 4CRWB 2YZNA 2R86A 5KU7A 4R7TA 2WILA 2J32A 4J4TA 4NCHA 1GDTA 3IMFA 2GHTA 5BRAA 1CUDA 4RD3A 3OFND 3EOZA 4HQNA 4K2HA 4Y2GA 3B2NA 3H9BA 3K94A 1K4YA 2V55B 1E3IA 1RBZA 2FMUA 3DZIA 5DNWA 4N0EA 2RK3A 2YW2A 4JP8A 4LV5B 4A1OA 2H1IA 2LCQA 3S81A 2XYGA 5DBEX 3N9IA 1DIRA 1KI7A 2HLHA 3F67A 4IUYA 4XSVA 4QUBA 1OJLA 4FT4A 3GRCA 2JH9A 5IUJC 2FWJA 4WNCA 2L42A 3HUEA 1ISRA 3WNBA 5MN4A 4G5FA 1EG2A 3FNBA 4O29A 5KNDD 1YFLA 4ZCLA 1Z4QA 4M22A 5K03A 2Z56A 2QRVB 1TQ2A 1VXOA 4CL0A 3F6PA 3TLBA 2FUCA 4RQAA 3ZBQA 4U6QA 4U3JA 4CLOA 1IPEA 2JD1A 3I92A 2CWDA 2X8JA 1HZZC 2VUSA 2W70A 4ZCSA 1N5IA 1YR9A 3Q3HA 1QKJA 2A5FA 3UTDA 5C32A 3V00A 1TLTA 3C6MA 4JBIA 3H2ZA 3ZX4A 4BRSA 2E3JA 3TM5A 2OQRA 4WLEA 2ZXEA 3V1TC 1WMEA 2WFZA 3BB4A 3PPIA 4LJRA 4N48A 3H1BA 2VWHA 4X1KB 2VXBA 3KTFA 4H60A 1OLSA 4M0UA 1GV0A 2QQFA 2FJUA 5COBA 2OYRA 4K9KA 2EF0A 4FKBA 4RGYA 2ZM6B 2VDRB 4L8VA 2CLOB 1M1UA 3C4QA 3HP1A 2B5VA 2YZKA 3T1OA 3COZA 2OZLA 3VO2A 3BWBA 3MTIA 5KNBH 3L49A 2QTLA 4N76A 2Z8ZA 1RJEA 1T5TA 2XMRA 3G8BA 3TLYA 5DBGA 4BCBA 1RPZA 1P61B 1PJTA 2AVNA 3IJEB 1O5IA 3TX6A 4TYQA 4QOIA 1NM5A 2B61A 4N4AA 4EKGA 4B3CA 5FLYA 4YYEA 1P2UA 1KYZA 4FFDA 1W9MA 1LDBA 1VFNA 2JFBA 2A78A 3AJRA 4YCSA 2CBGA 4HJXA 1J06A 3PT5A 3FCOA 4FUTA 3AFIA 3TFOA 4I36A 1P7VA 1OXMA 4PN7A 3SYRA 5CAEA 1MOQA 3AEKA 1QG0A 1ZD1A 3D0KA 5JVDF 1B8NA 1ZEJA 4YT8A 3RM3A 3DE7X 1RXIA 2YWXA 2FPKA 4LXHA 2ID9A 1JEYA 3BD6A 1TT7A 3PHBE 4GBED 5HE9A 4C1BA 4K7JA 1DLJA 1Y8QA 4OUDA 1TZBA 4ZZIA 1BE6A 3VR1A 4LQ4A 4KO4S 4RNCA 4UE6A 3EZYA 3T4XA 4A92A 5F78A 4EA6A 3UAYA 3ZDEA 2V7QA 2ZT8A 5JSYA 1U2DC 3CG0A 5DYIA 1PZGA 4F60A 1P91A 3HCNA 2C5SA 3IQGX 3MWEA 1ID1A 1YRHA 1Y5LA 3AJ8A 1LS1A 4H7FA 3M6IA 2RGEA 3PGLA 2A84A 2GJSA 5DYWA 3MOIA 5I4BA 2P9GA 4KQ1A 4X8OA 3RLIA 4QTYA 1BS2A 4NBTA 2PGAA 1NKSA 2CE2X 2MOKA 1M0WA 1GNSA 3UJ3X 1UINA 1C3OA 1XLUA 4KMMA 2YZ7A 5H9VA 3UXYA 4F6LA 1I9CA 1GAXA 1DG1G 5CH3A 1HO3A 2QXYA 1M5UA 2F1HA 5E0KB 3WK8A 3VDNB 4IILA 1YULA 2X8AA 3HFJA 1NX6A 1YB5A 3A6KA 3D6JA 2ZI7A 1WPXA 3FHJA 1NW7A 1Y6JA 1RYYA 3DMGA 3B13B 3VYTB 1EK6A 1CZNA 5EERA 4KPUB 2EW2A 5TQ0B 1OKKD 5EJ2A 3COSA 4X20A 5ALIA 5K3CA 4KQIA 1MVOA 4LE2A 2XWQA 2M9MA 3KKNA 5EINA 1E9CA 2WTUA 2ZAGA 3G13A 4JLKA 4XE5A 3TKAA 1ORDA 3W5UA 2D5LA 4MVJP 4IUCS 2QGZA 3PL5A 4AG5A 621PA 3QA3E 4F2HA 4F1KA 5KOIA 1RQNA 5J58A 4AXXA 4JJ7A 2XZOA 1PJAA 4LJYA 3NTLA 3N5CA 4J0EA 5C18A 1ZHOA 1X7XA 2DJ5A 4MVXA 2WT9A 5CT8A 1IEQA 2R5WA 1I7QB 1AGRA 3L4BA 1DCMA 5FLXA 5K0JA 3H75A 3THWA 3B1JA 4HAOA 2W6PA 2BLLA 4CBVA 5LQKA 2WI8A 4TXMA 2G9QA 2P68A 1USVA 1UZNA 3D2BA 4B46A 5KNDA 4EPTA 1NBAA 5JT1A 3DE5X 1JDTA 3OC6A 1NI4A 4A6PA 4DV5B 1CNEA 2ACKA 2FRDC 3IPCA 2ZJ8A 1R5OA 5A7GA 2GA8A 3GLIE 3D7NA 4L4ZA 2J4FA 2R47A 4JDPA 1FVOA 1M2OA 4U2EA 3AINA 3H5LA 4QAJA 3KFLA 1YQQA 1F06A 2AT1A 2JHPA 3KKEA 3OX3A 1Z7EA 2FW9A 1C9EA 2QGFA 1K7FB 2QRNA 1GIAA 4JLVA 4LRWA 4DXDA 2IZOA 1JA1A 4YRMA 1G2QA 3S2EA 1T9HA 1IBSA 1ISGA 4G56A 2IRWA 4ID3A 1W5BA 5ANRB 4MKRA 1BROA 2E6KA 1GNQA 2NN3C 4BNJA 1K88A 1IK6A 3O2NA 1O94C 1YMUA 3L7LA 3FBWA 2O7RA 1RVDA 1YHNA 3VUFA 3ESZA 4KXFB 1GARA 1BRTA 2QGNA 5AP9A 5JZMA 1HBJA 1HC7A 2QMOA 4XZ3A 1J23A 6GPBA 2C3OA 3MWKA 5A03A 5B2FA 1CVRA 4KQWA 5AM3A 1ZM4A 1MJFA 2ZR9A 4S1VA 2VH1A 1QYIA 4YAOA 4E5MA 1XC7A 1ZJJA 2J7PD 2ATIA 3ZDBA 2PGLA 2XTNA 3TNLA 2AMFA 1G17A 1KO8A 2UUOA 3ZCQA 2AZMA 3VTKA 1YS7A 3CX8A 1DQYA 3D6MA 4TKMA 1F7UA 3K0FA 1ZZEA 3R3WA 3IAS1 4W9MC 3CZRA 1K7CA 4D56A 3EAFA 1D5WA 2YWEA 1VE7A 4PZ0A 5AHWA 2NACA 5EXSA 4OYRA 1ZITA 4NZYA 1WCYA 1Z0ZA 4OK3A 3TOXA 3U3XA 4J16A 4UCXA 5GONF 2A9RA 4MYUA 2YN2A 2XNKA 1SCUA 2NYVA 5AHOA 4BMCA 1KS9A 3I9MA 3ZVKA 3QMPA 2Q5QA 2QZSA 1DDIA 1M6HA 2E85A 1OW3B 2JIPA 2MSEB 2UZ1A 2V58A 3C85A 3G02A 4MVWA 1JTVA 5C3UA 1CDDA 4E1VA 3RADC 3FLMA 4EGAA 1CDZA 5ICGA 3OEHD 2QRQA 5FBRB 3NM5A 3Q5DA 2MYTA 2OGTA 5D51S 5DHRA 3VISA 1MABB 2G04A 5K8JB 2QSUA 4MUFA 1UPBA 2H2AA 4N03A 3GC6A 1E1LA 3TS1A 4YN3A 3CJRA 3ICPA 2G40A 2WDZA 3M0EA 3LPDA 4ND1A 1JHMA 3VVCA 4AO7A 4CCAA 4WCFB 1WCV1 1O7JA 3LLMA 1UT5A 1T4GA 5CHYA 5L95A 3IEMA 5EE1A 2WY2D 1R6UA 3TGWA 5B2EA 1KEVA 3HYSA 4WCVA 4N5LA 3RQSA 3WB0A 5AM2A 1FJXA 1UJ6A 5IFKA 4D8YA 1FYWA 5AVWA 3IESA 1K7YA 5MN6A 2Y93A 2YVQA 3DF7A 2ERYA 2M2IA 3QELA 4KLCA 1KE1A 3W5HA 5JFTA 4R9NA 3DEJA 2PXAA 3VTFA 2HKIA 4I4TA 1Q16A 1KFBB 4PFQA 1TM2A 4CMIB 4DF3A 1TCAA 2BDUA 2FFQA 3TZHA 1KK3A 5LLDA 4WXHA 2NZWA 4DS3A 2L17A 3TKYA 3N2GB 1T6BY 1N5MA 1NW8A 1IM8A 1T8TA 1VRWA 2ZYDA 3SC4A 3TD9A 4LMBA 4DDTA 1ZA1A 1QX4A 5A5VA 4OQZA 1DKPA 3HJHA 3N3BC 4QX6A 4X64B 4N8EA 4F3KA 3MLBA 2CUKA 3EASA 4UUPA 4JC4A 4YJDA 4A36A 2BMFA 3HUTA 4M1ZA 1T2UA 1UIRA 3ZK7A 2W00A 1IXYA 3VUEA 1N7IA 1SKQA 2OM2A 4G65A 1GQRA 3OEYA 4QJ5A 1ZONA 2AJCA 4ASUD 3T5DA 4ND8B 5CDFE 1JHAA 3DC2A 3DFKA 1K0FA 4KQEA 3OVMA 4JBWA 4Q82A 2O6HA 3GRPA 1JKIA 2DU8A 3FPSA 2Q3FA 3HVIA 2IYPA 1FNDA 5D1HA 2NVUB 4BP9A 2C77A 2O7NA 3OX4A 3QFRA 1Z4OA 4XDZA 4C4RA 5B58C 4HLCA 5K0SA 1B3BA 3OF3A 3BWEA 4Z51A 2P0AA 4LHXA 1N7GA 3M4NA 3HJAA 3OJXA 2H7YA 3RVOA 3D8SA 4P4SA 4IKEA 1Z7YA 3ZKAA 2N3ZA 1GZ4A 1FTSA 2DC1A 3T4EA 3DAGA 3LOUA 2G9UA 4GLOA 1RHJA 4Q39A 2IY7A 4BKUA 2PL1A 2YWFA 1BFDA 2Y0EA 4FR2A 3WNQA 4BQQA 4EY3A 4INZA 1G1MA 5DPMA 3BMOB 3ILYA 4KIGA 1T5BA 4POAA 2PL5A 1H3FA 1K8YB 3ZLBA 3BCRA 5FA6A 4A82A 1E4EA 1ODSA 4H0CA 1B2RA 5IZCA 4ARVA 2R751 2W4QA 4HFNA 1GYRA 5DJ5A 5CX4A 1J9ZA 4OIMA 5C52B 5HZGA 1Y3BE 3UHFA 1DQRA 3THYA 2B7BA 2IIQA 1G20A 1RC0A 3EH2A 5IW8A 3HB7A 3ER8A 3GDFA 5AUQA 1Q1EA 1E3EA 2E55A 3RNOA 2VXCA 3BSYA 3K0EA 3RTDA 4ZMRA 3FE2A 4LXGA 3X2EA 3QLUA 3UQZA 2OHVA 4XCQA 1PVOA 5BN4A 3WFIA 5GY7A 3H0KA 3SQOA 2WIFA 1QP4A 3B2QA 1QLJA 2WJGA 1NFQA 2P9TA 1D9XA 2FG7C 3I04A 3WK6A 4M99A 3D3WA 3LUGA 5FPKA 2VNHA 4N01A 4H0FA 4EPRA 1U3VA 3I61A 3K0AA 3KQWA 2H11A 2PWYA 3QXGA 5CYOA 5CBKA 2AYZA 4N49A 3K2BA 1R3UA 5EMHA 2BZGA 3PE6A 1HR0B 1CTQA 2OCAA 1FIUA 2VFAA 4EIWA 4MB6A 1RYMA 3AR5A 4FX2A 2VR1A 4QG7A 2NPFA 2OHGA 1Z5PA 2C7QA 5CM2Z 3PHHA 4YJKA 5K3DA 5IT5A 5I9NA 1B8VA 3OQIB 3MRSA 4PIMA 5BW4A 5CDGA 1YDHA 4IGEA 3TSWA 1ZY2A 1VCHA 4YXWA 3WL4A 3HGQA 3IR5A 4YQZA 4QXPA 2RHMA 4QUKA 1CIJA 1JEYB 3BIJA 4KRFA 2WPDD 2JATA 2X6TA 3LDFA 2X2FA 2R8BA 3L01A 3PRKE 2R8ZA 3ANNA 1U2ZA 2Q5EA 1JZSA 2Q4EA 1PJ2A 3U44A 4JI2B 4K2AA 3AHEA 5JH7F 2O8VA 4UW9A 1EP9A 5LCXA 3R6WA 1RXVA 3HV2A 3K05A 1MLDA 3ESYA 2LR0A 3G8YA 2BYTA 1DC7A 2PK3A 2QYOA 1QC5A 4JOQA 4A8JA 2GKSA 2PLRA 4BP8A 1KYWA 1NJGA 1JIXA 3Q40A 4ESHA 5BN5A 1I7PA 1VLHA 2P7HA 3B9QA 5D3ZA 4OXKA 5F7JA 1HY3A 3A0RB 3RFXA 3GVPA 2WTAA 5KDDA 1L8LA 2VYCA 4Z5XA 3NAZA 3PC8C 2IXFA 3JAKA 1SZJG 4UE3S 1RQ7A 3JVUA 4ZEWA 2BI7A 3W2FA 3WGZA 2BUBA 2E9SA 3BL6A 4P82A 1W5AA 4I1IA 1HNNA 4U9IS 2FXIA 5F35A 4HAUA 4IDOA 3K4HA 4ZD6A 4KR7A 1OROA 1PAUA 1QS0B 3F4LA 2GEUA 3PGJA 1Z2OX 4NMHA 4DV1B 5DM2A 3WNVA 3EQ9A 1L5KA 4G5XA 3LM8A 5BV1A 3WZMA 2XLBA 5JXHA 3HCEA 4LY0A 4ZKEA 5ESWA 2QYHA 4JXJA 1UC4B 2J59A 2UZ3A 2WWGA 4CZ2A 1Y37A 3SZLA 3L5OA 3AF3A 2OHOA 3GJSA 4X6YA 3HSYA 1MD9A 4HYEA 4L72A 4H9GA 4LDPA 4B9AA 2J1LA 4NULA 4OI2A 3RI3A 1G5TA 1SK9A 3B1KA 5EE5B 3KSAC 1KU0A 4TT8A 3R7FA 4DIKA 2B0CA 3BMCA 3DJYA 3CINA 4IVRA 1JWAB 3WIUA 4YDQA 1JILA 4EO4A 1SVUA 1XF9A 3I01M 1EIWA 4EUFA 2BKXA 4DL9A 2FPPB 4I5FA 2OFFA 2VF8A 5B7PA 3CA8A 4IX1A 5CFZA 2C5BA 4XM1A 5D3QA 1ZK2A 2DBVO 3EJWA 1WLYA 4PAGA 4BIIA 1Y7TA 3ZWMA 4DC1A 2QTWB 2ZVQX 5AJXA 2VJAA 3O9ZA 2KBEA 4ZTZB 3THWB 2BUCA 4DCVA 4KNVA 2BBOA 4BVGA 3K2EA 4EG4A 2C4HA 5JPDA 4YV0A 2VXYA 2Z3WA 3E27A 4XW2A 1CF9A 3FXAA 2JFNA 1T1EA 1E4EB 2XI4A 3DZDA 4KN5A 1OH7A 3I5MA 2DFPA 2J8ZA 4FQ5A 3LBIA 1VDZA 4B3FX 1G5HA 3P9SA 4TOIA 1X3LA 4BMDA 2FG5A 5FQOA 4HGRA 2DETA 4QL3A 2YDYA 4NBKA 2G36A 2C9DA 1VI5A 1X77A 3URKA 2FZ4A 4S04A 1RI2A 5CCXA 1DQNA 2Q50A 1C9YA 4TL9A 1EUDB 1T3ZA 5J2TA 2YUIA 1P31A 2RGBA 1BN7A 4WPGA 5AK6A 5LDDC 2AN1A 4EEKA 4YAUA 5F3RA 3T3PB 2JRCA 4J43A 4JYPA 1U8UA 5JPIA 5CA1B 4C7KA 3GRRA 1KC3A 1GTG1 1U4OA 1I2CA 1ORVA 2R4UA 3A4MA 1ZGZA 4MLDA 4QSHA 4DIMA 5I7FA 3SSNA 3SOZA 2EZ4A 1EVEA 2ZSBA 2ALJA 3KL2A 3O90A 3ZPXA 5L3VA 4W5NA 4KMOA 3PC4A 4MRPA 1CD5A 5HF5A 1ZI6A 4QARA 2PSSA 1E9AA 1E5VA 1KYQA 1M1NB 1PZXA 2ZATA 3LK6A 4Z0HO 1LW7A 4GM1A 3PE4A 5FP0A 5TSDA 4GGPA 4ZI2A 2E37A 2G5CA 2O20A 3IILA 4R81A 5BSHA 1W5EA 3O83A 4M0CA 2OCBA 1A2QA 1Z88A 1F1JA 3FYUC 3L1IA 1LBQA 2FRDA 2CVPA 4K8OA 2WSSA 3WLAA 5B4VA 4NCXA 3T12A 1KOJA 4JXKA 4PO3X 4HVLA 4L5JA 4KMRA 4A0QA 4CV1A 4LY3A 2X58A 1CB0A 1NUAA 1W2GA 2NUBA 4D43A 5JS7A 3MA0A 2E1RA 4EY6A 4IBOA 3OPYI 3PZBA 5HIIA 3SXPA 3IVCA 1Z7WA 2DBYA 4K87A 2UVPA 3KTOA 4W6QA 3NBQA 5C0OE 1JJAA 4E1AA 1CZLA 1WHSA 2JJ2D 1GADO 4ED9A 4JJEA 4DVGA 1GTJ1 4QC2A 1L4KA 3O38A 4KGDA 4O4HA 4RMNA 2R68A 3MTDA 4LBWA 4MS1B 3WV5A 2O9JA 3P9RA 1C0PA 2P5UA 2W71A 4C7MA 1F4LA 5FADA 5L53A 4IP0A 3NI2A 3VPDA 1K7SN 2WQZA 3IAAA 3LP6A 2CNKA 1OX4B 1JQBA 1NQUA 1O87A 2CE7A 4ITRC 4LSZA 4MUAA 1G6KA 4B2YA 1G8JA 1JSXA 4OAPA 3W1WA 1IUNA 4JI6B 4KUHA 1FFXB 1H23A 1UFRA 1T36A 2OFPA 3JQDA 3OOYA 4FYMA 5BUSA 1UPTA 3THSA 2QZJA 1M5RA 3UFXB 1V39A 2GVNA 1SXHA 3AHHA 2ZRFA 2J33A 3DJFA 3GVIA 4KR6A 4DLTA 3R40A 1AQYA 4NMWA 1B42A 1ST3A 4IF6A 3Q11A 1ILWA 4NLLA 1AUQA 3AGQA 4XGKA 1LV7A 3EJ6A 2ZB2A 4YCMA 3E0XA 4PRLA 4CLRA 1K75A 1QZZA 4P32A 5JAHA 4LF6B 3MAGA 2IYLD 1RM3A 2QRPA 4EA7A 3O94A 1DAEA 2CLSA 2OCIA 1E7SA 3GLFA 3KNZA 4HDKB 1YJ8A 4U7WA 4WESB 2R6JA 4K03A 5HPYB 1GZ6A 4KLZA 3KCNA 4DN6A 4NPHA 3T7EA 3CIFA 3MW8A 2C0CA 3CW2A 3KSBC 1JLHA 4EG8A 1H9BA 2A9PA 1Z8DA 2D13A 4HAYA 4H7EA 4O2BB 5BQOA 3UK1A 1HQCA 1THGA 4K9MA 4M98A 2H48A 4G5HA 1GN8A 3KKKA 1Z47A 3C6QA 5EAIA 4DDHA 3BMCB 4H4CA 2RG1A 2EFDB 1BFUA 2QX6A 1JQJC 3GJQA 4KQ9A 5IULC 5M3BA 4HLUA 1T36B 1VJRA 1KP2A 3WB1A 1CT9A 2II6A 3ZTYA 5HX7A 1E66A 4ARIA 1NVBA 2HDHA 1H2AS 4GXQA 1L5LA 5HKAA 4NF2A 1XZNA 4JC0A 2DWQA 3ROQA 5D7NA 4P4LA 4ZU6X 2H5JA 3Q98A 1XX6A 4FQ7A 3PFNA 4TTAA 2REQA 5DXAA 1CETA 1I1QB 2F3QA 2P5TB 2ES4A 3H2SA 3GD7A 3TFWA 3TW6A 2I6UA 2DLDA 2H4YA 3M5CA 5JVDB 3WDLA 2C2OA 3ZIDA 1XU7A 2VAWA 3AKYA 3G89A 1E9DA 4PC6A 5FO0A 1QHIA 3QQPA 3A6GA 1U7TA 3A2KA 4G09A 4PE5B 3IIIA 3PEVA 5JQGA 1TCUA 1Y6QA 4KTVE 4HDMB 2IYXA 2QPLA 4JUIA 2CN1A 1TD1A 3PXXA 2J9RA 1F0KA 3UYLA 5MGBA 2ZWOA 3HA5A 4NOJA 2HLNA 1DO2A 5C34B 1NC3A 4WT7A 2IYVA 3A14A 3WGUA 2NO5A 1Q7TA 4JLSA 2R6DA 4S05A 1VJTA 2HJWA 2QD3A 1BN6A 4MYRA 1KBQA 4QDKA 1OVGA 3F2IA 4QBKA 4ZZ2A 4JN6B 2IV2X 1LTQA 2C59A 3R4CA 3DTTA 1Q44A 2J0VA 3U7EB 3V9AA 2WYOA 4ENSA 4P81A 5KNLA 1XD8A 1P6QA 4UM8B 3RH0A 4AO6A 1ECFA 1ZGJA 4FR0A 4GSYA 5LL6P 1W8DA 1UFQA 3CF4A 1XE3A 2BEVA 2GBFA 2CFSA 2O14A 3CPJB 1GV1A 4XQGA 3IO5A 3BICA 2QSZA 2V9CA 4ZOLF 5TARA 5HW0A 4U6NA 5AJYA 2OEPA 2V5AA 2B2XA 3P94A 1CUZA 2HHLA 1MIOA 5EP2A 3B6MA 2ZUWA 5JCXA 1R5BA 4AJ4A 1FLAA 1QE5A 4HMOA 1IY1A 1EDBA 3SHVA 3MMXA 4CKWB 3ZQKA 1HTWA 4Y9TA 5DH9A 4IOKA 2WU8A 2AKYA 4OI4A 1FW6A 2IIVA 4Q21A 4FYJA 1GZVA 3NHMA 1HNZB 3V4RA 1I24A 5AW7A 1ZVQA 4KODA 1U3WA 4C0QC 2VN8A 1R0WA 1PLJA 2QNBA 3G2LA 1ULSA 1J2RA 3OE7A 4Q1CA 1JPNA 1E6MA 4ZZ0A 5IKXA 3IUBA 3O2JA 1CZRA 1V5EA 2PKQO 1OMOA 5FYDA 1DBPA 5JTTA 2X76A 1IG3A 3MK31 1EEHA 3OEED 3FSJX 1EBFA 4AY2A 2Q2WA 2W58A 2QRZA 5DI3B 4BP1A 1HNWB 2VUIB 1W73A 4UM5A 4GRDA 3M2PA 4ZICA 1ESEA 1S2OA 2C9BA 3NV9A 3R4VA 2C54A 3CISA 3O1JC 1NONA 3WRVA 4DY4A 5HEKA 2PUGA 2WTXA 2B82A 1F6WA 2CSXA 2L0XA 4PLPA 1T8SA 1Q1AA 4EB6A 3ZIAD 4ETWA 3RE1A 1BJRE 3OPYA 3VVBA 2WAXA 4DMRA 4Q4HA 3ND6A 2AXNA 2P6PA 2Q8QA 2V8OA 5F5LA 1G8MA 5KQSA 3W78A 4LFBB 3QEMB 3KB6A 1CUUA 4J4HA 4L8YA 4Q00A 1VPVA 5AHKA 1M7HA 3L4BC 1L5NA 2CDRA 1NBMD 3HFGA 1CVLA 4IDGA 2AE2A 2D5CA 1HRDA 4P5PA 4PWZA 3HA3A 2OHJA 3P0HA 2P6NA 4MJ3A 4NI5A 4DZTA 1GFSA 2QR2A 1PGOA 2OGUA 1SGWA 3C7CB 4IJWA 3RG2A 3HGTA 4RK1A 3DUFA 3VTZA 3X2FA 4Q1AA 6CHYA 2Q6TA 3Q8LA 4CKZA 2UZ1B 5K9ZA 2VWPA 3TIIA 3ETJA 4ER5A 3A4VA 1D7OA 3ZU6A 1ML4A 3TGPA 2JHCA 2CL5A 2PGXA 3ZWWA 4W99A 3G9TA 1R4MB 2BGMA 2IYSA 4MRRA 5ER9A 4A8TA 4URXR 4ESVA 1O0CA 3ENZA 4WIAA 3DSRA 3EXAA 2B4YA 4LYHA 3RRXA 1KI2A 1ID8A 3ODGA 3ZE6A 5CLFA 1KP9A 1N0UA 2XNDA 1V6AA 3DKIA 4FYWA 2FEWB 4ROTA 2NU8B 3QEKA 2PUAA 3NPAA 4JBHA 2YYSA 1TYCA 4W1RA 1GLVA 1RHKA 2D59A 2CD7A 2ZRGA 1PWHA 3KFVA 3OJ0A 1DRWA 4HNAA 3E9MA 4IXWA 4ZAGA 1Y4UA 4DRZA 1JYFA 4CMEC 3BHMA 4YP0A 3IKVA 4LHWA 3A7EA 4H4EA 2HV9A 5D86A 2VQDA 5C8ZA 4JB0A 3V6MA 2UXCB 1KKLA 2FZGA 2AIRA 4M0LA 3O84A 1RW4A 1OV6A 3CB4A 4RFSA 2QP9X 3C3KA 3NWBA 4R5HA 1VL6A 3TEMA 3IVXA 3ZUPA 4XGRA 2Z9DA 4V39A 1REQA 1M1YA 2DE0X 2I80A 2ZZNA 4GKKB 3NGXA 5H3LA 3UT0A 2C42A 3HBJA 1RYDA 1W6UA 3FYUB 3Q3CA 1MAWA 4K9LA 4QUHA 1JDJA 3GBSA 4YASA 3W90A 5CU7A 2OHXA 3KYCA 5HKLA 2GR9A 1KZGB 1VLZA 4HG2A 3VV3A 5CG2A 2JKYA 5EJ9A 1X86B 3CUEF 4RJ2A 3U4DA 3GP8A 3O8NA 3RVQA 3P5BA 4ZJUA 1LXCA 1HE8B 4R6XA 3PQ7A 5KYXB 1T9DA 1ZL2A 1XMPA 2Z30A 2YFHA 1Z33A 3GARA 3MRTA 3QXSA 2J3JA 3HLYA 4U2BA 5D3KA 5LDHA 1Y6GA 4TS9A 2NZVG 4AJLA 1L1QA 1VG1A 2DHEA 4MI9A 4X60A 3VR2A 1S02A 4F5ZA 4C0WA 1XYYA 5BSEA 1CS4C 1J07A 4PC3A 1L3CA 2FFBA 3QLTA 1KMMA 2PNJA 3SHFA 1MAAA 5JYCA 3AI1A 2A6PA 3PTLA 4ARUA 4DCSA 3L4EA 5CVCA 5CA1A 1A5ZA 3EXFB 2QQGA 2BFMA 2UUBB 1LVHA 2EAUA 4E46A 5BWCA 2W2NA 3OE5A 2BFAA 4QREA 3EIQA 1FYXA 2HA7A 4MW1A 3QE3A 2IY8A 1P9OA 5DTQA 3S55A 4C7JA 1NG9A 2DFNA 1MJNA 2V6MA 1K3UB 3SYNA 3N6RA 5DP2A 1Q57A 3A2LA 3W5BA 1UXKA 1WRBA 3L7DA 3EMBA 4K1LA 1JKJA 1TPYA 3JRNA 5JNVA 1GTL1 5K2OA 3WLTA 1T4CB 3FHTA 2JIOA 3ETEA 4LYAA 1QAQA 1OGYA 2PEYA 2ZRBA 5U1PA 1IHYA 3UXMA 3PC3A 4MICA 4JENA 3U1BA 4LNAA 3SYKA 5FOQA 3WYNA 4CWAA 1Z56C 1E2UA 1DAHA 1WAMA 1MABA 3AIMA 1CQJA 1PWYE 4GWLA 3KOXA 4US2R 1HEUA 1U0FA 2PX6A 3MYRA 4MDEA 2PO5A 2XD9A 4Z2AA 4MR8A 1XCBA 2ZSJA 3EBPA 2K7ZA 3GLKA 3OEEA 4WCDA 2I9KA 1N5KA 4X61A 5LYJB 4X1IB 2XW6A 3JQCA 3K5PA 3U4HA 5T6MA 4QKQA 1IBMB 4AO8A 5JYEA 4TXLA 1NQVA 2X0KA 2XRFA 3Q88A 1DBSA 1EB8A 5ARDA 4EEZA 3TG2A 1NI3A 5DDIP 1V7PC 4DADA 4QICA 2AJLI 5ALUA 4S0ZA 4YI3A 3SF0A 5IBQA 1EE9A 1MX9A 2QD2A 3QTTA 4CE6A 2IBSA 5IJ0B 3PEUA 4C29A 2LE0A 3RUPA 1P44A 2P65A 3C3AA 3Q41A 3PGVA 4JUBA 4O4LA 4PHFA 1V95A 1EM8B 4ZIRA 2Z2IA 2OPBA 2ZRPA 4Q3EA 2FSIA 1HFKA 5HBGA 4RLHA 3R75A 1MENA 1NY6A 3V1NA 4BGVA 1YBVA 4TLMB 5HKKA 4AF7A 2YNMC 4IINA 4E2ZA 2JFOA 1T35A 2ATVA 1CQJB 3VFDA 1E0AA 1CU1A 1SZDA 3WDMA 1E9FA 2X5NA 1POXA 1G3QA 4ZQGA 2XMCA 3MFYA 5H8WA 2NXCA 5BN3B 4INJA 3N8KA 2C2GA 3V4ZA 1TADA 5C5EA 1XI2A 2O6LA 4M9XA 5JEEA 3OT5A 4FGZA 4JYMA 1ECGA 5FJJA 4F8YA 5K8VA 1O1YA 2O1EA 3JWHA 2X8LA 3CUSA 1V3TA 5E38A 3MUOA 2XDYA 2J9GA 5FH9A 3HUUA 4H59A 4YRIA 3WLEA 1XDDA 2W2PA 3IOMA 5GV7A 2PGNA 4Q5IA 5JLJA 4RL4A 4D74A 3JASB 4JCOA 4CTKA 3IERA 4ARSA 4U7FA 4JQSA 4Z8XA 4WJZA 3KQYA 4FLEA 3KEFA 1RWXA 3C1AA 3U0BA 2GBPA 4EW1A 3AVXA 3EVZA 5CIYA 1CHDA 3FCXA 2NTEA 2IEYA 4A0RA 3EEBA 4KSCA 2PXCA 2WUFA 1L8OA 2W7TA 1ZLXA 1NZFA 1QHNA 1GUDA 2JJ8A 1RM5A 2YFYA 3FYCA 3HN6A 5I9IA 2VYVD 5I48A 1D1TA 4RJIA 5FUXA 2FPIB 5ALZA 4DANA 3A25A 3B6EA 2EU8A 1TPZA 3HS3A 4KVZA 1V5IA 2ZWVA 3G2HA 2WJ4A 1ACMA 5FOWA 4D9CA 1I3NA 2H1RA 3GRYA 3TLZA 1TQ4A 3EGXB 1J2UA 2QTBA 3FUVA 2CJXA 4Z49A 1HUQA 1W5FA 3I01A 3UOAB 1JFTA 4KGVA 4I6GA 2GRJA 3IP8A 4FQ8A 4RANA 4CIYA 2GZDA 2JZCA 4RCZA 4CM5A 1F1BA 2BRUC 4UEKA 5KYXA 5BOSB 3GXBA 2C9OA 3TQFA 1WY7A 4I55F 4JLUA 2FJ0A 3RRYA 3KDPA 3DBLB 4OQFA 3PFKA 1NVGA 5FOVA 1RRVA 2HQ1A 2W6NA 4IRUB 3ST7A 2VZ0A 3B8EA 3JQ8A 4LXTA 1CIPA 4TVKA 2CJFA 4D41A 1L7DA 4FYIA 2QL9A 4GXNA 3EW7A 4CLHA 2J87A 1FYFA 4RIGA 1OTYA 2Y2VA 1A69A 5K3BA 2HK9A 2ZSIA 3GG9A 1AF4A 3LQ2A 2IHJA 3TDNA 1JG1A 2FN8A 1QLHA 2VTEA 2X1VA 1P4SA 3P2MA 3MJHA 3AUUA 3WBKA 5IT4A 3EWIA 3ZYZA 1V5WA 3KZMA 4BU0A 4KHPB 2F8MA 1Z0AA 3M89A 5JRDS 4WOBA 4YGYA 1BC5A 3L82B 5LM3A 4XFDA 4P7GA 1J1IA 1F0YA 5SICE 3E1GA 4KQ2A 1GA6A 1H0RA 2X8BA 4BO8A 3WIOA 2HZBA 2FPXA 3ZKWB 4I6JA 4IUDS 3JQ7A 1VSUA 4B40A 3GH3A 3GP3A 4H7IA 1THMA 3FCYA 3DPUA 1KWKA 2P3LA 2CB9A 2Q2VA 2B4KA 3EC1A 5KNCA 2PUCA 3SBOA 3EUFA 5JFOA 4DWVA 2O7SA 4IYJA 3O75A 2VUTA 3L7IA 4E7PA 5CHEA 5KYGA 2HHJA 2NU7B 2WYWA 1NT2A 3MWDB 4PNHA 2DVMA 1VL0A 3H9QA 4WWHA 4KR9A 2AA3A 3PFIA 3VH1A 1AXGA 1S8AA 3EQ6A 2WM8A 3T6KA 1GTRA 3W7BA 5AKXA 3DOHA 1BMQA 1FUUA 5E7MA 1Y34E 3IEKA 5CXQA 2WU1A 1PLKA 3T95A 5L3SA 4JAVC 2HU7A 2IV7A 5BMVA 1OWOA 3VPBA 2PMWB 2JGJA 2N0SA 1WTCA 4C6RA 5JWHA 3K0FB 1ZRHA 7ADHA 2IPNA 3ZHQA 3PNKA 1E77A 5K8UA 4RK0A 4W8HA 4RZXA 1XRMA 5JCZA 4XCXA 1XDSA 4S2EA 5FV4A 2G7MC 3NKFA 5G0UA 1N0WA 2ACWA 1N2SA 1BDJA 4KCGA 4ACBA 5HGJA 3TL3A 4ZT4A 1GPKA 4HYYA 1CRLA 2RH5A 2ET6A 3ZUGA 4F1JA 3NJ4A 2FR8C 4JVOA 1CRWG 3RF7A 4TTQA 4PYKA 1I80A 5TDHA 4A03A 4PQYA 4A73A 1N92A 3ZHSA 1QVRA 4GGMX 1YR8A 1KF0A 1SQGA 1IMOA 3PWTA 4DM7A 1EAYA 3BX1A 3T0IA 1S9HA 1T15A 3LGXA 3N2NA 1KA9H 1N32B 5A9TA 1T0JB 1T5LA 1L7PA 3UBTA 2YL2A 3N87A 4KI7A 3WSTA 1J33A 4DMLA 3NYRA 4MVJF 1U4NA 4FFNA 3WLFA 1PFUA 1KU6A 1ABBA 1T5IA 2O8CB 3D4NA 4JR1A 2OC9A 4GZ6A 1R16A 4HEQA 3TLGB 2QUJA 5HCNA 1ZXLA 4GXRA 4ZJZA 1QE0A 4K6MA 4B73A 1Q6ZA 3RJMA 4W5OA 1KYXA 2E4AA 3PIIA 3UWPA 1QZTA 2ASVA 1LPMA 2L69A 2QY6A 2VDUE 4KVFA 4O8CA 5D5HA 4XUCA 5EZSA 4OFXA 5AKIA 1XDBA 4UCFA 1VSBA 1PE0A 3B36A 3IIKA 3Q6MA 1BD4A 4WTOA 4ZI5A 2HFJA 1B14A 4EFKA 2HU8A 2GS9A 5FAKA 5K51A 1CV2A 1WCWA 2WM9B 2IOYA 2IUFA 4H0NA 4OP3A 2J41A 1M34A 2FPSA 2WD7B 1G66A 5JDIA 4BLSA 3ZDYB 5I6DA 2ZIZA 2ZR0A 4W9NC 5I3ZA 2OAQ1 1ZD9A 4RF3A 3OTHA 4UHHA 4ZKDA 5JMOA 1QO7A 3G7SA 4C0JA 1V1RA 2R1VB 4TS4A 1XZKA 2H31A 3A1DA 1Y1PA 1LK7A 2GEJA 4B6PA 4FTWA 1NBIA 5I5EA 3GFOA 4HPJB 2QL6A 3F9CA 4HAIA 3LX6A 1JXOA 4Y2HA 3UANA 2BC9A 2ADFA 2UZAA 1AHIA 3G3EA 4JB2A 4CQMD 1P72A 1ZGCA 2XMGA 4IDEA 1XCMA 4RPLA 2PZ8A 5LWQA 2BZ1A 1Z5UA 4JT4A 4QPCA 4R1SA 4U8GA 4MQUA 4IZIA 4W5HA 3TW8B 4E6PA 2WKPA 4YAKA 4Q47A 2XX3A 3PJRA 1YZQA 1ZNQO 4M0EA 2IEAA 1SJ9A 3L6DA 4TUYA 4WA7A 4LCEA 5EC8A 4JI1B 4B48A 4R9UC 3JZMA 5T3YA 3WMXA 1CX9B 3DYBA 2HMTA 1RS0A 2WNIA 3MTBA 4K81B 1QV6A 1E5DA 1WMDA 1LI4A 3LCCA 1Y6RA 3TZBA 4DNOA 1KEEB 4HUQB 2EKBA 1VE5A 2JFXA 5AKGA 3C3CA 3RTCA 4EJMA 3C97A 4PEVA 3QU2A 4CQLA 1E18A 5P21A 3ETHA 1N33B 2IHKA 4XOUA 3DHWC 3ZDQA 2UKDA 3CCCA 4CG3A 2OO5A 2XDQA 4RJKA 5FTKA 5HM6A 1G4HA 2X9VA 2WWHA 3SLKA 1JW9B 4JUAA 4A26A 1U8CB 1UMCA 2FH5B 2EYQA 1JDPA 4ICIA 4CI0B 4HN9A 3MGGA 2PCLA 3GFTA 3T5CA 1UBMS 1SKUA 1C7EA 1D6SA 3HJGA 2QLNA 4AROA 5KREA 1B0PA 4HH3C 2JLRA 2WNSA 3TFQA 1H4TA 3VJMA 2DGDA 1K89A 4OX9B 4LJAA 1E60A 4TUYB 1H0SA 1TMOA 3WYGA 4TV9B 3QX9A 4LHYA 1WDWB 3AEUA 1UBSB 1TF5A 3OWHA 4L3VA 3T7DA 5IH3A 4OUDB 3AUYA 3ZNPA 3K5HA 4HRAA 5KNCD 2PT7A 4LYDA 3G9XA 1I5OA 2I99A 3WX0A 2FLVA 3RTEA 4RZHA 1ZISA 3GJ5A 5L3SB 4NXNB 1CJBA 1RQLA 1LV8A 1ZUNA 2HF8A 2JEYA 4TMZA 3FMIA 3ABQB 3UMGA 1YKGA 3AKCA 1NYLA 2JNWA 3D1JA 5HIKA 3GT7A 1ICIA 3SG0A 4XUGB 5L45A 3WLJA 3PQ3A 3K6SA 1D07A 3DBOB 1KSHA 1SH7A 3ZWVA 3MS7A 3OA0A 1RRPA 4H7JA 4G8DA 4F5DA 2I8CA 2N1BA 4Q7LA 1XRJA 4RESA 2EG5A 2GDZA 4NJMA 4XD7A 3L0SA 3UFXA 1TAHA 2QW8A 3ME5A 4L4YA 1W1WA 1X9IA 4EY7A 1B00A 5JROA 4GKJB 2KYRA 2PUBA 3D4IA 4EHDA 4NBVA 1OF1A 5E8RA 4DCUA 3C48A 5THQA 1E0SA 1YK1A 1PT5A 2VI5A 2HUNA 3ADKA 3PJDA 4RVOA 4AWXA 3U44B 1JH9A 4BECA 1O77A 4Q7MB 1WMAA 4UMVA 4UPVA 1L3IA 2VPYA 3I2JA 2F59A 1W75A 1KKMA 3BCHA 4V1CI 4D9NA 1E2EA 5JCPA 5KJ6A 4KO1S 4PSUA 4R3UC 4R0NA 1A7KA 2YWJA 4OHUA 5G40A 3K2IA 4TTVA 1MQAA 2JPDA 2OFXA 1E2QA 1MT0A 3JD1A 1CR4A 4KL8S 2HNBA 2GTIA 1XMSA 3RBZA 4R8KA 3HYCA 3G2IA 5C5CA 4GL2A 1NVUQ 3EG5A 4KXNA 5AW4A 3OTIA 5ERGB 1BCRB 4B3TB 2JLCA 4LKOA 3UH1A 1T25A 5M29A 5T4BA 3WIVA 1XTVA 3KSUA 821PA 4P53A 3DBVO 3SHOA 4ZAXA 3K70C 3FA2A 2MSDB 1SCNE 3ZDAA 1Q11A 5AKYA 4NJOA 4GW3A 4RK4A 3U1VA 5H83A 3WQHA 1C8KA 4PSVA 3UWDA 1EFCA 1FZQA 3IA2A 4GFDA 3DQPA 1JWBB 5ALPA 1VM6A 5C81A 3CTPA 3F3YA 3FYSA 3IMEA 3TPFA 4N0PA 2IVFA 5DZSA 4D4LA 3I8OA 1K4KA 3U3RA 1TMGE 3QHAA 5DSXA 4CIBA 1A9QA 2NSJA 5LA6F 3IOYA 4I5DA 2BCJQ 3K0CA 3RARA 1DGQA 1IQUA 1JTFA 4RYDA 2A0UA 1URPA 2R44A 3CPHA 1HL7A 1MH1A 3GLIB 3HM9A 3QPDA 1N2ZA 4RNDB 5DHTA 1BX0A 2NUAB 1E7RA 1EDZA 1MIHA 4BKMA 3DEIA 2MYUA 4DCMA 3JZAA 4ND8A 3KLOA 1SN7A 2KB0A 4FS3A 1VLMA 1WV0A 3FKJA 4TTPA 3WK7A 1G5QA 1J2YA 3SIRA 3VO1A 2XCTB 1PNTA 2R6R1 3B3GA 1YR6A 4LVCA 2WKSA 4O2BF 4PZAA 1R6XA 2P35A 4EZIA 3AGPA 3KVVA 3RTAA 3X1YA 1Z12A 3JARA 2PSHA 1J8YF 1O6FA 3KHTA 2QD4A 2X8JB 3HP7A 3KR2A 1QQTA 2PKEA 1U2GA 3WNCA 3OLCX 2FX5A 2H16A 4MWEA 4NV1A 1N2CA 4F3CA 1O94A 4XIGS 4ZK2A 1WUTA 1DIOB 4YJFA 1PG2A 1WA5A 4JGIA 2ZRLA 3S2YA 4UEWA 4ALJA 5BYAA 1WHTB 4W7IA 4RJLA 3E5NA 2ZCUA 3PA6A 9LDTA 5A4IS 3LKZA 5IHXA 3KXDA 1B8UA 2D5IA 4KGXA 4CN9A 4EG6A 2ONYA 2GI4A 3BA6A 1XD2B 4I9GA 5HILA 1KOLA 3SX0A 2J4CA 4QJBA 1ONNA 2QP3A 2MT9A 2QMZA 3L0BA 4BE7B 5LMNB 5KTSA 3IQXA 2WT4A 4MAMA 4YUVA 1TQ8A 2Q5LA 2IXBA 5LOVB 4DV0B 1PTJC 2H2WA 2JIQA 3PEEA 2O06A 3DYIA 3BH7A 6ADHA 3UAZA 1LFAA 3QVMA 1L6IA 5TXGA 3ICCA 1Y8QB 4Q4LA 3RYTC 4QNRA 1DC3A 4AAYA 3NBMA 1OPRA 5FFMA 4C06A 4Q3BA 3KPUA 2C04A 4HDSA 4CT0A 5A6SA 4KPYA 4UXJA 4ZA2A 2JFYA 1ZAYA 1M67A 2QQ0A 3FFBA 1KIAA 2CLHB 5DK4A 3W5DA 4EHFA 2DWUA 1LBEA 4M86A 5CH5A 1L7VC 1L1FA 4FFOA 2C3YA 2G5GX 1LX6A 1PHRA 1UZMA 3IR7A 4C4TA 2JDIA 1XXHA 3CONA 4CIDA 3M6AA 3E5MA 1CZUA 5EEHA 3H3JA 1VHJA 5CAEB 4AF6A 1KH1A 3NXKA 1EJ2A 3B6IA 3CLSD 4CR7A 1JJFA 2JVJA 1JNXX 2O4UX 1W5TA 3AWIA 4XDYA 4P33A 1DAMA 4OCZA 3H5AA 1S0UA 2YY7A 3A11A 3AHIA 4XD7D 5HRCA 4DSNA 1BO6A 2GTHA 2XB6A 1BXGA 1JQLB 4ME6A 4JBXA 4K9QA 4EUKA 4P86A 4TXNA 1V11B 3JQEA 4QU0A 3R0ZA 4HDOB 1MJGA 3GEMA 2I7TA 3GW8A 3P45A 1JBQA 3H6GA 4LBZA 4YB8A 3V8RA 2H4WA 2GAJA 2BGWA 5AWFC 4PRYA 5LZ8A 5CJ2A 3E9YA 4BVAA 1YU6A 5AVOA 2W2TA 3BFVA 4LJKA 1Z3CA 4ER3A 4F96A 1GUBA 3OQ6A 2C96A 1R6DA 4YIHA 1QHHB 2J4DA 2MIIA 3HJNA 3OMLA 3PNPA 4IZ6A 2ZI6A 3QU4A 4KIWA 2PZMA 1W52X 1RAHA 3DL0A 1F9EA 3OQMA 2AQIA 2QVYX 5JLAA 4BY9E 5AI9A 3ZBUA 3IKLA 1ZM9A 3UB4A 3H87A 4EMBA 1P2TA 4V0LA 1IWOA 1EFDN 3C8ZA 4XH9B 1ZBDA 1S8FA 3D5TA 1P2BA 4ZV9A 4JVMA 1WU8A 1KDVA 4RVGA 4M1SA 4W8GA 4QDTA 3GFSA 4QRHA 1BXGB 4HCJA 2Y9PB 4RKRA 5LQMA 1E7YA 1ORWA 4IHJF 4NK5A 2O8FB 3IIEA 2FN7A 5C7IO 1NR7A 2QAJA 1DRUA 3E3OA 4WINA 2BM1A 1ECLA 6NULA 1AN0A 1W87A 1QJ4A 3MQFA 4WK4B 2WJPA 1QZ3A 1WUIS 2ONCA 4N3GA 9MHTA 1P9LA 3VU9A 4ROSA 3F90A 4OSOA 5AOAA 1SOAA 3GY0A 3CY6A 3SEFA 5KYWB 3IAM1 4ZAWA 4GT1A 1Z3IX 2EJWA 2RCNA 1X14A 5LYJF 2EBHX 4XGIA 1MOZA 1Q95A 2Q8NA 3KQSA 3QYFA 5FOXA 1BYUA 1GGKA 2WUWE 3EXHA 1MNAA 2G88A 1UAYA 1M10A 3BC1A 5DNCA 1CUAA 3ZBTA 5EJEA 2AEEA 1IHOA 3UMYA 1Z6ZA 1R00A 3MCWA 1QQBA 1GTVA 1YDWA 2OBFA 3ENNA 1MJ5A 4IH4A 2D1RA 2QU8A 2DY1A 2FR0A 3DDNA 2ZTLA 4TRNA 3SZRA 3GNSA 5FUQA 1CE8A 2GXAA 1V9LA 3K0AB 2YVAA 3ZQ4A 3E9QA 3AF1A 3C6YA 1BCSA 1Y9EA 3AFHA 3EG9A 3RODA 1VMKA 2FUNB 4TXJA 5DSZA 4ZZ3A 2VZEA 2WIAA 1A76A 1IN7A 4DV2B 4A6DA 3EIXA 5EUCA 1JDBB 2C7VA 1P9RA 2KX7A 1LK5A 3PXDA 1PYOA 4BUZA 1J5EB 1LBHA 2FXVA 4FCTA 1P6XA 4HBZA 4RPCA 3S8EA 4RLQA 4YVFA 3QUTA 1QDLB 2RMKA 3G7UA 3HB0A 5DWDA 1ZN7A 4JUCA 5IHPA 2FR1A 1LQUA 3PHJA 3CZMA 1A4RA 4M7RA 5LOVA 5JD3A 3WWOA 3X1XA 1ZH8A 1BX3A 4YRRA 3COVA 3P0IA 2V7EA 4P98A 2H1VA 3O3MB 3R74A 1NQOA 2GB4A 2IXGA 5ITSA 3ZDCA 1U8ZA 2OBMA 3UWSA 1HQYE 4E15A 4NYJQ 4CKWA 3UGKA 5D85A 1WJGA 2O3TA 1K68A 3EQ2A 2RJOA 1Q0RA 3IBTA 3L7BA 2GRAA 3NBUA 4G81A 1CERA 1E4YA 1NVMB 4M7WA 2FRXA 5IBCA 1OIWA 2FLKA 4EHNA 2AW5A 2I71A 2YWRA 3QVLA 5DXFA 3SJCA 1A50B 3ZX5A 3KR1A 1BXKA 4ZT2A 5LUBA 2I55A 4X91A 4OQXA 4TQGA 3O8QB 4J4BA 4BC0A 5ES4B 3DYVA 3LY9A 4NCAA 2W6IA 1SIWA 3AY6A 1PNVA 1P2VA 4NBLA 4ZN6A 1ZN2A 2IZZA 3TOZA 4TN1A 1EM8A 1I14A 4Z2YA 5J47A 3JYQA 1F8UA 4BO3A 4DCJA 3RK4A 2NU7A 4OU5A 3VKFA 4DV4B 3U60B 2I67A 2ZSFA 3HEAA 1EGVB 2CJYA 5DHFA 1OIXA 4XQCA 5FPSA 3UMJA 2YINC 1TFUA 5JEDA 3F9IA 1OXUA 4P5DA 1SULA 1E1YA 4PZ9A 5AFSA 1E6WA 3H4IA 3P9KA 4AK9A 4ALIA 1QDUA 1R4MA 4NU5A 1PHPA 4H7DA 5GZ3A 3FD8A 5E9JA 4FE3A 1DXYA 4MIEA 3D3JA 4TMKA 1L7EA 3DL2A 1I51A 5AVVA 1E1DA 1O03A 3I2IA 4UZSA 1SHJA 1XZ8A 3FOAA 4Y3UA 1O3YA 3RYIA 3C41J 4ETIA 4F9TA 2EZUA 3SYMA 3N0XA 5CCBA 1VLQA 2KWIA 2IXAA 3MBIA 3LNTA 3Q2KA 3OQOA 4ZAZA 4U1RA 3CLTD 4HS9A 4NYIR 4V3BA 2ZI9A 1KDYA 3VR5D 1E2MA 1UCFA 1OI3A 2A2ZA 3UXHA 4CF4A 2CV2A 1U9JA 2MSNA 3INGA 1X8JA 1VFPA 4AVYA 4CKXA 1KK0A 3H1EA 2I4RA 5J2TF 4BEBA 5KJFA 3JALB 2P79A 4YT2A 5JANA 1IZ0A 2GLXA 3ORSA 4RHYA 4IG9A 4YRFA 3ZGYA 3AETA 1ZLYA 3Q7EA 3UJDA 4AF8A 3IP1A 5MF6A 2BFCB 1XEAA 3DEKA 3L02A 3UZUA 4A1FA 3UYKA 3PGA1 1SG6A 4TKLA 4Y2VA 2DJIA 3PIDA 5FCDA 4C08A 1OXVA 1IRXA 1IN6A 2HI0A 3NYWA 2VPQA 1KDPA 4P1ZA 4E31A 3NVKI 1ACLA 1QIJA 4TLLB 5CVEA 4AKHA 5E6RA 3T9BA 2IX9A 6LDHA 3EH1A 4GI7A 2J7KA 3O2SB 1XZIA 2OV4A 3LZCA 2PMFA 1UJ4A 3WAKA 4K8RB 1B73A 3QV1A 5FUWA 2W2KA 4GL4A 2Z9CA 3ZCTA 2J3EA 4BMOB 2HHCA 3HLKA 4DAEA 3GDHA 5E95A 1R8YA 5LPNA 4Y2PA 5CK5A 3E3NA 3BFPA 3HBFA 4QTUB 4ZT6A 2DCUA 1ULTA 3EZFA 3PYMA 3ABOB 4LWPA 1DOAA 1N2EA 3U7QA 2XUIA 2A67A 5KTTA 1NE2A 3H5IA 3F4KA 4QNMA 4FPXA 4BFYA 1XVVA 4PLYA 3WLQA 1KDRA 2V1XA 2I3GA 4Y2YA 1NF9A 3KEGA 5A06A 2CLKB 5KZMB 4NZ9A 1LRLA 2DKFA 1U28A 1CSEE 2CCJA 2HIAA 1WDTA 3H7AA 1KJWA 3CRQA 2IU4A 1J20A 5M04A 1HE2A 3NGMA 3BGDA 1TX4B 3I12A 5C7OO 3L0IB 2IPAB 5SZIA 3PX3A 3HYTA 2JJYA 1MX3A 2PWZA 2QT1A 4RM3A 5DMHA 4O5OA 2TECE 4LVNA 4JS0A 1CDEA 5EE3A 5AVTA 2RKWA 3DNFA 3GQBA 3LY7A 4M9QA 3DVAA 3GZTB 1UC5B 2ZE7A 2IDZA 3ECCA 3FTFA 1N9GA 1SCJA 1Z0KA 5KYKA 4DHWA 3LLSA 2QVXX 2NQTA 2PUVA 4PY2A 4D96A 2NSYA 1J90A 2I3DA 1F9AA 1ZBQA 4R8RA 1BHSA 2WTMA 4X5OA 2EHDA 1SEVA 3LT1A 2MMCA 3FTCA 4Y2JA 4L6CA 2CK3D 3IRVA 2WJJA 1O8CA 5GZ6A 5IF3A 3CHYA 2QT9A 1GZSA 4KYTA 1DAKA 1EZ4A 3FIUA 4RGBA 1TZMA 1RAIA 4WUVA 2X9LA 3ND9A 4BO1A 2WHPA 3A6FA 4WN9B 4JBLA 2FVXA 4YXWD 1LDEA 5EWJA 3VR3D 4HAXA 2RHJA 3CX4A 5IT0A 3RKSA 2Q5JA 2GT1A 3I5UA 3ELUA 4GZ3A 4GKBA 4ZEXA 5FTLA 1XVTA 1V96A 4I1OA 4TV9A 1T9ZA 3ROXA 4GOKA 3KTDA 3AEQA 3OM8A 3PA8A 2J3DA 2RH4A 1R64A 3N58A 2JA2A 4AKSA 1G8PA 3WZ2A 1RPNA 4E14A 2PA0A 3S1SA 4C7XA 1MO3A 5LP6F 2CL6X 5GIPE 1DTWA 4WADA 1FRVA 1ZK1A 3IE0A 2BTEA 1KXZA 3CEAA 1R8SA 4JU9A 4Q15A 5JASA 2N9UA 3QPAA 4QUAA 1EUQA 2VA9A 2ZIGA 3EWSA 2OCPA 4IRMA 4RCVA 3X1WA 2FK8A 1GPAA 3ZXXA 4BBJA 4D8VA 4ZV4A 5BQFA 1LBSA 3SFVA 1L5WA 1YRQA 5L6MB 2CNBA 3E1KA 4NABA 3ZY6A 1VSTA 3PUIA 3H86A 3COYA 4MZDA 4UNIA 2ZRQA 1GPBA 1DIGA 2BKUA 3PJGA 4NS4A 5TQJA 3AM1A 4BFVA 1TTHA 2WIGA 3ABRB 2QR5A 2XOXA 1M34B 4QATA 4RFLA 2XZLA 2XA2A 2Z04A 3BWCA 1VE1A 3GGGA 3PF9A 4E7OA 4DE5A 4E0BA 5HK8A 5K6AC 1PWEA 1DKLA 4YQEA 5JAPA 1M0SA 4KB5A 1UWLA 1PG0A 2VSNA 5H1YA 4DDUA 4NPAA 5CVUA 3UCXA 4YV2A 1RP1A 2RKBA 2CXUA 3KJQA 4GKVA 4J29A 3MJTA 4NR0A 1WQ1R 4ZQHA 1DCKA 2XXBA 3EA0A 4YJ2F 4M2LA 1WMSA 3TI7A 3N2GA 1T1GA 4XA8A 5A04A 5KQMA 2WWIA 4TVSA 4OD0A 2WKRA 1G9XA 3PC8A 3BE8A 4KDEA 2ZTVA 3QLJA 2JFPA 1E9BA 1H8HD 1X7ZA 2FKNA 5CNJA 3DMDA 3L46A 4RWZA 5HTKA 2D1FA 4AFNA 4WERA 5A4DA 1LPAB 3ETNA 2BHRA 4UMDA 2OWEA 4FS8A 1L5RA 4HFRA 2P77A 1W48A 1NOJA 2RJ3A 3TJMA 2B5OA 1ELOA 1QRAA 3ORQA 3NUZA 4UFPA 4NP6A 4LNUB 3LF2A 1WXIA 5A7FA 3VO8A 4DCGA 4ZVSA 3KX2A 5I9TA 3ZHYA 3IVRA 4X3CA 1JFFB 4OX9Y 1OH6A 4YLYA 3QSGA 3GT0A 3PFHA 1FNBA 2AFIE 3JQFA 2DM6A 3IAM6 3SBEA 5BUCA 1JLMA 1N1GA 2RI1A 4DSOA 1AK1A 1MB4A 2Q5CA 4R01A 4EITA 1IM5A 2TMYA 2QPTA 5BUQA 5KEIA 4NENA 2WJWA 4GH5A 2GVDC 4DNFA 3PNQA 2XXAA 1SUCA 3TMKA 5HUQA 2WUGA 4OQNA 1IOLA 1Z82A 1G59A 4ZOQI 5AKJA 1T9CA 1IZYA 1E1QA 1L5QA 2Y92A 3QWBA 5H16A 2Z6AA 2FP4B 5D7BA 3MILA 2VHQA 3MHPA 4HNQA 4YPFA 3GPBA 1J5PA 4MQFA 5K0ZA 2WNHA 3BMNA 3K0BA 3LPAA 1CUFA 1G8GA 1NN3A 2EJVA 4PZLA 3NETA 1J24A 1MV5A 1S3SA 1ZN9A 2HO5A 3FWZA 3KXPA 2EF1A 3CH5A 1XNJA 4MW6A 2A88A 3SYLA 1RJWA 3ANTA 4EG1A 1NI5A 3QEOA 4UDNA 5REQA 2B8TA 1EQUA 4OGKA 2V5UA 1B0ZA 2VEDA 3M8KA 2C07A 3EIUA 3I58A 3A7DA 3D64A 4U9UA 4KQXA 3S27A 1F5NA 3JARB 3A1VA 3F3KA 3KUXA 1A77A 1SG9A 1U3UA 2QM8A 4ZO9A 2I76A 2FSHA 1IJFA 4UC0A 4CXMA 1ECJA 1HLDA 3IH5A 3UPDA 3I53A 2CVOA 2ZYGA 2VNKA 4DTCA 4R2IA 1PNRA 4TSKA 4AX4A 4G6ZA 4L50A 1FK8A 4KN8A 4CV0A 5IASA 3L8DA 4CEIA 3TTSA 1YF3A 3RVSA 3ZWNA 3AK4A 3JU3A 4GGOA 4P36A 4WFKA 4OI1A 5BMVB 4DR2B 2J9XB 2WUDA 1PX0A 3JWGA 4RVFA 2C7RA 4P3XA 4YUAA 3L1KA 4WN9A 4Q3LA 2C8KA 2FP3A 2J9FA 3BJEA 2B99A 4YPVA 5ICFA 1C50A 2WG0A 1VMDA 3HDVA 5IZCC 3HVRA 2XV1A 1C4WA 4FI3F 4WH0A 5DTMA 5F21A 3D1LA 2QRKA 4CM1A 4RVDA 2JCYA 4CTNA 2QZPA 5J5CA 4S1OA 4M1YA 1QH8A 1CUWA 4K3VA 10MHA 1YI0A 2XCLA 3QY0A 4Q18A 4BMYA 2B69A 5DGXA 3AFOA 3M6WA 3OCVA 4M1TA 4O0MA 5I9MA 2WKWA 2HX1A 3UT6A 1E58A 1J7KA 6AT1A 2Q3JA 1K2VN 1OGIA 1U8TA 1S3GA 3IV9A 3H9GA 4GICA 1K7XB 4V0OA 4HBGA 4DKXA 1L7MA 4JWTA 3VHQA 1FDTA 2ZJAA 4FEGA 4UXIA 2WAOA 4FZ3A 4MW4A 2EATA 4LX0A 5LUAA 3K8QA 1V0JA 4OHKA 3CZCA 3L7AA 1M2GA 1OOEA 4FM9A 3CKYA 4I4NA 4IF4A 3WYBA 3CV3A 5GPBA 1CJSA 3JQGA 5I8ZA 3OFVA 3M1AA 2X0NA 2W2XA 4U2KA 4Y30A 1Q1QA 3KUKA 4G0MA 3KSRA