3WIPA

Crystal structure of acetylcholine bound to ls-achbp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
202
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Molecular recognition of the neurotransmitter acetylcholine by an acetylcholine binding protein reveals determinants of binding to nicotinic acetylcholine receptors
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 47
structure length 202
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wipA00
4QH5A 3WTMA 2XQ9A 2XQ4A 3PEOA 2XYTA 4HFIA 2YMEA 2W8FA 2Y58A 2XNUA 4ILBA 2UZ6A 2BJ0A 4TWHA 3EHZA 3RI5A 4QACA 3UU5A 2Y54A 5KZUA 5AFNA 5J5FA 5J5IA 5AFMA 2ZJVA 3SQ9A 4NZBA 4TWDA 3WTKA 4IL4A 5L4HA 3ZDGA 2BYRA 1UW6A 4UM3A 4HQPA 2BG9C 2BG9A 4X5TA 4UY2A 5AFJA 2WZYA 2XYSA 3WTOA 4IREA 4UXUA 3UU6A 2WNJA 4BQTA 4LMLA 4HFCA 5J5GA 5AFLA 4TNVA 2Y56A 3EI0A 2XQ8A 5TVCA 5LXBA 4Z91A 2XQAA 2BYQA 3WTLA 2Y7YA 5HEOA 5HEUA 2W8GA 3IGQA 1UV6A 4HFBA 5HCMA 2YN6A 2BR7A 3U8KA 4LMKA 5KE4A 4WV9A 5HEGA 3TLTA 3LSVA 3JADA 2X00A 2XQ6A 3ZKRA 4UM3P 4AFTA 5HCJA 4ALXA 4ZRUA 5CO5A 4XHEA 3SIOA 4UM1A 2PGZA 2BYSA 2XZ6A 3JAEA 3TLSA 5CFBA 3GUAA 4IL9A 3ZDHA 2BYNA 3PMZA 4TWFA 3UUBA 5AFHA 3SQ6A 2YOEA 5SYOA 5J5HA 3WTNA 4ZK1A 5BRXA 4D01A 4DBMA 4F8HA 4AFGA 2YKSA 3U8NA 4ILCA 5IUXA 4LMJA 2BG9E 4TNWA 4ZJSA 3WTIA 3UU8A 4BFQA 5AFMB 2XZ5A 4ZZBA 4QAAA 4QH4A 5AFKA 3WTHA 5J0ZA 3U8LA 3U8MA 4NPPA 2YMDA 3C79A 2XNTA 5JMEA 4XK9A 3SH1A 2X00D 3C84A 2BYPA 3WTJA 2PH9A 2BG9B 4ZZCA 3JAFA 4ZR6A 4HFHA 4ILAA 4FRRA 2XNVA 2C9TA 2Y57A 3P50A 3TLUA 4HFEA 5AINA 4QH1A 5HEHA 3UQ7A 3TLVA 4A98A 2XQ3A 5BP0A 4AFHA 2VL0A 2BR8A 5FJVA 2ZJUA 4Z90A 3RQWA 2WNLA 2XQ7A 5BW2A 3RIAA 4A97A 4COFA 1UX2A 4ZK4A 3UQ4A 1I9BA 4UM3S 2QC1B 4PIRA 2WNCA 3U8JA 3UU4A 3RQUA 5HEJA 3RHWA 3WIPA 3RIFA 5L47A 3EAMA 3TLWA 4QABA 2WN9A 4B5DA 5L4EA 4HFDA 3UU3A 4EZ1A 5LG3A 2XQ5A 4ZJTA 3P4WA 3T4MA
chains in the Genus database with same CATH superfamily
4QH5A 3WTMA 2XQ9A 2XQ4A 3PEOA 2XYTA 4HFIA 2YMEA 2W8FA 2Y58A 2XNUA 4ILBA 2UZ6A 2BJ0A 4TWHA 3EHZA 3RI5A 4QACA 3UU5A 2Y54A 5KZUA 5AFNA 5J5FA 5J5IA 5AFMA 2ZJVA 3SQ9A 4NZBA 4TWDA 3WTKA 4IL4A 5L4HA 3ZDGA 2BYRA 1UW6A 4UM3A 4HQPA 2BG9C 2BG9A 4X5TA 4UY2A 5AFJA 2WZYA 2XYSA 3WTOA 4IREA 4UXUA 3UU6A 2WNJA 4BQTA 4LMLA 4HFCA 5J5GA 5AFLA 4TNVA 2Y56A 3EI0A 2XQ8A 5TVCA 5LXBA 4Z91A 2XQAA 2BYQA 3WTLA 2Y7YA 5HEOA 5HEUA 2W8GA 3IGQA 1UV6A 4HFBA 5HCMA 2YN6A 2BR7A 3U8KA 4LMKA 5KE4A 4WV9A 5HEGA 3TLTA 3LSVA 3JADA 2X00A 2XQ6A 3ZKRA 4UM3P 4AFTA 5HCJA 4ALXA 4ZRUA 5CO5A 4XHEA 3SIOA 4UM1A 2PGZA 2BYSA 2XZ6A 3JAEA 3TLSA 5CFBA 3GUAA 4IL9A 3ZDHA 2BYNA 3PMZA 4TWFA 3UUBA 5AFHA 3SQ6A 2YOEA 5SYOA 5J5HA 3WTNA 4ZK1A 5BRXA 4D01A 4DBMA 4F8HA 4AFGA 2YKSA 3U8NA 4ILCA 5IUXA 4LMJA 2BG9E 4TNWA 4ZJSA 3WTIA 3UU8A 4BFQA 5AFMB 2XZ5A 4ZZBA 4QAAA 4QH4A 5AFKA 3WTHA 5J0ZA 3U8LA 3U8MA 4NPPA 2YMDA 3C79A 2XNTA 5JMEA 4XK9A 3SH1A 2X00D 3C84A 2BYPA 3WTJA 2PH9A 2BG9B 4ZZCA 3JAFA 4ZR6A 4HFHA 4ILAA 4FRRA 2XNVA 2C9TA 2Y57A 3P50A 3TLUA 4HFEA 5AINA 4QH1A 5HEHA 3UQ7A 3TLVA 4A98A 2XQ3A 5BP0A 4AFHA 2VL0A 2BR8A 5FJVA 2ZJUA 4Z90A 3RQWA 2WNLA 2XQ7A 5BW2A 3RIAA 4A97A 4COFA 1UX2A 4ZK4A 3UQ4A 1I9BA 4UM3S 2QC1B 4PIRA 2WNCA 3U8JA 3UU4A 3RQUA 5HEJA 3RHWA 3WIPA 3RIFA 5L47A 3EAMA 3TLWA 4QABA 2WN9A 4B5DA 5L4EA 4HFDA 3UU3A 4EZ1A 5LG3A 2XQ5A 4ZJTA 3P4WA 3T4MA
chains in the Genus database with same CATH topology
4QH5A 3WTMA 2XQ9A 2XQ4A 3PEOA 2XYTA 4HFIA 2YMEA 2W8FA 2Y58A 2XNUA 4ILBA 2UZ6A 2BJ0A 4TWHA 3EHZA 3RI5A 4QACA 3UU5A 2Y54A 5KZUA 5AFNA 5J5FA 5J5IA 5AFMA 2ZJVA 3SQ9A 4NZBA 4TWDA 3WTKA 4IL4A 5L4HA 3ZDGA 2BYRA 1UW6A 4UM3A 4HQPA 2BG9C 2BG9A 4X5TA 4UY2A 5AFJA 2WZYA 2XYSA 3WTOA 4IREA 4UXUA 3UU6A 2WNJA 4BQTA 4LMLA 4HFCA 5J5GA 5AFLA 4TNVA 2Y56A 3EI0A 2XQ8A 5TVCA 5LXBA 4Z91A 2XQAA 2BYQA 3WTLA 2Y7YA 5HEOA 5HEUA 2W8GA 3IGQA 1UV6A 4HFBA 5HCMA 2YN6A 2BR7A 3U8KA 4LMKA 5KE4A 4WV9A 5HEGA 3TLTA 3LSVA 3JADA 2X00A 2XQ6A 3ZKRA 4UM3P 4AFTA 5HCJA 4ALXA 4ZRUA 5CO5A 4XHEA 3SIOA 4UM1A 2PGZA 2BYSA 2XZ6A 3JAEA 3TLSA 5CFBA 3GUAA 4IL9A 3ZDHA 2BYNA 3PMZA 4TWFA 3UUBA 5AFHA 3SQ6A 2YOEA 5SYOA 5J5HA 3WTNA 4ZK1A 5BRXA 4D01A 4DBMA 4F8HA 4AFGA 2YKSA 3U8NA 4ILCA 5IUXA 4LMJA 2BG9E 4TNWA 4ZJSA 3WTIA 3UU8A 4BFQA 5AFMB 2XZ5A 4ZZBA 4QAAA 4QH4A 5AFKA 3WTHA 5J0ZA 3U8LA 3U8MA 4NPPA 2YMDA 3C79A 2XNTA 5JMEA 4XK9A 3SH1A 2X00D 3C84A 2BYPA 3WTJA 2PH9A 2BG9B 4ZZCA 3JAFA 4ZR6A 4HFHA 4ILAA 4FRRA 2XNVA 2C9TA 2Y57A 3P50A 3TLUA 4HFEA 5AINA 4QH1A 5HEHA 3UQ7A 3TLVA 4A98A 2XQ3A 5BP0A 4AFHA 2VL0A 2BR8A 5FJVA 2ZJUA 4Z90A 3RQWA 2WNLA 2XQ7A 5BW2A 3RIAA 4A97A 4COFA 1UX2A 4ZK4A 3UQ4A 1I9BA 4UM3S 2QC1B 4PIRA 2WNCA 3U8JA 3UU4A 3RQUA 5HEJA 3RHWA 3WIPA 3RIFA 5L47A 3EAMA 3TLWA 4QABA 2WN9A 4B5DA 5L4EA 4HFDA 3UU3A 4EZ1A 5LG3A 2XQ5A 4ZJTA 3P4WA 3T4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH5 A;  3WTM A;  2XQ9 A;  2XQ4 A;  3PEO A;  2XYT A;  4HFI A;  2YME A;  2W8F A;  2Y58 A;  2XNU A;  4ILB A;  2UZ6 A;  2BJ0 A;  4TWH A;  3EHZ A;  3RI5 A;  4QAC A;  3UU5 A;  2Y54 A;  5KZU A;  5AFN A;  5J5F A;  5J5I A;  5AFM A;  2ZJV A;  3SQ9 A;  4NZB A;  4TWD A;  3WTK A;  4IL4 A;  5L4H A;  3ZDG A;  2BYR A;  1UW6 A;  4UM3 A;  4HQP A;  2BG9 C;  2BG9 A;  4X5T A;  4UY2 A;  5AFJ A;  2WZY A;  2XYS A;  3WTO A;  4IRE A;  4UXU A;  3UU6 A;  2WNJ A;  4BQT A;  4LML A;  4HFC A;  5J5G A;  5AFL A;  4TNV A;  2Y56 A;  3EI0 A;  2XQ8 A;  5TVC A;  5LXB A;  4Z91 A;  2XQA A;  2BYQ A;  3WTL A;  2Y7Y A;  5HEO A;  5HEU A;  2W8G A;  3IGQ A;  1UV6 A;  4HFB A;  5HCM A;  2YN6 A;  2BR7 A;  3U8K A;  4LMK A;  5KE4 A;  4WV9 A;  5HEG A;  3TLT A;  3LSV A;  3JAD A;  2X00 A;  2XQ6 A;  3ZKR A;  4UM3 P;  4AFT A;  5HCJ A;  4ALX A;  4ZRU A;  5CO5 A;  4XHE A;  3SIO A;  4UM1 A;  2PGZ A;  2BYS A;  2XZ6 A;  3JAE A;  3TLS A;  5CFB A;  3GUA A;  4IL9 A;  3ZDH A;  2BYN A;  3PMZ A;  4TWF A;  3UUB A;  5AFH A;  3SQ6 A;  2YOE A;  5SYO A;  5J5H A;  3WTN A;  4ZK1 A;  5BRX A;  4D01 A;  4DBM A;  4F8H A;  4AFG A;  2YKS A;  3U8N A;  4ILC A;  5IUX A;  4LMJ A;  2BG9 E;  4TNW A;  4ZJS A;  3WTI A;  3UU8 A;  4BFQ A;  5AFM B;  2XZ5 A;  4ZZB A;  4QAA A;  4QH4 A;  5AFK A;  3WTH A;  5J0Z A;  3U8L A;  3U8M A;  4NPP A;  2YMD A;  3C79 A;  2XNT A;  5JME A;  4XK9 A;  3SH1 A;  2X00 D;  3C84 A;  2BYP A;  3WTJ A;  2PH9 A;  2BG9 B;  4ZZC A;  3JAF A;  4ZR6 A;  4HFH A;  4ILA A;  4FRR A;  2XNV A;  2C9T A;  2Y57 A;  3P50 A;  3TLU A;  4HFE A;  5AIN A;  4QH1 A;  5HEH A;  3UQ7 A;  3TLV A;  4A98 A;  2XQ3 A;  5BP0 A;  4AFH A;  2VL0 A;  2BR8 A;  5FJV A;  2ZJU A;  4Z90 A;  3RQW A;  2WNL A;  2XQ7 A;  5BW2 A;  3RIA A;  4A97 A;  4COF A;  1UX2 A;  4ZK4 A;  3UQ4 A;  1I9B A;  4UM3 S;  2QC1 B;  4PIR A;  2WNC A;  3U8J A;  3UU4 A;  3RQU A;  5HEJ A;  3RHW A;  3WIP A;  3RIF A;  5L47 A;  3EAM A;  3TLW A;  4QAB A;  2WN9 A;  4B5D A;  5L4E A;  4HFD A;  3UU3 A;  4EZ1 A;  5LG3 A;  2XQ5 A;  4ZJT A;  3P4W A;  3T4M A; 
#chains in the Genus database with same CATH topology
 4QH5 A;  3WTM A;  2XQ9 A;  2XQ4 A;  3PEO A;  2XYT A;  4HFI A;  2YME A;  2W8F A;  2Y58 A;  2XNU A;  4ILB A;  2UZ6 A;  2BJ0 A;  4TWH A;  3EHZ A;  3RI5 A;  4QAC A;  3UU5 A;  2Y54 A;  5KZU A;  5AFN A;  5J5F A;  5J5I A;  5AFM A;  2ZJV A;  3SQ9 A;  4NZB A;  4TWD A;  3WTK A;  4IL4 A;  5L4H A;  3ZDG A;  2BYR A;  1UW6 A;  4UM3 A;  4HQP A;  2BG9 C;  2BG9 A;  4X5T A;  4UY2 A;  5AFJ A;  2WZY A;  2XYS A;  3WTO A;  4IRE A;  4UXU A;  3UU6 A;  2WNJ A;  4BQT A;  4LML A;  4HFC A;  5J5G A;  5AFL A;  4TNV A;  2Y56 A;  3EI0 A;  2XQ8 A;  5TVC A;  5LXB A;  4Z91 A;  2XQA A;  2BYQ A;  3WTL A;  2Y7Y A;  5HEO A;  5HEU A;  2W8G A;  3IGQ A;  1UV6 A;  4HFB A;  5HCM A;  2YN6 A;  2BR7 A;  3U8K A;  4LMK A;  5KE4 A;  4WV9 A;  5HEG A;  3TLT A;  3LSV A;  3JAD A;  2X00 A;  2XQ6 A;  3ZKR A;  4UM3 P;  4AFT A;  5HCJ A;  4ALX A;  4ZRU A;  5CO5 A;  4XHE A;  3SIO A;  4UM1 A;  2PGZ A;  2BYS A;  2XZ6 A;  3JAE A;  3TLS A;  5CFB A;  3GUA A;  4IL9 A;  3ZDH A;  2BYN A;  3PMZ A;  4TWF A;  3UUB A;  5AFH A;  3SQ6 A;  2YOE A;  5SYO A;  5J5H A;  3WTN A;  4ZK1 A;  5BRX A;  4D01 A;  4DBM A;  4F8H A;  4AFG A;  2YKS A;  3U8N A;  4ILC A;  5IUX A;  4LMJ A;  2BG9 E;  4TNW A;  4ZJS A;  3WTI A;  3UU8 A;  4BFQ A;  5AFM B;  2XZ5 A;  4ZZB A;  4QAA A;  4QH4 A;  5AFK A;  3WTH A;  5J0Z A;  3U8L A;  3U8M A;  4NPP A;  2YMD A;  3C79 A;  2XNT A;  5JME A;  4XK9 A;  3SH1 A;  2X00 D;  3C84 A;  2BYP A;  3WTJ A;  2PH9 A;  2BG9 B;  4ZZC A;  3JAF A;  4ZR6 A;  4HFH A;  4ILA A;  4FRR A;  2XNV A;  2C9T A;  2Y57 A;  3P50 A;  3TLU A;  4HFE A;  5AIN A;  4QH1 A;  5HEH A;  3UQ7 A;  3TLV A;  4A98 A;  2XQ3 A;  5BP0 A;  4AFH A;  2VL0 A;  2BR8 A;  5FJV A;  2ZJU A;  4Z90 A;  3RQW A;  2WNL A;  2XQ7 A;  5BW2 A;  3RIA A;  4A97 A;  4COF A;  1UX2 A;  4ZK4 A;  3UQ4 A;  1I9B A;  4UM3 S;  2QC1 B;  4PIR A;  2WNC A;  3U8J A;  3UU4 A;  3RQU A;  5HEJ A;  3RHW A;  3WIP A;  3RIF A;  5L47 A;  3EAM A;  3TLW A;  4QAB A;  2WN9 A;  4B5D A;  5L4E A;  4HFD A;  3UU3 A;  4EZ1 A;  5LG3 A;  2XQ5 A;  4ZJT A;  3P4W A;  3T4M A; 
#chains in the Genus database with same CATH homology
 4QH5 A;  3WTM A;  2XQ9 A;  2XQ4 A;  3PEO A;  2XYT A;  4HFI A;  2YME A;  2W8F A;  2Y58 A;  2XNU A;  4ILB A;  2UZ6 A;  2BJ0 A;  4TWH A;  3EHZ A;  3RI5 A;  4QAC A;  3UU5 A;  2Y54 A;  5KZU A;  5AFN A;  5J5F A;  5J5I A;  5AFM A;  2ZJV A;  3SQ9 A;  4NZB A;  4TWD A;  3WTK A;  4IL4 A;  5L4H A;  3ZDG A;  2BYR A;  1UW6 A;  4UM3 A;  4HQP A;  2BG9 C;  2BG9 A;  4X5T A;  4UY2 A;  5AFJ A;  2WZY A;  2XYS A;  3WTO A;  4IRE A;  4UXU A;  3UU6 A;  2WNJ A;  4BQT A;  4LML A;  4HFC A;  5J5G A;  5AFL A;  4TNV A;  2Y56 A;  3EI0 A;  2XQ8 A;  5TVC A;  5LXB A;  4Z91 A;  2XQA A;  2BYQ A;  3WTL A;  2Y7Y A;  5HEO A;  5HEU A;  2W8G A;  3IGQ A;  1UV6 A;  4HFB A;  5HCM A;  2YN6 A;  2BR7 A;  3U8K A;  4LMK A;  5KE4 A;  4WV9 A;  5HEG A;  3TLT A;  3LSV A;  3JAD A;  2X00 A;  2XQ6 A;  3ZKR A;  4UM3 P;  4AFT A;  5HCJ A;  4ALX A;  4ZRU A;  5CO5 A;  4XHE A;  3SIO A;  4UM1 A;  2PGZ A;  2BYS A;  2XZ6 A;  3JAE A;  3TLS A;  5CFB A;  3GUA A;  4IL9 A;  3ZDH A;  2BYN A;  3PMZ A;  4TWF A;  3UUB A;  5AFH A;  3SQ6 A;  2YOE A;  5SYO A;  5J5H A;  3WTN A;  4ZK1 A;  5BRX A;  4D01 A;  4DBM A;  4F8H A;  4AFG A;  2YKS A;  3U8N A;  4ILC A;  5IUX A;  4LMJ A;  2BG9 E;  4TNW A;  4ZJS A;  3WTI A;  3UU8 A;  4BFQ A;  5AFM B;  2XZ5 A;  4ZZB A;  4QAA A;  4QH4 A;  5AFK A;  3WTH A;  5J0Z A;  3U8L A;  3U8M A;  4NPP A;  2YMD A;  3C79 A;  2XNT A;  5JME A;  4XK9 A;  3SH1 A;  2X00 D;  3C84 A;  2BYP A;  3WTJ A;  2PH9 A;  2BG9 B;  4ZZC A;  3JAF A;  4ZR6 A;  4HFH A;  4ILA A;  4FRR A;  2XNV A;  2C9T A;  2Y57 A;  3P50 A;  3TLU A;  4HFE A;  5AIN A;  4QH1 A;  5HEH A;  3UQ7 A;  3TLV A;  4A98 A;  2XQ3 A;  5BP0 A;  4AFH A;  2VL0 A;  2BR8 A;  5FJV A;  2ZJU A;  4Z90 A;  3RQW A;  2WNL A;  2XQ7 A;  5BW2 A;  3RIA A;  4A97 A;  4COF A;  1UX2 A;  4ZK4 A;  3UQ4 A;  1I9B A;  4UM3 S;  2QC1 B;  4PIR A;  2WNC A;  3U8J A;  3UU4 A;  3RQU A;  5HEJ A;  3RHW A;  3WIP A;  3RIF A;  5L47 A;  3EAM A;  3TLW A;  4QAB A;  2WN9 A;  4B5D A;  5L4E A;  4HFD A;  3UU3 A;  4EZ1 A;  5LG3 A;  2XQ5 A;  4ZJT A;  3P4W A;  3T4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...