3WIOA

Crystal structure of osd14 in complex with hydroxy d-ring
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
265
structure length
265
Chain Sequence
b'AKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable strigolactone esterase D14
publication title Molecular mechanism of strigolactone perception by DWARF14
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 85
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wioA00
3H0CA 2PPLA 2QJWA 5LZ9A 1VA5A 3I2KA 3WYNA 1DINA 3N0TA 4F0JA 1IUPA 1CUGA 4C4ZA 3HXKA 5SYNA 1H23A 3I1IA 3QMMA 3FOBA 4BE4A 2ONCA 1Q83A 2ZYRA 5JATA 5C8XA 1CUCA 3D0KA 2HU5A 3D7RA 5ALFA 3L1HA 5AJHA 1BU8A 5DTJA 1BEEA 4P93A 4WCVA 1LZKA 5A6VA 3H17A 5FP0A 2I03A 3EQ7A 4W1QA 5BV7A 1EDDA 4BAZA 1A8SA 5DNUA 5AIBA 1XLUA 5HCUA 5YASA 4YX9A 4H77A 3FLEA 4NZZA 1WB5A 2UZ0A 3PF8A 1XKLA 2GZRA 3G0IA 3FLBA 3V9AA 1FFCA 5K3FB 4EY5A 5LZ5A 4X85A 4EB0A 1GKLA 4Q3KA 2K2QB 3BDVA 3RARA 4J0CA 5LZ4A 1MO2A 3LIIA 2O2HA 4BATA 5JAHA 4X00A 4UHDA 4UBOA 5JD5A 3A2MA 1IUOA 5IVKA 1XZAA 3KD2A 4CIAA 1GPNA 4H7DA 1T2NA 3F98A 3U0VA 4MQLA 4AB1A 4DNPA 2DHCA 1JJBA 1SOMA 1VOTA 2RAUA 5AI9A 2XT0A 3F9CA 1UOQA 3G9ZA 2OPHA 2I78A 1QGED 5AI6A 3E3AA 2WUDA 2HA2A 3CN7A 3LS2A 2WJ3A 4KR0A 5AHXA 1WB4A 3HZOA 4C89A 5HK8A 3JWEA 4AMYA 3AZQA 3C8HA 4B7ZA 1S8OA 5AKJA 1DX6A 4H7EA 1EA5A 5AI4A 4FOLA 3V1NA 1E3QA 5EIEA 3R3WA 1WM1A 3AIMA 1CIJA 3HACA 1CV2A 3QM1A 1M33A 3FLAA 4BDTA 4BCCA 5ALEA 5IH7A 3R41A 4BTLA 1YASA 1XZFA 1J06A 5CBKA 1NX9A 4AQDA 2RGUA 2WHPB 2PX6A 3FYTA 1ZD2P 1ZD3A 3IUNA 1ORVA 4GXNA 1Y37A 4KACA 3G0GA 4JYPA 2RHTA 1CFJA 4UFNA 1YS1X 2QOEA 3ZPXA 5AM1A 3IA2A 4G9GA 4Y2TA 3ZLVA 4H0CA 2Z8XA 3H04A 1XZBA 5DYWA 3FAKA 3H2KA 4PSUA 4KYVA 4X90A 5HK9A 3E4DA 1CUAA 2QXUA 2RIPA 2FJPA 4PSCA 1YSCA 4WJLA 2H7CA 3MVEA 4WDRA 3K9BA 1EDEA 1UOPA 1FFDA 3OURA 5FPPA 5IVDA 4ZI5A 3C5WP 4DM7A 1UK6A 1WOMA 5LZ8A 1XZJA 2AXEA 4G4GA 4MQMA 4QDTA 3FYUA 2WHPA 3K2IA 4CG1A 5EHZA 3VISA 1J07A 2WIDA 2X5XA 1EH5A 1U4NA 1ZICA 2JGLA 4U2DA 5JAOA 3A6ZA 4BAGA 1XZDA 3DKRA 5CT9A 2PSJA 4XIIA 1IMJA 3WK7A 1AC5A 3I2IA 3WK4A 2PSFA 1QIDA 3VJMA 4N8SA 2XI4A 2XUAA 1G4HA 2BUAA 1CQZA 2GBGA 2VA9A 3ESBA 5C81A 4K6GA 3SX4A 5AM5A 2YXPX 3ESDA 2C7BA 4OYYA 4U2CA 1XQXA 4QLOA 3CXUA 4LHEA 1JU3A 2VATA 5HFAA 3EQ9A 4CCYA 4Y2RA 3C5VA 3G0BA 2DHEA 4ITVA 5AOAA 4WY8A 5A7GA 4BZWA 3AZOA 4X92A 4YK7A 3AILA 1T4MA 3C6BA 3OPMA 5LYYA 3OOSA 4BYMA 1DWPA 1QJ4A 2XUPA 1DQYA 4G4JA 2P8SA 1XZCA 3WMRA 4BVLA 5AKGA 1CUVA 5ALRA 2C5FA 3PFBA 5AP9A 3QH4A 3QMVA 4KE9A 4U2BA 4PV7A 3HSSA 1TCBA 2XQJA 2HA0A 2OCIA 5A7FA 4BTVA 1HQDA 4LYDA 3BJRA 2WFMA 2BCEA 1ZI8A 2WLSA 3N2ZB 5ALXA 4B6GA 1H2YA 4ZV7A 4WDQA 3IB3A 3C45A 1RYYA 4AO6A 4DIUA 2C58A 5JD4A 2DCMA 4V2IA 2VJDA 3D5EA 5JARA 1GPKA 2ZJ7A 2XB6A 5LZ7A 4L0CA 4X6XA 1PV1A 5F4ZA 5ALPA 2V97A 5EHQA 1ORWA 1MX1A 3Q0TA 4I4CA 5DYYA 4D9JA 3F8SA 4KAJA 5HF6A 4L72A 4HZGA 3K6KA 3G0DA 2JBWA 2QTBA 2WU4A 3WWDA 2QS9A 4K2AA 3WWOA 2CMFA 4OSEA 2QT9A 2JGKA 3PF9A 4E11A 1F8UA 4HVTA 3KOOA 3FVRA 3BL8A 4MXDA 4LXIA 3QPAA 2H1IA 3DCNA 1GXSA 2IIVA 3QITA 2XUJA 4KEAA 3RK4A 4QDXA 1DWOA 4RPCA 1A88A 2PSHA 4IH1A 5CXUA 3I6MA 1MNAA 2V96A 3PUHA 2DQYA 4IO0A 1EB8A 5DTIA 1GKKA 3NWOA 2HIHA 2CBGA 2XMZA 3ICWA 5T4EA 1VXOA 5LZ2A 2ZYIA 3C43A 2O2IA 5ALGA 2D0DA 1GQRA 3AUKA 4JNCA 3DNMA 1GZ7A 4BB0A 5AM3A 3AFIA 5K3AA 3DJYA 5ALHA 4Y2SA 2E3JA 3C6YA 1CUDA 2BGNA 5FRDA 3SWWA 1JI3A 4M0FA 2QM0A 4FFWA 1JT2A 2Z5GA 2V9ZA 2GYWA 4B82A 3I1YA 2O7RA 1XZLA 1LPOA 3QMWA 4B81A 4DNQA 4BCBA 3MUOA 4H7KA 1QIHA 2WHRA 2CZQA 5DLPA 5CW2A 1TK3A 3C87A 4HRXA 4P9NA 4DMFA 2QXTA 3WKEA 3STXA 4J03A 4CG2A 3IBTA 5AI8A 1VE7A 2BAGA 4LXHA 5CT5A 5AM0A 4ZV9A 1QLWA 4W9RA 1JU4A 1F0NA 2VEOA 3CN9A 3BWXA 1UFOA 4C6HA 5BOVA 5JAPA 3STTA 1KU6A 2JGFA 2J3QA 4BP8A 5AK5A 4FLEA 4QWMA 5AK6A 1JFRA 2XLCA 2WILA 5FXMA 4X91A 3WIBA 5EI5A 5HZGA 1HDEA 3KWJA 1VZ3A 1O6FA 4OB8A 4F60A 1JJFA 1YB6A 1XZEA 2OAGA 5BWBA 1R4ZA 3I2HA 5JYCA 1UXOA 3NOXA 3V1LA 3SC2A 5T4BA 1NU6A 2WM2A 5C7YA 4X95A 4X94A 1UK9A 2WG1A 3EIOA 3FSGD 5E4JA 1DTEA 1NU8A 5ALIA 1W1IA 2W6CX 4KRYA 3GELA 3LP5A 4J0DA 5AKHA 3R3ZA 1QIIA 2PKYX 1TAHA 4JH0A 5LLSA 1BCRA 2HA3A 1THTA 1FFAA 2HA5A 3O95A 4MWTA 4FMPA 1K6EA 2JEZA 3M83A 1A8QA 2Y6UA 5T4HA 1QIJA 5D3KA 3PUIA 4G8CA 1QE3A 1VJ5A 4G8BA 2EDCA 5DJ5A 2W22A 3S8YA 5A7HA 4MWSA 2B61A 1H2ZA 3R3YA 3C70A 4C87A 3WKDA 4AN1A 3BIXA 2HRQA 2QR5A 4PSDA 1CUHA 1R9NA 2PSDA 1UKAA 1OXMA 4ARAA 1MX9A 1W4LA 1F6WA 1N5MA 1G42A 2WIKA 2OGTA 3WJ1A 2ZYSA 5A62A 3DQZA 2CB9A 2DHDA 4G8DA 1VZ2A 4UHHA 2ZYHA 3WLAA 3IULA 1QIGA 4Q05A 2XDWA 2QJRA 4ZGBA 2WTMA 4AO7A 4FLFA 2WJ4A 4K5QA 5FUMA 2YH2A 4OCZA 5AKLA 2IITA 2B4KA 4Q82A 2OCGA 1HPLA 1J2EA 2BUCA 5AOCA 1AGYA 2BKLA 3IDAA 5FOQA 5ALJA 4A16A 3R3XA 5ALTA 5AICA 1QIFA 3AZPA 5AKKA 4FDMA 4HXFB 3DL4A 1LPBB 4LYEA 3G0CA 2VJAA 1K5PA 4BC1A 3WYDA 1ODCA 4UUQA 3TEJA 3B3QA 4NVRA 1YB7A 2OQVA 4QDZA 4EY6A 4W1PA 3O9VA 3G8YA 3V48A 4FBLA 3VJLA 1TQHA 3DDUA 2WIGA 2Q0XA 2D5LA 2WFLB 3R40A 3WKCA 1TCCA 2XMSA 4A23A 2HA7A 1P0PA 1DWQA 3O4IA 4EHBA 5ISMA 5EHNA 4OPMA 4MJ3A 4WFJA 5D6OA 5LKRA 3FYUB 1L7AA 4AZ3A 1X70A 5EHXA 4J0HA 2RHWA 3HLKA 1EXWA 3DD5A 4C88A 1CR6A 1Y7IA 3H19A 3B12A 3R3UA 2BFNA 1JMKC 2ACKA 1UK7A 3D2AA 1CEXA 3W04A 5HF5A 3VJKA 5ALSA 1UZAA 1H2WA 4L9AA 3H2HA 2HFJA 5LIPA 1QTIA 3M3DA 3VDXA 4HXEB 4B0PA 1ZGCA 1GPLA 3IUQA 2RI6A 3JYHA 1EB9A 1N8SA 1CUFA 4NS4A 2WFLA 1MPXA 1F0PA 3R3VA 4CCYB 2WFZA 4DMCA 3DYIA 1ZD4A 3H2IA 5AKEA 4Q3OA 3ED1A 1VE6A 2ZVDA 1W76A 1AZWA 3NGMA 1THGA 2HA6A 1D07A 4Y2UA 3I6YA 4CG3A 3AIOA 2WIJA 1K63A 1JKMA 1E5TA 4QNNA 1ACJA 1XKTA 1LNSA 5AI0A 2VTVA 5AKXA 1ZJ4A 4XVCA 1EI9A 2BJHA 2R8BA 2Z3WA 4GEGA 3QPDA 4CFSA 4DNOA 5JD6A 1TKRA 4XX1A 5CT8A 2C0QA 5CRIA 3GUUA 3GZJA 3BF8A 1LPSA 2G5PA 3PI6A 1C7JA 2XQIA 4ZWNA 1QIEA 1Y7HA 4GWLA 4OB6A 3WK9A 2G63A 1EK2A 4AN0A 2B9VA 1XZKA 5AM4A 4MEBA 3WJ2A 3JW8A 1ODTC 1CUEA 4H7HA 2ZJFA 1QIMA 4IH4A 5T4FA 1QTRA 4QWWA 2ECFA 2OAEA 3KWFA 1BCSA 5BWCA 1E8MA 2XMQA 4ZRDA 1TRHA 1B41A 1XRMA 4LXGA 1LBTA 3B5EA 3SK0A 1E8NA 2QUBA 3D2BA 7YASA 4MEAA 4L3WA 4ETWA 1PJAA 1RP1A 1GGVA 1FFEA 2G4LA 2JGEA 1WCYA 3M82A 2JGIA 5CT6A 4UPDA 1WB6A 5ALYA 1UT6A 3A2NA 4BZZA 2XUOA 4BBZA 1MAHA 4LKOA 2X8BA 1A7UA 4J0GA 4W63A 3WI7A 4B85A 3ZLTA 2VJBA 3M81A 4G9EA 4DTCA 2FX5A 2PBLA 1CUYA 3TJMA 1UKBA 3VKFA 5IVIA 1XFDA 4DSAA 1Q0ZA 1XZMA 1ZI9A 4C4XA 2J4CA 2JIDA 5ALKA 4HTAA 4WFIA 1N1MA 2Y2UA 3WWPA 3WZLA 3STUA 4UHBA 4XJVA 5CH3A 4RE5A 1A8UA 4W1RA 1OILA 2FJ0A 1C4XA 5JZSA 2WU3A 5EGNA 4B80A 5ALOA 5H3HA 3FNBA 1W75A 3F67A 4I19A 5JIBA 2OQIA 2ES4A 4XWGA 4N8EA 2XMRA 2XUQA 4I3FA 5JZBA 1C7IA 2CKMA 1MJ5A 2XUKA 3ZWQA 2AJCA 1YAJA 4DMKA 4J0JA 4Q1VA 4K6HA 3STVA 3FSGA 1XLWA 5JALA 4U2FA 5ALDA 1E66A 1WHTA 3OC0A 4UBKA 1VLQA 3BF7A 4PW0A 4HS9A 3YASA 1LPMA 1BRTA 2WKWA 1J1IA 1K8QA 4AXBA 1MAAA 4MYSA 2AJDA 5ALWA 4J7AA 2Z3ZA 1EVEA 3O4HA 2XUIA 1BS9A 1LLFA 4G4IA 1U65A 4FLMA 5KWIA 3GROA 4BRSA 4RGYA 2H9YA 4RNCA 3H2JA 2DR0A 2HFKA 2HHAA 3IUMA 4E46A 4BCDA 3I28A 4CIBA 4N8DA 1XQYA 5ALMA 4UBNA 3G9UA 1XRPA 5FV4A 5C8VA 1HKHA 3H1AA 3E1GA 3T4UA 4BAUA 2QZPA 1CPYA 4AO8A 2AJLI 1P0IA 3W2TA 3D2CA 4BVKA 2LIPA 2YASA 3O4JA 1LPPA 4BP9A 4QE3A 4X71A 4O08A 2XUFA 1MNQA 4KAAA 2XQFA 5D7BA 5SYMA 5LKAA 3UUFA 3HC7A 3DYVA 3FCYA 1H2XA 3FYUC 1JJIA 4KE7A 1CLEA 1U2EA 5KBYA 1XROA 3EBLA 5CMLA 3WKAA 5IKXA 3T52A 2EDAA 4GBGA 1XRLA 4H35A 5D3ZA 1R3DA 2JGJA 2Y6VA 3GBSA 2WG2A 1XZHA 2C4HA 4EY8A 2ZSHA 1DU4A 1E89A 1SCKA 3V1MA 4B9EA 4FFVA 4U2GA 4UHCA 1QFMA 3MUNA 1CUWA 2C0PA 2XMCA 4FHZA 2CUTA 1USWA 4GECA 4OYLA 1X2EA 5FKJA 3HJUA 3V1KA 1SCQA 4FKBA 3AJAA 2WQZA 1QFSA 1XQWA 4GDMA 3X3HA 1K4YA 3W9UA 4DMHA 1KU0A 2I3DA 1R9MA 5E4YA 2NW6A 2VJCA 3GFFA 1LZLA 2WUEA 4JEIA 3I2GA 4HXGA 5C8ZA 4W1SA 2OCLA 5K3BA 5AOBA 2WIFA 2ZSIA 1I6WA 3WQHA 1AX9A 3FCXA 3P2MA 3BJMA 4ZREA 5K3DA 1XZGA 4Y2VA 3WL8A 1R88A 3G7NA 2QUAA 2V98A 4OU5A 4AZ0A 2WG0A 3H18A 4KE8A 2GBIA 3H1BA 4DGQA 1WPXA 2VSQA 5AM2A 1DT3A 2PU7A 3A2LA 4YPVA 5E2IA 4KAFA 4P92A 3WA7A 1U8EA 4Z49A 4DLNA 4M0MA 2Y1KA 2HL6A 3A70A 4IH9A 3D3NA 1QIKA 1ETHA 1EVQA 1MU0A 3DL7A 4PO3X 5A71A 2HADA 5ALQA 5JZ9A 3BE8A 3DOIA 3EQ8A 4CCWA 2Z8ZA 3PDCA 3G9TA 3ANTA 4CI9A 4GW3A 2VT6A 1AKNA 3QZUA 3LLCA 2OG1A 3QVMA 2X76A 1BROA 2ACEA 1MT3A 1ZJ5A 2QMQA 2GBFA 1CUXA 4EBBA 5JADA 5K5EA 4FTWA 3TRDA 5HF8A 5J3JA 2PUJA 2XUHA 4KE6A 5FLKA 2DSNA 3AINA 3S2ZA 1DT5A 2AJBA 3O4GA 4N5HX 3R0VA 4H7FA 5CURA 4BDSA 4G5XA 4EZIA 2PSEA 1CUIA 3PE6A 4TPKA 1HL7A 1OCEA 2VF2A 3WKBA 4BE9A 3WIOA 2XMGA 2J4FA 1W6RA 5ALUA 4FBMA 1QOZA 2VAVA 5AKYA 1ZIYA 4TGLA 1DX4A 1XLVA 4DSZA 2I3ZA 1DQZA 3G9XA 3U1TA 2R11A 1LPAB 5K3FA 2GZSA 2CEKA 3I2JA 3WK5A 2EEPA 1YA8A 3ESCA 4DYHA 1EDBA 4TVKA 4Y2PA 3G02A 3RLIA 1LBSA 4Y2YA 2CJPA 2HU8A 4DNFA 3Q8WA 3WWEA 2BGRA 3QPCA 1UK8A 5I8PA 3ZLUA 4EA6A 1ISPA 4HRYA 1CUBA 2Y2VA 2B20A 4UFOA 4H18A 3WK8A 5ALZA 3LCRA 3L1IA 4AMZA 2HDWA 5AO9A 1GT6A 1UKCA 2XQKA 4MYDA 4JYMA 4UHFA 4X7BA 3DOHA 1KEZA 4N5IX 4PF1A 1L7QA 2XMBA 3HYSA 4Q3LA 2PVSA 1XQVA 2HM7A 3I2FA 2PL5A 3F96A 3GA7A 2PU5A 5ESRA 1YCDA 3CCCA 1MX5A 2VT7A 4J0KA 4F5ZA 1YS2X 3QYJA 1Z68A 3STWA 1W52X 4G1FA 4K6KA 5KREA 4EY4A 3VXKA 2JEYA 4A5SA 2C5GA 5AIAA 4UBIA 1G5FA 3HABA 5DNVA 4S0XA 5JASA 1MN6A 4KRXA 4B9AA 5HKAA 5CH5A 1TIBA 2XQGA 4Y2XA 1CUZA 4FNGA 4INZA 3WL5A 5AH0A 1QONA 6YASA 4HAIA 4QEKA 4BRZA 1JMYA 1UOOA 1RWQA 1VA4A 1LGYA 3BXPA 4ARBA 4UBMA 3ANSA 5DWDA 3IURA 5A2GA 1QO9A 5AKIA 1LPNA 5AI5A 3HEAA 1VKHA 2OCKA 2WJ6A 2XUDA 4EY7A 4U2EA 3IVMA 2BUBA 2HRRA 4IQ4A 3FVTA 3FWHA 1HLGA 1Q84A 1EINA 4B84A 3WA6A 1ZOIA 1AQLA 4H7JA 2RONA 2FUKA 3C6ZA 4OB7A 4GI1A 4B0OA 1XZIA 3H2GA 5CXXA 2XE4A 3PICA 4GLBA 4J3JA 3KSRA 3MGAA 3UMJA 4YASA 1YA4A 5K3EA 3WL7A 3WK6A 1ODSA 3I6ZA 4UBJA 1P0MA 2ZJ6A 1N5RA 2O2GA 1GQSA 5KWJA 2WHQA 1XRRA 5FPQA 5AK3A 1SFRA 3F97A 1R1DA 1AURA 2XUGA 2YYSA 3BDIA 2GBCA 4Y2QA 2ROQA 2OGSA 1WPRA 5JANA 4OD0A 3HI4A 1CRLA 3TGLA 5HQ3B 3WZMA 1WHSA 4IHAA 1MTZA 2HA4A 4KJXA 3CCBA 4H7IA 3D4LA 4RE6A 5AKZA 3HRHA 1CVLA 1P0QA 1BN6A 1IUNA 1ZIXA 3LIPA 5HF9A 2J3DA 2WTNA 3FBWA 3ILSA 3ZV7A 1X2BA 1EHYA 1QO7A 3DKKA 2IX9A 4QA9A 4UBLA 3RM3A 1ZGBA 2H7XA 3E0XA 2OLEA 4Y2JA 1VXRA 1B6GA 5EIHA 4BVJA 5EFZA 1XRNA 4FNMA 2GYUA 3D59A 5ALVA 1XRQA 1BEZA 2G5TA 3KDAA 4LIPD 5HQ3A 1R50A 5DYTA 1UWCA 2XMDA 4X3CA 3RKSA 1YAHA 1EX9A 5CH8A 4J0IA 5FDFA 3O9MA 1EK1A 4Y9SA 4Q34A 1BE0A 2OXEA 5DNWA 5CTAA 5IVHA 3DLTA 1O6GA 4M0EA 4PQEA 4PNZA 3O0DA 3VVMA 5I9IA 4EUSA 4GHWA 1G66A 4F21A 4OUKX 4C4YA 2WSLA 1FJ2A 1L7RA 4FWBA 5LP1A 4OU4A 4C01A 3OM8A 2GYVA 3W06A 2WUGA 1ZD5A 4X93A 1CQWA 3OG9A 1IVYA 1ZI6A 4P08A 1AMNA 2ORYA 1YR2A 2WUFA 4WFKA 2OGZA 3KXPA 3DEAA 3L1JA 1IZ7A 1HBJA 2O7VA 5CT4A 2QRUA 2DQZA 4B83A 4X97A 1SC9A 1AUOA 3EF3A 3ICVA 2JF0A 4E15A 2AJ8A 3VVLA 4UHEA 4JUIA 4AX4A 1E8DA 1CUUA 3ESAA 5HFNA 3W9BA 4X6YA 1ACLA 5JAUA 3OTQA 1QZ3A 1FFBA 3STYA 4QLAA 5AK4A 4QDOA 4NMWA 2PUHA 3QBJA 3IIIA 4Y7DA 4BC0A 4X6UA 1H22A 5HKBA 1FSSA 1CUSA 2DFPA 1SCIA 1BN7A 5K3CA 1TCAA 1CUJA 3W05A 2QVBA 3C6XA 4E14A 3ZI7A 4ROTA 3BIWA 1IZ8A 5ALNA 4QDUA 4QZVA 3DS8A 5E4TA 2H7YA 5EIAA 2VQ6A 5I7UA 3WWCA 3IUJA 3C8DA 1PFQA 4WY5A 2XLBA 3WL6A 4UFPA 5ALLA 3AIKA 3NUZA 2JGMA 2QKYA 1Q0RA 2HU7A 2VAXA 3UUEA 3PFCA 4ZXFA 2PM8A
chains in the Genus database with same CATH superfamily
3CUYA 2PPLA 2WZQA 2G08A 1ZRHA 4C5BA 3IDSA 1X7YB 1SHTX 1QM5A 3CLSD 3ZWAA 3GFRA 3VSCA 2B34A 3WYNA 2P90A 5I7VA 4CCSA 1VKZA 3JQAA 2JD2A 4RF2A 4HWKA 1AM4D 2EFHB 4YCBA 1MEEA 2H3EA 4JC5A 4RK0A 4V0MA 3VR5A 2OD2A 4C4ZA 4DCSA 3CPJB 1H2BA 1ZU5A 3U13A 4LBVA 1GARA 4LVNA 2VAMA 4JQSA 4N49A 4WACA 3TLJA 3AR8A 3VKUA 5IYZB 3DBLA 1BMQA 1WSAA 2F1HA 4DCTA 1DIAA 1L3IA 4PRLA 3OZRA 5I4BA 4O0LA 4OK6A 1CUCA 3EW9A 3IXMA 2Y4NA 4IJUA 2C82A 4MIKA 2HU5A 4RTNA 5DEIA 4EJSB 1FMLA 2BF7A 2OCXA 1G63A 1NY5A 1FDSA 1KQNA 5IT4A 1O57A 3EG5A 4WGFA 3L1HA 4GXQA 4CM9A 5BXQC 4MR7A 4CIVA 2WMDA 3E22B 1B2LA 1N75A 3ONWA 1M2HA 5DP2A 3VZRA 5JSZB 2QRLA 4LDAA 4U6NA 4WINA 2ILTA 1N92A 4GFDA 5HZKA 1U9ZA 1SB8A 5KPDA 1LZKA 3LVRE 4OHBA 2DLDA 3ZGOA 5G3YA 5CFNA 4DTIA 1GUYA 4G6ZA 2YYZA 3BGWA 2GXSA 4NATA 1R4MA 5KI6A 4JA0A 3WGHA 2C9ZA 2OM6A 2OV6A 3EQ7A 1EDDA 2CJXA 3K5PA 3O83A 4RZUA 1EG7A 3P9KA 3T5MA 1SA0A 2W00A 1FDRA 5LR6A 1T3SA 5HCUA 3K3PA 3MINA 3IX7A 2C59A 1PJ4A 3FCCA 2QW1A 4LXUA 5DM0A 5HKLA 1YR1A 2A14A 1BXGB 4MRRA 4CKZA 4C4OA 4AM8A 4CIYA 3FXAA 3U4QB 3U31A 2ZM6B 3G0OA 2XVXA 4MVJH 3WSVA 3EEOA 4LFAB 1IEVA 4Q24A 3U7HB 4PPNA 1RKBA 4LFCB 1B42A 4N9QA 4ZCMA 4HH1A 2D1TA 3KLBA 3LE8A 4QUDA 4OA5A 3QYAA 1F3OA 1FFCA 4KO8A 3V9AA 4JJEA 2EHJA 4OREX 2VP0A 4FB4A 1B0AA 3K5WA 3QVUA 5KTOA 4DV7B 3A4TA 3O2JA 3PX7A 4Q3KA 1QHNA 2Z04A 3R7WA 2QDKA 1NSFA 1I6MA 3FVWA 4QICA 4TM8A 1U8YA 1ONSA 1IOZA 1TCUA 4GKAA 4J0CA 5LJLA 5CFLA 1UDXA 3SNHA 2R7NA 4PIVA 3ZV3A 3BGIA 1G64A 1LBIA 4RVNA 1WBDA 2PH1A 4K9RA 3C6KA 3UK1A 8LDHA 4NV0A 4C6TB 1MB3A 5H59A 1BOOA 2JD1A 1EFRD 2VJKA 4NXNB 1C1XB 1K88A 4KGXA 5IDYA 5JAHA 4UCQA 4KRFA 1B6RA 2UXBB 1ZEMA 3BSSA 2B94A 4IF4A 2PUCA 5K0NA 4CEIB 4TYWA 5IVKA 1JU9A 1ODLA 4DBLC 4DIKA 2YNMC 1RNLA 4EP1A 4CIAA 4H7DA 3CZRA 2O0LA 3DFUA 1JI0A 1E1CB 3F98A 4ZVNA 5CYFA 3U0VA 2HLNA 2NZWA 4AP6A 4E3ZA 1T6BY 1IY9A 5H4GA 2PY6A 3JQ8A 1HFKA 3N7AA 4GPBA 4ZGGA 1YR6A 2IUEA 4XX0A 2DHCA 2VZ8A 4YJ2F 4K46A 1JLLA 2X9VA 3PCXA 5IULC 3ER8A 1ADGA 1P3DA 1YHNA 1D4ZA 3TBKA 1WXWA 4CF4A 2RAUA 2FPOA 4NLLA 1EX1A 2VYVD 1YDMA 1G8FA 2E87A 1Z4LA 3PK0A 1ZYUA 4I99A 1W35A 4EKNB 3MJVA 1E3MA 2Z2KA 4H7PA 2Y67A 2YDYA 3EB9A 1DKRA 4FUQA 5AI6A 3RIXA 3DBHA 2X0KA 4P34A 2WJ3A 3KTFA 5A9TA 2BHTA 5E6SB 1G3MA 4HDQB 4UAVA 4C89A 1P1RA 2PMDA 4WKCA 1VE1A 3BTVA 2HQ1A 1Z18A 2YV1A 5J1TB 4MULA 1S8OA 2I6GA 4KMRA 1GCGA 4H7EA 1T29A 1EA5A 1DADA 1FP2A 5KVQA 2Q3CA 4G5OA 1W88A 3BD8A 3RIMA 1JHYA 3AFNA 4EPWA 4MI9A 1G8AA 4YJHB 3AJEA 1Y3AA 4FOLA 1O9BA 1J20A 4Q4JA 1U31A 3SIRA 1WM1A 5EMNA 4TQGA 5TB5A 1I1NA 1X7GA 3ND9A 5CP8A 1E6CA 3GP5A 4B6RA 2W2OA 4RFVA 3N86A 1S4QA 3HACA 5IC4A 1FOEB 1IATA 2GMWA 1Z6ZA 1SVOA 1CV2A 3JSXA 3H99A 1JWAB 2EJTA 1HNWB 3QM1A 1Q0SA 5BQ5A 4U9UA 3USCS 2FW1A 4B3JA 3FLAA 3IO5A 2G25A 4BCCA 5IH7A 3DBVO 3D2LA 4IX9A 2FN9A 4LYAA 1S1MA 3WO0A 1MB0A 2P1DA 1RXCA 3QJ5A 2ZBPA 3GG9A 3WGNA 1GQFA 2P4EA 2BHSA 2HMWA 2C2KA 4IILA 4KLZA 1XMXA 3DOJA 2LV8A 5J2TF 3VR5D 1NA5A 1ESNA 2XNDD 3WISA 4O8ZA 1JT9A 2PFKA 4HH4A 3UB3A 3WMGA 3C5HA 7MDHA 5IWCA 3ULKA 2OP1A 2BHNA 1FY2A 1VYTA 4TMTA 1UL1X 1KDZA 5CCBA 4U9HS 2IGBA 4BO2A 3FYTA 4PY2A 1JHOA 4F9TA 1ZD2P 5DSXA 1G7RA 1PK9A 1Q7RA 1V11A 2ECOA 4GXNA 4KACA 1QYDA 4MUEA 3U3KA 1XZPA 3AEZA 4RCZA 5INTA 4XVQA 2RHTA 1HK7A 4UFNA 4QDJA 1EFVA 4RANA 5MGBA 4CM9D 2ECKA 1YS1X 4MQ6A 5JV5A 4KHPB 2QOEA 3W6ZA 2AZTA 4PLCA 4EGFA 1VL1A 1XALA 1N4AA 3ZLVA 1WCIA 3Q7SA 2YZ2A 4RTQA 1WULS 3DW1X 1RQXA 3N0VA 1XZBA 4JNKA 4MRPA 1Q57A 3SP1A 2CXHA 4PS0A 5FI0B 3VR5H 3MMPA 1U0GA 4MWBA 3TXAA 1SUEA 1Z2DA 2BIFA 4A1FA 4DREA 2DFTA 2HCTA 3OD1A 2RHCA 3ZHVA 5TVGA 2PLRA 3GGOA 1CY6A 3P5SA 2V6IA 1MC8A 1YSCA 4PYNA 4L3VA 3W78A 2ZI4A 4F1JA 1Y3FE 2H7CA 1RRGA 2DYKA 4TXMA 2R00C 2QF7A 3G17A 1NR5A 1X7HA 2DWOA 2G4VA 3K9BA 5DSTA 3TNLA 2W6OA 5LP6F 1UOPA 2KW5A 2D2VA 4LOAA 1RKXA 2I1WA 1D2CA 1XVIA 3OIYA 1V3UA 3KYDA 2P9FA 5D5QA 2QGZA 1F20A 1WOMA 2CHUA 2CKDA 2HMUA 1SVLA 3B6MA 3K0AA 3PDWA 2NUPB 3T94A 4MQMA 4G4GA 4P58A 4PRZA 5JS7A 3BRSA 2CVQA 2WHPA 1Z35A 3FPAA 4XEUA 1BX0A 5LXTF 1KFCB 4NU5A 2QRVA 3WV4A 4J7XA 3FDZB 2R2AA 1TL7C 5LOVB 4M9ZA 1QBGA 2E18A 1U4NA 2JGLA 4X8OA 1YQXA 2JJ1A 2QV7A 2ZJ0A 3CKMA 4CMGA 2JLWA 2VTBA 2C42A 2IEGA 1O3YA 4UNPA 4NH4A 5JHGB 3FRIA 3EWNA 2G8LA 4LNHA 5HGJA 5CT9A 2JLZA 4GPTA 2RG1A 2P3OA 2HXYA 4XIIA 4BPBA 2CHEA 3EPHA 3LDGA 3WHLA 1KYVA 1I5EA 1EFPB 1LVUA 2FN4A 3HKEB 3LYHA 4I1IA 5ITSA 1AUVA 2ZB4A 5ICMA 4M1TA 4LRTB 5ELLA 1N8NA 4HDAA 5PNTA 1AHNA 1LRLA 3ZQJA 1ZW1A 2Q9AA 4M2LA 4DJEC 1F5NA 1R0KA 4FWTA 3GEMA 3LFTA 4PAWA 4CYMA 3GPCA 2BUAA 3JQ6A 2B30A 1RHUA 1UKVY 1PR9A 1CQZA 2GBGA 1T4CB 3A1DA 3K9WA 2GCPA 4HLNA 4R2JA 3TLEA 3WQSB 1AO0A 3H42B 2CHFA 2I2WA 3H1GA 3Q6IA 4RZSA 5AM5A 1HFJA 3JS5A 3SEZA 2R8XA 2GAOA 3AY6A 1XQXA 1VLHA 3L7NA 1V4BA 4RESA 3LPCA 3T7EA 1KAEA 2VATA 3V97A 1BO6A 5HMLA 1M5UA 1SHJA 4CIDA 2W6ID 5CU7A 4X44A 3O94A 5LYJF 3CVYA 2H6EA 3RJMA 1E7QA 3UT0A 1LW7A 4Y2RA 3MPOA 4DR6B 1X86B 3N75A 3VZCA 3LVFO 4D5EA 1KY3A 1DCTA 2EKDA 1XK6A 3P97A 5KYYB 2RBEA 3DUFA 4JBGA 5EKSA 1A82A 3F9RA 3OLZA 1NDQA 2DY0A 1SPXA 4ETMA 2E4VA 3KSUA 4IIHA 1DZ3A 2CHQA 3QOWA 1UDAA 4C4PA 1K4MA 3CB4A 4HRVA 1MIOA 3DXFA 4R6XA 5LYYA 5JSHA 1GZ5A 1W0KD 3NANA 3Q8KA 4KBYA 5E9JA 2P8SA 1WZUA 3DP9A 4K28A 1XZCA 4XYGA 2WPDA 4FOTA 4E6PA 3ZHTA 4EDHA 3AQIA 5JDIC 5EUQB 3CISA 1TZ2A 2X9LA 3ELDA 2HEIA 5AKGA 3T0IA 4LZPA 4Q3BA 2FPWA 2ONKA 1WW2A 2RH4A 3F90A 5JHHB 3NCHA 2GAFA 1Q3HA 2ZEJA 3EOZA 3IPLA 3PFBA 4YRIA 5HIJA 2BH9A 1JR2A 1Y1KE 3QH4A 1E79D 2QTLA 1BA3A 4ZYZA 3V8BA 2JLUA 4AX8A 2D6FA 5CDFE 2NYRA 3AB7A 3WLHA 3L7MA 4OK5A 4EOGA 1AJEA 5K4AA 3O91A 1A27A 1CYDA 3HSSA 2F9MA 3WGTA 2XQJA 4F9FA 1KEEA 3FFAA 3RSLA 3FKSD 3S5JA 1Q0TA 1QVWA 4ZA2A 3HN7A 3CH4B 2PTHA 2YWJA 2O3TA 3GH3A 4RZIA 4DCOA 4KU4A 2CVZA 1ECGA 1KBZA 4XDGA 3RVJA 4CKEB 1E18A 2C2WA 3BMNB 4MAFA 3CBGA 2X6TA 3BJRA 2HSJA 1MAWA 2BCEA 3O2QB 3N2ZB 1CNFA 4INOA 3IKJA 1QQTA 5ALXA 2BGIA 1H2YA 2CNWD 3EXEA 3IOEA 4O4HA 4ZV7A 2GM3A 4WGGA 1IIBA 4WDQA 1TM5E 2EWVA 4PFKA 5E9WA 5EJ6A 3F73A 1RPZA 1FUUA 1RYYA 3HLYA 3IE2A 3QW2A 5AHOA 3C4JA 4MW9A 4D4HA 5A5FA 2IP2A 2P2NA 1RCTE 3E58A 4DIUA 1PUJA 4Q3EA 2Z5LA 2P3LA 3WHIA 1JTEA 1KYTA 1P31A 5HKOA 2SECE 2WKRA 4Y6SA 4ZTUB 1B15A 3FPJA 4DQVA 4YDRA 5LMCA 3U4HA 3RHTA 2XB6A 5LZ7A 1YMVA 5AUNB 4YPFA 2QD5A 3VC7A 1N6NA 1PV1A 3ZHOA 5F4ZA 1SBHA 1Z62A 2HY7A 3JU3A 3JTEA 4NJOA 1Y3IA 2ZAMA 3PE3A 4EK9A 2CV1A 4I4CA 1E2HA 2B5OA 1PFVA 3AF4A 4IZOA 2ERXA 3MAAC 5DYYA 1Q6YA 2XB8A 4YRFA 4DR2B 3HH8A 1PGJA 4KDRA 2W6JA 3LZ6A 3UAOA 1KGDA 2QN7A 2VI5A 4JQCA 4MVYA 4HZGA 5FBVB 2FPIA 2JBWA 3B1JA 3JYLA 1KI2A 4WZBB 1L5NA 1AA9A 1CJVC 3SM9A 2IYTA 2Q6IA 2Q3DA 2XDQB 2QD3A 1E20A 1SZCA 1ZEJA 2QS9A 3QXJA 4K2AA 3K6JA 4UASA 5DHSA 4K9QA 4QYIA 4INAA 2G36A 4RKWA 4C5AA 2ORIA 1RWMA 3COYA 3UF0A 3JQ9A 4YC7A 2DE0X 2JGKA 4EG7A 2ODPA 4YMIA 3PF9A 1FP7A 2FRDC 1IJBA 1ZW6A 1F8UA 1ODKA 1L4LA 1OW3B 5I47A 5KTTA 1NGSA 5EPUA 1SEVA 3WLLA 4GLJA 5EWLB 2G9UA 4MXDA 2BGMA 1R5OA 3QPAA 1L4FA 3NTXA 3SZGA 3SX0A 3GJ6A 4ZO6A 4F06A 1O77A 2BY4A 5DE3A 3TDKA 1Y9DA 4RVUA 1GXSA 2LUOA 3DTVA 4N3GA 1DRJA 3PP8A 3VYUB 2NZ8A 2PX0A 3OP1A 3QITA 4ME6A 3T1OA 3OFSA 1YCGA 2H18A 4MUXA 3B1YA 3LT1A 3RK4A 3RS7A 4G0YA 2E5LB 3KQLA 4QDXA 4ZU6X 3TFQA 1UPXA 1Y5LA 3D3WA 3R3JA 3RYFB 1FIUA 1DWOA 2FCRA 4F8EA 3KLOA 4RPCA 4ER0A 3LPLA 4NS1A 4PG5A 5JVDA 2XCTB 1YDHA 3ZW9A 5K3OA 1A88A 3U16A 3T5DA 2PSHA 2WRZA 3Q12A 4B17A 3OU2A 4F6RB 3I6MA 4BMXA 2CC2A 4JS0A 2EBUA 3HDTA 4HVAA 2V96A 1H05A 1T1GA 2BR4A 2C5SA 3KZNA 2EERA 4CV2A 2GJAA 4RSGA 3GGJA 2AFIB 4LHZA 1BEUB 1C0IA 1C14A 1NE2A 2X0JA 3JZFA 3NWOA 2BCJQ 4XCQA 3LUKA 4CTKA 1JG2A 4LMAA 2LPMA 1LKZA 4ZYTA 4U7FA 5KEIA 3OCWA 1YRYE 4MROA 1LJ8A 4NZOA 1TVEA 1Z4PX 1FMJA 3ZZTA 4CL3A 1VXOA 2RBGA 4FOSA 13PKA 1MEOA 5IAJA 1WETA 1J97A 5ALGA 3D6JA 3AHCA 4P2BA 4CT0A 3I72A 2D0DA 5GONF 4Z4HA 1GPAA 2QN6A 1VHLA 5BYKA 5IJWA 4JNCA 1DIHA 3KLMX 1G3QA 3GL9A 3AM4A 5IRCD 5DCWA 1T8UA 3B1WA 4RVDA 3W5BA 1OXKB 2I2CA 4ND2A 2B4AA 1FMTA 3UENA 3O3CA 2WPDD 2QTHA 1KWGA 1QS0A 3DJYA 5ALHA 5HS6A 3QFHA 4EVQA 2KLBA 3KZMA 1CUDA 3NIBA 1O9GA 3RTAA 4QYSA 5DB4A 2BGNA 3MWEA 1EM8A 3N70A 3EXFB 3VX4A 2BFCB 5FRDA 4IFEA 3TR6A 2ZG6A 1E3TA 1GFZA 1J8FA 2OBBA 2QLNA 2F4NA 3N0WA 4M0FA 2UZ1B 2OAP1 3AQ4A 1XU4A 4FFWA 2Z5GA 4LQCA 4R68A 4Y1GA 1KETA 2H4HA 4B82A 1UPUA 2IZZA 3KSAC 3HBAA 4JK3A 1AIPA 3I23A 3D6MA 4KTVE 3BBLA 1D2RA 1LPOA 2HKIA 1JH8A 2AH5A 2V4MA 3PPXA 3QMWA 1DBSA 2JARA 3ONEA 1YZTA 4G37A 1B73A 2AQIA 2WWHA 3L9XA 5LA6F 4ONEA 3IXLA 4MGKR 3FNIA 4PZLA 2ARKA 1O4WA 5KTRA 1BAPA 1P72A 1B2RA 5MF6A 3TSOA 1PEAA 2IUYA 3WYEA 3F6PA 3DLBA 3C87A 4JA2A 4WAUA 1L8LA 5FL3A 4QL3A 3VDQA 1VL8A 2GK6A 4CM6A 2MR5A 1NVWQ 4WASA 1FP4B 2QXTA 2VPQA 4FYVA 3STXA 1B8NA 3VYVA 3MGCA 1OF1A 4J03A 1DLJA 2VSFA 4H4DA 3KYJB 4PU0A 3RBAA 3UH0A 2C1XA 2C7VA 3Q2IA 4BJ5A 1P1IA 3GH1A 1FS5A 1FVXA 1F0KA 5K4HA 1QTNA 2CNNA 4TLDA 3KUKA 5CT5A 3PEFA 4ZV9A 3ZCSA 5B12A 2XW6A 4P53A 2P2DA 3GRYA 3V32A 2LZ0A 4NULA 4OFZA 1JU4A 1DUIA 1F0NA 3O3OB 3RLFA 3K70B 1QK4A 2VEOA 3ESQA 3N74A 4GX2A 3RGGA 1ZSNA 2BWJA 3KQTA 3UGTA 1AV6A 1JKIA 1S2DA 3L6EA 5DASA 2ID8A 4ND8A 3MB5A 1ZM9A 2OHOA 5JSKA 1AUQA 3EXG1 4MR8B 1OJLA 5JAPA 2NZ2A 2X7JA 3F4BA 2ZJAA 3PCRB 1SC6A 4CT5A 4HJXA 4KG7A 4QHTA 3STTA 2F1JA 3VOTA 1KJNA 1F4VA 5B1YA 1IN5A 3AF6A 1T8TA 2P4UA 4P83A 4NYJR 1RJEA 1C9DB 2WILA 3KE8A 3LWNA 4CW7A 5K0GA 2IYOA 1E7WA 1ZY2A 3PNPA 2BZ1A 4KLNA 4JI0B 5JR3A 3UMYA 2I99A 1E69A 4DLXA 1RM3A 4ETIA 1Q1GA 3DF7A 1JXQA 1Z0SA 1Z8NA 3GJTA 3KWJA 1JN0A 2NNLD 3UK2A 4YRDA 1TYEB 6REQB 1YR7A 1U2QA 2QLBA 4FFLA 4TTVA 4ZQGA 2X2EA 2ZDQA 3UICA 2VK8A 3KQSA 4QVGA 1PJ3A 3QGMA 3UGQA 2HGSA 4E5SA 4LX0A 4ZVVA 4R51A 1XDUA 5COQA 2GYYA 1R4ZA 4C0QC 2GEVA 2C3OA 2JIRA 1SCUA 3L6UA 1TKAA 2E37A 2P9QA 4YYEA 3NOXA 3SJAA 1XI2A 2W2VA 1Q74A 3BRWA 3OUZA 2XTMA 2B7LA 4HTFB 5C31A 2R6JA 3IILA 3TRFA 3NNSA 5TMPA 1GTMA 1NU6A 2WM2A 3EXIA 4EHFA 5KSWB 1C7ZA 4X95A 3KJGA 4LDPA 2NVOA 3WQBA 1LVGA 4MRSA 3NC4A 4US0R 4EF5A 3JQDA 2XF2A 1N4DA 1I6KA 2C92A 1FLVA 2WG1A 4JB3A 5FT9A 3ZLJA 3TE7A 1E7MA 4CQJA 2Q1UA 5EIWA 1DTEA 1SKQA 2E5WA 2WVJA 4LZNA 1KYZA 3UK0A 1PGNA 5LQUA 1OKKD 2W6CX 4N41A 4FYPA 4WCFB 3OPVA 3T3IA 4AMVA 3M6WA 2M6RA 1OFUA 2N9UA 3S70A 4PYRA 2WWTA 3AO0B 3LXMA 3IR6A 3B82A 3RSCA 5IDQA 1G55A 4U4AA 2C9CA 3JAKA 5EESA 2ZPAA 2X77A 3TNDA 2WYIA 2WWVD 2QQ0A 2P2SA 3OIDA 4X24A 3PJRA 3VU1A 2JDIA 5ARDA 4GAEA 3BFVA 1TEVA 1THTA 4YTEA 3PGVA 4NMMA 4ARSA 3ACCA 4FK8A 1P2GA 2XOXA 2ZJ5A 3O95A 2BTOA 3SQMA 4FMPA 3NBYC 2V1XA 1V5EA 4JGGA 2JEZA 3IEXA 4I4IA 2RARA 4KLCA 3P4YA 4BWFB 3GN2A 3M83A 1G3IA 4PFQA 2C8JA 3L49A 3H4TA 2C2XA 2Q4RA 1U8XX 1DEOA 1VIAA 1Y5RA 1GRVA 2GZDA 3AI1A 3I64A 3IEUA 3NGXA 5D3KA 1DELA 3W2GA 2E4ZA 2YQ5A 3KQYA 4D6XA 3PGLA 3O8RA 1X74A 5F21A 2ASEA 3MSCA 5FOUA 3TD2A 5DJ5A 5JI3E 1R64A 1G0OA 3VHLB 2W22A 4IICA 3RASA 3CW2A 3KPUA 2EZUA 4EO9A 1QGZA 4LYFA 4DA7A 2XGJA 2ZSKA 3E9DA 5U4XA 4X84A 2YVLA 1A7AA 2ON6A 1UBOS 3ANMA 3LSTA 4GG1A 4C87A 2VPTA 4FHCA 4RPHA 4W5NA 1RPTA 3BIXA 4PSDA 2KS6A 1T8RA 2GBPA 2YWHA 4GVXA 1CUHA 3AHEA 3KKZA 4L16A 4RWEA 2PSDA 4F6CA 3OQ6A 2R8ZA 4AC9A 5A5VA 2JA2A 3OCVA 4D57A 1O7JA 3GJ0A 1NPYA 4CHTA 3MAJA 4GWGA 4EA8A 2PUGA 2QQGA 1D0IA 1C0KA 3KXIA 2R6CA 3GFOA 3OZWA 1S8AA 4W5HA 3L4KA 3HHEA 1CF9A 3ENWA 1I4WA 4J0FA 5DHTA 5A62A 3D7LA 3DQZA 1CY8A 2RHOA 2CB9A 3QYPA 1M1NB 3NBQA 4IXWA 4PNEA 3K1ZA 4PO8A 3II6X 1NI4A 1S1CA 1WXQA 1VZ2A 2QMHA 4EDFA 2FDCA 2AWNA 4CF3A 5JS2A 4ER5A 1M74A 1NUHA 2Z9DA 3OPQA 3OZGA 2IYFA 1FZTA 2PTGA 4JASB 4BNLA 2R62A 4MVCA 1PK8A 3EGIA 3T3GA 4FNAA 2FGJA 2Q8PA 2PIDA 5B1EA 4B6JA 3LLUA 4IQFA 2O1WA 2XDWA 3F5QA 5IJZA 3BK7A 3R6LA 3SBDA 5GM1A 5FA8A 4QUIA 2XMPA 3VPDA 1K66A 5M7EA 2D1FA 3LCJA 3WLIA 1ZU4A 4I6JA 4EO4A 3FNQA 3KV3O 3E8MA 2EKPA 3LX4A 1ISJA 1Q95A 4LRUA 4QXRA 2Y1CA 3RVRA 2O2CA 1R74A 3SZOA 3UJDA 4YMLA 4US1R 5FUMA 1C3LA 1YJBA 3FPHA 2KYRA 1Y3CE 2VBCA 5J43A 4OQXA 2B4KA 3HYTA 4Q82A 5AVZA 2BKUA 2JIBA 1W8DA 1YK1A 2PVPA 2FN8A 3UOAB 2BRUA 5JU6A 2BUCA 3QVTA 4JUAA 4ZEOA 3VO8A 1UDRA 3FWKA 1NI3A 4DCPA 1XTIA 3GJZA 1RZ3A 4MOWA 4QAQA 3MERA 2XH8A 1UQRA 3TJZA 3VAZA 1DBVO 4FYYA 5G0UA 1EUCA 2Q07A 1MF7A 4LECA 4M22A 4LXXA 5ALTA 3GLGB 1B43A 4B74A 2I6XA 3QJYA 5AKKA 2BW0A 3THYA 2LR0A 1VGVA 4HXFB 3BHMA 2R6HA 3DL4A 3PFHA 4D26A 1XDGA 3C8UA 4LHVA 3P26A 1RIFA 1GGJA 1L8AA 3A9CA 1NBEA 3G0CA 3ROMA 1AKQA 2CE2X 2PH5A 3FVQA 3LJKA 5B58T 3KOUA 1PEDA 2R3SA 4WNCA 3ANXA 2MHCA 3CZAA 3KKEA 3AEQB 4K9PA 1ODCA 2CJFA 3NYQA 4UUQA 1IY0A 2G72A 2FSHA 3TEJA 3GLHE 2WWXA 4HNHA 4Y1FA 4JP3A 2DKFA 2HMVA 5THXA 5AVXA 2VS1A 2R97A 2OQVA 1E1QD 1MPTA 2IF2A 3T7SA 9GPBA 3BRWD 5BMVF 5H9WA 4QDZA 3UHJA 2O2SA 2DH5A 2ZTVA 2NO6A 1Z5OA 1KSHA 2CXXA 3EGXB 4B79A 4BIIA 1F4LA 1Q20A 2O2ZA 3GGCA 2G82A 1E2MA 4RSHA 3V48A 3ZE0B 1EQUA 7REQB 5GZ6A 3C5EA 3PL5A 1Z36A 3MCWA 3K20A 3QEOA 1P1FA 3RYIB 3SLGA 4US2R 5EUMA 3ACBA 3H8VA 1TQHA 3QF4A 1EAMA 2PA3A 4IW3B 2Q7DA 4YMVA 2CW5A 2WIGA 4OXKA 4U5QA 2D5LA 1KDVA 4QNMA 4XVHA 3R40A 5FUYA 4BWGA 2V7PA 1KFBB 1ZL2A 2MR6A 4OJQA 5FA5A 3VI3B 3SQOA 3CMCO 1EWYA 2HA7A 1T9ZA 4D8XA 1JEJA 1DWQA 2HSDA 1M6VA 2A9PA 2QTMA 2YWDA 4EHBA 2BSQA 4X63A 1ONOA 4H60A 1QG6A 1ZM4A 2NP7A 1BG6A 1VMEA 2NUBA 1ISRA 5CFPA 5LKRA 1PD1A 4FBGA 4AZ3A 2PL3A 1I1OA 4TTTS 2AFHA 1EK0A 1Z6PA 4NDAA 5KVSA 1FSPA 1JR3D 3NS7A 1U0NA 2B1RA 2K7ZA 4Q9DA 1I0IA 4IRXA 2RHWA 4YAUA 2R84A 1PJZA 4FQ7A 3B89A 3EQZA 4EW3A 4J6EA 1M0SA 2RG7A 4QGAA 1LF0A 1Q91A 3H19A 4JR1A 2FPMA 5DT9A 4WZ6A 3B12A 4QARA 1ZN9A 1BSVA 2IZ1A 3QKRB 1D1QA 3R3UA 1ZM7A 1QDUA 4FFMA 1MW9X 2BFNA 3W2EA 4CGYA 4FYIA 2ACKA 2IBSA 1BHSA 3KFXA 1CEXA 1ZONA 2ZLBA 4NZYA 4ZYWA 3QPVA 2DEUA 1P9WA 3QU7A 1AGRA 1P7CA 5JY6A 4Z4EA 1TJ5A 1Z7GA 3L7IA 4RHYA 2PUBA 3SHFA 4JHXA 2IV7A 3IVCA 3ZE9A 3OLVA 4X8MA 4IDNA 4LWPA 3OJXA 2AB0A 3DOEA 3MCAA 2P62A 1ZH2A 3K6SB 1BMTA 5LIPA 3B51X 3KP1A 4FT4A 4QJIA 1QTIA 3HRKA 4A8JC 3M3DA 3F9IA 1ZWLA 3I73A 4UMDA 4HXEB 5CM8B 1PO7A 3HJAA 1R12A 4GM4A 3TSWA 3GPLA 3CX8A 3CUVA 3H5AA 4QOSA 3EF0A 1G8GA 5HS4A 1JIQA 2JAUA 4XWKA 4F3YA 3IIJA 3FHOA 2BMWA 2HJGA 1RWWA 1N8SA 3PPWA 4QU5A 3HYLA 4G09A 4F4JA 4JJ8A 1ZM3A 5G2OA 3HKBA 5C4GB 1WXGA 2VZLA 4O2BA 2C5EA 2CMGA 2QTAA 4IIXA 4B31A 2WFZA 4DMCA 3DZIA 4KQEA 1PSDA 1W5BA 1LV7A 3KQKA 3OQNA 1A5SB 2H4JA 3CX6A 3FNRA 4MUJA 4NBRA 2BDUA 4Q3OA 5AKEA 3RTEA 1ULUA 3VV2A 4AF7A 4BHTA 5J2UF 3U61B 1TTQB 1PT9A 2FETA 2YQ4A 2ZVDA 4JVSB 1U63A 4BEJA 4IHJF 5NULA 4XLZA 4DBVO 1KZ7B 2N42A 4Y2UA 3V3KA 2BLLA 5IDVA 3DKIA 5CVUA 3RIYA 1Z07A 3AIOA 4HBZA 4J1TA 1GZ6A 2WIJA 2AC4A 1A9YA 1I51A 3WMFA 1GUFA 1JWBB 1W94A 5A06A 4DC1A 3WGIA 4KQ6A 1LNSA 3KQOA 1QKJA 2VDVE 3O38A 1QV9A 3W5DA 2HV9A 4EI8A 5KC8A 5AI0A 1YK0A 3I42A 1LI4A 4G9BA 5JQWA 1KK0A 1TIKA 5CDTA 3NM4A 1YS6A 1YRWA 5EIBD 2D7CA 1NBAA 2XRZA 3LECA 2BM1A 3EJWA 4N40A 3NVKI 3S0JA 3ETGA 2IBTA 2XBUA 4CFSA 1QCDA 5BQPA 4B09A 1QAOA 3QFRA 5JD6A 1EKXA 5CT8A 2X41A 5BO5A 1E98A 1RQ2A 3GUUA 3MS4A 4MVWA 3A4VA 4WXMA 1QF6A 2JB9A 1EP3B 1OIWA 2ZSDA 4OMDA 3BF8A 3G2PA 2XNJA 2YRWA 3GAAA 5C8YA 4FJ2A 2ENWA 4R0MA 4AECA 4B34A 4DE5A 2HDNB 1Z83A 2FP4A 1KHHA 3TAHA 1ZD1A 2QTRA 1H6BA 1QIEA 1GLNA 1Y7HA 1AHPA 1XAGA 3P9XA 1PK7A 4LUCA 5DX0A 3JQEA 1NRWA 1U5BA 3GF4A 5J2TA 4OX9B 2YVKA 3WRYA 2O0HA 1FP6A 1EXDA 2Q4BA 3RBVA 4OQLA 1QH0A 5MDHA 1SU6A 3S27A 2D13A 3Q2OA 2DXIA 3RO7A 4MWOA 2I4OA 2PBFA 3NXSA 2B9VA 2XAAA 2WWIA 4GLLA 3OTOB 5KNCD 1DOAA 2RC6A 3S28A 5AXDA 2FOIA 3I8XA 5HM8A 1ONNA 2I29A 1E2FA 4RHFA 5EXDA 4MV1A 1AHIA 2NYAA 4K6CA 2CDRA 2JBAA 3O0TA 1ZK0A 4E2FA 3BFPA 3LX8A 1KIAA 2VHEA 3NHUA 1QIMA 1U04A 1THMA 2EW8A 3GGGA 4IDFA 1J2UA 4R8LA 5J9FA 4Q9KA 5KMGA 1NF2A 5TQ2A 1FDWA 2WD8A 2H4FA 1E5VA 4BNYA 2AYYA 1K4KA 3MM4A 4RETA 1NXWA 1YGPA 2IXEA 3X2EA 1JVNA 3EA5A 1KGSA 4EI7A 1P1HA 2XMQA 2RGXA 4PXYA 4XTCS 3DZBA 4Z2YA 5BN5A 5A1TA 3TEMA 2VVTA 4PC1A 2PPVA 2V9CA 4QBFA 2O3RA 4KWCA 2JJ2A 4RTSA 1B41A 1DTWB 1M1YA 1TOAA 3IOCA 2CLFB 2IUUA 4YAWA 1JGTA 1AS2A 4MZDA 2QUBA 4OKIA 2X7HA 3TSZA 3FTEA 2VOJA 4RD1A 3LC2O 5FNZA 2OILA 1X3SA 7YASA 1YR9A 4MEAA 5JBNA 1ICEA 2Y1OA 5A0VA 2CVHA 1VKNA 4ETWA 4I8XA 3CVVA 1SH7A 1E2PA 1RRKA 5CA0F 5TPWB 5GJBA 4O29A 2VSXA 1EGMB 3W7AA 5CX1B 4DC0A 2V7EA 1HY3A 1WCYA 3DM5A 3TECE 5IP5A 1PQ4A 4EW1A 3AYZB 4BZZA 1HH4A 2EQAA 3LHDA 3R9WA 3I8OA 3AL0C 2R85A 5BVGA 3D8TA 4AT1A 2W2KB 1H85A 1JAIA 3JQBA 5ER9A 3QNUA 5B7GA 3F6RA 5FFFA 5IZCA 2IYSA 3F3YA 3RRBA 1CQJA 2X8BA 4G1MB 1D8AA 5IHXA 1UMBB 4F72A 3QVGB 2GI4A 3M81A 1Z13A 1Z4KA 4KV7A 2X1HA 4IR7A 2ZSEA 4WNYA 1P29A 3FFBA 1WG8A 4TV9A 1WKCA 2ZCUA 4GR9A 1OZAA 4FFBB 1N9GB 4RK7A 3IXQA 4AU1A 4JJZA 4NKRA 1NSTA 4ESOA 1OH8A 2UUBB 3OEEA 2C7RA 5KPJA 3AUTA 1Q0ZA 2XE8A 1XZMA 4NNJA 2UYOA 2Q3BA 3FB4A 2HV8A 4IJ6A 2WUWE 2XTAA 1LWOA 4BNZA 1PDOA 4C4XA 4GU5A 2CLDX 3WQQA 1D6MA 2JIDA 1EEXB 4B32A 5K05A 3ZDXB 2OKGA 2I1QA 4P32A 3NLLA 4UDNA 1E3EA 3RC7A 4BO6A 5C35A 5TEVA 2FCAA 3AUFA 3EVTA 3A3KA 3P1JA 4HYEA 1XO1A 2BEWA 3DEKA 3OE5A 1FYDA 4RE5A 4ZOEA 2HZBA 1W85A 2A30A 5GIPE 1K8XB 4W1RA 5TQ0B 2J45A 1P8AA 4DBZA 2AQKA 4ZHQB 5L45A 3DMPA 3E53A 3QEAZ 1ZJ6A 5C32A 3KOWA 4D6YA 1Z88A 4KQIA 1JSRA 3QLJA 4QBIA 2JHAA 2LCQA 3TVTA 2QRJA 3ZK9A 2NVUB 4Z0HO 5H3HA 1WUIS 4DY6A 2Y0DA 1JTVA 2OWDA 3F67A 3M6XA 4EA7A 2OQIA 4HVCA 4B3SB 4G36A 4GBED 4WESA 4CTMA 4E33A 3AI3A 1EGVB 4A73A 2WM8A 1HZZC 3N58A 1SCJA 5FWNA 3WLQA 5D2CA 2ZRJA 2ZXEA 4TWAA 3K72B 1O95A 2FPRA 1Q1QA 4IS3A 4BLOA 4ZN6A 4MW1A 5BNZA 3OQHA 3HK2A 4CM8B 3WNBA 2DQSA 3B1FA 1Y6ZA 4IGKA 2CL0X 3SXJA 1RBYA 3L07A 1GAXA 4F7DA 2B2NA 3T1HB 5G40A 4F5WA 2B36A 5L7WA 4MKFA 3L0IB 1NBOA 1HC7A 4IJKA 4MYUA 3TW6A 4EYOA 1NAIA 4YMUA 5IPFA 5KO2A 1PBTA 5TS3A 4BNXA 3J81A 4A15A 3A1SA 4K8OA 4YP9A 3KO8A 2EAUA 1Q7TA 2MSKA 2OLJA 3AM5A 3UFXA 2GPAA 3UW1A 4BMSA 5JALA 3AKZA 3CO5A 1BOFA 1OX4A 1SELA 2AN5A 3OWHA 4U2FA 2OO5C 1W48A 4DQDA 3ADCA 1I2DA 1WHTA 1OH6A 2Q5EA 1A5TA 2QSJA 1NF8A 2V5VA 3N6RA 1IHOA 3ZD8A 3YASA 4HQNA 1ZC4A 1M67A 1RQPA 1OAOC 1V25A 4L8YA 5BT9A 4GMFA 5LDGA 1BRTA 2WKWA 3F6BX 1K8QA 4EFNA 1D6SA 3GJYA 4LKRA 4MTLA 1KS9A 4Y9TA 1VLZA 3CRW1 3I0ZA 2G71A 3D6NB 5GQSA 3UEOA 4J7AA 1HTTA 2AF4C 4FMCF 3HWX1 1POXA 1L2TA 3NBFA 5JQGF 1COZA 4YONB 4EH1A 5LQNA 1M34E 2XUIA 3G1TA 5IN5A 3U4IA 3OZAA 4FQ5A 4HFJA 2AD1A 4Z2AA 2AW3A 3D02A 2W6MA 3GOHA 2AHOA 5L53A 1Z39A 3Q2KA 1OGJA 1Z2EA 1NRJB 3LDAA 4U02A 2PD6A 3ACDA 3MN1A 3H2JA 3ORQA 2DR0A 2VZEA 4BBAA 3GZNB 1EVYA 2HHAA 2HO5A 2O59A 2EG5A 5AVQA 4CIBA 3C1OA 3HI6A 2F00A 1JVBA 3AOGA 1ATIA 2I71A 2VH2A 2KX7A 4UBNA 3I39X 2ZUSA 1NNI1 5HUQA 3PV0A 2ZCJA 3QHPA 5AXAA 2OSVA 2SKDA 16PKA 5DHFA 5HXAA 1P5RA 3LV8A 1GNLA 2W8ZA 3E61A 1SXJC 2I4LA 2A5LA 3RYCA 3UPUA 4ILKA 3BK2A 2JAOA 2JLCA 2QLMA 3ZHYA 3OC6A 4G0UA 2MSLA 1MV5A 2VTDA 1TJNA 3PEVA 4JVOA 4OG2A 1UBKS 4EUFA 1QRDA 1H4SA 2PWPA 4EENA 1H0HA 4KVGA 2ZR8A 5JMOA 2H1HA 1R0ZA 1D6NA 2AJLI 3L5OA 1WW3A 3QV1A 1V4VA 1EUDA 3D2CA 4OJNA 2LIPA 1J0BA 4BVKA 1A50B 1NMQA 3W6PA 1HG1A 1LPPA 2XXJA 3K4QA 4YLEA 2K87A 4RS4A 3HNPA 1NULA 3SSMA 5GJCA 4EEXA 3EH2A 3I4CA 3WAKA 1YKGA 4W5WA 1FTWA 4X71A 1Y3HA 4LDJA 1L4MA 2BEUA 3LA8A 1CFZA 1P2TA 2FPPB 5DOVA 2XUFA 2FX2A 2ZIEA 1MNQA 3KEOA 3UKDA 4KAAA 3NWBA 4FQ8A 2QNRA 1WE2A 2CGEA 2FH5B 4P4UA 4KYIB 2AKEA 3SYMA 4LZZA 3UUFA 4B48A 2H5IA 2IUFA 3FTPA 1V95A 4AXXA 4U9IS 2V7WA 4NYJQ 1SK9A 1CY2A 1P4SA 1KBQA 3DB2A 4RSMA 1MA0A 3RS0A 3UV3A 3PIDA 2EKLA 1BTOA 3W2HA 3ZTYA 4BP8A 3A7DA 1KOGA 3R7BA 3FYUC 3PS9A 3R0JA 2JJQA 2H17A 1JJIA 1ZRNA 2FPGA 1CLEA 3KBOA 1N1DA 2D1QA 5C2JB 1CS4C 5LC1A 3SYLA 1OZGA 2YWFA 2HMAA 5HQTA 1T9DA 3G59A 3EEIA 4D97A 4RYLA 5JC8A 2C57A 3ETEA 4YJ3A 1Z5GA 3AVVA 2DJ5A 1SC1A 2V8OA 4KUHA 3L05A 4GRDA 3V6LA 3RK0A 1R66A 5EZYB 1EE1A 1I24A 2LGJA 3MTJA 3NRBA 1TD9A 2EDAA 4H0NA 4IXTA 2G7ZA 2ID9A 1L5GB 2QZSA 4AJOA 3HCRA 5JROA 1FL9A 1LU9A 5D3ZA 3RS9A 3FOCA 4QODA 5BNTA 3ENVA 3LL4A 3E4CA 1ZGAA 3SJZA 3VTAA 3VR6A 1NLYA 1P77A 2WSSA 4M8KA 3A32A 1NM5A 3V80A 1KJYA 3DA8A 3GBSA 3NFRA 3VFDA 4WRRA 1XZHA 4O2RA 2C4HA 2QMYA 5MN4A 1USGA 1E89A 2B7BA 4FI3C 3V1MA 1K06A 4LF9B 2W2QA 1I9CA 2IXDA 4ZOQI 4M89A 1OHHA 4B9EA 2VG8A 4M0LA 2AOTA 3OQOA 1QRRA 1AQYA 3ZWVA 3ZY2A 3D7SA 4TL9A 4B5LA 2OSBA 3ZDZB 4BLSA 2CT8A 3G5TA 1QFMA 1ZA2A 1CS0B 1BFDA 2JIPA 5FTKA 1JUDA 4MV6A 1FNDA 4RMHA 4UJ5A 4WXEA 2C0PA 2WKSA 5EJFA 1YRLA 2CUTA 2Q2QA 1QG2A 4DMUB 1G3RA 3FE2A 3IQHX 3R0IA 5IANA 3PQ7A 3UJNA 3AOEA 1Q7EA 5EN4A 2D1YA 5EUCA 3FOEC 2X9GA 2JCVA 4UXHA 3AB8A 1VPWA 1RJFA 1KXZA 1LJLA 3H9UA 3HJUA 3KJNA 3Q5DA 5JO9A 1J9GA 1CK4A 1MO5A 1G59A 4MW6A 4BMPB 2ODQA 2FSSA 2VT3A 1TAQA 1XVLA 3B53X 4I4TF 1E9SA 4IL5A 1ZQ9A 3TQCA 3KKKA 1PLLA 5KVAA 2Y1GA 1AQJA 1QO0D 4Z0NA 3H6HA 1FLNA 2F1RA 3DJFA 3K6RA 4ZVOA 1DKPA 2CSUA 4JGBA 1OFGA 1KIFA 3QE2A 3A6GA 2JKVA 1PT8A 2BV3A 5LQCA 2JHCA 4ZYVA 3ZNNA 2QROA 4F5DA 2PKQP 4X8HA 1CEEA 2PH3A 2VF5X 3OO0A 1KU0A 1A77A 3OF5A 2I3DA 2W6NA 2D5AA 4TUYA 3L84A 3BERA 5F78A 3C98A 5MHTA 3KRTA 3KFVA 1D9XA 1IHPA 2ZJ4A 4BNFA 3MTEA 4W6ZA 5CFQA 3I2GA 4L27A 4LW8A 3FGZA 2O8FA 3UYLA 2NVWA 2V55B 2CFSA 5DHAA 1Q7CA 2ZUWA 2X86A 3IA7A 4W1SA 5B6JA 3PFWO 4Y1RB 2IFTA 1ZD8A 3BB1A 2C1ZA 2PGIA 3CCFA 4TSRA 1Y34E 3NVAA 1DIRA 3O93A 1I6WA 4G2TA 1QF9A 4D3XA 2W48A 1E58A 2YYYA 2WTUA 3IBSA 3QKIA 4CLDA 5BPFA 2IXBA 3OO1A 3RABA 2WD7A 1BJRE 2RD2A 2FR8C 4KR2A 4OL0A 5K3DA 4PG7A 3RWMB 1T34A 4N3AA 4ZOCA 5FBKA 1LDNA 3NH6A 2GJ4A 3VPSA 1F2TA 1LFDB 1R88A 3AVXA 1PHRA 2R5WA 1K3UB 5A0FA 5C1OA 1WRBA 3MWLA 5FBWB 1E9BA 1CE8B 1NLMA 3MD0A 1G21B 3O9ZA 3TJRA 2R25B 2VDWA 4FGZA 3W3AA 4LCJA 4ZI7F 1V4NA 2BYTA 4CMHA 3RWOA 5CG2A 4UNQA 4IMJB 5CUQA 1IPHA 1IRXA 4BJ6A 2GJ9A 3MELA 1TZCA 5KJFA 1H5UA 3MJTA 1E4EB 3PNYA 4P80A 4P92A 2O57A 4BFVA 4ARZA 4LNAA 5IJ9B 4RIEA 2ZR7A 1U3VA 2J07A 2GKSA 2XOEA 3U26A 1O0CA 4ND5A 2Q1XA 2Q8QA 3OJ0A 4JXKA 2CV0A 4I50B 2VXOA 4CM5A 3KQPA 2IYYA 4J94A 2PE5A 1W36D 3E84A 2UAGA 1HSZA 2HL6A 4JOCA 5FLXA 4GYYA 4MIOA 1FYFA 3CUUA 5TMEA 4IH9A 5HSGA 1RXWA 1FZQA 1O97C 3QFTA 3T35A 1HNXB 2Q6OA 1M5TA 4N7BA 4YGYA 1QH1B 2SKCA 4DL9A 2O8NA 1NX6A 2Y0BA 1DHTA 1W4CA 3JWGA 1NFQA 3DVRX 4WJKB 5JZ9A 5EVJA 2VXCA 5I5EA 3HYNA 3EQ8A 1C7QA 1I33A 1M8FA 2DFDA 3AR7A 4GC5A 4KO3S 5E8JA 4Q47A 5TJHA 3HFJA 4DABA 3MJ4A 1LK0A 1JG7A 3DR5A 4GI3A 1MHTA 3NWPA 4D7AA 3UMBA 3G9TA 1LW6E 2PX8A 5DGCA 3A36A 1GN9A 1WCV1 3ASVA 3H11B 1AKNA 1SUSA 2C2MA 2J3LA 1KDOA 2ZB8A 3KKMA 3H7AA 2HWXA 1JKFA 1CZRA 4EKYA 1KL7A 3P2KA 1ZC3A 1T3HA 3CGGA 4B4DA 4UDYX 5DCUA 1K7FB 3D81A 4BP3A 4IEIA 2X0NA 4D9IA 4OJYA 5IYZA 4WHMA 4ZRMA 2F59A 1V26A 4IX1A 4AJJA 5JADA 3HFGA 3NORA 3QU2A 4O4LB 2D59A 2VHZA 3FROA 3R5XA 1Z73A 3SF8B 5JSQA 4HNQA 3BTUA 5B4UA 4AJLA 5KYXB 3PTAA 3BULA 3ICCA 2C3UA 2AXPA 1YC5A 2HHHB 2QUHA 3KV1A 3SMVA 1VBFA 3THXB 1LTHR 3N2GB 4PPFA 1Z6XA 3E22A 5FFMA 3IIKA 2ORWA 3KYCB 1DT5A 2AJBA 3H86A 5D84A 5BW4A 2W4IA 3ZK7A 2ZANA 3KJFA 4RY9A 1V37A 1C1HA 1Z0ZA 5JPCA 3A0RB 4IKPA 2YIDA 1K9SA 3MGBA 3PKIA 1CUIA 1OHHD 3QK7A 4TWBA 1JRLA 1L5VA 5J4KA 5JH7F 4BXOA 2VDNB 1RWNA 1Z4OA 3P9RA 4WBXC 1KJ8A 2WTAA 3Q8LA 3B5JA 1HL7A 4B45A 2O1EA 2QVCA 3M9XA 1TM1E 2H57A 2ACWA 5JG7A 2DFVA 4WD3A 4C04A 4K2HA 3UW3A 1H3NA 3LBFA 2VJOA 3FZYA 4INPA 4FBMA 2ZIGA 3DLHA 1ICIA 4PG8A 2R8YA 5LWHA 4I2VA 4JXXA 3U7GA 2RJ3A 2Y0EA 3PGKA 3FHCB 3Q3GE 1R6VA 4I5GA 3Q0EA 5KYVA 1Z6QA 3W5VA 5KOHB 3OKPA 2A1IA 3R5FA 4ZU1X 4E5PA 1JHUA 1ZIYA 4FINA 1DX4A 4MVJG 4QUEA 4TGLA 2XOKA 3VR6H 5KNBD 1F6DA 1LQUA 1QDLB 1TCVA 2GN6A 4CV0A 4FGSA 4HWOA 2Q5QA 2G17A 3A4NA 4C4RA 1CC1S 4LRYA 5E1BA 3K1AA 4GPAA 4D9HA 4EGCB 3EVFA 3OE7D 1TT5B 3QA3E 3MJRA 3TOZA 1EU1A 2IEDA 3I2JA 2V0NA 4P84A 1RIIA 1GNSA 1O1YA 5LUBA 3DYBA 5JW6A 2EEPA 2PZLA 2TMDA 1NUUA 4YFVA 3I5XA 3S1AB 3UBMA 2O07A 3Q3IA 4RZXA 4Y9RA 5JPIA 2ZIFA 4TLLB 1OWNA 2F3QA 3C5CA 1EHIA 3CRVA 5IZ4A 2VNIA 3LX5A 4TVKA 4CE6A 1ZNYA 3GAFA 3MC1A 5A4FS 1M7HA 2VPXA 3CEAA 3G02A 2O2JA 4CEIA 4FE7A 4HS4A 1LBSA 3A25A 1BHJA 3Q8WA 2BGRA 2H07A 2A3RA 2QSZA 3QPCA 5I8PA 1E1CA 3ZLUA 3A6PC 1QXSA 2GDJA 3DMFA 5EWMA 4YCCA 4N6OA 4A92A 3RU9A 1ISPA 1OXTA 1RS0A 5I7FA 4EL0A 4GI5A 2RHLA 1GADO 3OFKA 4UFOA 1VG1A 4H18A 3C3EA 4EJ0A 5F7XA 3E48A 1HETA 4WXRA 1ZESA 5ALZA 3UAYA 4BLVA 5AW2A 2CMHA 1ID1A 4UQOA 4BO7A 3EUAA 4AMZA 2BTQB 4GVLA 2YJZA 1T9HA 2ZIVB 3I8SA 4JWTA 4F85A 4ENRA 1GT6A 2C88A 2YWRA 3HR7A 4ZI3A 4CTOA 5AMXA 2ZK7A 1J33A 3LGSA 2EYUA 5KQSA 3DOHA 5E6SA 3MXTA 2EWMA 5D87A 2DFNA 4EHKA 3W3AD 3FF1A 4PF1A 1DPFA 1OQAA 1QAMA 2YWCA 4FFNA 4FJ0A 1YZQA 1JXOA 3IELA 4NL4H 3O8CA 4JXZA 4KFUA 4R0NA 1IQPA 1BRMA 1U8TA 2HM7A 2I4TA 2JZCA 2PVSA 2XBLA 3U6KA 1T9CA 1SQ5A 3NHZA 3ODPA 4DFDA 4ZFNA 3ML1A 5LQDA 5JDCA 1OLUA 3MCZA 5CDYA 2KM1A 3JWJA 2WPNA 3T0GA 4QHSA 1KA9H 4IGAA 3GRRA 5K2MA 4J16C 3VM6A 3AHHA 4JODA 1KQGA 4EB6B 4M1KA 4IFTA 2VT7A 4P33A 4ZI2A 3AG5A 3JRXA 4DLTA 3VNVA 1DBIA 2ZYDA 2M6LA 1Y1QA 2FPUA 5A3SA 3NBUA 2W6QA 3PFKA 2AX3A 2PUWA 3ZCUA 1Z75A 1GPMA 2PLWA 3A9TA 2A9RA 2XTZA 2XV1A 3GT0A 3KEFA 4A5SA 3W3AH 1Z16A 3U37A 2OVBA 1V45E 2QIOA 1TQ4A 2QUZA 4UUOA 4WZZA 3UJPA 4E6EA 5DBEX 1G5FA 3ETNA 3MMSA 1EP1B 3D6UA 2E4AA 2HRZA 3P4UA 3GLIE 1UH5A 3G88A 3UA3A 3BWCA 1YZFA 1CEYA 3V8VA 4B8WA 5CH5A 1N1GA 3VKVA 3AI2A 3VPXA 3ZWXA 1Y81A 2BELA 1ZM2A 3G2KA 4OQPA 3R3SA 3EXAA 3ZOZA 1QLHA 4JI7B 1V9LA 2R4UA 3JAWB 3P2EA 4KYTA 4FNGA 4YRTA 2OTCA 5DWQA 3K4HA 3IAUA 1QUEA 3OE1A 3CZ5A 1NN0A 2O3JA 1RWQA 2X4GA 3ND5A 4YMGA 3GCXA 5KQPA 3OHMA 3EIXA 3DFKA 4CV3A 1B76A 1UODA 5DHRA 4ER7A 3BXPA 2IE0A 1Z2CA 1CG6A 4D9GA 3L82B 1E5XA 2RB4A 4PONA 4Z53A 1SXJE 3MZ0A 1U7TA 3SEQA 5IM4A 2WHEA 1MB4A 1SQSA 3LPAA 4YALA 5HUHA 1TF2A 3ANSA 3IODA 4RF3A 1G9XA 3B60A 4JBNA 3M1LA 1VLMA 2V8BA 2FMHA 4ID3A 3CSDA 3OCZA 3D4PA 1TEZA 1K97A 4GYKA 3K32A 4K88A 1P2UA 3ZZNA 2GFIA 3QSGA 5I4KA 1VL2A 1MT0A 3HB4X 3N53A 3HEAA 5AI5A 1VKHA 2H0QA 2HQSA 2XSZA 3BQNB 3NBMA 4HAZA 3R5JA 1JA0A 1URPA 2XCSB 1CY1A 1GCIA 2JIOA 4QBTA 4EAAA 4B3MB 2JNWA 4XGKA 5CA1A 2JFWA 1D9ZA 1DRKA 2AK2A 3D3EA 1D3AA 3TCNA 1Y63A 3DAOA 1RAIA 2HRRA 1RYEA 3AL2A 3AEUA 3HP7A 3KYIB 3I52A 4NEQA 1TQ6A 2PEYA 4LQDA 1EUZA 1BX3A 3FWHA 3REGA 10MHA 2Z1DA 1T24A 1TPYA 1XXHE 1MAVA 4I36A 3HXOA 1XDZA 3RQSA 2C2GA 4JENA 4G0VA 5JJCA 5L6LB 2OXFA 3GR6A 1AQLA 1LA2A 1XNGA 3IMGA 5IAEA 3UJ9A 2PKCA 2DWQA 3L46A 3MYYA 5HKKD 1KJJA 3A7EA 2NUPA 4ECAA 3TNFA 1YUMA 4AWXA 3VH2A 1TTPB 2FUKA 2R44A 3LDUA 4QKQA 3SDZA 5IK2D 4PS1A 3G9QA 3PENA 2HLDD 4OB7A 2ZB7A 1BDIA 2F1KA 3FDZA 3ZWYA 4M1SA 5GTDA 3LOUA 1FUIA 1JS1X 2VNAA 2W0SA 1IXSB 3RAPR 3DHEA 1SIWA 3HDVA 4BBPA 1KI8A 4RDCA 1U9YA 1JL3A 3H2GA 3PDJA 4BN4A 3V4SA 2QN9A 3A6EA 4LJ7A 3DDCA 4GLBA 1H0SA 3RTDA 1T5BA 4KXLA 1BYUA 5TPZD 5FOSA 3GEDA 3NVDA 1R9GA 1YA4A 2QTCA 4LY6A 3EZLA 5EEGA 4E5NA 3R9XB 4TXNA 2VUIB 3K09A 1SMKA 5JSYA 1EFPA 2VK4A 3HKEA 3KFLA 3D7NA 3EDYA 4J2HA 1QOQB 4YROA 5I51A 2WHQA 3GNLA 3TQTA 4ZVLA 4EB8A 1UJ4A 4FIZA 1GQOA 1NBIA 3FPCA 3RVOA 3W6OA 4AZSA 2VF4X 3MPUA 2WP0A 3UMFA 5T3UA 4GLFA 4NECA 3U19A 2ZJ1A 3AR3A 1OVMA 5F98A 2YDXA 5KX5B 1IVNA 1UCFA 2SICE 1DOHA 4BLTA 1ZGZA 3CZPA 3OLWA 3PFGA 4G5QA 4WLVA 5B3JA 4D44A 1WPRA 3BB4A 3H05A 4NMHA 2EFGA 4OD0A 2QQFA 4QREA 4HN2A 1MOZA 2GOYA 1LX7A 1B1AA 5HQ3B 5LL6P 1FC0A 3RYHB 3E7FA 1MGOA 2XPCA 2FZGA 4R31A 2XR1A 1NVKA 3E9YA 1USKA 3NX4A 3V7WA 5KYYA 1FB5A 1G19A 4QJ4A 3DEFA 2QBYB 3RIGA 3WSWA 1MTZA 1ABBA 3TLYA 5D86A 3QOYA 4FKMA 1FVHA 1NZDA 3Q4GA 4UC0A 3ROTA 4H7IA 3NEAA 2GXQA 4PQFA 4NYMQ 4NU0A 1CVLA 2F62A 3A1UA 2SCUB 3EZFA 1RZRA 1M54A 1GDHA 1OC4A 3GCZA 4DQXA 1RVDA 2REQB 1P0QA 2VCEA 3GUCA 2R2GA 3O1HB 4MS1B 4GP7A 3ZVMA 1VC2A 2Z83A 4XJTA 1QK3A 5H81A 4MTCA 3KQMA 4LSZA 1N2BA 1PTJC 3SEFA 5CVVA 4X61A 2Q28A 2ISCA 1BGWA 3NDIA 3ST7A 2PGLA 2FPKA 3PX2A 1M3SA 4LXYA 4FSHA 4QD3A 5TSDA 4JI2B 4AKGA 3BMOA 1U02A 5JMWA 1Z2PX 4FDTA 2D06A 1P9NA 2QYSA 1Y6QA 2FDXA 5B2FA 1G8JA 1X7DA 1LWNA 2IX9A 4UBLA 1ZGBA 2D1RA 1YJXA 2H7XA 3CJRA 3O73A 3WYBA 4P3KA 2XZOA 5H3CA 4QQ8A 3GUYA 1RFLA 4BBJA 1Y3DE 2ADFA 2GQ0A 2G67A 1CZLA 1X1BA 1KYQA 1WMDA 1KP3A 3GLKA 4YR7A 1V8DA 1A9OA 4ESVA 1E1MA 1Z74A 3PNKA 3LHSA 5CLQA 4ZK2A 5EFZA 1KI3A 2GBLC 1XRNA 3U40A 1MOQA 3I05A 4CKEA 3W5AA 4FNMA 4K9LA 3BMNA 4HEHA 2PLAA 2F3RA 5BN3A 4BNNA 4S1TA 3H5NA 1GNTA 2P5UA 2CMDA 3MIIA 1ECBA 2ZWOA 4IIYA 2V7BA 1P4RA 2R79A 4P81A 1XMVA 3GD7A 3JATA 1R0YA 2PT5A 4UJ3A 1C5KA 3LBYA 3GNSA 2NSHA 1ZP6A 4PXSA 3ZUGA 2HT6A 3EZYA 1DP4A 4PX5A 3V8EA 3DMHA 1YAHA 3CTMA 3AR9A 5KNLA 2V1UA 5CH8A 2YZNA 3RRJA 4G5YA 3P2IA 4OHUA 1Y9AA 4J0IA 4PQRA 2YZ7A 1JILA 4MCHA 2XB4A 4EAQA 2POCA 3I0MA 2B98A 5FDFA 4AYXA 2ZITA 4UAJA 2ZETA 4R1PA 3CW8X 5DHPA 1EK1A 4QPJC 1SKYB 1M2VB 5CAEB 3KQQA 1VCOA 4OSOA 1UMDB 1BE0A 4JB2A 2NTEA 4KCGA 4YLYA 3ISVA 4LOJA 5CTAA 4RTPA 4MCJA 5KNDD 3PFNA 3DE3X 1S6YA 1N0WA 1ZRSA 4RD6A 1T6ZA 5PGMA 3ROEA 3BTSA 4M36A 3LUFA 1KR5A 4LC0A 3LP6A 3TOXA 2QAJA 4FZVA 2HJSA 3EZ7A 3SSNA 1NW3A 3P0HA 2H92A 2BJWA 4B73A 5B1DA 4B6QA 1X7ZA 2XJ4A 1DC6A 3HP1A 1R5NA 1ULSA 3B1XA 3BDAA 4M0EA 1E9RA 5DW3A 2QX4A 3MB8A 3WIVA 3O0DA 4PYLA 3SHWA 5FTMA 4BJ3A 4K9OA 1WUHS 1I6LA 1EWVA 1IAQA 5D3MA 5F64A 4KOEC 3VMMA 4D8UA 4UXIA 4EUSA 4NBSA 4GZ6A 4X62B 1E96A 4HPJB 5DNAA 3S1SA 2AI1A 2GM5A 2JAQA 4GE0A 5DM1A 4F21A 4ZQHA 3VO9A 1ZXLA 4BUZA 3F6EX 1DQNA 3A04A 2HBQA 1JA9A 1FJ2A 3OPXA 4C29A 2EGUA 1BMFA 1D4FA 3KOYA 4FWBA 2V58A 1DMSA 3O26A 1F9AA 3I5YA 2JGDB 2QXYA 4HAVA 4ZAXA 3TKAA 5FEMA 4DIEA 5JS1A 4DT1B 2EFJA 2NUTB 3PSHA 1CP2A 1LQTA 3E81A 3O03A 4TKUB 3RG8A 1S3IA 3W06A 2XA2A 2AD5A 2WUGA 3B9BA 1IVSA 4X93A 3ROXA 4BFWA 5ADVA 2I9PA 1JBKA 1GL7A 2BF4A 1JBQA 2P7HA 3GDWA 4XSGA 4QT0A 5EKXA 3UJBA 5LCXA 2BI4A 2RHGB 5I7SA 4FSXA 3EQ2A 1IB6A 4HR7A 4NEHB 5CD9A 4EPYA 1YRBA 2UVPB 2FP3A 3HGMA 3CLHA 2CFCA 4WFKA 4A0HA 3DEAA 4GSKA 1N2CE 1GL9B 1HBJA 1M7GA 4NE2A 4JAVC 1J8VA 5C53B 4NI5A 3C48A 3DT9A 4O4LF 4UVGA 1SWVA 2AWOA 3T5BA 3QFCA 3SDSA 4YK7A 1NUQA 2IEAA 3OICA 2VP2A 3DL2A 1AUOA 1V47A 1WPQA 1XR3A 2Q6KA 1XCBA 1R5JA 1K08A 4ISCA 1RVV1 2FRVA 3UWOA 1JHXA 3ROGA 1KRWA 1Y5NA 2DP4E 1E8DA 2V0GA 2GJ8A 4GQIA 1SN7A 4UOQA 4BV2A 4HLUA 3ESAA 3WV5A 3W9BA 2ZRCA 3A3NA 4X6YA 1LNZA 2YZKA 3ZWMA 4B40A 2CF5A 1KO4A 4S1PA 3OTQA 4DRZA 5JAUA 3PC7A 4LZLA 1F8YA 3ZYCA 5A3JA 4IV5A 3EZ2A 5EMJA 4CQMB 1UBFA 1YUBA 4E7PA 1FFBA 1X77A 5HGXA 4BNVA 5DNYB 1QKIA 4IIJA 1OYVA 4DVGA 1C3VA 5HFJA 3EYWA 1BJKA 3FX2A 2NPIA 1LNQA 1JG4A 1ZPDA 2VF7A 4QDOA