3WJ2A

Crystal structure of estfa (fe-lacking apo form)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
303
structure length
299
Chain Sequence
MVDPDFNSLIELSKSAGDMTKIEPAMLRNFLDESSLSSRGAPVEIKEIKDYKIKLDGRTLNARMYDDNNAKSAILYYHGGGFLFGNIETYDNYCRFLAKESGVKIISIEYRLAPEHKFPDAFNDAYDSFHYIAKKKKDFGIEGRIGVAGDSAGANLAAALCLKCRDGKTEMPAVQVLFYPSLAPDNFSRSFIEYSDNYVLTGKMIRYFGNMYSKNINPYFSPLVADDFSNLPPAIMVTNEYDPLRDPEETYVKKLREAGVRAVGIRGIGMIHGSATDFEVSDGARNIVKMVARIIPDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Low-pH Adaptation of a Unique Carboxylesterase from Ferroplasma: Altering the pH Optima of Two Carboxylesterases
doi rcsb
source organism Ferroplasma acidiphilum
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 113
structure length 299
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wj2A00
1QIMA 3RLIA 2BUBA 1QLWA 1L7AA 1BCRA 5A7HA 1XZGA 2PBLA 4G9GA 5E2IA 4WFJA 5CXXA 5SYMA 3D4LA 2D0DA 1G66A 3PI6A 5EI5A 2PSJA 1J2EA 1U65A 1SOMA 1XZJA 3YASA 2XLBA 4MYSA 2XQGA 3VJKA 3W9BA 1W76A 1JJIA 4MWSA 3G7NA 5ALWA 4H7KA 4QDXA 1E8DA 2AJCA 3F96A 3AILA 5EHNA 1LPAB 4B9EA 4Y2TA 1XQWA 5AM3A 3KWJA 2C5GA 5C8VA 3HXKA 4FDMA 4MJ3A 3DS8A 4LYDA 1ODSA 4W1RA 3CN9A 1MX9A 4G1FA 5DTJA 5ALUA 1XRMA 4BYMA 4FBMA 4WCVA 3I2KA 1BEEA 3IDAA 1JKMA 2QUAA 1YA8A 4N8EA 5ALQA 2O7RA 3BDIA 1LGYA 3WK6A 3C6YA 3QMWA 2G5TA 5AK5A 3A2LA 3FNBA 3C6BA 3WK8A 5DYWA 1SFRA 5A71A 1CUJA 3SWWA 1CR6A 4X90A 4EY4A 1ZJ5A 3GUUA 5AIAA 4UBLA 5JIBA 1X2BA 2OQIA 2CB9A 3QMMA 3JWEA 3VJLA 4P9NA 3FVRA 2XB6A 4ZWNA 3EBLA 4BZZA 3DEAA 1CUXA 2JGKA 4GEGA 2PSEA 4AN0A 4BE9A 4Z49A 3K6KA 2HU5A 2QMQA 2C5FA 2V9ZA 1JMYA 3R41A 1N8SA 5FPQA 5ALEA 4B80A 2HA0A 3HZOA 4BC0A 3PFCA 4H7HA 2XQKA 2XQIA 1XRPA 2WFLA 1XQXA 5EIHA 2W6CX 4F0JA 2XUIA 3D3NA 5C8XA 4Y2RA 1XRNA 5HK8A 1ZD2P 2YYSA 2QJWA 1ZD4A 2BGNA 1GKKA 3F8SA 2DSNA 5AIBA 3DJYA 2PM8A 1XLWA 4GW3A 3TEJA 5KWJA 4ZGBA 3KWFA 2O2IA 4QDOA 5AKHA 3GELA 4Y2XA 2JIDA 4MEAA 4TPKA 3WL7A 6YASA 3R3XA 4CIAA 3PF8A 5DNUA 1C7JA 5A2GA 5AI5A 1AZWA 2I03A 5HCUA 2PSHA 3WKBA 4EZIA 3VDXA 3ZI7A 4BCDA 1THGA 1W52X 4C6HA 3WWCA 1MO2A 1NX9A 4WDRA 2QM0A 1WHSA 4X91A 4INZA 3WYDA 1PJAA 1ZOIA 1BE0A 3K9BA 2G4LA 5E4TA 4UHEA 4N8SA 3STUA 5ALPA 1CUUA 2WM2A 4AB1A 4V2IA 5BWCA 3GZJA 5K3DA 5LLSA 2V98A 1ACLA 2OAEA 5AKLA 4B7ZA 5K3EA 2XQFA 4UBNA 1EVQA 4C4XA 1WM1A 1XZKA 1Y37A 3WK7A 1BS9A 3MUOA 1R9MA 1HL7A 4BCCA 3WZLA 1N5RA 3C8DA 2I3ZA 2WSLA 4LIPD 3H0CA 1B6GA 4DSAA 4U2CA 2VA9A 1R50A 1HKHA 3MVEA 1AUOA 1IUNA 3I1YA 4ETWA 4XVCA 1MNQA 3WZMA 4H7DA 4PSDA 1D07A 2ZSIA 5IVIA 2WFZA 3N0TA 5AI8A 3I2JA 2WIKA 3ED1A 1J07A 5ALYA 4IH1A 4BAZA 3HJUA 1TCAA 2OQVA 2CZQA 2C0QA 1R1DA 3NOXA 3FSGD 1DWOA 5CH3A 3AFIA 4EBBA 3FYUB 1P0IA 1E8NA 4AN1A 4ZI5A 1ZIXA 4L72A 1C7IA 1ORWA 4UBOA 3V9AA 1EI9A 3RK4A 5LZ7A 5CXUA 4HVTA 5FUMA 3D2BA 4KE6A 4N8DA 1YAJA 4EUSA 1UK6A 1WOMA 5A6VA 3FCYA 2OCGA 4BATA 1QIKA 2JGJA 3BF8A 1CFJA 3G9UA 5FRDA 2XQJA 2WTMA 1R3DA 5AKGA 1VXOA 4TVKA 1W4LA 5C8ZA 2OGTA 2IX9A 3AIOA 3R3UA 3ICWA 3E3AA 3AZQA 3C43A 5FLKA 1CIJA 4E15A 1XKLA 2ZYHA 2GZSA 3B12A 4IH9A 4DNPA 2GBCA 2VSQA 4B84A 5HQ3A 2B4KA 4J03A 5BV7A 2OXEA 3CCBA 4DGQA 4DNFA 4KACA 1E5TA 2HL6A 2H7CA 3AUKA 4XWGA 3PICA 4BDTA 1ZD5A 4C4ZA 1UKCA 1XRQA 1CUAA 2CJPA 3W06A 3EQ9A 3DYIA 5EIAA 5IKXA 3OTQA 2GBIA 4DSZA 5EHZA 1CUIA 2ECFA 2VF2A 2FX5A 2EEPA 1J06A 4UBJA 1YR2A 1XZMA 5HZGA 1PV1A 4Q1VA 4G4IA 1JJFA 4E14A 2WUGA 5DLPA 3F98A 2OCIA 4M0EA 1GPNA 5AO9A 3WKDA 2XUKA 3IUNA 1XFDA 1YA4A 5CT4A 1AQLA 1EINA 1BN7A 3WWOA 4FOLA 5AM5A 3L1JA 1QTRA 5I7UA 3U0VA 4CIBA 2X8BA 4ZV7A 5FXMA 4X93A 1FFEA 4GBGA 4GWLA 1ZJ4A 3W05A 4CG3A 5JATA 1SCQA 2BGRA 1QIJA 2GYWA 2JGEA 3WI7A 4EHBA 1WCYA 2AXEA 4HTAA 1NU6A 3KXPA 3SC2A 1XRRA 5K3BA 4UHDA 1AMNA 2CEKA 2WFLB 4HRYA 5ALJA 2XMGA 5E4JA 1Q83A 4W1SA 4CCYB 2Y6VA 2R11A 1VOTA 2H7YA 2R8BA 4AZ3A 4Y2PA 1XZFA 4J0KA 1N1MA 1I6WA 4NZZA 4E11A 5LZ9A 2UZ0A 3MUNA 4N5HX 3DCNA 5BOVA 1UK7A 5CMLA 1VZ3A 4FBLA 3H2IA 1U8EA 1JMKC 1UT6A 2BCEA 2WHQA 2VAVA 2ONCA 2XMQA 2WUFA 4OB6A 2ORYA 3M81A 4RGYA 3ESDA 1CUEA 1AC5A 5HK9A 2GBFA 2ZYRA 5EGNA 4QDTA 1EDDA 2QKYA 2DR0A 3BL8A 2LIPA 3EQ8A 2WUDA 1QOZA 2AJ8A 2BKLA 4G4GA 3BDVA 1R88A 4QEKA 2C58A 2DCMA 4IHAA 1VJ5A 1TQHA 4HXEB 3STVA 4LHEA 2VATA 1HDEA 1ZIYA 1XQYA 4KRXA 2YASA 4Y2SA 2HDWA 1TAHA 4CG1A 3H19A 1VE6A 4AXBA 3I28A 3C6XA 2WJ6A 5AH0A 1IUOA 3LP5A 1H2YA 3I2HA 4F21A 3C8HA 3OC0A 1G5FA 2JEZA 4AX4A 4EY7A 4FFVA 2QJRA 1MAHA 5JAUA 4HAIA 5EHXA 2XI4A 2Y6UA 4UBKA 3QM1A 1ZI8A 1BCSA 1BU8A 1DQZA 3G9ZA 2AJLI 4ARAA 4B6GA 2GZRA 1JU3A 2YXPX 4EY6A 1BRTA 2WG1A 5ALFA 1YASA 1UWCA 4M0MA 3BIWA 1XLVA 1C4XA 4NVRA 4W1QA 4U2DA 2HIHA 5AK4A 4G4JA 1IZ8A 3QYJA 1CQZA 4BDSA 1MN6A 4J0HA 4OYLA 4H7EA 2OGSA 2B20A 4UBIA 3C5VA 2QXUA 4H7JA 3UUEA 5FV4A 3GA7A 4DMFA 5ALTA 5JADA 1ZI6A 4UFNA 1O6FA 2CUTA 1UZAA 2HADA 4X95A 5DTIA 5SYNA 3HC7A 4B0PA 3PFBA 2WIDA 3HABA 3C5WP 4CFSA 2HFJA 2VTVA 1ZGBA 4K5QA 2WLSA 3L1IA 3E4DA 2CMFA 1N5MA 4GHWA 4NS4A 4G5XA 5CT5A 2Y2VA 1H2ZA 4FLMA 4HXFB 2B61A 2EDAA 4FTWA 5FP0A 2HFKA 5AKYA 3LIPA 3WK4A 2XLCA 5FPPA 3HI4A 1P0QA 2O2GA 1LPMA 3KSRA 1FFCA 3LIIA 4FMPA 2I3DA 4FKBA 1VA5A 2WTNA 3FAKA 2VT7A 3OG9A 4KRYA 3QH4A 3AZPA 4EB0A 3D59A 1RYYA 4X6UA 1MJ5A 1QTIA 1XZEA 4UHFA 4IH4A 3IUMA 1DTEA 3H2KA 4KAAA 1LPPA 1X70A 4AZ0A 5ALSA 3IUQA 1CUDA 3OURA 1K6EA 3RM3A 2PPLA 5ALOA 3STWA 5JAOA 4X97A 1QIHA 1VZ2A 4X71A 5HQ3B 4Y2UA 5A62A 5EIEA 1DWQA 1EHYA 4Q3LA 3DL4A 2WIJA 3C45A 5AI9A 5AM2A 4J0CA 4WJLA 5AM0A 3STYA 3MGAA 5HF6A 4KYVA 1X2EA 4BRZA 3H2HA 3U1TA 3ESBA 3QBJA 2BAGA 3C70A 4HXGA 3QITA 5DWDA 3DD5A 2XMCA 4WFIA 4X85A 3NWOA 1CPYA 4G9EA 5YASA 1WPRA 3I2GA 1LBSA 5ALDA 4BTVA 2WHRA 5HF9A 3G02A 3D2CA 3FYTA 4HZGA 1QJ4A 4Y9SA 2X5XA 4B85A 1YAHA 1A8UA 3AINA 1VXRA 3ESAA 2PX6A 4BCBA 4Q34A 5T4EA 1LZKA 1F0PA 2B9VA 3ZPXA 2WG0A 1XKTA 1LBTA 1UFOA 4A16A 1TIBA 5JD5A 4K6KA 4H18A 1K5PA 2QOEA 2PUHA 2H1IA 3M83A 2HU7A 3UMJA 4GECA 1DT5A 4AO7A 3DOHA 5ALVA 4K2AA 4QNNA 4X92A 4FLEA 2HA2A 5CH5A 5AOAA 5I8PA 2O7VA 1LPOA 5AM4A 3G8YA 3I6ZA 4CCWA 1CUYA 1QE3A 1CUVA 2ZJ7A 2PL5A 4LXHA 1XZAA 5H3HA 2WIGA 5ALGA 3DL7A 3PUHA 3VXKA 3UUFA 3WA7A 5DJ5A 5T4FA 5FDFA 5K3AA 1W1IA 1UKAA 3G9XA 5BWBA 3WWEA 3EQ7A 2D5LA 1DWPA 5AHXA 3VVMA 1GXSA 5I9IA 2PU7A 3JYHA 3OM8A 3K2IA 4Y2QA 3FLAA 4K6HA 5AKZA 2WKWA 3FVTA 4KE8A 4UPDA 3WL5A 4DMKA 1QZ3A 4QDZA 3TGLA 1S8OA 4KE7A 1GKLA 3R3YA 3WMRA 1MT3A 1QIGA 4P93A 7YASA 2Z3ZA 3DOIA 1R4ZA 5ESRA 5K3CA 1W6RA 4WDQA 5KBYA 1IVYA 2K2QB 4L0CA 5EHQA 3VJMA 4C87A 1VE7A 4XJVA 2OPHA 3H18A 4ARBA 4H0CA 4KR0A 1Y7HA 1TCBA 3G0DA 1CLEA 3DDUA 1PFQA 2GBGA 4DMCA 4IO0A 4BVLA 5KWIA 5IH7A 1MX5A 1T2NA 4DM7A 1XQVA 3WA6A 3PF9A 5JD4A 1CUWA 1Q84A 3IVMA 1FFAA 5ALHA 5IVKA 2RGUA 1IUPA 2XMDA 2GYUA 4KE9A 1USWA 3R3WA 3A6ZA 1EXWA 2IITA 5JANA 4AO8A 3IURA 4JUIA 1U2EA 3W04A 1SCIA 3IIIA 5JARA 1XRLA 4JYMA 4C01A 3BWXA 2XMBA 2EDCA 1E89A 4FNMA 1XZBA 1JFRA 5LZ8A 1H22A 3FSGA 2XUQA 3V1MA 1RWQA 4H35A 2WU4A 5DNVA 3R0VA 3S8YA 4DNQA 4B9AA 3G9TA 4QLOA 4LKOA 1EK1A 1MU0A 1WB4A 3V1NA 1QIEA 2WG2A 4B83A 5AI6A 1DX6A 2W22A 3STTA 2DFPA 1KU6A 1QIFA 2XMZA 2BUAA 4X7BA 1A88A 1K4YA 2I78A 2CKMA 3Q0TA 4F5ZA 2WHPB 4W9RA 4BTLA 1M33A 1CUZA 3AIMA 1H23A 5DYYA 1JT2A 4ZRDA 3FBWA 4HRXA 2Z8XA 4ZREA 5HFNA 1CRLA 4PW0A 4BE4A 4YPVA 4H7IA 4RE5A 4B82A 1YB6A 4I19A 4AO6A 1VA4A 5C81A 1ZD3A 5CTAA 2C0PA 3O4GA 2DHCA 1R9NA 4OUKX 1THTA 2JBWA 2VAXA 4ZXFA 1ACJA 2VT6A 2XE4A 2J4CA 4JEIA 4Y2VA 3WK5A 2RONA 2XUAA 4QA9A 5AM1A 1CQWA 3DKKA 3WKCA 4BRSA 4BZWA 2Y1KA 3M3DA 3IB3A 4FHZA 5AK3A 2RHWA 3W2TA 2HA3A 2Z5GA 3QZUA 3SX4A 2XUOA 4GXNA 1OXMA 3DLTA 4F60A 2H7XA 5AKEA 3A70A 3LLCA 1CUCA 2QZPA 3M82A 4BBZA 4GLBA 2J3DA 3TRDA 3V1LA 3O9MA 2XDWA 2ACEA 3F67A 2VJAA 4G8CA 3EF3A 5KREA 1A7UA 2RIPA 3WLAA 3FYUC 3AIKA 3H17A 1QO7A 2WFMA 2C7BA 5EFZA 4OCZA 4DMHA 2VJDA 3WKEA 1EH5A 3N2ZB 3H04A 4Q3KA 3HSSA 1ETHA 1KU0A 4PF1A 5LP1A 3I6YA 4GDMA 2XUHA 2BFNA 2JGLA 3T52A 2PVSA 1J1IA 2XUJA 4X00A 2IIVA 3H2JA 1MTZA 3BIXA 4UFOA 4OB7A 1XZCA 4U2BA 4A23A 4GI1A 3H1AA 5CURA 1K8QA 3LCRA 3GROA 1F0NA 3V48A 3G0CA 4G8DA 3E0XA 4WFKA 5A7FA 2G63A 4CI9A 4PV7A 1GT6A 5ALKA 1G4HA 1GQRA 2OLEA 2XUPA 5AJHA 5CH8A 2VJBA 3ZLVA 1SCKA 3ANSA 3FCXA 5E4YA 1L7QA 3VVLA 3D7RA 2CBGA 3WK9A 4OSEA 3W9UA 1YS1X 3O4IA 4Y2JA 1LNSA 1XZLA 5LYYA 4K6GA 5AOBA 3HYSA 2WHPA 3OPMA 1YS2X 2RI6A 2PUJA 3L1HA 1A8SA 3ZLTA 5ALMA 4TGLA 3EIOA 4UBMA 5K3FA 3VISA 1JJBA 4L9AA 1EX9A 2QRUA 5CT8A 2HM7A 4J0GA 3BXPA 4YX9A 5JASA 4PNZA 1WB6A 4Q82A 5K3FB 1GGVA 4BAGA 5FKJA 5AKKA 2ZJFA 4DTCA 4AMYA 1DU4A 4I4CA 1IZ7A 1EK2A 1MPXA 5D7BA 4ZV9A 1MNAA 4H7FA 4DIUA 2ZSHA 3R3ZA 1A8QA 1W75A 1WPXA 1UOPA 3H1BA 3RKSA 1XZDA 5DYTA 4BVKA 2DHEA 1HQDA 3D0KA 3H2GA 4BP8A 4S0XA 1JI3A 1H2XA 1QO9A 5ALRA 1ZGCA 3FLEA 2JGFA 3V1KA 2QR5A 5HFAA 2QVBA 3NGMA 3BF7A 3ANTA 3WWDA 4EY5A 1ODTC 4JNCA 3G0GA 1GPLA 4QLAA 4HS9A 5JZSA 2XMSA 5JZ9A 3WL6A 5DNWA 2HA7A 3DKRA 3BE8A 2OCKA 5ALNA 2ZVDA 1LPNA 1U4NA 5AP9A 4KEAA 3FWHA 4N5IX 3DNMA 3QMVA 4PSCA 4FFWA 5LZ5A 4Y7DA 1L7RA 5AK6A 3IBTA 1Y7IA 4MXDA 4DNOA 3I1IA 3HRHA 4PSUA 1B41A 3WJ2A 4QZVA 5AI4A 2JF0A 4Y2YA 5ISMA 5HF8A 2XT0A 5A7GA 2O2HA 1VKHA 4UHCA 5LKRA 3I2FA 4AMZA 1CVLA 5D3ZA 1JU4A 5J3JA 3T4UA 2BUCA 1FFBA 2NW6A 1NU8A 4MYDA 4RPCA 2ACKA 5HKBA 2HRQA 1WB5A 2JGMA 2PSFA 1XROA 2WILA 5AICA 1F8UA 4KJXA 1Z68A 2VQ6A 2QTBA 1QIIA 2PSDA 4MQMA 1F6WA 1XLUA 4QE3A 1TK3A 4BAUA 4OPMA 3I6MA 3STXA 1E8MA 3R40A 4MEBA 2VEOA 5ALLA 2OAGA 1DT3A 4YK7A 1EVEA 2QT9A 5D3KA 3PDCA 3Q8WA 2GYVA 1CUBA 2WU3A 4MWTA 3FOBA 1HBJA 4EY8A 1UOOA 2JGIA 1CUGA 1FSSA 3IA2A 1E66A 3PE6A 1RP1A 4C89A 3P2MA 4ITVA 1KEZA 4J0DA 3IULA 1YCDA 3D2AA 4OYYA 2RAUA 3S2ZA 2C4HA 5JD6A 1Q0RA 3ESCA 4J3JA 3O9VA 4FLFA 4CCYA 4B0OA 1AGYA 5LZ4A 1EB8A 4UHBA 4Q3OA 3I2IA 3A2MA 2E3JA 1TRHA 2HA5A 3C6ZA 1BEZA 3GFFA 4LYEA 4UFPA 1FJ2A 1XZHA 2HU8A 3E1GA 3QVMA 1MX1A 2FJPA 4A5SA 1LLFA 1OILA 2Y2UA 2WUEA 1TCCA 2VJCA 4IQ4A 1LPBB 4O08A 4H77A 4BC1A 2Z3WA 3WIOA 3O4JA 3O0DA 2HHAA 1T4MA 4PO3X 3CXUA 2WJ3A 1UKBA 4D9JA 5LIPA 1UOQA 4QWWA 3CCCA 1YSCA 3AZOA 3JW8A 1BN6A 2XUDA 1K63A 1DX4A 3KD2A 5AOCA 5CW2A 3B5EA 4MQLA 3LS2A 5HF5A 5JALA 1QGED 2J3QA 3FLBA 1EB9A 1AKNA 5T4HA 1OCEA 2DHDA 3TJMA 1IMJA 1ORVA 2XUGA 5AI0A 4U2EA 3PUIA 4M0FA 3AJAA 4RNCA 2HA6A 1GQSA 2FUKA 4X6YA 3HLKA 3RARA 1CUFA 1YB7A 4EA6A 4KAJA 1QIDA 3QPAA 3F9CA 4FWBA 4JYPA 5D6OA 1H2WA 1LZLA 2OGZA 3SK0A 1FFDA 4WY5A 3KOOA 3A2NA 3O4HA 4BB0A 2PU5A 3CN7A 1ISPA 4OB8A 1EDEA 4QWMA 5IVHA 2WIFA 1TKRA 4J0JA 3G0IA 4U2FA 3C87A 4X6XA 5FOQA 3FYUA 4W63A 2HA4A 4OU4A 1ZICA 4XIIA 4LXGA 5AKXA 3GBSA 2BJHA 4X94A 2XUFA 4OD0A 4XX1A 3WWPA 5K5EA 1GZ7A 5IVDA 4RE6A 1XZIA 5AKJA 4OU5A 5C7YA 1BROA 4KAFA 2Q0XA 4PQEA 3G0BA 4J7AA 1O6GA 2PKYX 2DQZA 1VLQA 2FJ0A 1DQYA 2HRRA 4DYHA 2AJDA 3QPCA 2QUBA 1G42A 1E3QA 1CEXA 2WQZA 1DINA 2ZYSA 1AX9A 2V96A 5T4BA 4BP9A 1SC9A 1QFMA 4G8BA 3ZV7A 1EA5A 1CUSA 1HPLA 4FNGA 2QXTA 2XMRA 4UHHA 3BJMA 3ZWQA 3B3QA 3DYVA 5CRIA 1EDBA 5F4ZA 3WKAA 1AURA 3WIBA 2G5PA 4UUQA 5JYCA 2ROQA 5AKIA 4BVJA 2OG1A 1HLGA 3ICVA 4E46A 2WJ4A 3KDAA 4C4YA 3HEAA 3O95A 2ZYIA 2QS9A 5LKAA 5ALIA 3ILSA 4P08A 4DLNA 4QDUA 2ES4A 4X3CA 4B81A 3X3HA 5JZBA 2V97A 2OCLA 3VKFA 3WQHA 4U2GA 1ZI9A 3HACA 2H9YA 3R3VA 4CG2A 1P0MA 1Q0ZA 1CV2A 1P0PA 5CT6A 2Z8ZA 3WJ1A 4ROTA 1QFSA 2AJBA 2ZJ6A 5JAHA 1WHTA 5LZ2A 5ALZA 2JEYA 3QPDA 4NMWA 4L3WA 4C88A 3BJRA 1CUHA 4JH0A 2X76A 4Q05A 4W1PA 3IUJA 4P92A 3DQZA 4J0IA 3D5EA 3NUZA 1ODCA 1LPSA 1UK9A 1UXOA 2J4FA 3WYNA 1UK8A 4YASA 4I3FA 4AQDA 3ZLUA 2DQYA 4LXIA 5HKAA 3WL8A 2YH2A 4WY8A 1MAAA 3F97A 5JAPA 5CT9A 5ALXA 3OOSA 2P8SA 1QONA 1GPKA 5CBKA 2RHTA
chains in the Genus database with same CATH superfamily
1QIMA 2BFAA 4LX8A 2EG5A 1GR1A 3KJQA 1BCRA 1J97A 4R2JA 2PBLA 1GQFA 4G9GA 2E1RA 5F2EA 2VS1A 4KN6A 5CXXA 2HT1A 5KNDA 2VUSA 3OZFA 3E9EA 4QQKA 3OH8A 4S04A 2IPXA 2O8EA 2QMEA 2VZ0A 3PI6A 4R2LA 5KDDA 4CM9A 3OX1A 1M6EX 2A67A 3C39A 3URMA 2I66A 5IJZA 1ORHA 5KTPA 2XEDA 4G1EB 2XLBA 3KXLA 4LW8A 4MYSA 3CKYA 1W76A 1T3ZA 4FR5A 3OE5A 4I55B 1TECE 3KVOA 3RWMB 1PS8A 5DEOA 3U3ZA 5L4SA 1NNI1 2JAUA 2P2CA 1UXKA 5FPHA 3W5IA 1U7OA 4BNNA 1I4DD 3OIFA 3D6FA 3NAGA 4D4KA 3G7NA 4GMHA 5BVGB 4OATA 3W34A 1SUSA 2XAUA 1ADJA 1RKXA 1CD5A 2ISQA 2W4MA 1SXIA 2Y93A 4QDXA 2VK1A 4FCWA 4XGRA 2GO7A 3NHFA 4I4LA 4Y30A 3UT0A 4DLRA 2RH5A 2X0EA 3ZD8A 1D4FA 4DR2B 4KMSA 4O5OA 1EM6A 1XMJA 2JBAB 2XB8A 4OGKA 1JA0A 5TQ0A 2OKCA 2ZB4A 3BE6A 3R24A 4B9EA 4ZIRA 5IKEA 4WZZA 5TEWA 3AEYA 4O0LA 2GB4A 1VL0A 3UMSA 1T6YA 2EEZA 4TTRA 4JROA 4TS4A 2C5GA 5F4BA 1RMYA 1J5XA 3HXKA 1KWGA 1X9HA 1SGWA 2W6MA 3CMCO 4MJ3A 4QPDA 4REOA 1CJUC 2EJWA 2M6LA 4EKGA 3LP8A 3F90A 4TLBA 1O97C 1T8SA 1V5GA 4G1FA 1IN6A 3B8EA 4O4LB 1FBNA 4F9GA 2C2HA 4X61A 4O25A 2GJAA 5HE9A 1RAAA 2IHBA 4Z8YA 1NRJB 3ETEA 3SJBA 3GLGB 1YA8A 3AJ9A 1IXKA 4AYWA 2J1LA 4KGVA 3NT4A 3OUTA 1F2UA 4WNYA 2NUTA 1UKVY 2Z2ZA 5ALQA 3ZTTA 1SCNE 2DWQA 1ENOA 1U0FA 1JE0A 1WU8A 3ENNA 3RU9A 1MB4A 4HN4B 4IS3A 4EGQA 3FNGA 3VYWA 2K6GA 4D8YA 2Q5CA 1Y89A 2I80A 1Z39A 2RJNA 4KFRA 3HR8A 4ND5A 3WGGA 4EG7A 1P62B 4EUFA 1DJNA 1BCSB 4CQMD 2GSDA 1I3MA 3EIHA 5JCOA 1M2GA 2DF8A 3U17A 4CTOA 4ZEVA 1J2YA 2GOYA 4DR4B 4HH3C 4KZPA 1U5BB 1E77A 3VOAA 5A71A 2Y9PB 3Q41A 4KLRA 4B3JA 1NBME 5TJHA 1ULHA 3HO8A 4W6QA 4BKPA 2GKGA 2MSCB 4ZZ1A 4X90A 5JHHB 4B76A 1QH1A 2OO5C 3GUUA 3HDVA 4N12A 1BYUA 1SC4A 1GNQA 1MGOA 4K3VA 4LF5B 1FQJA 5I7RA 1G9TA 3EBOA 1XTBA 4Y98A 4WERA 3UICA 1GQYA 4HLNA 1N0VC 3VJLA 1SULA 4R69A 4ETMA 1SHLA 4HWRA 4RIIA 1CS0A 2ZI3A 3L8FA 1UDBA 3MRTA 1O9GA 1WY5A 3CLKA 2GUWA 3JVEA 1OLSA 2HDNB 3HRIA 4PU0A 1CNEA 5FD8A 3DEYX 3WGIA 4BWYA 1CUXA 3FPEA 4UATA 4CF4A 4D6YA 1J56A 121PA 1G3MA 4NEGA 3TRKA 1EFRA 1S1MA 3K7EA 2E87A 5E8RA 2F8TA 2CDNA 3N2GA 3FUCA 5TPWA 2PKWA 2NSYA 2G9UA 5KOJA 4YMSA 4D3FA 2HU5A 3QQPA 2QNIA 3ETGA 2GT1A 2V9ZA 1SKUA 4ENVA 4I8XA 2I7DA 2FMHA 3BMXA 1JMYA 3ZCQA 2OYCA 1KNXA 3R5TA 1NPDA 3TS1A 2F8SA 3ML1A 1YTLA 3GHYA 5IWAB 4OKIA 4ZHQF 1XYVA 5AVOA 1ZXBA 1B00A 4XKJA 1PT5A 3NR2A 2IOFA 5JWHA 2VAWA 1Q2UA 1WRBA 4DFDA 1WMDA 2GLXA 2WSYB 3BFXA 3EMDA 2QSJA 3NBZC 4ANFA 4BFZA 5IPFA 4N6GA 4I50F 2E49A 3R8CA 1VQ1A 5JDCC 5EIHA 1TC2A 1WUJS 1XQXA 2H2AA 4FYIA 4C7OB 2A9VA 1C80A 5C8XA 3D3NA 3PFKA 3S3TA 2ZAGA 3AYXB 1M8GA 4MVJF 3OJWA 1IBRA 4QGGA 4WIAA 4Y2RA 1K97A 2NUAA 5EIFA 3OOJA 4C05A 1GFZA 4ZDIA 5FFFA 4EGCB 4XB6B 3KL4A 3K9GA 1Y5NA 2V9CA 1MEOA 2FEMA 3IBCA 3DWEX 3LOUA 2FPIB 4O2AF 1KDPA 1SC1A 2BR5A 1FRZA 4L7VA 4C1NA 3S8EA 5GIOE 4AW9A 3TEJA 5CFLA 5JISA 2O57A 4C4AA 2I67A 4S1TA 4D81A 1SHKA 5C18A 4L50A 4JYAB 3CLTD 4II3A 4Z51A 2ASEA 5BUQA 4XJTA 3RFTA 3H5AA 1X7GA 5E1BA 5JBQA 4LYFA 1YDWA 3DC7A 1MB3A 2BH9A 2Q6LA 4MEAA 4C9BA 4A9AA 2A35A 3BIOA 4TPKA 4B40A 4CIAA 5LMUB 5FI3A 1L4BA 5KJ1A 1YZTA 3FNFA 1G0NA 3PGKA 4FHGA 2BFBB 5AI5A 1AZWA 1I2BA 2VPPA 3IT1A 2PSHA 3R7DA 4ZYLA 1YRHA 1P7WA 1M1XB 2XGSA 2ESRA 1NG1A 1O97D 3MLEA 4JR2A 1SM4A 1L5LA 2GUGA 1JR6A 3P0IA 1THGA 4RAQA 3UB4A 3V8RA 1MO2A 3GL9A 3E5RA 4WDRA 3VNAA 3VSBA 4DA0A 1NDUA 4ER0A 1L1RA 3ZWVA 4X91A 4IJMA 4M0CA 3T4PA 5AW0A 1Q3HA 3G2QA 1ZOIA 3P26A 2AXNA 4OL0A 5BSWA 4NBRA 5LP6B 4WNAA 1D1SA 5E4TA 1W5BA 2MMCA 2QRMA 2NZJA 4HAWA 1FTQA 4V1CB 3STUA 5LBTA 3E3MA 2Q27A 3VPGA 5BR7A 4GYYA 1N34B 3PKJA 3UW3A 1WD7A 2RDMA 2WYUA 3KS9A 5F1OA 4B4VA 5AW6A 4DB2A 3KUDA 2XGGA 3NGLA 3TE7A 3QE4A 2RGXA 1A5ZA 4O1MA 1KVSA 1YACA 2E85A 5H59A 1PN3A 2YN2A 2WU8A 4ESEA 2OAEA 2AQHA 4B7ZA 4CL2A 2IBSA 2HLDA 3DLCA 5BV0A 4R9VA 3C4JA 4HWKA 3VOSA 2Q8QA 4IWYA 1WM1A 3PPXA 4C4XA 1NGSA 1XZKA 1Y37A 3AFGA 1C9NA 4AURA 1MPTA 1ST2A 2PY6A 4YN3A 2DQSA 2UUCB 4US2R 4DL9A 4MYRA 4YHHB 5LOVF 3ETCA 3DOFA 4YLYA 4ZZIA 4IICA 2W2MA 2HCRA 3EHDA 3PHHA 4LI3X 5B2FA 3D8UA 2B2NA 1IN4A 2J9ZB 1XNHA 4I5GA 3DBRA 3T7DA 3RHFA 4FQ5A 4U2CA 3RO7A 4E0BA 1NW6A 1RHRA 3D1JA 4URHA 4WZAE 1XEFA 1UC5B 3GN1A 1JKJB 3C6MA 2ZFUA 3KQMA 4XM1A 4UKDA 2ZAYA 5EUBA 3CZMA 2XVYA 4FDUA 3A9RA 2KMLA 4ZAXA 4DWWA 2ZRKA 4GXRA 4IKPA 2SKEA 3HGMA 1ZD9A 4XVCA 2PX0A 3T54A 2HWKA 1GRNA 1BVYF 2I2AA 4ZMSA 1QB7A 2XCOA 3NCTA 4KWHA 3KOMA 3E4CA 4LNAA 3KT3A 3OP4A 3N0TA 2O8VA 1LSUA 4Y8VA 4BLUA 2J30A 1X38A 3TVYA 4IJWA 1M5TA 3WV4A 1FVHA 2B30A 4JLVA 2WDZA 4BNWA 1NOKA 5ALYA 2OEPA 3T5DA 2CL5A 3SBXA 4BAZA 4JC4A 1T8TA 1E20A 5I4IA 2OQVA 3M9XA 2CZQA 3ZCXA 2P68A 2VG8A 4WXMA 4KR6A 1R1DA 3FSGD 5FBLB 5BV8A 3ER6A 4JODA 2CLMB 5CH3A 3T9AA 1JTEA 2DUWA 4LZLA 4IDEA 3CB2A 5BNTA 1EESA 1P0IA 5BRAA 1WW8A 2AFHB 1XJWA 3H7AA 4ZEXA 3MQFA 5ECYA 1EP1B 3BH7A 4D43A 4ZI5A 1UBLS 3CKLA 1ZIXA 2OB1A 3DHWC 2AS0A 1DIOB 1R6UA 4L72A 1KY2A 4TV9A 1RRPA 5IC4A 4B3HA 1ORWA 1T8UA 2VPQA 3A6PC 4XOIA 3L6CA 1U3UA 4RK5A 5DHFA 1N2XA 2X9QA 3OPXA 2J08A 3V9AA 3AF4A 1GAWA 2REQB 3B85A 1IPHA 1O94A 4YJ3A 4TTPA 1V96A 4FSHA 1EP3B 1UDRA 3DMTC 1EVYA 4HADA 4NENB 4RA9A 4RIFA 3HJRA 1PUIA 3ZZ0A 3FF1A 1JHOA 3CMMA 3S7ZA 1QO0D 1L5OA 3QLEA 5JJ5A 2NPOA 2Q62A 3VH4A 1KYQA 1UK6A 1WOMA 3VH1A 4BB5A 4JJEA 2CD9A 1ZEJA 3K53A 1NN0A 2ZT7A 3T0FA 1XA0A 2OV3A 1N2JA 1ZGHA 2XODA 5A6VA 3ERCA 2D2XA 8AT1A 3HO1A 3JQBC 1GTRA 2V55B 4U9UA 1G2OA 1DAMA 2I1QA 1EUZA 2YTZA 2BR4A 2J33A 4YP5A 4CQMB 2GARA 1R18A 2IUFA 5CA0A 4JX9A 2JGJA 1C0PA 3B1FA 3BF8A 4BL5A 3FR8A 3PP8A 1I51A 3K2BA 4KP7A 4WXPA 2IXDA 4NCBA 4D9EA 2CDBA 1W48A 3FNIA 4DLBA 3ABSB 3VNVA 3TGPA 3GP8A 1K6MA 3PSAA 2YXNA 1AH2A 4RADA 3IBSA 4QTUB 3IQFA 4RPKA 1VXOA 1V4NA 5AKGA 1R4NA 4GLJA 5C8ZA 2E5LB 1GQ2A 3HVUA 3AIOA 2GK6A 2AB0A 3QPWA 1ZR4A 4D80A 4AULA 3VX3A 3ICWA 4PRYA 4Z2YA 3DM5A 5JROA 3LY9A 1KJQA 2HJSA 3I9JA 5F2KA 4E15A 4AKEA 4B46A 1XKLA 3TZ6A 4A7PA 4CFYA 4DMMA 3QPUA 3T1NA 5BY2A 2EZTA 5JRDS 4IH9A 3PWZA 3DZGA 3Q9LA 3ZTYA 5IDVA 1LV8A 3LO5A 2O48X 5DT9A 3ZWDA 3HGTA 5HQ3A 1IPFA 2WIBA 2YOGA 3OIUA 4J03A 1RWVA 4NG4A 5ES3A 3U1VA 3LDFA 5BV7A 2OXEA 5JYEA 1TVCA 3JVUA 1AHIA 4DGQA 5M5BA 3VH2A 4G65A 3L8YA 2F3RA 1KF0A 3AUKA 3O47A 3O92A 4KQJA 3GRFA 2QLFA 1IJBA 2CLIB 2PRYA 3JATB 3QFSA 2X9GA 4K6MA 2XSZD 2FP4B 3CJQA 4HEHA 4QICA 2JAWA 4YC7A 4YRZA 1K2VN 4Q1EA 4D2IA 4JFAA 2NZYA 1H0KA 9GPBA 3UXMA 2BISA 4AT1A 1QLHA 1B3RA 1UBOS 4OUDA 2FUEA 1VG8A 1KO7A 2EV9A 1J09A 1GTVA 2D1FA 5CDUA 4WI1A 1Z5GA 5IKXA 1SPBS 2HKIA 1HQCA 2GBIA 2Z6AA 4KN8A 5U4QA 2FRXA 3VR3A 4DSZA 1BKDR 2V7WA 3HYRA 1DFIA 2XOKA 3L77A 1CUIA 5G0TA 2EKZA 2FX5A 3O73A 2EEPA 1BE1A 2X5KO 3P9QA 4BQQA 4EMTA 2XXAB 1YZUA 2HREA 1JZTA 4P33A 2PWYA 5HZGA 3KFLA 2OE2A 1DKMA 3CIOA 3ESZA 4NCJA 5GVSA 1G41A 3KO8A 1RNLA 3ZKAA 1KOGA 3QEAZ 2PXCA 3KYDB 4PFKA 4HNSA 1JJFA 4FK8A 4OV6B 3ABIA 3RRXA 1TAGA 2WUWE 4E6EA 3QVUA 2WUGA 3ZWWA 2VH5R 3D0QA 3PTLA 4CMIA 5CD9A 2XE7A 3QKUA 2HTEA 5CA1A 2X3UA 2G25A 3HE3A 1G20B 3LVRE 4U7GA 1DXOA 2W2OA 1FNSA 1U8XX 2DM6A 2JHCA 3SAJA 4CV3A 621PA 1ZIDA 5DK4A 3P2IA 3PCTA 1B7GO 4ZDKA 1KZ4A 3UYLA 3SZUA 4PM4A 2EERA 3A1TA 4BNVA 3AHFA 1TMKA 4NFLA 1LVUA 4R1PA 4UAGA 2IBMA 3SKYA 4AKSA 4WQMA 5A05A 3RVRA 2XGMA 4V0OA 3U0VA 4ZV7A 5SZIA 3VU1A 4DCGA 2EX4A 2FSGA 4DYVA 4QODA 5FXMA 16PKA 3E27A 1KSHA 1XMVA 3U3OA 5IX8A 2HQ1A 3M7IA 3SZ3A 3PBKA 5LYJB 4XIFA 5CIQA 3W05A 1DFHA 1DC7A 2IHJA 3ZWYA 1JF8A 4CG3A 4ZOBA 1QIJA 1T29A 1DC3A 1G9XA 2JGEA 3PCXA 4HTAA 4IHQA 3EGOA 4L1KA 4OHXA 4EHBA 2WB2A 4PX9A 3KXPA 5EQJB 3IJPA 4UHDA 5FUXA 5AVSA 3LOQA 3IE2A 2BSXA 2VJMB 4NQZA 5BSEA 3N28A 1P1JA 3JD0A 3SJCA 3VPFA 5JAZA 4HATA 4EELA 1PSZA 2H06A 2CNNA 1TYEB 1NVMB 1R27A 2CL6X 3EB9A 3NDJA 1N9GB 4IR7A 3ZZNA 1E7RA 5F3DA 3TNJA 1SKQA 2W9XA 2IYEA 2Y67A 1GILA 2ZWVA 3EFHA 1LD3A 4PXAA 5GM1A 3SZLA 2JGDB 2KBFA 1YZ3A 3G8DA 5K8UA 1VHWA 2DHQA 3NMUF 2CNDA 2JRCA 1VLMA 5G0SA 2RKOA 4CKYA 4PG7A 3MTEA 1VOTA 2XWPA 2Z2JA 1K9VF 2O0HA 3WFIA 4BMPB 4DWVA 2R8BA 2NPIA 1E3JA 3GRPA 4NQRA 4PVCA 3TQCA 1UFQA 1UWLA 2ZSKA 3HHEA 3LUHA 4LV6A 4ZI2A 2RBGA 2IOHA 2JDIA 4J0KA 3V4PB 3OZVA 3SOZA 4D96A 1YIOA 4TQUS 5DHQA 4PZUA 1I32A 1QRTA 1JN0A 5LZ9A 4C4ZA 2UZ0A 4OI4A 3RU3A 4KXNA 4YRNA 1LSOA 2AGVA 4ZD6A 1OFVA 3O91A 1CXZA 2PT6A 3AJ8A 3X2FA 3TRJA 2Q5EA 4ZYTA 5BOVA 4BASA 4AG3A 1CJSA 5CMLA 3PL1A 2FW7A 1DCKA 1L3BA 4JOCA 5C8YB 3DBRB 3DPUA 3MPOA 3I12A 4CLDA 2HMSA 1VZ3A 1XAGA 4O8ZA 3H2IA 2X4GA 4IDGA 1BHSA 1E7WA 1Y3HA 2AKYA 3K8ZA 3RPEA 4F92B 2WHQA 4X60A 3UFXA 1DLIA 3E61A 2AKEA 1PQPA 2ONCA 4EW2A 1RKBA 1DKOA 4RD3A 1Z5NA 4MVXA 2JJ2D 4L6IA 1H4QA 1WCV1 2ZJ3A 3M81A 2DULA 2IPNA 4RGYA 2YJ3A 3R74A 2I4MA 3OSUA 5AXCA 1PFVA 1AC5A 4I4NA 4FOSA 2H00A 4A2QA 1M6VB 4M9XA 4W5NA 4LHYA 5D00A 1E2EA 2AYZA 4YAWA 3DTNA 1VYHA 3GRKA 4DV3B 2QPLA 1OX6A 3MPUA 4UVDA 2OXCA 4MVJM 4KPYA 2FWBA 2E4UA 2Y92A 1L5FA 3IELA 1ZAKA 3BL8A 3ON5A 3Q5DA 1ZISA 5IM5A 2VCYA 4OKSA 1JHMA 1QTNA 1RJWA 3PFIA 1Y42X 2BKLA 2FN8A 2X0DA 4ED9A 2PA0A 2PKXA 2VOJA 4EGFA 1W36C 1NT2A 3PX7A 3GLGA 4IMIB 1R88A 3BMCB 1N2IA 3E7FA 4MR9A 4QEKA 4X24A 5FL7D 3UXHA 1VMAA 2FPGB 2FFRA 2HBQA 5CLLA 4C03A 2Q3LA 2VPYA 4BMCA 5JFGA 3DCIA 1O6BA 2WTAA 3AB8A 1ZA1A 3LWNA 4Q6BA 2L2QA 1RZVA 4J1TA 3JWJA 5PNTA 5H80A 4LRXA 1X14A 1XQYA 2GHRA 2WICA 4BVAA 1HR0B 3RJ9A 4BLVA 1G2PA 3GPDG 5TC4A 4CG1A 1YONA 1FSZA 1KBZA 2YQ5A 2BTQB 3GT3A 3R5FA 1WXWA 3OHPA 1TE2A 3SC6A 1CRWG 2FX3A 2HEIA 3LECA 3MLAA 1L7VC 3H6HA 1KAGA 2WJ6A 3LP5A 4YCCA 1AY0A 4ZVOA 1H2YA 5HKKA 2BFCA 3C8HA 3HY3A 2Q3DA 3I3SR 3LUJA 2ZE7A 3F5FA 5FR2A 1G5FA 4ZEWA 4E2YA 3SS8A 5HKKD 2PT5A 1K0UA 1ND5A 3M6AA 3PVSA 4EY7A 1Q2XA 1X94A 4Q39A 5B2EA 1MAHA 4EY6A 1FYVA 3QTBA 5FNVA 5H5JA 1DQNA 2JFGA 2V7VA 3UQYS 5EHXA 3E8MA 3KOWA 3LCMA 2H17A 3R1IA 4UBKA 3SG0A 3WLKX 3FGZA 4LHXA 3BHJA 4O2BF 3UAGA 1OTHA 5G3YA 1XNJA 3HYLA 1DQZA 3CJTA 2KS6A 4OA5A 2YMQA 1JMVA 4HDMB 4ARAA 1RCTE 3RYTC 1QRRA 4OHVA 5EVCA 2IQIA 4GSKA 3KZOA 2YXPX 4TTSA 3A4LA 4GU5A 1L4FA 3CEPB 3HNRA 5HQJA 1GDHA 3VGJA 4MZXA 2P69A 4RHUA 1A5AB 1Z7GA 2VZ9A 4YJGB 4F6RB 5AVYA 5ALFA 3IDOA 3K6SB 1UWCA 1UMDA 3NP7A 5GP1A 2IYFA 2KX7A 2BFEA 3DULA 3F9RA 1VB5A 2FFJA 3EH1A 3O3NB 1PSWA 4KPUB 3JSXA 1BYIA 1H2EA 4MINA 4YRSA 4MMXB 3LX5A 1VCMA 1WQ1R 2QQ5A 3AI7A 3OU7A 1I4LD 2FZCA 1PJSA 2HIHA 1LTHR 1XHFA 2JIMA 2ONKA 4RD4A 3MWDB 3TSOA 2YHIA 3W8FA 4P83A 5FBQB 3QYJA 3C15C 4TS9A 3L07A 4A27A 1ZM3A 1W5EA 4HNHA 5C3MA 3QWAA 3MB5A 1ADGA 3CW2A 1LNQA 2J4DA 2BMDA 3HEMA 3DE4X 3UGTA 4HFMA 3R3HA 4CQLB 4NESA 5EQFA 1TVEA 4OYLA 2A9PA 4M87A 1XYYA 2OGSA 2QYHA 3DEHA 2B20A 1TJPB 3LC7O 4K8OA 4UBIA 2OVBA 2QN2A 5I7OA 1MABB 1BJRE 4FR2A 2C9YA 4HS4A 3UMGA 5BN1A 5BUSA 1QANA 3EVGA 1FF9A 2NO5A 2CNWA 4NZMA 4ZZ2A 3W4JA 3X43A 4DLKA 4DCTA 2JLBA 4YDSA 1NSYA 5IH7A 5K9ZA 2JAQA 2KWIA 4GP9A 3VZQA 1X3SA 3AERB 3UUEA 5FV4A 1DO0A 3ZE0B 1E2IA 3ZK9A 2OHHA 3MIIA 3SEZA 4DMFA 3R9IA 2W2KA 3HCRA 3MXOA 3ACBA 2D5IA 4MPPA 1UEIA 2YZMA 3KB2A 5JADA 3DV0A 2ODTX 3ORSA 3K94A 2VQDA 1QWSA 4H6PA 1O6FA 4UFNA 5C1IA 3H9QA 4M8NE 4X95A 2CDCA 3VTKA 4ZHQB 5EINA 3IEMA 1US8A 1TW3A 2V5UA 4MVYA 5F3WB 1FUKA 4R81A 3RC8A 1XFAA 3QEJA 4YXFA 4CDMA 1QYIA 3ZEIA 3JV7A 3VAZA 4PO8A 1JPNA 1U1GA 3B2NA 2IUSA 3C5WP 2ECQA 2AV6A 1WP9A 3DFIA 4RU1A 4MYHA 4COKA 3A0RB 4ALLA 2HF2A 1ZBQA 2DPHA 1OA0A 3A6HA 3KQVA 4HH4A 4IZHA 1EE2A 3VTZA 1IIRA 2VTDA 4ZK6A 5J58A 5DLQC 1DBSA 2ZANA 4QXAA 2WJJA 4UUMA 1FXWA 2W48A 4C2TA 5IVPA 4Q4LA 1OFUA 3WMGA 1QGAA 4QRDA 3DAHA 2W0SA 8GPBA 5CT5A 2DETA 3K92A 3IDFA 4FM9A 4IV0A 2H2IA 2O8CA 1GCIA 2O4UX 1TT5A 3KVRA 1TL7C 4F5YA 3IKTA 2X0RA 1OXSC 4Q1CA 4B2YA 3L7OA 1H2ZA 1UPTA 3RHSA 5JY1A 3U7HB 4FIDA 4HXFB 1U2RA 3BSFA 3FKQA 3KM0A 2Q6TA 5DLDA 5A4IS 3KDSE 4A15A 4UNPA 1ISGA 3N3AC 5AJVB 5FP0A 4OJMX 2Q4RA 3GEBA 3SJZA 3DOOA 4B2PA 2VDPB 2P77A 4MRRA 3HB4X 3BD9A 4RXMA 1ZMTA 3I0ZA 3HI4A 4M1TA 1P0QA 4NAHA 1PUXA 5JCJA 2JD1A 3CX4A 4J4HA 4NI5A 4IIGA 2W2LD 2XGOA 4LJKA 3BN3A 3LPNA 2B4YA 3NT5A 1R0RE 2PANA 3L49A 3ZCUA 5BPFA 1JFVA 3NONA 1RLUA 2XWSA 3INGA 1FFCA 4MUAA 1N4AA 1KKUA 1M66A 1ZHHA 3F5SA 3H0EA 5E95A 3K0EA 1FU8A 4J6FA 1KI3A 2CJWA 1PT8A 1VA5A 3OX4A 1MKYA 4DCCA 3TOSA 1GAJA 4EZEA 3LTNC 2IYXA 3FSEA 3PUZA 3KQHA 3QH4A 2DLCX 2V5AA 3H16A 2G83A 2FSIA 3GLFA 1SK9A 2FW1A 3EULA 1H3EA 2B99A 1I2DA 3UGJA 1QTIA 3F5QA 4RWEA 3TZLA 1LC3A 2A0XA 1LFDB 2P0EA 5JH7B 4AK9A 4WCFB 2MSDB 3QX8A 2ZREA 2Q5LA 1DTEA 4KAAA 4E5VA 5DIFA 2D5BA 2X3FA 3EIWA 3RAEC 3M4NA 4CW7A 4MRSA 5ALSA 2GXUA 4F12A 1VJ0A 1NN1A 4KIWA 5BWLA 3IEPA 1C1XB 4BKUA 4ZEMA 1XTZA 3FTCA 3B6MA 4N0PA 3ESQA 2DWPA 4E07A 2PD4A 3OQPA 4OMUA 4R2WA 4D92A 5JNVA 2GF0A 2O6HA 1TTQB 2C07A 3K20A 4FMDF 4H0FA 2PPLA 4HLQB 1T13A 1LU9A 4M1EA 1PZFA 4YS6A 5EP2A 1QIHA 1VZ2A 1VE1A 1I7QB 4MV1A 2FPSA 5LD2C 1TFRA 1NVUQ 4F2DA 5BT8A 4DUGD 1GA1A 1VL6A 1INLA 3B2QA 4Y2UA 5A62A 3ORHA 2FG5A 1DDIA 2HAEA 3R7LA 4DUGA 1VKNA 2M98A 1EBFA 3LXXA 2YHSA 4FKMA 2PLWA 4DG8A 3IBFA 3O0TA 3RTGA 1FDRA 3DL4A 5AJTA 4M8SA 2C04A 3CQ9A 4PLGA 5FPYA 1X13A 4P0PB 5FT9A 5HE8A 3GLHA 4WEQA 5AVJA 3SQWA 2AN4A 1TB4A 3EVCA 4ND8B 1R4NB 1JBQA 4FT4A 4NPCA 5GQSA 4L2IA 1KEEA 1TO2E 1YQUA 1OLUA 4WJLA 1T2VA 2X1HA 5AFSA 1TF2A 5AM0A 3QSGA 1JDNA 3DTVA 1KDTA 3SXJA 2B3TA 1E3TA 2JIBA 3MOSA 4RHYA 2GERA 1QGUB 2R84A 1MC8A 4YCMA 2B94A 3Q6NA 1YUNA 1OBCA 4G1MB 1O58A 4H6XA 4BRZA 5B7PA 3H2HA 4YAEA 2QRGA 3DD1A 4MS1B 3A4NA 2Q3HA 1L8XA 3L7MA 4K1XA 5EC8A 1J9EA 4CQMA 2RHRA 3EYAA 4OGLA 1RI1A 1TVKA 1ZQ1A 1WUIS 4G37A 1GA6A 4ZU3A 1ULSA 3QITA 5I4BA 4DCPA 3SS7X 4UVEA 1QM5A 2I62A 4FYVA 4W4TA 5HKLA 3SF8B 5JSZB 3MMNA 2FRDA 2O07A 2QY6A 4LXQA 4AUNA 4X85A 3TGWA 2OZPA 3KKQA 3JPYA 3ZNOA 2OVFA 3U3XA 1CDDA 1RU3A 5YASA 3HVHA 4Q15A 2I65A 3I52A 3QFFA 3I2GA 3W5VA 2P9TA 3OE4A 1PU2A 2ACVA 2FP4A 4MHSA 1SG0A 2WHRA 1TOAA 4AJ2A 1DHTA 3MTAA 4KKXB 1VIMA 1KZHA 3AEKB 5JZMA 1YTUA 2QTHA 3D2CA 2Y76A 3FYTA 3ITEA 1GVNB 3FZYA 1O08A 1QVAA 3C6QA 3LDUA 3HVIA 3UMFA 3A4YA 4I4TB 1C8KA 5FI0B 3VQTA 2QP9X 1YI1A 2XNHA 1L4GA 2X5XA 3IQHX 1YAHA 4B4DA 3ESAA 1R0LA 2OXRA 2WJVA 3PNYA 3PUWA 4IOLA 1XU4A 3HNOA 4HHEA 4UHKA 3X0DA 4BCBA 4RTJA 3ORYA 4IHJF 3MRXA 4V3BA 2H2DA 1WVMA 3IHWA 4KHZA 4UULA 1JP7A 2B9VA 2I8CA 2OESA 3HFSA 3ZPXA 1VBNA 1IDOA 2XNSA 4K87A 3T3PB 2H1VA 3ZQ4A 4MAAA 1RHMA 3GQBA 3HBNA 3EVAA 4RKRA 2IDMA 4K6KA 1T3TA 4Q02A 1LBQA 2C5HA 1FTWA 2WLTA 3RYIA 3TXYA 3SLKA 1EUDA 4G84A 4ZTZB 5LU8A 2DSTA 2ZYDA 4KQHA 4M99A 4RGBA 4BGVA 4JI8B 1XZNA 2MWMA 2VF5X 4BQOA 4LZNA 1SUEA 4GECA 1U2DA 3OE7D 4PQGA 4AO7A 5EWLA 3DOHA 3UV7A 2WPDA 4D9MA 5ALVA 2EFDB 3MGCA 4K2AA 2IZ0A 3LHIA 4PCVA 3KL2A 5JI3E 3L1KA 4W5OA 1KDVA 3KBOA 3RAPR 4A26A 3HKDB 2DAPA 1GUDA 1XVVA 1D2EA 2OORA 2O7VA 1IQUA 2VSNA 3EIXA 3Q9UA 1WU7A 2AFHE 3JQEA 1T9DA 3BWEA 3DAOA 1M7BA 5HJ7A 3G5TA 2PKEA 3JD3A 1XDBA 2ZJ7A 1V5FA 4NOLA 5CX1A 4IDDA 1VYUA 5L4NA 4XYBA 3H42B 3U81A 1K5HA 1WEKA 2AF3C 4ME6A 4X9XA 5DNDA 1H94A 5JI2E 1OI4A 5FTWA 5ALGA 1K8ZB 5T7BA 3PUHA 3CVVA 3W7AA 3L7BA 3UUFA 3D64A 1T26A 1EGAA 2J9XB 5EPEA 4ZOCA 5D8DA 4FILA 1IXZA 5DJ5A 2D00A 3ZU6A 1RD4A 4MR9B 5FDFA 2JI6A 3AL3A 5IYZF 2PWZA 3VKGA 3D81A 3ZBQA 3IBYA 1H5UA 2GPSA 3O9ZA 2DPYA 1T5LA 1ELOA 2AN1A 5K05A 2I1VB 2WA2A 3EQ7A 4P3YA 4IOKA 1X8JA 2BKUA 3VVMA 2AW3A 4WZAA 5I9IA 5DT2A 4NPAA 2GQ0A 3OM8A 1P44A 4WOJA 5IDWA 5ITVA 1T1GA 1UM9A 3UY4A 3GVXA 3MCUA 3K2IA 5CJ2A 4ZAYA 3V4SA 5F3RA 2ZQZA 1EFKA 2A1UA 3RYHA 1KXZA 1VPLA 1X77A 2VBGA 2PA3A 4ASUD 2C4MA 2WKWA 2C9CA 3PFHA 2R1UA 3QVJA 3RC2A 1J4AA 1XN1A 4KGXA 4UPDA 2VBFA 1CZOA 2CNKA 4C76A 1X87A 3FOWA 4CKWA 2DCUA 2R25B 2BGWA 5MGBA 4FYMA 4M7WA 4QDZA 4YCDA 2QWXA 3TMKA 4WZ6A 1OBVA 1CC1S 3EUWA 2I8AA 1A8PA 2P2LA 3DMYA 3OVMA 3R3YA 1OB2A 1NVAA 2QG9A 1GPJA 1PX0A 2WUVA 4OF4A 5B5SA 4KIUA 5CA0B 1XCOA 4P93A 7YASA 1KJYA 2R9VA 4FINA 4G0YA 4GOKA 2HJHA 1P80A 3UC5A 1OH5A 1R4ZA 2Q2QA 3CT4A 1SVUA 5ESRA 1RHKA 4LMRA 5K3CA 3K32A 1MOQA 1W6RA 1G7SA 2JZCA 1AQ6A 4HGQA 4X44A 3RAFC 3A8TA 4FFBA 4J9VA 4AN4A 5ITZB 1RWOA 4CM1A 1IVYA 4NZNA 3I73A 3DWFA 2JFZA 2ZJOA 3OLCX 2OPHA 5J2TB 2H4YA 1Y7HA 1TCBA 1ISSA 4D9BA 1E1RD 3R5KA 1J2RA 2R96A 4DMCA 2GBGA 4R2MA 3QK7A 1I1HA 4G1CA 2ZT8A 3LM8A 1RZUA 4MS3B 1NR1A 1WF3A 3KJFA 4FJ2A 3PNMA 1YKGA 2JHGA 3FSRA 3I61A 1QDLB 5C46F 4DIBA 4NONA 1DEOA 4B3TB 5AUNB 4TV9B 3JALA 4E4RA 3AFMA 5B3JC 2O20A 2EW8A 2P8JA 3GPIA 1U28A 4JVOA 1XPUA 3RANA 3IOBA 5AYVA 4NPHA 5IVKA 1NUAA 1YZYA 2GNAA 2JD0A 3FCAA 1I14A 3VR0A 4LWOA 1IUPA 2X8AA 3VPHA 2ZIXB 3ZV5A 3KTDA 1USWA 1PS0A 1L5MA 2QQGA 4E3WA 4BFCA 4MQFB 4AO8A 1YJAA 3MEQA 3EF1A 5HXAA 3DTYA 2A5FA 4RLFA 5FCDA 1PVVA 2A3NA 3OU2A 1GEEA 2HYDA 2ZDHA 3NWEA 4FFSA 4S12A 1CZLA 4R5HA 5IKPA 2ZS7A 3KKKA 1J2TA 4CKBB 1XXHA 3IIIA 3BBPA 2IZ6A 2V8BA 2L69A 1XRLA 3U3JA 4RWZA 1G38A 2C00A 1OT3A 2DJ5A 2V4UA 3QXGA 1E89A 5EJAA 3GLHB 1XZBA 2ZWIA 4JBNA 5SZHB 3FSGA 2XXBA 4QGFA 3ESXA 1U0RA 2P5TB 1FFHA 3LH5A 3UBMA 3ZIAA 3A9VA 1G7TA 3M4ZA 3PR2B 4BUZA 3SP1A 3WB0A 1QC5A 1NXOA 4P6VF 2WU4A 1D03A 4DG5A 4R1LA 2NGRA 1N6KA 5CX1B 4JMPA 2HGSA 3G9TA 1YFZA 4QLOA 3NCHA 3JRXA 3CE6A 2ZUWA 4XGNA 2IHNA 4LF9B 3CURA 1J6UA 4R9NA 4DJTA 1R74A 1F7VA 5REQA 4CL8A 5EEHA 5I01A 5K99A 3C3WA 4MQ4A 3U9TA 4DUYB 1GNTA 1I10A 2WG2A 4B83A 1DX6A 1WB9A 5C35A 1SXJC 1KA9H 4XSGA 3RYFA 2DFPA 3LKBA 3E58A 1HSZA 3TNDA 1Z4MA 3ZJ5A 2JLUA 1J90A 2W93A 5L3QA 2IFTA 1WKBA 4JP8A 2FKAA 2D2EA 5EFOA 5HIAA 1A88A 1E0JA 1DC4A 1E1KA 2W6JD 4JT4A 3VDQA 2ZK7A 3HU2A 2ZBVA 3P52A 1ULAA 2CKMA 5FA6A 2WTXA 3R6DA 4J75A 1DV2A 2QNBA 1USIA 4NZOA 1QK3A 1HA3A 4XD2A 2IP1A 3H13A 2AVDA 3LXUX 1FCJA 2H7VA 3VHLB 4WCFC 3WP1B 2HBYA 1N36B 3MM4A 4AZVA 2DRIA 3DE6X 5BSMA 1U2PA 1BTOA 3M49A 1JE1A 4H4DA 3O3MB 5CYOA 4ZT6A 1DI0A 5IFLA 1CZRA 1SHJA 5C1PA 4BLWA 1E6LA 2Z8XA 5KNBA 2W7TA 2NO4A 2W42A 4R8MA 2UYHA 4KIJA 1SXJE 3BVPA 3N0XA 2QRKA 1CRLA 5JWOA 3JRNA 1P33A 3UQZA 2AD1A 4WHMA 4BE4A 4YPVA 2ZWPA 4GX2A 1N5DA 4M1OA 1SVOA 1P2UA 3BERA 1G63A 4OOFA 2VPTA 5M2QA 2ZZMA 4CV2A 1Z6AA 4I19A 2R44A 3SU8A 1XKQA 1PJZA 3NHBA 1R12A 2WWRA 2DQ4A 1QHGA 2YINC 1KK0A 3N2GB 1ILEA 2PX4A 2BDTA 1T10A 2DHCA 4LS3A 5ED4A 2OCDA 1Q92A 4WKPA 3FFXA 1N3BA 2QTVA 2VHCA 4CGZA 4F1JA 2HPHA 4D8WA 1Y81A 2QZ9A 1DRUA 2XOXA 1YQEA 2EYUA 1RRMA 3L82B 4WOCA 3EDYA 3KEMA 4BLOA 4RVSA 5LA6B 1GO2A 5ICGA 3EWIA 1YWGO 4LGVA 4D3SA 2CFOA 3NORA 3WZ2A 6GPBA 2BMVA 3C3MA 2R6HA 1N0WA 3PFNA 4Y2VA 2X13A 4D6PA 4E30A 4JQCA 1X1RA 2CFCA 1RI2A 2IPAB 2W6ID 4OBWA 2HMVA 5F35A 3ADBA 2FPPB 2VHYA 2DFNA 3I0MA 1IM2A 1S2MA 5BUZA 5J59A 4BRWA 4WCDA 3LFUA 3ZH2A 4W8GA 5JCJD 4MB6A 4LYJA 3ZR4B 5B36A 3ZIDA 4BRSA 4TYWA 4ZT7A 1ILWA 2Y1KA 5DI9A 2Q4BA 4LDQA 3TM5A 4X3OA 2HC9A 1CIPA 5F1KA 3IB3A 1QF7A 2GI4A 4HX9A 4Z9YA 2ET6A 1SG6A 2WF9A 4GKVA 4HRAA 5JEDA 1NJ5A 1SU4A 4JGBA 1MO6A 1T34A 3ZDZB 1FZQA 1BWQA 4DPMA 5A04A 2G4VA 3B7WA 1M0WA 2AKAB 5T8KA 1FP7A 1Z2PX 1QSGA 3TNYA 2PKQP 3K0AA 3WC4A 1N2CE 2XVAA 2ZRFA 3TTWA 3P4UA 3JZAA 4GXNA 4IJKA 1OXMA 3RVPA 2YV5A 3DLTA 4GP6A 1TTHA 2PS9A 2H7XA 3JQGB 3A70A 4PLFA 1GAXA 4HEA1 4P5EA 2A3RA 4C2AA 3LLCA 2SCUA 4BLTA 4EI8A 3F1KA 4P4SA 1X3LA 1CUCA 2J0VA 3N3BC 1KI6A 5JLJA 2QZPA 4ZCPA 1H1DA 5CB4F 3HBFA 3B6EA 4YRCA 3WLPA 1I3CA 4M1WA 5IAJA 1JHQA 4JJ6A 4QVGA 2BI4A 1L2TA 1S01A 2A88A 4RCYA 3REOA 3TRDA 1OTXA 3V1LA 5K0JA 4JUFA 1J8QA 3O9MA 3ISVA 1SBCA 4B71A 1OLXB 2DH5A 1W44A 2ACEA 1G6HA 4JSTA 3F67A 2RAVA 1JEYB 5IM4A 5CFZA 1H05A 5JCPA 4BFSA 1JIKA 4PC2A 2VJAA 1MXFA 3EF3A 3C4QA 5KREA 3WLAA 1FMLA 1GL7A 3FYUC 1W19A 3TF5A 2YHUA 3D4BA 3N7AA 3OFJA 4GRIA 4TKLA 3EXAA 2XRMA 4FCCA 4GL4A 1FIUA 1U0LA 3M6LA 2Q7DA 4FI3C 1LDNA 4KVFA 4H3VA 1RXWA 4EKNB 1DEAA 2IF0A 3RF7A 3T5BA 4HNQA 3BHNA 4DMHA 2QMYA 1G4UR 1WSWA 2R7LA 4OGGA 4LMBA 1PV4A 5GJWC 1NF8A 1VBKA 1VP3A 1Z15A 4AMBA 2DBZA 2VJDA 2I99A 1EH5A 4Z53A 1QG0A 3EY4A 3N2ZB 3H04A 3NHRA 4FFOA 3HP4A 4GR9A 4Q3KA 3OPYB 4TMZA 3SCZA 4C0JA 4ZI7F 5KKNB 3PT5A 2L42A 1ZGJA 5LQNA 1MQ9A 1D9XA 1RKVA 2IP4A 1FQWA 2A1TR 3IHKA 4EG5A 4YV7A 4PF1A 5LP1A 4JXKA 2JGLA 3T52A 4KNYA 2UAGA 1J1IA 4ZVVA 4IW3B 2PQ6A 1V6CA 2BLLA 2O2YA 1QAQA 3FHOA 2EX0A 1TK2A 3DVAB 4US1R 4YRTA 2JFNA 1CR2A 1JA9A 3LX8A 4FZVA 4YBRA 4A3SA 3VDNB 1DRVA 1JQBA 4QAJA 3MJRA 5FTLA 2OFPA 3AKYA 1XZCA 3DBHB 1UJMA 1OIXA 1PR1A 4MJLA 1MXHA 2XNDA 4U2BA 4KV9A 4A23A 4JEHA 1T1SA 5B7GA 4KWEA 1C81A 1J1ZA 1G8PA 4R05A 3ZWMA 4RL6A 2J7PD 3CZ5A 1YBVA 3HR4A 1F0NA 2Q2VA 2IEZA 4MW7A 1UKEA 1N2CB 1Q16A 5C8YA 3V48A 3OKPA 4BNHA 4URYR 2G7ZA 3BMOA 1JECA 2EGUA 4WFKA 5A7FA 1EXNA 2G63A 4LSZA 3V2IA 1GT6A 3WLQA 1D09A 1HTTA 2JH3A 2YOFA 2Z2IA 1FMJA 4R83A 1NW8A 4Q19A 3LSTA 3EF0A 2W11A 1B1AA 3LA8A 1YOBA 1QV6A 1QC5B 4AYXA 1H0HA 2IODA 3Q5EA 4K05A 1A4RA 1RXVA 1L3IA 3PQFA 3QQ5A 1E2BA 4NARA 1YK0A 3ZV6A 3V80A 2D0PB 2IELA 2RMKA 1GSHA 1R10A 3FCXA 3ZC3A 3BXFA 4M37A 2B8EA 1Z4IA 5DHAA 5FO0A 3NRBA 3RSGA 3WK9A 7AT1A 1M5RA 3HL4A 3IUEA 3REGA 2DYKA 4K9LA 4N0MA 3TLEA 3ZH9B 1Y0BA 3EPHA 1XVAA 1GSAA 4ZYZA 3U4GA 3CNEA 1TXGA 1LNSA 1U7ZA 1NSTA 1XZLA 5LYYA 3SYNA 4BLRA 3FTNA 5D85A 1HE1C 5IAOA 3CUKA 2VDQB 4LGMA 3MUEA 4F8EA 4R3WA 1S02A 3LWZA 2BSQA 4BQNA 4K7JA 4GPZA 2WHPA 2ID8A 4EBFA 3ZHRA 1CQIA 1W8IA 2UZ4A 2P7HA 1I9GA 3OHMA 1GEGA 5DM2A 5C51B 1U9IA 1ST3A 3ZLTA 3DXYA 4A0GA 4AUKA 4B7UA 4Y3UA 1H1LB 2ZWOA 3F9IA 3GHHA 4IEIA 4NJEB 1Z45A 3UG7A 2UV8A 1GFWA 4TGLA 3ZDAA 4A0QA 4JKYA 3A05A 1JG2A 5IBRA 3A9SA 1P4SA 5F12A 3VKHA 1JJBA 2O0MA 4L9AA 1UPBA 3EXEB 2GRUA 2O8CB 4GOOD 5JVDF 5DM60 3DL0A 2G40A 4MCJA 4E94A 4HBZA 4J0GA 2PX2A 1IBSA 1M1YB 1XJCA 1MG0A 1NOIA 3L8CA 1WXDA 4PNZA 1XO1A 2GD1O 4AY5A 5K6TA 3UEOA 5KWEA 5DP2A 5J4VA 1AQUA 1YZFA 2HMYB 1M8FA 3IODA 1EEXB 1RBQA 1WCIA 4HQ6A 2R5NA 2NAPA 2Z30A 4BAGA 1E69A 1FUIA 1XTUA 4DLTA 4MUXA 3N86A 5F9FA 2ZJFA 1Y63A 2ZT6A 2X2FA 1Z2OX 2AFIA 4AMYA 4C3VA 1X1SA 4YP7A 3ESYA 3TRIA 1B26A 3LPLA 5D7BA 3RRFA 4ZV9A 4H7FA 3Q4GA 3ZHXA 1DTWA 2ZTMA 3CONA 2YWBA 1UJ6A 3GR6A 2D6FA 4HB2A 1K8YB 4RA6A 1J2JA 2HTFA 1A8QA 3JQAA 3LCCA 2QTRA 2CNOA 3F6EX 1TKBA 4KC0A 5CIWA 5DTQA 3L7AA 4FEYA 3UMMA 3BMNB 4QT4A 2Z09A 3RODA 2XOKD 4GDFA 3ZE8A 4OO3A 1OASA 4HPXB 4ESOA 1HQDA 5TQ2A 4LF4B 3JQ6A 2AI2A 1NQAO 2OZKA 4H60A 1CY8A 4N7JA 4O2AB 1QO9A 1WX1A 4CODB 4OSOA 1L5GB 5E8JA 3I62A 2B7CA 2Z2YA 2A5GA 3H9CA 3NHAA 4QDJA 4LFBB 4B6EA 3NALA 1DELA 3ILHA 4ZOEA 3G2HA 3JYQA 1IE3A 1RKQA 4TLMB 4I0WB 3EVTA 4YCBA 5HFAA 1EMDA 1YIAA 3NKVA 3OKFA 1NQ5A 3B78A 5H7XA 3TFWA 2QVBA 3KSBC 4IIJF 4L5BA 3GGJA 1QFZA 5C4GB 5B57C 2F6RA 1OLXA 1KL7A 4EAAA 5K8TA 4D25A 2PHZA 4KVAA 3RREA 3WTCA 1K66A 2CHQA 3I1FA 2H59A 2W00A 3KKZA 2QUIA 4DHEA 3T3NA 1ZYUA 4U1RA 1HYEA 2X0NA 4XWTA 1E2DA 1J49A 5DRYA 1KERA 3E15A 4QLAA 4I4IA 4AP5A 5JV5A 1JXOA 5E0KB 4PCLA 4X1YB 3VR5D 4DF3A 5C37A 2ZKIA 3MIZA 2XA2A 4WZBB 1B0ZA 4O4HA 3CNNA 5DNWA 3FCSB 1NVXQ 2FQWA 4B4KA 2R7NA 4Q7JB 4YRJA 3WGJA 4JKIA 3S1AA 2CXRA 2CKDA 2J3EA 4U5XA 1F8XA 1N0UA 1AK1A 4EB8A 3DGFC 1DAKA 4GLOA 4ZVTA 2C9OA 4G07A 4EA9A 4ZGGA 1BS1A 3NWJA 2I9KA 5CCXA 2YWRA 5JRZA 1CF2O 4GBED 4L8GA 5DHTA 3IP9A 1GLNA 2EBFX 4LJ7A 3OQ1A 4Y9RA 3TB4A 3OPYA 1R37A 3COZA 1DTSA 3EJWA 4UJ5A 4KXMA 4AJEA 2UYGA 1GA4A 4MOWA 1FLAA 3CLRC 2LZ0A 1THMA 4FS3A 1NNLA 2A0FA 2GVNA 2WFAA 2Y1WA 4N3BA 4TRRA 4D3XA 4F5WA 3K05A 1L9KA 2AMJA 2B69A 4U39A 5DASA 4MXDA 3GUZA 3LCVB 3R3SA 4TZ0A 5K45A 4YA6A 3NHLA 3PZRA 3A6JA 4WAUA 521PA 3IP3A 7GPBA 5HS6A 2F67A 4JVMA 4QZVA 1BH6A 1P6XA 4TKUA 3ZZMA 4EFLA 5KVSA 2HWYA 1NAIA 4PS0A 1AKUA 1S7CA 3ZZ1A 5JCXA 1E7YA 3FZEA 3H6GA 4I1OA 2QAJA 4PZEA 4OK6A 5EMNA 3W5JA 3OO0A 4PBTA 5HF8A 2DECA 1JHVA 3ZW7A 4U6QA 4TYNA 3F6PA 5AQ1A 1VKHA 5BN4B 4DREA 2YICA 1DSSG 1G1AA 1BJTA 1I4TD 1YE8A 2B7LA 2VT2A 1HLPA 2VWQA 3DONA 3I30X 4PGFA 4UHCA 4N76A 4PYMA 1A5BB 3B1VA 3B1JA 4TZ6A 1TK9A 1X1TA 2PSSA 2PXHA 3K8OE 1S5PA 2I87A 1TU3A 7MDHA 1M6WA 1JU4A 5J3JA 4ZT3A 1RT9A 1FFBA 3JU3A 4K0RA 1VMKA 2NW6A 1GR0A 4IRUB 1O57A 3FWYA 3KG2A 1P2SA 1TUBB 3CBQA 1XA4A 5BUCA 5BYJA 2O6LA 3CG4A 5CNJA 5DX1A 1XI2A 1C7RA 2FXVA 3BXHA 4Y0AA 4C22A 2BM8A 2JGMA 3EAQA 4NCIA 5A02A 2ZWMA 4J1TC 3ZNQA 2FQQA 4KJXA 3SBEA 3P2YA 4WECA 4IVNA 1ZCZA 3AF5A 3AVPA 3RGWS 4FEGA 3T7RA 3V1UA 2C2OA 2OL4A 2PSDA 4ZAVA 1F6WA 1RJ9B 3V2HA 5B58C 4BPBA 3S2FA 2AG6A 3THSA 2YWGA 2QJFA 3ODGA 3B6ZA 2YJ4A 3QVGA 4FR0A 3A9CA 2ZRHA 4FC7A 2EL9A 1FU4A 1QHEA 1IY0A 4P35A 4XARA 4ASUA 4NSNA 1DIHA 1EWTA 1ORIA 2YV2A 4N0EA 3HFGA 4X8LA 4TLDA 4IIYA 1PCXA 3R40A 1P18A 1O87A 2NZUG 1Z88A 3OJEA 4PLVA 3RNOA 2FCRA 1Y6QA 3UHFA 3JYOA 3GB9A 3QBEA 2JHFA 3O1IC 2CEAA 2RC6A 3EXG1 2GESA 2V7XA 4HUQB 1Z6TA 2ZYUX 3N8IA 4IUBS 4LJ8A 3FM9A 2AXPA 4LOJA 5FFMA 1ORDA 3GLRA 5AHRA 1P4AA 4BU1A 2BSAA 3FGPA 5FQOA 3FOBA 3L8MA 4YUYA 3I45A 2Q21A 1ZC4A 5FA5A 2G0NA 4DJFC 4ZVMA 4EY8A 5JJBA 4TV8B 1UOOA 1M2VB 3LQ4A 1HNZB 3IMEA 4KO1S 1H4VB 3THOA 2RIRA 1CR0A 1CUGA 1OX4B 2EF0A 1DAIA 1IXRC 2Q41A 3ZHCA 1M1UA 1E66A 1H8HD 3GFOA 2JI9A 1XVTA 2ZSAA 1CX9B 2NX2A 4HMOA 1RP1A 3WGKA 3WLHA 4OX9B 3AR9A 2O54A 3BXEA 1R8QA 1SNYA 1IRIA 4MCAA 5JQGB 1QZUA 2C9DA 2PAAA 2QG6A 1BAPA 3NC0C 3QNUA 4G0QA 4R68A 3TUIC 4EJ6A 2BGMA 2NP6A 3FI9A 1SCBA 3FROA 1GTZA 1HL3A 1DE0A 3LL7A 4AZ0B 4MW9A 4B75A 3S2ZA 4R41A 2C4HA 1CYEA 4OJYA 5EZYB 3W1EA 1E2HA 1T36B 4J3JA 1EZ1A 1V37A 1Y8RA 3CTMA 3O9VA 3U4AA 3T1HB 1L6IA 1NF2A 4G4SO 1AGYA 3JD1A 2A1UB 4C5CA 5LZ4A 2XB2A 3WWYA 1WHTB 4UHBA 4ENRA 4KFCA 3C0KA 3QUQA 5A4FS 3R7BA 3A2MA 2E3JA 5CG2A 3WADA 3KPVA 3C6ZA 1LF0A 2UUOA 1CEYA 5TE9A 4MIKA 2DWOA 4LTMA 1E7SA 1T1EA 1WMSA 1ETUA 2EWWA 2WVJA 3CH5A 4C0QC 5E4FA 3GPLA 4I3GA 2HU8A 3VHXA 3ZW8A 1B93A 2MSEB 2C4NA 2YV3A 2JRLA 1H93A 1YMUA 3QVMA 4LBYA 4MUMA 3WGZA 4BFTA 3VJRA 3DO5A 3NBMA 2WR8A 1MDBA 1Y7LA 1LTQA 4F85A 2FJPA 1V3VA 2RGGA 4BMXA 4I9HA 4BNDA 5BOSB 1OILA 5JO9A 1EVIA 5FBZA 3B6IA 3Q6MA 2JJQA 1QG6A 1V8ZA 1NRWA 2ZAMA 1VI5A 2O2SA 2DFDA 2Z3WA 1YL6A 2FETA 4TLEA 3WIOA 3OLQA 2BFDB 2VDOB 2FOXA 3H11B 3I5MA 1GZDA 1PUJA 3K30A 3NTVA 3O4JA 1RPNA 3GLTA 3QXSA 4FGUA 4E5MA 4EUHA 1MTOA 5KX5A 2EZ8A 3ZD7A 4KR7A 4UTVA 2O0JA 2E1PA 2QQFA 2QTTA 1Q1EA 3UTCA 3MTJA 2O4CA 2ILTA 2MYUA 2NYUA 4C7MA 2WF7A 3HYCA 4JBGA 3WOVA 5LIPA 4OMFG 2RHGB 1C9MA 1ZK0A 4G5QA 5DYIA 4OY3A 4JI5B 1YSCA 4LA4A 3R0JA 3JW8A 4M54A 1C1XA 3A1UA 3CZCA 4NBWA 2XUDA 1KK3A 7ADHA 1UXHA 1T0JB 1EUCA 2AG0A 2QG4A 3KD2A 3P9IA 2VEDA 3B5EA 3QWHA 5AOCA 4A2CA 2HPVA 4EL0A 3HMQA 4PSKA 4HX2A 1ZO8A 5J5VA 1EXDA 4AKIA 1P5HA 2PZLA 3L04A 3CJRA 1QGED 3OY2A 4W5JA 2A9QA 1XEAA 3EZ6A 5JSHA 1KJZA 2I4OA 2MU1A 4RJLA 2DPGA 2LUOA 1OCEA 1UUFA 3WYCA 3I4FA 2WTUA 1ORVA 1BWPA 1KJ8A 1XCMA 4M0FA 1HRDA 1M1NA 3RS7A 1E6CA 3ZVRA 4N3NA 1JT9A 1QFYA 5TIIA 4Z4HA 1U4OA 4YEDA 4C43A 5L3SB 3AI1A 3CKKA 3JARB 2PXXA 4IEFB 3QP9A 5JDIC 3RARA 4P98A 4BWGA 4X41A 3L7CA 5BO5A 3ZUPA 4B43A 1ZVVA 6ADHA 1E9VA 1ESNA 4LVOA 2OZEA 3LDAA 3OQ6A 4KAJA 2M1XA 4WNAB 1U0EA 1QIDA 4RH0A 4FWBA 2PZFA 5FOWA 2A5JA 2CV0A 1H2WA 3G17A 5EHIA 2RD2A 3TJRA 3PX2A 5H1YA 2C42A 2KW5A 3B1XA 1RI4A 3AVVA 2V6BA 3KJGA 1E4EB 4EJMA 3AF6A 1J42A 3I8XA 3O4HA 1FNNA 1VI6A 1BMDA 5HYVA 3R7AA 3VMFA 5ESXA 4QWMA 2F9LA 5IVHA 2ZJZA 2WIFA 2A9RA 2I22A 3CF4A 4U2FA 1XN4A 1YHZA 2BW0A 2J85A 3GLUA 3C87A 2CFRA 1UCFA 2HB6A 4TUYF 2C2ZA 3DF9A 3KNZA 1Q7CA 1R5NA 3ONDA 2KJQA 3PGMA 4FJ1A 4MKRA 5BSVA 5ADVA 4W63A 2HA4A 4OU4A 4UW9A 3F2IA 2KE5A 2PNJA 3N2IA 1ZICA 2WAYA 1UH5A 2K4MA 1WZ2A 3PPIA 2DBRA 4TKUB 4L08A 1GGEA 2HZ7A 2Q3BA 4L8VA 2YCLA 2EKDA 3CS3A 5DGIA 4AP6A 4F93B 4X94A 1K27A 2XDAA 1MG5A 2YN4A 3WWPA 2ZSEA 3K6JA 2QTCA 4LPSA 4B6RA 5K5EA 2P1DA 1MOZA 5IVDA 1E94E 2GFIA 1SXGA 2NSHA 4BP1A 2IZZA 3OFSA 2NXNA 3ZKWB 2ZE5A 5DNYB 1IQ0A 1CJTC 5BN3B 3KK0A 4OXRA 1OAOC 4Z3DA 2CYAA 4OU5A 3Q7TA 3RVBA 3PXCX 4PE5B 4JI2B 2Q0XA 1FMCA 5EJFA 2PG3A 2Q6VA 2P0YA 2QTFA 4J4BA 4TT3A 1Z4JA 1WNFA 2AR0A 4N0DA 4UMEA 3TDNA 3WDKA 4ARZA 4EVQA 1VLVA 2AOUB 3SQMA 3OCWA 3W4IA 1PEDA 2G0TA 3EIFA 4AKTA 4MRMB 5FNVB 1QJCA 5KIAA 3DVQX 3CZ9A 2PQ2A 1P2DA 5TVGA 3QEKA 2AJDA 5KSZA 4U00A 3GUVA 1G42A 3G89A 1E3QA 1CEXA 1X7ZA 2QM3A 4IUYA 3ZDFA 8OHMA 1DINA 3A28A 4PYIA 3M6UA 3GFTA 4M1MA 2OYRA 1JDBB 2WJYA 1WVIA 2DG2A 4ZI7B 4NMMA 2FRDC 4I6JA 4NEHB 5TMDA 3MQ2A 1E1CB 1ZUD1 3HXQA 2JCXA 5K0LA 4R8RA 3O2NA 5F7ZA 3ZDDA 4NEQA 3ZV7A 2BJVA 2V7UA 1EA5A 1UPFA 1C4KA 2EGHA 3DB1A 4CMHA 3CUYA 1NONA 1IBLB 3BZWA 1SUWA 3QTTA 4W8HA 1KMHA 3O75A 4U8HA 4JB2A 1HDOA 3S44A 3W78A 4RK7A 1W93A 5HSGA 1CULC 5LNK1 4L76A 2WZBA 3B3QA 1PW7A 4LF7B 1E2MA 4M89A 1CY7A 3FPAA 4GM0A 3ZS8A 5CDHA 5F4ZA 1JIJA 1E3DA 5BW5A 2P4EA 3MJTA 4ZOQI 4JVLA 1PJ3A 4GVXA 3GJZA 3ZLJA 2JI8A 1R4MA 2RGYA 3EDOA 3NJ4A 3UWMA 3WFJA 2I55A 2XB9A 5I4KA 1SQ0A 1TZJA 2GAFA 2ODWA 4JCOA 13PKA 1L7OA 1OX5A 4PGMA 1W2WB 2CK3A 4UUQA 1ZW1A 2H1HA 1GCOA 1CJVC 1MFPA 2H1FA 1EGHA 2VP9A 2ZTSA 3FTQA 4WKBA 4CU5A 5CBPB 2ROQA 4QAQA 3D54D 4JVNA 4ZALA 3AIIA 4HH1A 1RLOA 3NNSA 1RHQA 2JJ1A 4DXAA 1T9GR 3ZY5A 5CDFE 1J39A 1UXGA 2WNSA 4DILA 4OI1A 5HGJA 1ZUNA 4BVJA 3P0RA 2QVXX 1XNGA 1P7CA 2OG1A 2PJUA 3ACCA 4EHKA 1HLGA 2CE7A 4JT2A 5GIPE 3QXJA 1HETA 3PRJA 4E46A 1R9GA 4JJ4A 1ML4A 1CBUA 1E1RA 2IV7A 3O95A 1YB4A 1YB1A 4DLYA 2I2WA 1T4CA 1F2UB 3JAKB 4HCJA 3ZHYA 4DDVA 3D8NA 3S81A 4YCNA 1FJHA 5TGDA 2I1WA 2P6MA 2YZGA 4ZOLF 4B81A 3L7IA 3X3HA 4R0MA 1HX7A 1AUPA 4MUEA 3VC7A 3UJAA 4C7JA 4DRXA 1GKYA 3ELUA 3INRA 5KVCA 1DJPA 2IXAA 3EZFA 3JTMA 3MWEA 4MGEA 4RL4A 3EYWA 4R1MA 3REQB 1OPXA 1RJEA 2QIOA 4TLCA 3K0SA 2E89A 1HZJA 4DLVA 4PR0A 3HACA 2H9YA 3R3VA 4XQEA 2M6SA 2O23A 1HOXA 5BXYA 4YGXB 4IDFA 3S68A 1BWSA 2GAOA 2QIPA 3H5LA 1D0IA 1M83A 1P4GA 2R86A 1EU1A 4KW7A 1AA9A 1YBFA 5KMGA 4EG0A 1R9JA 4FPXA 1J20A 4MI1A 4KXYA 4XVQA 4KQEA 4A8HA 5HW0A 3WL3A 2V03A 5CAEB 2WP8J 3GPCA 5CLIA 3CO0S 5JAHA 5EJ8A 1LRLA 4BMOB 2GCGA 3V2UA 3C3JA 5LZ2A 4WRRA 5KSWB 1JSLA 1TAQA 1YNSA 2VSXA 4QDKA 3NIWA 4I08A 4UASA 1WL8A 5CUQA 4XFKA 5BWMA 3JZMA 5BSKA 3BH6A 4FCTA 2QV0A 1JDZA 1RLTA 4OLAA 4JH0A 2X76A 4Q05A 4OHZA 3G2OA 3NBAA 3PC6A 3DR3A 4ICIA 2VYNA 3U40A 2HGZA 3QVTA 1UEJA 3U48A 3BTUA 1R0SA 1GL9B 3WSTA 2Q50A 2Q1SA 3T8YA 4P2BA 4UUOA 3RVJA 5KQLA 4L5YA 1O96B 1SOWA 4OFBA 4BU0A 5J63A 4FU0A 5BRJA 2BM0A 5JMTA 4OXIA 2E4AA 3W77A 4LECA 1XAJA 3NUZA 1ODCA 5B7QA 1ZAYA 3BJEA 1M6VA 1WA5A 3NM5A 3H8JA 1LPSA 1W2GA 3N59A 2ERXA 4AF8A 4RD1A 1UXOA 2ST1A 4QUDA 2ATIA 2ZTVA 4Y1GA 1A9XA 4X7MA 4C6RA 3T06B 1TJ4A 2QM8A 3QI2A 1H65A 4YECA 3KOXA 3USES 4LXIA 2DPMA 5F9HA 3QU9A 3HLYA 4I1UA 3TSWA 3WL8A 2FDCA 3H99A 5I7WA 1N6IA 1MAAA 1TT7A 3UO8B 5DHUA 5CT9A 1P2FA 2WTEA 1P2TA 1PTJA