3WJAA

The crystal structure of human cytosolic nadp(+)-dependent malic enzyme in apo form
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
562
structure length
562
Chain Sequence
RRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-dependent malic enzyme
publication title Structural characteristics of the nonallosteric human cytosolic malic enzyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 198
structure length 562
sequence length 562
chains with identical sequence B
ec nomenclature ec 1.1.1.40: Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)).
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wjaA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 3wjaA01
3ITDA 3A06A 4NK5A 4BS9A 2Q99A 4GVXA 1H9AA 5HRUA 3JD1A 3LT2A 1ARZA 1RKXA 1TA4A 5FYDA 5B1YA 1QP8A 3W8FA 3KBOA 1P1RA 4MVJD 5IN5A 1ML3A 2X0IA 3OJEA 3W8EA 5F1PA 2GRAA 2HK7A 4M86A 3STHA 1DIBA 4TRMA 1PJQA 4KDEA 4AJIA 5I8WA 4O1MA 3QWFA 1KY4A 3JYPA 3WGIA 3CMMA 1E1KA 4YDRA 5CDYA 2HK9A 3F4BA 2VHVA 4GX2A 1N5DA 4J9VA 2CDAA 1GAEO 1ZKMA 5JYDA 3DZHA 4QTZA 3GAZA 3WFJA 4CM4B 3I5MA 2NLOA 4DWVA 4ZHSA 1C1DB 5KVQA 2J8ZA 1F06A 3AY6A 4CM3A 3FI9A 4NZ9A 1I33A 2OOSA 3AUSA 5DBFA 4MO2A 4CQMB 4A73A 4QT0A 5G4KA 5KVCA 2A35A 3FF4A 3SX2A 4IZHA 4CV2A 4J49A 1UDBA 2C7VA 3HDQA 4WOJA 3QWIA 4NR0A 4PG6A 2C2YA 3FTNA 2FR1A 3E5MA 4F6LA 5CDUA 1BDMA 3GMSA 1I2ZA 1H93A 4CQLA 4DTIA 4XQGA 5C5IA 2EHDA 1L7DA 3R3JA 3TZCA 3KZVA 1CF2O 2Y67A 3MJCA 5ADHA 1XCBA 3AY3A 3HN2A 3DZIA 4DQUA 4H7PA 3MWEB 4DXHA 4EJ6A 1E1LA 1PQWA 5ITWA 5JAQA 1T24A 2PV7A 4ZVVA 1D1SA 1FK8A 2NWQA 4L75A 3JYNA 3QVXA 4CUJA 1U3WA 2DFDA 1W6UA 3SC4A 1HT0A 5JMWA 1DAOA 1EUCA 2POQX 3PRJA 4NBWA 1PWZA 2HMTA 4Z9FA 2BGKA 1E7WA 4W7HA 3DZFA 4LVUA 2B4TO 4G65A 1QYXA 3AOGA 4PLYA 4CMJA 1U5AA 2P9CA 3WSWA 3C3XA 2HUNA 3FRJA 3JQBA 1J0XO 2FPPA 3ZNQA 4PLFA 3E03A 1ADGA 3VHRA 4O63O 1ZEMA 1ULSA 3UHAA 3OJLA 3Q2IA 4BQPA 3PJGA 5BNFA 4BO8A 3VDQA 1D1TA 1OI7A 1PR3A 3L4SO 3WYBA 3G49A 2YV1A 3WOHA 3IKTA 4OH1A 5F21A 1MG5A 1JU9A 2VYND 4UUOA 1J5PA 4MVJE 5L7WA 3WR5A 2X4GA 3GZNA 3JQ9C 2VHYA 5JBIA 2W4QA 1FXSA 2FR8A 1DHRA 3HG7A 4DA9A 4MIOA 3I9LA 4JP2A 1FDSA 3JSAA 4S1VA 1F8FA 3UKOA 2QRLA 3EW7A 4FOSA 1Q0QA 5JAMA 4BKOA 4CM9A 1F14A 1BW9B 1IYZA 3LYLA 4YRAA 4X54A 5IFLA 3ZV5A 2AQ8A 4CMIA 4LRSB 4ZU3A 2C07A 3GLQA 3JYQA 2VRBA 1KEUA 4UVDA 3RU7A 2OO5A 3S1LA 2DPGA 4BO4A 4IM7A 1LQUA 5A03A 2XXJA 2VT2A 3GR6A 1OZAA 4BNXA 4D45A 5JDIA 2JD2A 5GZ1A 1GZ4A 4PVDA 2VHWA 4B8ZA 5EINA 3EC7A 3MJEA 3PK0A 4DL9A 1NNUA 4D44A 2QRJA 5DNAA 4E0BA 2Q50A 4XB2A 3BYZA 3VH3A 1KERA 3ZNNA 1PSDA 1JW9B 1MP0A 3JQGA 3L4BA 3BTSA 4KUGA 5ILOA 4TVOA 2AE1A 2DUUA 1OOEA 3AFNA 3CIFA 3RUHA 3E82A 3DFZA 1F0YA 2VZ0A 4O5OA 3WSVA 5F1OA 2OORA 2I99A 2HK8A 1FJHA 5F1KA 1PJCA 4ALMA 3E18A 3IP1A 4GI2A 4LMPA 2BFAA 1YH3A 4Q3CA 3AFMA 4XGIA 3ROQA 2NACA 2JKVA 2Q2QA 3N74A 5A9TA 4C7KA 4CUZA 4YYZA 4E33A 1ISFA 4E2WA 1WMAA 3VZRA 2W90A 2BMAA 2HMWA 2PKQO 2QQ5A 4NBRA 4LGVA 4QFCA 5AVOA 4GWKA 3UUWA 4WKGA 1T2DA 1XU7A 1SB8A 4YBZA 1ID1A 1O94A 2ZYAA 4CM1A 1ENOA 1P1JA 5IZCC 4TMFA 1KEVA 1IY8A 3O03A 1UP7A 1U8FO 1YL5A 1QMGA 1UR5A 3LLVA 4IJUA 4Z0PA 3EVTA 3SJ7A 2X5OA 1YO6A 4XKJA 3NAQA 4JNKA 3UF0A 1UP4A 3WGQA 1ZXLA 4NFSA 1O8CA 1I32A 4FJ1A 3WTCA 3N7UA 2GDZA 4DPLA 1UXHA 4BNLA 4Q3EA 1HEUA 3Q2KA 2X22A 3V2GA 4AJ4A 4WPGA 2WYUA 4R54A 4Q9NA 4K28A 3VZQA 1WNTA 2B69A 1YBAA 2Y0EA 1PX0A 3INGA 4PG4A 3DO5A 4PLTA 2TMDA 3E48A 1GYPA 1XHLA 1LBEA 2X0JA 4KMSA 3KRTA 3G1TA 5EIOA 4MDHA 4K6FA 4J2HA 3GGOA 1KY5A 1X15A 4BMNA 2Q3EA 3UXYA 4N7RA 3L9XA 4KUHA 1YGYA 4Y98A 4LISA 4R1SA 3ZI0A 3TFOA 4CV1A 3GA0A 4CR7A 3PI7A 4L9RA 1YS4A 4TKMA 5A9SA 4W4TA 1SZJG 1S6YA 4JIGA 1ENZA 5KCZA 5JDCC 4TZKA 3DZKA 2I9PA 3WGHA 4LVCA 1DXYA 1SMKA 3OQ6A 5BSGA 4GLOA 2Y0DA 1LU9A 2ZKLA 3VOSA 4M87A 3DHEA 4LW8A 1PZFA 4PLCA 2UUPA 4HY3A 1JKFA 2X0NA 4ZD6A 4J90A 4FGWA 5BSFA 5B4UA 5LDHA 1WMBA 3DL2A 1Q2XA 1NAIA 2EV9A 4OHUA 3CEAA 1NHWA 1U7TA 4J7UA 1MXFA 2EKQA 3WGZA 4IIVA 2HJRA 3UN1A 5H82A 1HETA 3ZWBA 1A71A 2YDXA 3NT4A 1R0SA 3MEQA 3PHGA 4NPCA 2UV8A 4RF2A 3UH1A 2X9VA 2AG5A 3ZU5A 3H9UA 3U0BA 3AUTA 3KUXA 5DZSA 4J7CA 1LLDA 5DBGA 5CEEA 1U2DA 4QUKA 4CLRB 3WFIA 4QO7A 4DC1A 2V6BA 3C1OA 1GQ2A 3JQAB 3KYBA 4EDFA 4ZQFA 3EUWA 2CFCA 2H9IA 2VYVD 4J0FA 1JTVA 1WAMA 3GVPA 3W4KA 3FNHA 4XIJA 3WJ7A 3HADA 1MFPA 2VHZA 4B3IA 4YT4A 5IJZA 1ZK0A 4R68A 2AEJA 3TOZA 2PGJA 2X1HA 1AN9A 2NM0A 3D5TA 5A5EA 3M1LA 1R16A 3QWAA 3WMWA 3H2ZA 3A4VA 3JQ9A 2CDCA 2WE7A 4RVSA 1B14A 1HE2A 1VPDA 4NBVA 1OBFO 2RHCA 2PZJA 4ND3A 2G82A 5JE8A 2NU9A 2C0CA 3UCEA 4BO5A 2YUTA 3GN1A 4G81A 3DMTC 4MP6A 3VVBA 3LF2A 3AM5A 1LDYA 4ZQGA 3DBRB 5LC1A 5BR7A 4RDIA 3B1KA 4D3DA 1B3BA 1JKIA 1BXKA 1B8VA 1YVEI 2Q1TA 3GVXA 4M49A 4IIUA 5HBRA 4U8GA 4OYRA 1G1AA 3WG9A 1EVYA 1HSOA 4AL4A 5G2OA 2DBQA 4INAA 1MXHA 2GYYA 2QW8A 2XOXA 2VZ9A 5IXYA 5KJ1A 5B12A 3KYDB 2AMFA 4DPMA 3ASVA 4BKQA 2CZCA 2H1SA 4FB5A 1EUDA 1KEPA 3KYCB 4BNGA 5JC1A 3ZHZA 3OJFA 5LDGA 1RYEA 5G4LA 4U7WA 4PLHA 3NRCA 5TF4A 5I7SA 2O3RA 4GX0A 3KTDA 5JCXA 3E9QA 3ENNA 4Z6KA 4ESOA 4GLLA 4DIOA 4FCCA 1DDOA 4B8WA 4Z9XA 4YRBA 2WEKA 3JQ7B 3ZV6A 2BHLA 3D64A 4YXFA 4KTTE 3X2EA 1CWUA 3WMXA 3QSGA 3LT4A 1Y9AA 3OEYA 2Y99A 4HADA 3TL2A 1M67A 3RCBA 4AJEA 1HSZA 5L4NA 1C0LA 2DBVO 5C37A 2GASA 4CM8B 2WMDA 3S8MA 2ZTLA 4EUHA 1GV0A 1OAAA 3U4DA 2W2LA 3DOOA 2VWGA 4KQXA 3OIDA 4ZJUA 2Q1SA 3DMYA 3GVIA 1TXGA 3PWKA 1SOVA 3SC6A 3O26A 4WOKA 1HDCA 2DVMA 4TSKA 1JDJA 5TNXA 2ZB3A 3NJ8A 4OQYA 3G17A 4UUPA 4IINA 1LC3A 3FWZA 3K6JA 5GZ6A 4CM4A 1A9YA 1S7CA 2YHUA 1BXZA 1C1DA 3PTZA 4OMUA 3H8VA 4B3JA 5IZCA 3Q11A 4W99A 3PJDA 4CQMA 1YDEA 4E6PA 3TN7A 1SOWA 4UVIA 1SPXA 5IDXA 4U6QA 3EGOA 3DTYA 4IGFA 3TDKA 1H6AA 5EESA 2J6IA 2Y1FA 4RF5A 2X23A 4PVCA 2X8LA 2EF1A 5DDIP 2FZWA 1VL0A 5CDGA 1A5ZA 3PZBA 3TNLA 2GPTA 3ZV4A 1J49A 2JD1A 3OQBA 4WUVA 5AXBA 2AXQA 3Q6IA 3L6DA 1HE3A 2GGSA 1K89A 4BGEA 4CJXA 1EBUA 2O3TA 3ZHXA 3O8QB 1Q0HA 2DLDA 5TRTA 4JROA 3NDJA 4RDHA 4XWYA 1LQTA 5IN4A 4ONEA 5A04A 3NT2A 4I8XA 5ER9A 4FD3A 5K0ZA 2Z1MA 3AUAA 3EY4A 4NFHA 1LEHA 2FWMX 3ORFA 4FR5A 2PZMA 1ZJYA 3V1UA 1XLTA 3PPIA 4XRRA 1OC4A 4RPJA 4DPKA 3NDRA 4TVBA 1QYWA 4XYMA 4YJHB 3S2FA 5JDCA 1BDBA 3JQFC 3OSUA 2FMUA 2V6MA 4ITUA 5I9NA 1I3LA 2A4KA 3GEGA 5T5QA 1Y5RA 2YDYA 4YCAA 2D1YA 5G0UA 3OM9A 2W2KB 4JLWA 5ILGA 3ENKA 1CIVA 4CMHA 3RU9A 1E7QA 4DIBA 5K9ZA 3DR3A 3F4LA 4NG5A 1LC0A 2ZQYA 3PZRA 1H6CA 4NDNE 4RVHA 1YQXA 1Z73A 1ZIDA 3JQCA 3KM0A 5MDHA 1MG0A 5JY1A 2B5WA 4PLWA 3WWYA 1B8UA 2RH4A 4RORA 3WNQA 2E4AA 1ENPA 4B7UA 4NIMA 3TFQA 3ROKA 1Q7CA 4GKBA 1Y81A 2ZB8A 1HXHA 2AG8A 2DTXA 2VUUA 3KEOA 4HX5A 4YQYA 5I7FA 2OFPA 3QHAA 4N5LA 1ZO8A 1BW9A 3DZGA 4ALLA 1HZJA 4HNHA 3RJ5A 5ICSA 2CVZA 3PWSA 1M76A 4KQWA 3V2UA 3BA1A 1CDOA 1N7HA 4UUNA 1HE4A 4I9NA 1VRWA 4BMSA 5CFZA 1TLTA 6LDHA 1R4NB 1E0DA 4BO0A 4LSMA 2UDPA 6ADHA 1GQYA 3W4IA 2RAFA 1EUZA 4UUMA 3M2PA 1DC5A 2OMEA 1KIFA 1P33A 1VI2A 4L74A 3LT1A 4YR9A 4MKZA 4ALKA 4NU5A 3ABIA 1P1IA 4DC0A 1K3TA 3S2IA 2OUIA 2IYOA 1QYCA 1G0NA 4ALJA 4BNNA 3DONA 4BV9A 1DRWA 3D1LA 2J3IA 3GFBA 3QV1A 3PGXA 4PRLA 3WYEA 1VSUA 4QSMA 1UAYA 4U6SA 4EI2A 1C0PA 1E3EA 4OSPA 4CLHA 4DMMA 3OJ0A 1WP4A 4R41A 1D4FA 4BUCA 5C7IO 2UAGA 5T6BA 1YJQA 5J23A 3RSHA 3GHYA 1UXGA 3PFWO 4BKRA 3L6EA 1H94A 1X7HA 1GD1O 2JD0A 1PEDA 3K2BA 3BMNB 5FI5A 3W8DA 2OXIA 2BFPA 5C7LO 4Q39A 1HLDA 3QVWA 3PGJA 1PJLA 2Y0CA 4ZN6A 1ZK1A 1O89A 1YOVB 4Z0TA 4JGBA 1YQGA 3VTZA 3ZWMA 5CAEA 4IMPA 3WQQA 1MV8A 1TB4A 2B4QA 4J3FA 5KWEA 3NUGA 4XIYA 5DP2A 1JQBA 1YB5A 1XG5A 5A9RA 4R69A 2OZPA 1GPDG 4TRJA 4YEDA 1X7DA 1B16A 3GPIA 4FBGA 4P38A 4WEOA 4C7JA 1WVGA 4HWKA 2JAHA 5F5LA 4GSKA 1NVMB 2BKAA 1YQDA 4BNFA 3BHIA 1ONNA 4L73A 3PJEA 4MVJF 1EFKA 4YJFA 2EJVA 1MC4A 2VOJA 2VUSA 3CINA 1YWGO 1BTOA 3BTOA 2JHFA 2AW5A 1E6EA 2VUTA 3DAGA 5AQ1A 3Q3CA 3OEWA 2H63A 3TRIA 4Z3DA 2ZTVA 4J1NA 4E5NA 4EEXA 3H65A 1A7AA 3JD4A 4UEKA 1T2AA 7MDHA 4YT8A 1PL8A 1GU7A 3T4EA 1Y8QB 2HMVA 5IXSA 3PLNA 1KC3A 1LSOA 1RM5A 1BRMA 3W6ZA 2EW8A 1E7MA 1NYTA 3CSDA 2PFGA 3I4CA 3JYLA 3ZHYA 3U5TA 5JPIA 1K6JA 3WDSA 2YV3A 3WQSB 3VPGA 3OIGA 4WLOA 4TRRA 1NASA 5ENVA 3TZQA 4BO7A 2V6FA 3QVSA 3CH6A 3RC9A 3LT0A 1LJ8A 1DC3A 1BVUA 2O50A 2WD8A 2C5AA 3K9QO 1WWKA 2PD4A 4HP8A 3RUEA 1NWCA 2JJYA 1Z6ZA 3FPCA 1ISIA 2C54A 1ONOA 1VL6A 1ZH8A 4CM7A 1V3UA 2D5CA 2JFHA 3RC7A 4WJZA 4L4XA 1DFHA 2D2IA 3KSUA 1QV7A 5AOVA 3FSRA 5BT9A 4YAEA 3DOCA 4BNMA 4WLEA 1E7YA 1C0IA 4ND4A 1UXIA 3BTUA 4HKTA 5EERA 1QYVA 2IYPA 1H6DA 3OP4A 1Z74A 5JW6A 3I6IA 4A26A 3PEFA 2W2LD 4KWIA 3U4CA 1KVUA 1VJ1A 2BI7A 2EGGA 5CDTA 2WJPA 4I5FA 2OL4A 3EHEA 1NPYA 3JQAA 2D4AA 2Y1EA 3PHIA 4OL9A 4PZCA 5JAZA 2O23A 3RFTA 1DFIA 3SLGA 2CF5A 3NGLA 4BOYA 4BNWA 1ZK3A 3S2EA 4E5MA 3E9NA 1AHIA 3JQFA 3MTGA 4BHTA 3TZ6A 1E7SA 1E3IA 3DFUA 3F5SA 3TQHA 4ILKA 4D0SA 1ADCA 3F1KA 3N58A 4UEOA 3E8XA 4BGVA 2VZ8A 1I8TA 4CQMD 4A03A 2GSDA 3VVCA 1I3MA 4NQZA 5BNTA 3CZRA 5K6AA 2VHXA 1KYQA 1H5QA 3ZWNA 3AWDA 3ONFA 4FFRA 4EUEA 1H2HA 1N7GA 1TI7A 2FPIA 2GN8A 1VLLA 1MFZA 2ZYGA 3R1IA 3I3OA 2X7HA 2PNFA 3AI2A 4KDFA 3WGTA 3WXBA 1GADO 3ROPA 4QO8A 3DBRA 1ZVMA 3PVZA 1U28A 4GX1A 2Z95A 4ZQHA 3K31A 4I9UA 4GAEA 5ES3A 5HA5A 3I9NA 3FCOA 2FZEA 4E3ZA 1NPTO 2O2YA 1U9JA 5L9AA 2HRBA 2RBEA 2NV6A 1DRVA 1EDZA 1XA0A 3OA2A 1E1NA 2XXBA 2O3SA 1GUZA 5MGBA 3KYDA 2R00C 5H81A 5A4DA 1DBVO 3B1FA 5TT0A 4DGSA 3KYCA 1DB3A 5FI3A 4ZRNA 3RFVA 4YJDA 4MVJH 3WGGA 1K6XA 1X0VA 3Q9NA 2QZ9A 4GBJA 4E30A 1R6DA 4MIYA 1I5RA 3H5AA 5IDQA 3JQ7A 1LDGA 3V1TC 3EZLA 3GHHA 3RUCA 1ZK4A 3BHJA 2D3TA 4XD2A 1SAYA 4OM8A 4P4GA 1I10A 1NQTA 4RJTA 1R4MA 3H9GA 1P31A 2VOEA 2VCYA 4RVDA 3E9MA 3PDJA 1PJSA 3MJ4A 2JFFA 3ZWAA 2AHRA 2WD7B 3MJVA 3CXRA 4LN1A 1KC1A 3PDUA 4CMCA 2A9FA 1EK5A 3LK7A 3M1AA 3VPSA 1F12A 3B70A 4IDCA 4EGFA 3JQ8B 3M2TA 2Y93A 1PZEA 2YQ4A 3IAHA 5LCXA 3VPXA 2RIRA 5G0SA 3ASUA 4B79A 3T4XA 1NM5A 3KETA 1PL7A 2C20A 1WZEA 5JAIA 3DBHB 4QQRA 4NMHA 4BQRA 1T1SA 3Q0EA 3VPHA 4OO3A 3IOYA 3V8BA 4C4OA 1Y1PA 2F1KA 2VTDA 4XX0A 2H5LA 2BRUA 3O38A 4E21A 1ZUD1 4BMVA 1A27A 1LDBA 3T7EA 4JCOA 5FEUA 4CM6A 3F6YA 1P1FA 4II3A 3P19A 2BFOA 4PLGA 2YYYA 4YPOA 2AQHA 2Q4EA 1MC5A 1GCUA 2LDBA 3AY7A 3NTRA 1L7EA 4WCFC 2LDXA 2RCYA 3H9JA 1FDVA 3IUPA 1YBVA 1Y9EA 5C7OO 4NBTA 1NR1A 3E1KA 4JK3A 4CMKA 4YAIA 1I30A 3TWOA 3HJAA 1XIVA 3O8QA 3UCXA 1KVQA 3GC6A 4PFJA 4BGUA 3GY0A 1KVTA 3DBLB 3QRWA 2NNLD 3WQRA 3K96A 3UGKA 5HTOA 2YW9A 4KP7A 4WEQA 4IDDA 4HFRA 4AJPA 4OXKA 4PG7A 4HFMA 2Q49A 3WNVA 5IG2A 4AJJA 1J6UA 1BVRA 4XDZA 4YJHA 3ON5A 1HE5A 1Y8RB 2IODA 3G3EA 1VJ0A 1WXDA 4CLDA 3B20A 4J2OA 2O4CA 4DVJA 3VAZA 4BL5A 1N8KA 2Y1DA 3G79A 3MJTA 4GWGA 2DU8A 4IBOA 1PQUA 3TF5A 3M6IA 1A4IA 4II2A 5TJ9A 4GGPA 1M6WA 2GF2A 3PFFA 1KETA 1EDOA 1LLQA 4R3NA 4RZHA 3GQVA 3JCZA 1SEPA 5THQA 1LDEA 1XYGA 1DFGA 1X14A 4RLSA 4OXYA 2ZJ1A 1A9ZA 1O95A 4BB5A 1PGQA 2D59A 4D46A 1LLCA 5G0VA 4Z3KA 3X2FA 1FDUA 2EKLA 2HMUA 2JAPA 4P22A 2C29D 4CMEC 1UJMA 2NVUB 5ENDA 2B37A 1ZBQA 1Y6JA 3A28A 3PQFA 4L8VA 2EP7A 1PGPA 2X86A 2HCTA 4CQLB 5KJCA 3BHMA 4L4RA 1R4NA 2WTBA 4QXMA 5JCJA 1ULUA 1XR3A 3I83A 4AVYA 5BSHA 4IQ0A 3WTBA 1ZSVA 2C2XA 4RZIA 1NWHA 2UVDA 1SCUA 3GDGA 3I9JA 4BNHA 2ET6A 4F46A 1DC4A 1YXMA 3C1TA 4BNIA 3OICA 4FC6A 3HDJA 2Y05A 4D0RA 3B6ZA 3ZCXA 5KTKA 3GNSA 1GEEA 2Q1UA 2EJWA 3GF4A 4OKNA 1YJ8A 4J0EA 1E3JA 4HXYA 3GGGA 1R37A 1UXJA 2BD0A 4OKIA 4XJSA 5KJ6A 1EZ4A 2E49A 4WNIA 4IS2A 3UFXA 1ZFNA 3DB2A 4Q3AA 5TSDA 1RM3A 2DFVA 2PD6A 4FFOA 1Y7TA 4UULA 4XZ3A 1VC2A 2VWHA 4NHEA 3L9WA 1YL7A 3H3JA 4IDBA 3F3SA 1QR6A 3BMNA 4OSOA 3MOGA 4PG8A 1MA0A 4YAGA 1WPQA 3VC7A 3BMOB 2DBRA 4YAKA 3U09A 1N2SA 3CE6A 4NNJA 1YOVA 3C7AA 4Z9YA 1X13A 2AE2A 2BF7A 1V3TA 1Z75A 3ANNA 4NFYA 4IZIA 3HE3A 4MVJA 4RGBA 5CDSA 3BMQB 3HB5X 1N1GA 2PKRA 3QWBA 3KHUA 1VM6A 1DJNA 2EEZA 1LRJA 3HZZA 2ZTMA 4EJMA 1Q7BA 5I8ZA 1N92A 2WYWA 1ZEJA 3EZYA 2C7GA 3ADOA 4R16A 2I65A 1LDMA 3BMCB 1ZNQO 3WB9A 3ETDA 3FHLA 3AI1A 1PJ4A 3H3FA 4RO0A 3VH1A 2HJSA 4E31A 3AW9A 2X9GA 1C1XB 4TZTA 1B8PA 3ETGA 2E37A 3EDMA 4UVGA 4AICA 2VNAA 1K5HA 1PU2A 3P2YA 1GY8A 3C7CB 5AXCA 3FD8A 4FOOA 2PK3A 3PHHA 4P4NA 3WJAA 1HDRA 1PJ2A 4PLPA 3ZGYA 5TJHA 1Y8QA 1NFRA 5G0WA 3ST7A 4XRGA 1R15A 2PY6A 1E3LA 2X58A 4KOAA 1R0KA 4CM9D 1IZ0A 5JXWA 4TQGA 4FFNA 1I36A 3BXXA 4IXTA 5CEFA 4ALIA 5ICMA 4ALNA 2D0IA 3IKVA 1XKQA 3MOIA 2IEBA 2NU7A 4GQAA 5AXDA 3TPCA 1HDXA 2O2SA 3C8MA 2HU2A 3HSKA 1KOLA 9LDTA 1SNYA 1ZCJA 3DWFA 3H5RA 3ICCA 1DEHA 2P68A 2XAAA 2J3KA 4J4BA 1ZJZA 3PHLA 3KB6A 4NJMB 2Z1NA 3F9IA 2D5AA 5JY6A 1KBZA 2JCVA 1ZSNA 3RI3A 4PGFA 3ICPA 2PZLA 2DT5A 4D79A 3IIEA 3AOEC 5COBA 2A94A 4I5EA 2X5JO 1JN0A 1XDWA 3D5QA 4HFNA 4AFNA 1H9BA 1PTJA 3W4JA 4DBVO 3ROMA 4EBFA 4URFA 4CUKA 3MCVA 3R0IA 1IPFA 4BGIA 5JNLA 3IJPA 4MJLA 4JXKA 1PGNA 1GEGA 3JD3A 5DF1A 4CMAA 4EEZA 1CYDA 2ILTA 2NADA 4LK3A 4BNKA 1AXEA 4R4JA 3K2EA 3ZNOA 4IJVA 4E32A 4FJ2A 5TLSA 2FN7A 1F17A 5KOIA 5JFOA 1B15A 4WLVA 4BKUA 5DOVA 3GVCA 5T67A 3ANMA 5DP1A 3DQPA 3L07A 4W7IA 1LDNA 4BO1A 1HLPA 4R5MA 3H4VA 4RVFA 1N9GB 1DHTA 3I23A 4W9NC 3RUDA 4FDAA 3KVOA 4IJKA 5BSEA 1I2CA 4GVLA 1RPNA 1BGVA 3H6KA 1DOHA 4GPD1 4HNGA 1GYRA 2B4RO 2GR9A 4E12A 1T2FA 5DN9A 4CR6A 2NU8A 4WLUA 2QZZA 3U49A 1IUKA 3GAFA 4E4YA 4B3HA 1JKJA 3VZSA 5A9SB 2I76A 4FJ0A 3INTA 1Z7EA 4MKXA 2CDBA 2NTJA 3RQSA 4RQUA 5FF9A 4NK4A 2FSVA 3IS3A 3D4NA 3ETEA 3TJRA 1HYHA 1R66A 5U1PA 1NQOA 2HQ1A 2P2SA 4AJHA 5DT9A 4DLBA 2P4HX 1V0JA 3NJ4A 4EZBA 3ZU2A 2O7QA 4Z0HO 2DUWA 5CG2A 3EYWA 2VWPA 4HV4A 1Q0LA 3MTJA 1NR7A 1LNQA 4H3VA 3AM3A 3ZN2A 4DYDA 4FGSA 1DIAA 1I2BA 4Y6PA 3RFXA 3D3WB 2BLLA 1T2EA 3WICA 4JJIA 2JHGA 1E92A 1P77A 1U1IA 5DCWA 3D0OA 2DTEA 1E1MA 1W0CA 1XQ6A 3AM4A 3R3SA 2Z5LA 4I5GA 4R1TA 4DLLA 5IDYA 4XCVA 3U62A 3TOXA 4IDEA 1CQIA 1X1EA 1I3NA 1NHGA 4MVJP 1PWXA 1HRDA 2Q46A 3RBZA 2PWZA 4RV9A 1DJQA 1E6UA 1UZNA 1CRWG 2EXXA 1NPDA 3PYLA 4RPGA 5JLAA 1GQQA 2E6UX 2DM6A 2PZKA 4R5HA 4D41A 3RVDA 2BGMA 4AJKA 4DQXA 2JCYA 4MVJI 4J91A 4JP3A 2WSBA 3DAPA 2YY7A 2QRKA 2CVQA 4FQ8A 3E6AA 3I9MA 3NX4A 3RUFA 1K2WA 5CPBA 3WIEA 5I9MA 2YHIB 5JSFA 3QW2A 5EMHA 1ZMOA 1UUFA 3DMTA 5JDIC 3DZBA 4G5HA 2OP0A 4NBUA 1AE1A 4O0LA 1ISGA 3KLMX 3JQDA 3JQ8A 5L4SA 1E3WB 3HWRA 2IZZA 1ZK2A 2I66A 4PZEA 3T7CA 3HDHA 4XYGA 1HWYA 1VE9A 1QLJA 1YBMA 3L4BC 2VRCA 3ZH2A 3GG9A 3DBHA 2J3JA 3OA0A 4ID9A 5TGDA 4A2CA 2FY8A 1X0XA 4I5DA 1LI4A 3LC1O 1KVSA 2PR2A 5HS6A 1ORRA 1RM0A 4XQ9A 4GGOA 2PA3A 1LA2A 5KVVA 3GEMA 5T64A 4E5PA 1GL3A 4MIEA 1BG6A 4IQ8A 2EERA 2O4UX 1PQPA 7ADHA 5IZ4A 2ZCUA 5TX7A 1DLJA 1DAPA 2I67A 1NAHA 1YB1A 3DTTA 4M1QA 5L95A 5TIIA 1G0OA 3TL3A 2CSUA 1BMDA 5COQA 2QYSA 4TWRA 3OECA 1AXGA 1Q1NA 1HF3A 5L45A 4XGKA 3ZW8A 2JFGA 5IF3A 2UUOA 1N1EA 3MWDB 4FC7A 4XJTA 5KVSA 3JQ6A 4QECA 4D42A 5KKCA 2CUKA 4GKVA 1TT5B 5U9CA 4CLOB 1O9BA 2J3HA 1LRLA 3DBLA 3VKVA 4ND1A 4E2YA 1EEHA 1O0SA 1CEQA 1SO8A 2BI8A 3IDSA 5B4VA 4GMFA 1EVIA 4OJNA 3I52A 4Q3BA 5TS3A 3OHSX 4MPDA 4Q3DA 1QV6A 3B1JA 3UICA 3SVTA 4HUJA 4EYEA 5T8KC 3UAGA 3OMLA 1JWAB 1MB4A 2IDZA 2RH8A 1ZZEA 1ADFA 3JD2A 2AEFA 4CV3A 5H83A 4J6FA 1Y8RA 2HDHA 1E5LA 4D3SA 3RBVA 1P44A 4YT5A 9LDBA 3GDFA 2AQIA 1T26A 4CODB 2Q1WA 4IGEA 4OOFA 1XQ1A 2W98A 2YZ7A 1P9LA 5TT1A 4YWJA 3OBBA 4PN3A 1PZHA 2XF8A 1ONPA 1R12A 3OH8A 1GZ6A 2PTGA 3PWZA 4K6CA 3S2GA 3JTMA 1EQ2A 1I24A 1JVSA 3AOEA 3QE3A 4ROSA 2EP5A 4FSHA 1DIRA 4N5MA 5DCUA 2VYVA 3NTOA 4BB6A 2O3JA 4GH5A 1K0UA 4WCFB 3U9LA 4EJ0A 2BFMA 5DULA 3FN4A 3DBVO 1XELA 3RC2A 4XGNA 4BNVA 3W1VA 4YACA 4OAQA 1IOLA 4J43A 1HKUA 2P91A 2GD1O 2NVUA 3VZPA 3PHJA 3OFSA 1DIHA 4HBGA 1P0CA 2P9EA 1GTMA 2VWQA 1A4UA 3L0DA 2PGLA 4AJLA 4CLRA 5B4TA 4CMBA 1PIWA 2B36A 4CPDA 4AJOA 1H0KA 4KTVE 1EE2A 2RHRA 4FPXA 4UREA 4I1IA 3H5NA 3I9KA 2I5PO 5DCYA 3DOJA 4AJNA 3GPDG 3MZ0A 4F6CA 2JCXA 4W9NA 3CKYA 1C0KA 1MX3A 3NT5A 2EIHA 4K9DA 2HKIA 2Q2VA 4IDFA 3ZWWA 2Q4BA 3KO8A 3TSCA 3VPFA 5A3JA 1ZMTA 1P45A 1EVZA 1OMOA 3F5QA 2P9GA 3WWZA 3ZHBA 5EL0A 1T25A 3K73O 1YKFA 3HN7A 4FIZA 4JX8A 3U3XA 2E82A 3KOUA 3LC2O 4WECA 4Y9DA 3FBTA 4IXWA 5IDWA 1PR9A 1ENYA 2Q2WA 3BMOA 3SBOA 4A0SA 2J5QA 2IEDA 2I3GA 4N5NA 1GUYA 2DBZA 3DC2A 4M54A 1W73A 1O6ZA 1H6BA 5BNIA 4RPHA 5L4LA 4KZPA 3BMQA 3FNGA 4QEDA 4L4SA 3GUYA 4IPTA 4Y6RA 2NVWA 3ZDFA 3HQ4O 1PJTA 4JN6B 1IE3A 2GCGA 4E5YA 3UCFA 1LX6A 1UDAA 2VTEA 1WDMA 5JS6A 1QXSA 3V1YA 1GCOA 4DREA 3ZZNA 3BMCA 1PJBA 1CQJA 1X7GA 2NUAA 2DPHA 5EPOA 3ZU4A 4R1NA 3AUUA 4J1SA 1K6IA 1SB9A 4L0QA 1DC6A 1U2GA 2GZ3A 1UP6A 4B4UA 2QX7A 1D3AA 1C1XA 1IB6A 4PG5A 1WDKA 3WLEA 1DPGA 2HLPA 5ER6A 5I7EA 2O3UA 3RD5A 2IXAA 4A5OA 1G6KA 3DHYA 1XSEA 2NTNA 5JO9A 4M89A 4UEJA 4ZA2A 1KVRA 4LCJA 5C3MA 5CG1A 4S3MA 1VSVA 2QG4A 4F3YA 4ZQEA 2PH5A 3PYMA 2P5YA 4J7XA 3P5SA 2W8ZA 1TVEA 2NQTA 2VN8A 1W4ZA 4FS3A 1P0FA 3HB4X 3I4FA 4CV0A 4R1UA 3RKUA 5CPFA 1NP3A 5KKAA 3IC5A 4BO3A 1IZ9A 3K8ZA 3EMKA 4K26A 3QVTA 5DOZA 3SEFA 4CL3A 3ZW9A 2BELA 3P2OA 1D8AA 1EMDA 4JJFA 4HFJA 1NQ5A 4N18A 3VH4A 2R2GA 3FR8A 3EAGA 2ZB4A 2BGLA 4D7AA 4PLZA 2G0TA 1P74A 1QSGA 1PZGA 1V9LA 5JYEA 1PJ3A 3NDIA 3K92A 4P4LA 1UDCA 2GUGA 4IY1A 4NJMA 3HNPA 4DQVA 3RUIA 1BXGB 2CY0A 4BV8A 2GN6A 3GN2A 1UZLA 1M66A 3ANLA 3UW3A 3NTQA 5GMOA 5GZ3A 3H2SA 2Y1GA 3ONEA 3GDOA 3RUAA 4Y8VA 2ZYDA 4W6ZA 2OBNA 4FFLA 4E5KA 3OIFA 3PQDA 5L40A 4NJOA 4WCDA 4WNCA 1KS9A 2ZCVA 1BHSA 3AK4A 3JD0A 1EE9A 3KLPX 4GX5A 1LXCA 3WLFA 3LC7O 3ZV3A 4DMLA 3PIIA 2P4QA 5KNLA 4YJGB 4J16A 4BNTA 4J9UE 4YJFB 4BVAA 3RJ9A 2Y68A 1MUUA 5KJFA 1DSSG 3PYXA 4XEHA 5T8KA 1F8GA 2DQ4A 1FDWA 1L1FA 1E6WA 4UVEA 3A14A 1WLYA 2VNSA 4YVFA 1UZMA 2CMDA 3KXDA 4R51A 4RPKA 4CLXA 1I01A 1A72A 1W8DA 3GUCA 3QP9A 4CM5A 2VRCD 2DAPA 4DYVA 1C3VA 4OXNA 1V3VA 4LMRA 3AI3A 1T4BA 3PXXA 1T4DA 1EQUA 3IQDB 2A92A 1DRUA 1N9GA 4R9SA 5L53A 2ZB7A 5EN4A 1GUFA 3TZHA 3VDRA 5CHEA 5A1TA 4B7CA 3WIDA 2W2KA 2GERA 1UH5A 4U0JA 3WX0A 5TC4A 1VJTA 1XU9A 8LDHA 2AEMA 3QWHA 1YONA 4CL8A 3QVOA 1EBFA 4RQTA 2GN9A 3TZKA 2HRZA 4IDAA 4XYBA 2YJZA 2WM3A 3IJRA 3FNEA 4DBZA 2EKPA 4BO2A 4B4OA 2EGHA 4FN4A 3RKRA 1U5CA 1LLUA 1UXKA 3DHNA 2HMSA 5L7YA 5G4KB 1P3DA 1SEVA 2X6TA 1DIGA 1MLDA 4PIVA 3NYWA 3KV3O 3RBXA 4IDGA 5A3VA 2DC1A 2XPCA 4ZQBA 1IHYA 4U5QA 2GO1A 1IULA 1TT7A 4WK6A 5KJEA 3WYCA 3EK2A 1T2CA 3D3WA 5AXAA 1IHXA 4BNZA 3GOHA 5B37A 4MINA 1GR0A 2OBYA 5EQFA 3ZWVA 1AHHA 4KUEA 4KWHA 4NI5A 4TRNA 4U0KA 1FMCA 2FOIA 1Z45A 1YDWA 2V65A 3V5NA 3RIHA 1VL8A 3C85A 2EG9A 2G76A 1PL6A 3A1NA 3U4HA 1VKNA 4CM8A 1XEAA 5GY7A 2YV2A 4YRDA 4RF3A 4A10A 1Q7GA 1SC6A 4J1QA 3SLKA 3BAZA 8ADHA 1P1KA 4DUPA 3DXFA 4JBIA 1GV1A 5HS4A 1H2BA 3HHPA 3ADPA 3I1JA 3LU1A 4OOEA 3SJUA 3GFGA 2Y66A 1U3UA 2GZ1A 4QX6A 4A27A 2YHIA 4XR4A 4F45A 2IE0A 4A7PA 1YB4A 3ULKA 4DLAA 2C59A 5TQVA 1JLLA 5COAA 4RCVA 2QYTA 2H6EA 2X9NA 2YFHA 1ZXBA 3JV7A 1E3SA 3QIVA 1SBYA 1E3WA 4IS3A 4H15A 5A06A 1RM4A 2X5KO 1V8BA 1QLHA 3DDNA 2UYYA 3G1UA 4OIMA 4B4WA 2QIOA 2I6TA 3LVFO 3GG2A 2B0JA 4IUYA 4AG3A 1JWBB 3DEYX 1NVTA 3IUSA 2G1UA 4FW8A 4LCEA 1KEWA 3GZNB 3O4RA 3QY9A 1V35A 1EFLA 3PIDA 4I9HA 3JQAD 2BH9A 2F00A 1B2LA 1HDGO 2R00A 3FR7A 4DRYA 2J5RA 4GMGA 1QG6A 5A5FA 3CUKA 2NTVA 2V7PA 3NEPX 4BKPA 2J5KA 2Y1OA 4TKLA 1U8XX 4MP8A 4NH4A 4BNUA 2O7SA 2X0RA 1XWFA 2OP1A 3LQFA 1I0ZA 3Q1LA 4CLEA 4MOWA 4RL6A 5I7VA 5F3RA 1MGOA 4MKRA 4CMIB 4WLFA 5JC8A 5BQFA 4P8RA 3E5RA 3GMDA 3WS7A 1P1HA 2ZQZA 4XQEA 1A7KA 3F46A 4O6VA 5L3ZA 4B4VA 2VQ3A 1TT5A 2Y1CA 4XR9A 2HAEA 4CLOA 2WWRA 3PQEA 4YA6A 3D7LA 4CR8A 3K30A 2C5EA 1IPEA 4PCVA 3HDYA 1AUPA 5JO0A 2CNBA 5I9LA 3ZWXA 1PGOA 3PP8A 2TMGA 4AJ2A 1JVBA 3JQGB 3HUDA 2QHXA 3ZNPA 1GZ3A 1R4MB 2YFQA 3GGPA 1LRKA 3BIOA 2HSDA 4Y67A 4UVHA 1ADBA 4XYLA 2ZK7A 3WGYA 2FHSA 3UVEA 3C1AA 2VT3A 3PLRA 1NX6A 1B3RA 2NU6A 1C14A 2IZ0A 3RWBA 4B7XA 5IAAA 3GRKA 1NFFA 1U4OA 2WDZA 3AU9A 4D43A 3RC1A 1M6HA 1I3KA 2WE8A 3WGOA 2B5VA 3GEDA 4WCFA 4E13A 3FBGA 2CD9A 3S55A 2AA3A 2B83A 5FWNA 4L76A 2GNAA 5ITVA 1LSSA 3GNQA 3JYOA 2FPGA 1V6AA 1R0LA 1JA9A 1TEHA 1FDTA 3I9OA 2IRWA 3GH3A 1BWSA 3GT0A 1WDLA 2ZATA 3WBBA 2VYNA 4XYEA 4MVJG 2G17A 1NVGA 3UOGA 1NBOA 5THKA 2O48X 3VH2A 3D4OA 4QFDA 4BO6A 4CMGA 4W82A 4M55A 3V2HA 1HYGA 2GZ2A 3ZWYA 2OHXA 1T1RA 1HYEA 4R01A 4FFPA 1PS8A 3LZ6A 1OFGA 3CMCO 2FR0A 3PJFA 5CEJA 3AU8A 2CF6A 3W6UA 1CERA 4NU6A 1ISJA 2PD3A 2PKQP 2FRDA 2ZTUA 4PZDA 4BIIA 1GDHA 3A9WA 3KSDO 2ZJ0A 5U4QA 1NTOA 3H9QA 1AGNA 3NGXA 3QJ5A 3L6OO 1O5IA 2FSSA 2I3AA 3G0OA 4YB8A 1QYDA 3LSYA 3R6DA 1M75A 1PS0A 3ZU3A 4XQCA 3QQPA 2HO5A 3JQEA 1EVJA 1E7RA 1X1TA 4RF4A 1E77A 2DTDA 3FTPA 3H7AA 2FP4A 3HFSA 4WLNA 5CP8A 3KEQA 5AYVA 4ZICA 3GVHA 4J4HA 3L77A 1B26A 4UAGA 3HFGA 2PLAA 1QRRA 1WW8A 5DBIA 3NKLA 3INRA 3C7DB 1Y5MA 3RAJA 3F47A 5L51A 1YL6A 1HDZA 3SXPA 4TROA 4PLVA 1LTHR 2NQ8A 3JQBC 3K5PA 1RWBA 4H16A 2EWMA 4MVJM 4XB1A 4E2ZA 3IL2A 3IMFA 4BNYA 4M8SA 4WGGA 4CMEA 2Q45A 1JAXA 1HZZA 1M2WA 5K6AC 4D3FA 3GRPA 4N54A 5A02A 1HL3A 3MJSA 3ZWCA 1J4AA 4RVGA 1OC2A 2NVBA 1JAYA 1LUAA 3O9ZA 5KIAA 1GFSA 2IXBA 4XDYA 1NFQA 1DO8A 1HTBA 1Z82A 4R9RA 3DZJA 3VTFA 4J4TA 1U3TA 3ZWPA 4J1TA 4ZRMA 2D8AA 4WE3A 3BZUA 3Q9UA 4OQZA 4ND2A 1GPJA 5F5NA 2CVOA 3WBFA 3FNFA 1HDOA 2V6GA 4EITA 1LSJA 2WYVA 3BTVA 3CTMA 4IJWA 2E48A 4ND5A 2ZIZA 1ISMA 1VKOA 1ZSYA 4LRTB 4ZGWA 4EUFA 5EJ2A 1CETA 4E2XA 5L7TA 4YTEA 1HDYA 1QKIA 3IP3A 3FWNA 2YQ5A 1IL0A 3DAFA 3OJOA 2NSDA 3GZ4A 3CZMA 2EW2A 5T57A 4JQCA 2AQKA 2C82A 4RVUA 2G5CA 1BSVA 2O3QA 2WD7A 1D7OA 1B0AA 4AJ1A 3EVNA 3LLSA 2IZ1A 3KSZO 3QA9A 2JL1A 4IQGA 4DIFA 4OGWA 1E5QA 2R6JA 3LDHA 1Z7BA 2B35A 1U4SA 4G2NA 1WZIA 4JBHA 2DKNA 4RPLA 1ZW1A 3QLJA 3D3EA 4YT2A 3ZWOA 3OETA 1DLIA 1QORA 1XGKA 2GN4A 3H9EO 3U4IA 3LF1A 3RASA 3D4PA 5FFFA 5EQDA 3RROA 5JCJD 3AJRA 4IMRA 4Y6SA 5JMPA 4WASA 3NV9A 3ITKA 4I08A 4O59O 4GSLA 1NQAO 1EK6A 4RLHA 5A05A 1LSUA 3OQ1A 4LSWA 3OF2A 4EW6A 1BXGA 1YE3A 1GYQA 5HWSA 1B7GO 1YRLA 3FPLA 4PRKA 4YAJA 3I6QA 4JJGA 4JBGA 1FF9A 4XA8A 3C24A 2GLXA 5G0TA 2P5UA 4Q3NA 4BNJA 4K1LA 1PS9A 3F1LA 3P7MA 1NXQA 3GK3A 3GNTA 1U7HA 1ISHA 4BO9A 5HM8A 1PGJA 1RJWA 2SCUA 1CJCA 3COSA 3ONDA 4MP3A 2OGUA 2PGDA 1U3VA 2PH3A 4R3WA 4YJGA 3VKUA 3CPSA 4GL4A 1UAGA 4YQZA 4FFMA 1RYDA
chains in the Genus database with same CATH superfamily
4XUCA 3B1WA 5BWOA 3SHVA 1WY5A 1ZH2A 2A0YA 3PNYA 4BS9A 2XCLA 4NEQA 3T3MB 1BKSB 1P91A 4Z2AA 4MDFA 2XCSB 4GVXA 1AO3A 2BBTA 5K01A 5JD5A 1ARZA 1SPBS 1IHDA 3ACBA 3OZUA 4MR7B 3TD9A 5ITZB 5EE3A 1YT5A 1HEYA 2V5UA 3MCTA 4GZ6A 4OHVA 3UM9A 5IN5A 4KQ6A 1JHYA 3TUIC 1ML3A 1MORA 3HACA 3RREA 3TVYA 5LA6A 3OJEA 4Z5XA 5F1PA 3ZTYA 3TLMA 3FMGA 1CTQA 3ZJUA 5EC8A 5ECWA 4C7OA 1DINA 2GRAA 4EL0A 3G8BA 5EI5A 3QKTA 2GETA 1EJ6A 1S4MA 4CTKA 3UAYA 3WLLA 1OWNA 1L3IA 4ISCA 2NO4A 5I8WA 3QWFA 3C0KA 4B3MB 1KY4A 1LWNA 3CMMA 1Z5UA 2HV9A 1E1KA 3KAJA 4O2RA 4PF1A 5JS7A 4HBZA 3PC3A 3O91A 4QYWA 1ZI9A 3F4BA 2VHVA 3LXRA 1BS1A 3R6GA 1NZFA 2XEXA 1MOPA 1EB8A 3M6LA 4C0SA 2VDUE 5JYDA 4QTZA 3KC2A 4TL8A 4LZLA 4CM4B 3T1NA 4DMUB 1CP3A 2IS6A 1C1DB 5KVQA 1Z3IX 4K9NA 2PTHA 3OQHA 1F06A 1PNOA 2FDRA 2FLWA 3NBUA 4HN4B 4HQFA 4KIGA 4N5HX 3TNJA 4ZYTA 4BU0A 5H7XA 4MO2A 2HT1A 1YI1A 2GVZC 4PQRA 3VYRB 5CB0A 3FF4A 2IW3A 5ED0A 3SX2A 4EF5A 1N3LA 2C78A 3EBOA 1I9CA 4NG4A 1TMKA 2PT9A 1RBQA 2O57A 4NR0A 4EHDA 3GMTA 2BFBB 4NCJA 3KJNA 5KVAA 4R9UC 3E5MA 5D3QA 3VBCA 1JAZA 3BDAA 4YRNA 5IYZA 1QGYA 2DZDA 2J4DA 3ZVLA 4KNYA 3KXLA 4DTIA 3T54A 5CIQA 4LXIA 3R3JA 3GEBA 3KZVA 1CF2O 3MJCA 3URMA 2P2LA 1XCBA 4UQPA 3L0ZA 3AY3A 3HN2A 5TXGA 2DERA 2QW0X 1QAQA 4H7PA 4YECA 3LUBA 4BX2A 4C6SA 5ALZA 4PBSA 3PG5A 1NSYA 1SD1A 1N75A 2C8LA 2FGJA 4MUIA 4YRQA 4YGYA 5KUTA 3CNEA 3D2AA 1QH1B 3NTXA 4N7MA 4ZVVA 1QE3A 4L75A 2IOFK 5JZVA 1NJ1A 3QVXA 3MINB 3GGJA 2I55A 3KE9A 3UMSA 4KCGA 1PNRA 1MW9X 4Y7CA 3KXKA 4G4IA 4A2QA 1KI4A 1P75A 2AEEA 2ZGVA 3BRWD 3IVXA 4QRHA 2IPAB 3V33A 3GGSA 5J3JA 1E7WA 1Y8AA 1DBQA 4LVUA 4YV7A 1M8FA 2VXCA 1IVNA 5DI3A 1NMXA 1U5AA 1XBTA 2P9CA 1XMXA 2FSUA 4KE8A 4UTOA 5D87A 1NJFA 4HATA 3OX1A 4PX2A 1Z07A 4ABTA 4KRYA 5E3IA 4C3ZA 4FM9A 4LFAB 4PLFA 4Q7MB 3E03A 5H8WA 3PQ5A 4C01A 3O47A 3U9TA 1KDRA 2BCGY 4M1TA 4Q00A 3RVBA 4UBOA 4BEBA 2QKYA 3UHAA 3OZWA 3PJGA 4LZJA 2G09A 1PR3A 4EELA 3L4SO 3BX1A 2BONA 3UBMA 3T4UA 5AMXA 2JH8A 4OH1A 1MG5A 3V2IA 2O1EA 3ESXA 4BTEA 4I9FA 4JYBA 4MVJE 5L7WA 1BIFA 1UL1X 1KQOA 2X4GA 5H3LA 4LJYA 4LYJA 1KJ9A 1VCIA 4N3NA 4EQ6A 1E4YA 1QVWA 3VR5A 4QM6A 1ESEA 3HG7A 4G4JA 1E0JA 4URHA 3MJDA 4CG0A 3I9LA 1QR2A 3LKVA 4YUAA 3JSAA 3A4MA 1JR2A 3DE6X 3MTIA 2BKXA 1OIXA 2QRLA 2BLNA 3EW7A 3QKRB 3ZLJA 1CT9A 4M0FA 4NV0A 3RSFA 1JBQA 4AT1A 4U5XA 4J07A 5HGXA 5IFLA 3H1EA 3KSRA 3G5UA 3MBOA 4ZXPA 1L7VC 3AHDA 4UNNA 2VH2A 3NG1A 4RA6B 4LRSB 5AHOA 1OH8A 2OOKA 1C30A 3E4CA 1FVOA 2PMWB 3UEOA 3WKAA 1FCJA 3GJ8A 4QYXA 4CL0A 3TEJA 3I12A 2XE8A 4HDOB 2JZNA 2JJ2A 3E1SA 1F8XA 4HNVA 5H02A 5A03A 4TWBA 2VT2A 1BQEA 4YQEA 1OZAA 4BNXA 4KMRA 4QFBA 5JDIA 1QIFA 2X2OA 4AULA 4PVDA 4MZDA 5KNDH 4L50A 5AK4A 4DLVA 3PX3A 2HXYA 4AW9A 3MJEA 2X1MA 5IH7A 3PK0A 4DL9A 4M9ZA 5AVXA 4E0BA 3AR4A 3WE7A 1SUPA 2EC5A 4QJ4A 1W2WB 4UMVA 3A31A 4EHAA 1IDN1 4KE7A 3ZNNA 1PSDA 1MP0A 1EBBA 2OB1A 4QGHA 4MUJA 3UT5A 4NOJA 121PA 3B6EA 1KSJA 2AE1A 4TVOA 3AFNA 3CIFA 1QUEA 5CXXA 4P83A 2R62A 1GN9A 4JCCA 4C4SA 1JH9A 3IIKA 1XHEA 3E7XA 2OHGA 1L5HB 3MRXA 2I99A 3GDWA 4Q7EA 4Z4GA 4UTVA 4LF6B 1FJHA 5F1KA 3RRFA 2C9DA 1L4GA 1N2OA 1YCGA 1SUSA 1YRQA 4LZZA 3VZDA 3ESRA 3EZGA 4ALMA 1JPJA 2PUFA 1WZ2A 2MMCA 1OFVA 5CVCA 2W6JD 2WJVA 4Q3CA 4XGIA 3VZCA 3ROQA 2NACA 2JKVA 3PVCA 1NUHA 1YR1A 3H19A 4HZGA 1KKLA 5AUNB 4MYTA 2X14A 4X8LA 3AR6A 1QQ5A 1YR6A 3QY0A 3OJCA 3GGCA 2PKQO 1F2VA 1ORDA 2QQ5A 3KT3A 5AVOA 2ZKIA 3EVZA 4DRZA 1T2DA 1XU7A 1WKBA 1O94A 3KPJA 2HNAA 1IJEA 2XA9A 1L5WA 3I5XA 1FMLA 4AS1A 1XE3A 4GXRA 5IZCC 5K8LA 5KWSA 1E8MA 3MRSA 3ZBUA 4AF7A 5JFTA 1SA0B 4XTCS 1CNEA 2RAVA 3L8FA 4IJUA 1XP5A 3NHYA 3UF0A 4XKJA 4LJSA 1JLSA 1SVKA 3II6X 2OAEA 4FJ1A 5KSOA 3WTCA 3N7UA 1EX6A 2JBWA 1YNOA 3E4DA 4AXBA 4DPLA 5DXAA 5JFGA 3FVWA 1ECGA 3RSLA 3DEHA 1CE8A 4WPGA 1K0FA 5SZJA 2AZXA 1Y1SA 1OYOA 3OZBA 4HNQA 4HWSA 4P54A 1LVHA 2TYSB 1YVUA 1XXHE 1CP2A 3CLTD 4MI6A 3F49S 3VZQA 1Z8HA 3C5HA 3U3RA 4XD7D 1YBAA 2ODWA 3IX7A 2OV3A 2W6OA 2G4LA 4PG4A 4TSRA 5CT4A 1JALA 1OZGA 2ZE7A 1Q95A 4MUFA 4PLTA 1YTUA 2TMDA 3DR5A 1GU0A 4IRXA 4QBGB 2HQBA 1O87A 2BJWA 5FB3A 4KYTA 5EIOA 421PA 4JC0A 1WSAA 2O6LA 1Z06A 2HJGA 1L5SA 3DO6A 3K1TA 3L9XA 1KK0A 1YGYA 3KQPA 3RS4A 5CLIA 1FP2A 1YZKA 3COYA 3HS3A 3QG1A 4REMA 1UEJA 3PI7A 4CR7A 4CV1A 4TL6A 5I7RA 5A9SA 1MQ8B 4MWGA 4ENRA 1FQKA 3UN1A 1Z7YA 4UBLA 4JMLA 1SZJG 4OD0A 1UBGA 3UMRA 5JDCC 1DELA 3WHKA 2ZR7A 3QVVA 3GNLA 3CNLA 5KQGA 1SMKA 3CF6R 5BURA 1HNZB 1W0KD 5CCEA 5K0SA 5J9FA 3G88A 2XMSA 1S2GA 1CZLA 1N2BA 2PRSA 4YRJA 5DGCA 4HLDA 1KJWA 3COVA 5JJBA 3BAFA 2Q2OA 2UUPA 2PL9A 4KO8A 2C4HA 4HY3A 4CIAA 4DV3B 5NULA 3NOVA 1TK9A 4TXNA 1SUAA 1G63A 3CRW1 1NAIA 3NCTA 2E89A 2VXOA 4ZJPA 1KRHA 4U2BA 3BL8A 4Q47A 2V6JA 3B53X 3N70A 1XZ8A 2ZVJA 4WK0B 1JLHA 1B23P 1M83A 3KX2A 1TTHA 2JBAA 3UWMA 1XN1A 4RF2A 2XDAA 2X9VA 2QRUA 4CCAA 2J7PD 5ALXA 4FB4A 1D1PA 1Z29A 3AUTA 1QM5A 5HZGA 1PKEA 1FUKA 5CEEA 2M9MA 1Z0ZA 4KGXA 4QUKA 5TQ0A 4S12A 3DFKA 2WT9A 3O75A 3M6UA 1X1SA 4DC1A 1XZIA 1L7XA 3C1OA 3G6KA 1GQ2A 1VCMA 2P6OA 3HBNA 3JQAB 2GCEA 2Q3LA 2ZRHA 4KMMA 1P7YA 2CXQA 2R6HA 5AKIA 3VKHA 4M0UA 1KI6A 2WJGA 2Q5FA 3G2QA 4W5RA 1IXKA 2BFFA 3SR0A 3V9PA 1JT9A 4J0FA 1N5RA 5F52A 4RH3A 4EYQA 4ZI2A 1KQ3A 4E5VA 3R6WA 1IWOA 3W4KA 2H1OA 2ACEA 4KXNA 3CLSD 2R3SA 1H4TA 2DUJA 1YS7A 4Q18A 4R8SA 1JE0A 5CD9A 1ESZA 1OASA 4XIJA 3WJ7A 1FSSA 3HADA 3PC8C 1EVLA 2GRJA 2VHZA 4TYMA 3SS8A 2GHQA 1NRIA 1ZK0A 4YT4A 5JTTA 4R68A 2AEJA 3FYCA 1TCCA 3CRQA 2X1HA 3IOEA 5ERGB 4J94A 1TIKA 4D8UA 1GG5A 2XJ4A 3IEXA 5A5EA 3K1JA 3TKLA 4GDMA 3QWAA 5D7NA 2BMWA 3WMWA 1GPNA 1YR8A 4IQFA 4CKZA 2A0XA 3R20A 5LP1A 3PFGA 4O1IA 1KK1A 1LTKA 4U2KA 4NCBA 1IY0A 2FPIB 1KNQA 3HKCA 3IUMA 3MQFA 4FYHA 4HDNB 4JI5B 5ADWA 2G82A 1VL2A 2NU9A 2C0CA 1DVRA 1DXQA 1FZQA 3C97A 3E15A 4FLMA 5EJEA 2UYHA 4TTRA 2HEGA 5INTA 1SQGA 1PJRA 2C92A 3DMTC 4P3KA 2DQSA 5GJBA 2NUBA 3BSFA 4UPVA 3GT7A 1T5DX 1P2UA 1IBCA 2WP0A 2JIQA 2ZS8A 4RDIA 4EFLA 4HRXA 2OYSA 3ECAA 4MKHA 3GAAA 1ETUA 1YVEI 2BGNA 3RHZA 4CDGA 2O8VA 3H2YA 3AF2A 4IIUA 5HBRA 1E6CA 2R4TA 4OYRA 1G1AA 1EVYA 1HSOA 2XW6A 4ANFA 1WCWA 1MXHA 2VZ9A 5IKXA 4QULA 3TOSA 3WKDA 2X6RA 5B12A 1V4BA 4O4LB 1JHDA 1KYWA 4JT2A 1XTVA 1J0AA 5ELLA 2C2KA 5CRIA 4URXR 4EY5A 5FJJA 3S0JA 1KEPA 3UA3A 3KYCB 4L5YA 3U17A 4IEFB 4O33A 4OB7A 3X43A 4UQLA 2IHUA 3BB1A 3IOBA 1RYEA 4RPIA 4U2GA 4BN0A 2X0EA 2DWQA 3R09A 3H1FA 2Q6LA 1QP4A 3B1XA 3ENNA 3LBYA 2YNMC 5BSKA 4O4LF 4B8WA 3RVQA 4KXMA 1QCDA 4JUAA 1CWUA 4BP9A 2GT1A 2V7GA 3NTVA 3QSGA 1SBQA 4HADA 2PFKA 3OEYA 3H6GA 1JV2B 5IBPA 3CPHA 4TV8F 2QP9X 4DUGA 2ABWA 1BEZA 2D7CA 2PUEA 5C37A 2FAXA 3QEBZ 3Q1KA 1EFVA 2TRSB 1EIZA 4K81B 3KLBA 1YMVA 4OQDA 4RY0A 5K0TA 3THWA 1BWQA 1HFJA 4C0BA 1GV0A 5KKNB 3BXPA 4OA8A 1OAAA 1U8TA 5DYIA 1TGVA 1N2CB 3D6FA 2WUVA 1AUOA 3VV3A 4D4JA 3W5CA 3DOOA 1QF6A 4MUAA 4K9QA 3KQUA 1XQYA 3A6EA 5WRFA 1Z25A 3PWKA 1SOVA 1H5UA 4X20A 2XQFA 3M3DA 4BMDA 4WOKA 2OENG 2ZRMA 3W3AA 1JDJA 4O4HA 3NJ8A 3HLYA 1G3IA 4OQYA 3G17A 1VZ3A 2I2XB 4LXQA 1NDUA 3H2HA 1NY5A 3FW1A 4UBKA 1LC3A 2PVCA 4LF9B 3TZBA 3K6JA 3L7IA 1PNVA 4H17A 5GZ6A 5LVAA 1T13A 3SEZA 2YHUA 3EEFA 3EIOA 3PTZA 1PFGA 2EQAA 4UDNA 2FRVA 1N4AA 1FZTA 1GGKA 4UMEA 1I1NA 3Q11A 4K6OA 1U9IC 3PNSA 3BK2A 4TMKA 5TY0A 5FTMA 1SOWA 2BSAA 3C7TA 3I72A 4DDMA 1PF7E 2NZVG 3EGOA 1OFUX 4U6QA 2AUTA 2PMKA 1KZ1A 2AJTA 2OLKA 3EEQA 3OC6A 3P2JA 1FA9A 5E2AA 3VKWA 2V74B 1T8YA 4MR9A 4RK5A 3IALA 1KO4A 4OJYA 2ZYVX 3TXYA 1U0BB 1IIRA 3FKSA 5KSPA 1O96A 5BSTA 1V8FA 2HBYA 2NO7A 2PSHA 2FZWA 5JXHA 1A5ZA 1XTZA 1V2HE 1CS0A 2H31A 1HX7A 2GPTA 5ALVA 3ZV4A 1QU2A 2B61A 4WUVA 4AN1A 5AXBA 3Q6IA 2VSNA 2YOHA 2Z2KA 3LLCA 1X1RA 2GGSA 3GLUA 3KFLA 1QB7A 4KN6A 4BGEA 1OROA 2HWYA 4DMGA 5IT9A 1JSZA 1D6JA 2I3DA 1EBUA 3DV0A 3JARB 4Z7NB 3COJA 1B0UA 1SHUX 2IHKA 5E6UB 4CN8A 4OHRA 5FWYB 3NDJA 4FBMA 3HDTA 4RDHA 4XWYA 2ATXA 1JSRA 1WUTA 2H7VA 3KQNA 1H5NA 1MJGA 2C4UA 1QMPA 2NIPA 3NT2A 5A04A 1NT4A 1Z9BA 2ZULA 5ER9A 1P0MA 1K75A 3ACCA 5K0ZA 4CZ2A 2Q6TA 1UT5A 1MBZA 3HEAA 4LYYA 3W1EA 4H77A 6REQB 3V1UA 1ZJYA 3EQ9A 3N2GB 1SU7A 3PPIA 1OC4A 2IOQA 4HG2A 4EGAA 5CA1A 4HDRA 1WF6A 4GP6A 1E4EA 2QW1A 2BH2A 3S2FA 2JVJA 1EG7A 1FNBA 2BFDA 3PDWA 1XP8A 5BV0A 1ZMRA 2V6MA 3HKEA 4V0QA 3USES 2ZTSA 4W5JA 4MW5A 4MEJA 5A7FA 5M7EA 2C5SA 5AI9A 2YDYA 4YHBA 4KO3S 3LP8A 4OQMA 2C77A 5JUWA 3K15A 1LPOA 3DR3A 3F4LA 3LXXA 3MK31 2D62A 1LC0A 1VLJA 2CLIB 2EJTA 2NYAA 3FBWA 3IQFA 4RVHA 1YQXA 5GJWC 5AOAA 1XALA 2CHFA 2XECA 3W5IA 3LYAA 1KMNA 1Z56C 2H4WA 2WHQA 2QTVB 1DG3A 2ZANA 1B8UA 1JJVA 4K9OA 4PAQA 1N34B 1PLLA 4NJEB 1CUIA 4B7UA 4BWGA 1E2GA 2X13A 5IASA 3KNZA 3W34A 1WHSB 5FLYA 2AXPA 3RRMA 3L1JA 4GKBA 4EVSA 3TPZA 3LV8A 3USCS 1Y81A 4ZO4A 4MRMB 2D3WA 1QIGA 3ILSA 4YQYA 3U1TA 5I7FA 3IV9A 2UXCB 3EWAA 4N5LA 3QHAA 1IM8A 4QAQA 1ZO8A 1BW9A 5EHNA 1CJMA 4HCJA 1M76A 1MAVA 3UAXA 3VOSA 5FLXA 4LE2A 1HE4A 4I9NA 1PFKA 3T3IA 2MSLA 1VRWA 2VNJA 3OPXA 4BMSA 4FCVA 1TLTA 3JAWB 3TRFA 4JJ8A 4FXPA 1J2YA 1TM2A 3TLXA 2RAFA 5TPZA 1E63A 3VKGA 2XNCA 1OV6A 1S2IA 3LP5A 3OLQA 1PG5A 3GLHA 1GGJA 1PEAA 1HQKA 2QAGA 2VK4A 1Z39A 3GLTA 4PSCA 1EEXB 3MSCA 4C89A 4YR9A 1XCLA 5B36A 1XPOA 1MVOA 1TQ4A 2J45A 4H1UA 4LY6A 1FX0B 3Q6MA 4MCHA 1ZISA 2O52A 1P1IA 4DC0A 3HKBA 3S2IA 2FFJA 3ERCA 2JLQA 1DRWA 3D1LA 1P9WA 4L7QA 2XUQA 1GRNA 1NQWA 4NE9A 3WYEA 3AIKA 2M1XA 4M0CA 1UBCA 3BHNA 3QPVA 3EIHA 1D2MA 1RWMA 3QJGA 1C0PA 1U7WA 3ER9A 2QQ0A 4AUMA 3S99A 4DMMA 1DPFA 1BA2A 1YJQA 2DWOA 3IULA 3PFWO 5J2UB 3L6EA 2DOKA 1GD1O 4PGMA 1KWGA 1PEDA 1C4OA 3K2BA 5AVWA 2YXEA 2OXIA 1ZD3A 3GRRA 1XEWX 4OAOA 2A5FA 5C7LO 4YO7A 4EB6B 1ECJA 4RTRA 2OK8A 2OFOA 2E4VA 3C39A 2ID4A 1PJLA 2Y0CA 3OFND 3PGJA 4YP7A 3T5TA 4CYMA 2IYSA 4FHZA 2R0QC 1O89A 3EG9B 1XEFA 4Y2TA 3ZWMA 3BSYA 4RD0A 4FYPA 5J2UF 3SWWA 1TB4A 4J3FA 2BL4A 2G7MC 3ETCA 3DMRA 4HS4A 4MYSA 4MI9A 2Q1YA 5KWEA 3NUGA 3RV3A 1JYSA 4C4RA 4KK4A 5BWCA 1KP3A 3GJ6A 3OLYA 3DH0A 1XG5A 3NHLA 4HC4A 5BPFA 4ZDWA 1P2FA 3SP1A 4CU2A 4C7JA 4WEOA 3N75A 5LUAA 4AKHA 2I4RA 4B34A 8GPBA 3QX3A 3E2MA 3OT1B 2I4LA 3GU3A 4RBNA 4BNFA 3BHIA 4JL8A 3QBJA 3PJEA 4FHFA 1G291 4L73A 3N59A 4KV9A 1EFKA 3Q40A 5LN1A 2G5TA 5IMSA 4WJKB 4WVLA 2VUSA 1FTSA 4BJ3A 1K08A 1OBOA 4DT1A 1BTOA 2WU1A 2VBFA 4FQ5A 1VG9B 3UT6A 1RXVA 1Y42X 3DAGA 3Q3CA 5KMGB 2GZAA 4AROA 1GTZA 3OEWA 4MB6A 5FOWA 2OXCA 4LHYA 5BVHB 4Z3DA 4JQOA 4E5NA 1PBTA 3G68A 4IJMA 3A1WA 4JBLA 3W79A 5HQTA 3H65A 3KYIB 3ZV7A 4UHHA 4OXIA 3UJNA 4D4GA 1I4OA 3LQRA 2WAYA 2G07A 4PZYA 4X1YB 1DX4A 2B7BA 2HMVA 4AO6A 1EVEA 4M0LA 4EFDA 1UBRS 5K0BA 1HH4A 1D9XA 1TE2A 4I81A 1U0RA 5CFRA 2HW8A 3ORQA 4S35A 1U80A 1NYTA 3RK0A 3U5TA 3I4CA 4YDSA 4BRUA 5DI9A 4N0PA 1TQ6A 3G2JA 2OR3A 1DRJA 3SKYA 3AKDA 3K16A 5J63A 5JPIA 4P3XA 2NU8B 1CPYA 1YCDA 2IL1A 3HEMA 3EUAA 3DZCA 4DKXA 3T9FA 1M34E 1XZEA 3CW8X 3I8SA 4FYWA 1XZAA 3OT5A 3WQSB 2NU7B 3TE7A 5ALJA 2QG9A 2BEVA 3E3AA 3EF0A 3HUUA 4TRRA 4KITB 1EK0A 4S05A 5HMMA 3TZQA 3QVSA 1XJQA 4X66B 1MO3A 4MUKA 3PQ6A 4YAWA 3ZQKA 4BBZA 1LJ8A 1VE7A 2WWFA 1QO0A 5DIFA 4A8HA 2C5AA 2PD4A 4FXOA 4JELA 3ENWA 2JJYA 1WPGA 3IKJA 4GW3A 1IQ0A 3CH5A 1ISIA 3H1TA 5E7MA 2C54A 3GFFA 1H9CA 3B36A 2PMDA 2H4YA 4CM7A 1YJBA 1JEAA 3RC7A 4IHKA 3KPYA 4QLBA 1KJZA 1DFHA 4PEVA 4Z4HA 5BUZA 4C2BA 3PNMA 2P7HA 3FSRA 4TOIA 5BT9A 2FFHA 3UAOA 4MI1A 3EFBA 1BHJA 1E2JA 3AVTA 1OGIA 3ITNA 2H57A 3NIGB 3IBYA 1MOSA 5H80A 5HIAA 1UXIA 1C3OB 3F7TA 3LPNA 3L1HA 4HKTA 2F8LA 3IE0A 5CB4A 5JH7F 1QRAA 3RR2A 4ZOAA 2XYGA 3GW8A 1QOZA 4A26A 1N25A 4X24A 1QH8B 1CUGA 5ECGC 3TR0A 1CD5A 1CUWA 1H0RA 4N0DA 4UU0A 1NE7A 4G8BA 4JI3B 4M21A 5JAPA 3I0MA 4FKBA 1NPYA 4ZREA 1T3GA 2D4AA 1GZUA 2CNNA 2IUTA 2QM3A 3EPPA 4MROA 4D74A 3D59A 5DX8A 2X15A 2XZLA 1GCAA 5C46F 1RKUA 4CKBB 2QJRA 3OE7D 1G20A 1HMPA 2PA0A 3BN3A 3QUQA 1P18A 1AHIA 4TXJA 4BHTA 4YMVA 5BUQA 4JI0B 1E7SA 2Q0QA 3P9SA 3DFUA 4IIJA 1HG0A 2R68A 2YL2A 2XIJA 1AXRA 3AJEA 3SQXA 4PC1A 3ELWA 3QUAA 5D00A 7REQB 3NIDB 1JJFA 4OG2A 2O0KA 5CH3A 3SIPA 4KWTA 1X86B 2Z6QA 2ZYUX 4RHUA 1L3BA 2Z2IA 1V8ZA 4WESA 2RBKA 1M0SA 2XZDA 3KQOA 1Z13A 3O2NA 4N3CA 4X41A 4AXXA 3K72B 2VHXA 3W5JA 2D5BA 4FFRA 3CCBA 3FFXA 4EUEA 2CCGA 2G5GX 1KZ6A 3B2NA 1S4QA 3R4VA 1T8PA 2WJJA 1N7GA 1Z37A 4O3FA 4QDXA 3RM3A 2X41A 2V7QA 5DYWA 1YUBA 4E4RA 1VLLA 1E2NA 1U0OC 4FHGA 2QMQA 3I04M 4C4XA 4RACA 1B43A 1J0EA 1NLMA 1NI3A 4KDFA 2X7HA 2PNFA 3AI2A 5B3JA 3EISA 4Q6WA 1ORHA 5K3DA 4P4SA 1QIMA 3C16C 3FWHA 3DBRA 3F2VA 3PVZA 3WZMA 4GX1A 2WF9A 1MAHA 3CRZA 4WCVA 4ZQHA 1KQPA 3DNFA 3O92A 4I9UA 4GAEA 4AUKA 6YASA 5DLPA 2FZEA 3R3WA 1C8LA 4UCFA 5SY6A 2V0GA 1DRVA 5KTYA 2JW5A 3I64A 1W5EA 2P4SA 1EDZA 1P4HA 4MUEA 2X4DA 3S28A 3TRKA 2WQ7A 3K9HA 3MMNA 4N5IX 4ROTA 2C2HA 5LM3A 4G26A 3KYDA 1S01A 3I0NA 2EX4A 1JDBB 4RXTA 1D9ZA 3FETA 4B76A 3VR6A 4FMPA 1DJOA 1JI3A 3NAZA 5TT0A 3HYRA 3NWJA 3AVXA 3IAS6 4NZMA 4V2UA 4EHLA 2PSDA 1CYEA 4N0EA 4ZRDA 3LPAA 4DCJA 1K6XA 1N1DA 3C4JA 4ZC1A 1Q83A 1R8QA 3U7QB 4E30A 1R6DA 2C97A 4MIYA 1TM1E 4LRQA 1S3SA 1U9YA 2NSHA 3EZLA 3RVRA 5FOTA 4D57A 3L7CA 5EXDA 5I3CA 3BFJA 1IBMB 3KAKA 4LJRA 3LCRA 3CO5A 3OZGA 3SSAA 1NQTA 4KVFA 2QQGA 1R4MA 3HA7A 4RL4A 4BC0A 5BOSA 2BZSA 3H9GA 5HIJA 1BYIA 2HRCA 2WVGA 4D99A 3DD5A 3SQDA 5KX5F 3OCWA 3PDJA 5DTJA 2ERXA 5G02A 2J0QA 3MJ4A 3MYYA 4BWVA 5LJIA 2V03A 5ALMA 1L7QA 3KQVA 1AZWA 4KSBA 1JR3E 2R44A 1FE8A 2E6KA 3MJVA 3RDPA 1Q92A 1SK8A 3PDUA 1KQNA 5M34A 2D5LA 4RK0A 1GM5A 4IG4A 1VPVA 2JAOA 5FEMA 1L5OA 3ZVMA 1F12A 3B70A 3G6WA 3NHAA 2XOEA 3M2TA 4C7MA 2YQ4A 4MV5A 3VPXA 3K4PA 2RIRA 5AM2A 2AZMA 1SZDA 3HL0A 2RGWA 2N46A 2QT0A 2WMNB 3WB0A 1B73A 1NM5A 4MRSA 4PXSA 4IV5A 5D1HA 4EPXA 1W85B 3IEPA 4P7JA 3H0KA 3WKCA 5AVRA 2XOKA 1DQSA 2GM9A 3QVMA 4BQRA 1INLA 5F7XA 3T35A 2Z98A 4NL4H 1ND5A 4KRXA 4QXPA 3UAVA 1W93A 1YQEA 3LY5A 4IIXA 4DIKA 4BDTA 3ZTWA 2VTDA 1T35A 4ZT4A 1RNLA 5CIYA 2YHBA 5JSZA 2FEMA 1AN0A 1TUEA 3LC0A 4GI7A 1RE1A 2ZEJA 3DCNA 4E21A 3ADDA 1DCKA 1ZUD1 2G06A 1HQCA 3CX8A 1D2AA 1QAOA 3HB0A 4BVGA 5FPSA 4WVFA 4KIJA 4KQEA 2WYHA 4CM6A 4Q0MA 1EFTA 1P1FA 3P19A 2EBWA 1L7OA 2AQHA 1C9DB 1GCUA 1MC5A 2FUNB 2PL5A 2QX6A 5KAPA 1AG9A 3X0DA 2H7CA 5F4BA 2J9GA 2ISSD 3NTRA 4KFTA 3W1WA 1VMIA 2V9ZA 1S89A 2LDXA 3IUPA 3H9JA 1FDVA 1W5FA 1U02A 1V5WA 2G63A 3FCCA 3WLRA 1FP4A 2YVLA 3KOMA 1MF7A 1ZCAA 3TWOA 1EFRD 1HR0B 3O8QA 4QXQA 3FSEA 1WABA 4TV9A 1KVTA 3DBLB 2NNLD 5DW3A 2BGUA 2NO1A 3DXXA 2P2NA 3EIWA 4KP7A 1XK7A 3UGKA 3E58A 3T3PB 5HTOA 4AJPA 4H7HA 2Z8ZA 3IOMA 3PCXA 4OXKA 4FSXA 4QRIA 1QFSA 2Q49A 3R0VA 4PXAA 5IG2A 3AR9A 3R7WB 2BEWB 3QHQA 4WINA 4X71A 3WBKA 4ZAVA 4Q02A 5F3DA 3PE3A 1CDEA 3AESA 3HO8A 3HPRA 3K5WA 4XDZA 1MH1A 1Y8RB 1MVNA 1TIBA 3G02A 3G3EA 4O2BB 4RQBA 1WXDA 1HUQA 1ZX1A 1KXJA 1P4GA 4U7FA 5FV7A 3B20A 4J2OA 3KJQA 1LF0A 4YNBA 3DVRX 4LFCB 4AMYA 4R0MA 4XJXA 2I78A 3AUFA 4KYVA 4BAGA 3P2MA 3R3UA 2IZOA 2IOFA 3DDZX 1DKOA 1N8KA 2YXLA 1WTAA 2Y1DA 3QA3E 1JH8A 3KCNA 3ZQUA 5CBKA 3G79A 5E7IA 2DQKA 4HH0A 4RM2A 1U6JA 1RYBA 4O2BF 1N5LA 2DHEA 2H59A 4GE3A 4BBAA 2XMRA 4KK3A 1M6WA 1W8IA 2OG1A 3FPKA 1MPXA 1KETA 3F6CA 4QM7A 3JWJA 1GZHB 4NE2A 3C3PA 1EHIA 2WFZA 3QXSA 5THQA 1LDEA 3HYTA 3B9RA 5BN5B 4BRSA 3EVGA 3MNFA 5K3AA 1A9ZA 1Z4JA 2XXAB 3JRXA 1PGQA 4L08A 4YP9A 3T0IA 3WLSA 1VKRA 1J97A 4Z3KA 1H2FA 3K4QA 4I50A 1TF2A 1GPLA 4OQLA 1USUA 2WZDA 5ALUA 3SF8B 2FUG1 3X2FA 4YLEA 1J99A 4BX3A 2JAPA 1AQUA 1X7WA 4P31A 2NVUB 4J0CA 4RE5A 5CNKA 4D9EA 3PQFA 5DNYB 4GG1A 1LJLA 3OPYA 3RAFC 2OBBA 3TBHA 3THRA 4AYWA 2JHAA 2PU5A 1DWUA 3QFFA 1R4NA 4QYIB 5DE3A 4MA5A 4QXMA 2E4ZA 4Y2SA 4D0LB 1ABBA 1KO7A 3HR4A 1ZSVA 2C2XA 3HWWA 1JDBC 1O77A 2NAFA 2O0HA 1FL9A 2XDYA 3GDGA 4DR4B 4K0KB 3DBOB 3P20A 4ZOEA 5I7OA 4HZIA 4BNIA 2XGMA 2F8SA 2V3CC 3VR3A 3V42A 1A97A 5FBZA 3KKPA 5KO2A 2WJHA 2Y05A 3DNPA 1U7XA 3T9DA 1KHTA 5KTKA 3X1YA 1GEEA 2Q1UA 3RVKA 3BGOS 1XWIA 2Z57A 3L46A 4CDRA 3P9CA 4J0EA 4JBWA 2VPZA 4BKMA 1WEHA 2QTLA 3CU5A 3VC3A 5CXQA 1B0PA 1K9SA 1UXJA 4GZMA 2GK3A 3SXUB 2EFGA 5HFNA 5IEBA 3AIOA 1KSHA 3JATB 3DB2A 1HT1E 3KU1A 2PSFA 3RT1A 4JP1A 2PLNA 1P4JA 3B1YA 3HVKA 3ANYB 4GMDA 2B20A 3WA7A 5HKAA 1ZA2A 2VDWB 4JC8A 3P9YA 3FKQA 2XUDA 1NRWA 1IZ8A 2Z5GA 5LQRA 1Z5OA 4X00A 2RGNC 3DM9B 3OQMA 2BPOA 4YAKA 1GRCA 1P80A 1R2QA 1TGYA 1N2SA 3X1MA 3CE6A 1XMPA 2OBMA 3C7AA 1AA6A 1NXXA 3KFXA 2WF6A 1U2RA 3ANNA 5AW8A 1EHYA 2ZAMA 2Q8NA 3P9KA 2XNJA 3LDUA 1BZYA 3CLTC 5ITSA 1GNVA 1MABB 2Z4RA 4DWOA 2PKRA 2E5LB 4MSUA 3KHUA 2BC9A 2EEZA 4JI7B 2ZTMA 2QTFA 3HABA 1R88A 1W4CA 2O2DA 2C5HA 1N92A 3STUA 2ZSJA 3BIXA 5EZYB 4GM4A 1JF8A 5D84A 3K0EA 2FMHA 2XKKA 2W4MA 1HOXA 2IWHA 4XUEA 1F60A 3C6MA 2XTJA 2ILVA 2XYVA 4L8GA 1E9AA 4RO0A 3VH1A 5KNBA 4Z4EA 5EOVA 4DOMA 4E31A 2AOTA 2X9GA 3FIUA 4G89A 4TZTA 5FPKA 4NV3A 3ETGA 3TMYA 3W05A 5EZYF 1KK2A 2I7CA 3DA8A 3JRNA 3NHMA 4JEUA 2G04A 2RGRA 2MU1A 2FPKA 3P2YA 4Q7QA 5J43A 4UFOA 1CJSA 3C6QA 4P4NA 2PPVA 3EHDA 3ZGYA 4OMCA 2A59A 1PKXA 1Y8QA 1CNMA 1D0VA 1C7ZA 1NFRA 2BIFA 1W9HA 3FPHA 4FVTA 5DHQA 4IP0A 4U7PB 2Y4NA 2ES4A 4XRGA 2JHCA 5DMHA 5DHAA 2Z3ZA 4BRWA 3CUSA 3DDWA 1VIVA 4KGVA 1GPAA 4KAFA 1IZ0A 1NN3A 3DCYA 3TRJA 5JXWA 4R2KA 4TQGA 4WXHA 4A8JC 4BPRA 4FFNA 4OYYA 3O1IC 4U3JB 3CSSA 1GNLA 4NNOA 3BXXA 4Z49A 1IHOA 1QPBA 1RBYA 5ICMA 3MELA 4ALNA 3C5WP 2UZ4A 2AN5A 1XKQA 5AUQA 1XDGA 1YIOA 2OZLB 1KAOA 1YJAA 2SHKA 3R8CA 1UC4B 2ONYA 4UXIA 5AXDA 1W52X 2P3LA 3MG9A 4DUZB 1GGHA 2YHAA 1HDXA 3Q0TA 1W25A 3KUUA 3E9YA 1Z2NX 4ZVSA 4CN9A 1EP2B 9LDTA 1SNYA 1ZCJA 3ZE8A 1XOIA 3TSWA 3ZCTA 2XAAA 4HHEA 3FWYA 5ALDA 3REQB 2Z1NA 5JY6A 1ZSNA 2HSZA 1JDTA 1U3GA 4PGFA 2J7KA 2PZLA 3ILHA 4YRSA 2O06A 3TBKA 3R4CA 3MERA 4DRXA 4RLQA 2A94A 1HA3A 4G0PA 2WYOA 4I5EA 1KEZA 4RKFA 4W5WA 5EYPA 2G40A 3D5QA 3M6MD 4IXNA 4UEQA 2E1RA 1H9BA 1PTJA 3VM6A 3W4JA 1TEVA 1S8NA 1WHTB 1XA4A 3O3OB 3CLSC 3HNRA 1YBHA 4MICA 1BN6A 2CL0X 5ALEA 4Y9UA 2FQ1A 2GCOB 2P1RA 3AINA 3FRIA 4UHBA 5MN4A 3C7KA 4ARZA 4DJJA 4BGIA 2IS4A 2ON6A 4JXKA 1G66A 2Q5CA 2WC1A 1XAJA 1A96A 3JD3A 3B3JA 5LOVB 1PEYA 3TGPA 2NADA 1GFZA 1Y1KE 1EFCA 3FHCB 4BNKA 3AX6A 1CHDA 2PMFA 1ODIA 2GA8A 5CH5A 2ZJBA 2XT9A 3UUFA 3WISA 2AZDA 3PGVA 5IAEA 2CXNA 2L69A 5IAOA 1F17A 1RJ9A 4O8ZA 5JFOA 2DH5A 3HUTA 2IPLA 3T34A 4GZLA 1LBIA 5LBTA 4LDAA 2VBGA 2Z30A 3GVCA 5FLEX 4BKUA 5LOVF 4EMUA 1PX2A 5KYXB 2QAJA 1IZZA 4YK7A 4WUTA 5JCOC 4G0UA 1G8HA 4X5OA 3BL5A 3L07A 4BO1A 1HLPA 1V45E 3S44A 3VO2A 1OJ7A 1O94D 1VBNA 3CWQA 3I23A 2COEA 1XA3A 3T12A 3KVOA 4IJKA 1HQYE 5T4HA 3KB8A 1Y6FA 3QELB 3DJFA 3JZIA 1HOTA 5EJGA 3OP1A 3H6KA 1PP4A 3OWXA 3CUUA 1Z62A 3GEPA 2GR9A 4HH1A 1XXLA 1T2FA 3E61A 4K8OA 4PSKA 1ZCZA 1KP2A 3OPYI 4KXUA 3LMKA 4YS6A 3U49A 4CR6A 5IJ9B 3MT8A 2O8BA 1OILA 3E0QA 4B3HA 2B8EA 2VDQB 2J0SA 3JWGA 1I9GA 5CYOA 4N3GA 4BN4A 3C4VA 3IQEA 4ZGBA 2OXTA 1YFLA 4K86A 5AT1A 3A9RA 3IS3A 1M2JA 4M0KA 3T3NA 2F4VB 3WK5A 2E4XA 1NQOA 1ZONA 2HQ1A 3QF4B 4FMCF 4PNPA 1V43A 2XQJA 1BC5A 1Q15A 1SCIA 2ZYIA 3N3BC 4GBED 2A1UB 1A9TA 4NPHA 2PANA 4XPIB 1RLMA 2DUWA 1T91A 5K51A 5KCMA 5FOQA 1IBRA 5KYNA 3E27A 2Y1WA 1E32A 1PHPA 3AV0B 1DIAA 1C9MA 4N7BA 1R6BX 3M83A 4F4DA 3CEHA 3KSBC 4HYTA 2H7YA 2JHGA 1E92A 4CCYB 5I6DA 4V02A 1U1IA 3UA4A 2N1MA 4BFLA 2BAGA 1UKEA 2BDTA 1X39A 3D0OA 3GD5A 4I5GA 4R1TA 3RS8A 3ZKAA 2Z5LA 5IDYA 3TOXA 4B47A 1QONA 3EWSA 4IDEA 1OLUB 1ZU4A 2HMAA 3ZHRA 3L8CA 2PV0A 2RSLA 4EH1A 4UMFA 1UKCA 1BDIA 4NZZA 2YWGA 1CSEE 1DKNA 1UBEA 1ULAA 2DKFA 2OGSA 2V54A 3Q3HA 1SG0A 3RBZA 3RIMA 4NS1A 1UZNA 4R98A 3FYUB 3PYLA 1B41A 1C4XA 1P6QA 2E6UX 1HFKA 2JIZA 4H3HB 3RVDA 2YR0A 2WWWA 3O8NA 3LM8A 3AF6A 1MRNA 4J91A 3EDCA 1XTKA 3A4IA 3N6RA 4NBNA 4B17A 3HDGA 3EXG2 4FQ8A 4YH1A 1KYYA 2B2CA 2VQDA 3LX8A 1HFEL 4H3SA 4KN8A 2GKOA 5I9MA 3WIEA 4D6YA 2H18A 1K4YA 2CE2X 1Q3TA