3WJAA

The crystal structure of human cytosolic nadp(+)-dependent malic enzyme in apo form
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
562
structure length
562
Chain Sequence
b'RRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-dependent malic enzyme
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural characteristics of the nonallosteric human cytosolic malic enzyme
pubmed doi rcsb
total genus 198
structure length 562
sequence length 562
chains with identical sequence B
ec nomenclature ec 1.1.1.40: Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)).
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wjaA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 3wjaA01
3F5QA 3TPCA 5K9ZA 3LQFA 2VUSA 3DWFA 3FI9A 2OFPA 1VPDA 1A72A 1ZUD1 3LLVA 2VHYA 2EGHA 3EK2A 1IPFA 2AHRA 4MIEA 4ZGWA 4TVOA 1MA0A 1I5RA 2AQIA 1F17A 2YHUA 3ZV3A 1SEPA 4CR6A 3WJAA 1XR3A 3AY6A 4CLOB 2CVQA 3ANNA 2D0IA 3KV3O 1CEQA 4I9HA 4ROSA 4AJLA 3A06A 3CPSA 4E0BA 1GYPA 1YS4A 4A7PA 1RYEA 1EVIA 1I2BA 4J0EA 1D8AA 3WQSB 1PZGA 1OMOA 4BKUA 5TJHA 3FWZA 1NQOA 4LGVA 5T5QA 3RJ5A 5BSFA 1I3MA 3U0BA 1PZHA 3KEQA 1E1LA 4XQEA 1BSVA 1GEEA 5AXBA 1M76A 1I01A 1R6DA 1MFZA 1MC5A 4NIMA 2EGGA 4MKXA 4RGBA 3MJCA 1HYEA 1Q7CA 2QZ9A 4U5QA 5A06A 3VPXA 4BO1A 3RWBA 4RPGA 2GZ1A 4XRRA 1G1AA 3ZWPA 2O3RA 1C1XB 1UZLA 1DB3A 3E9MA 4NJMB 4U0JA 3DMTC 1VRWA 4Z9XA 3C3XA 3JCZA 1R0KA 4ZHSA 1T1RA 3UVEA 4LVCA 1A5ZA 2O50A 2D1YA 2POQX 2VTEA 3BMNB 4WEQA 1NASA 3JV7A 3DHEA 3UXYA 2V7PA 1DIHA 5EJ2A 2D2IA 3WGOA 1QV7A 5BSGA 4ZRNA 1E3WA 5C5IA 3DHNA 4L4XA 2Q1WA 3IMFA 4R3NA 1UXGA 4WLVA 1BXZA 4P4NA 4BO5A 1U3WA 3ROKA 1I24A 2P4HX 2O2YA 1Q0QA 1Z7BA 2RHRA 2X6TA 3ZZNA 3B20A 3D4OA 2GLXA 1K0UA 3COSA 5A5FA 1ZVMA 1EQ2A 4RF5A 3OM9A 2IZ1A 1P9LA 1B8UA 1NVGA 2NUAA 2QX7A 3KHUA 4CQLB 5TIIA 2DBRA 4AJKA 3LLSA 1NHGA 4GI2A 1VKOA 3GG9A 5H83A 4CM1A 4IZIA 2Q46A 3NDRA 1R37A 3QP9A 2WD8A 2R00C 3GRPA 5BT9A 1O9BA 4FQ8A 4B4OA 3DB2A 3I9LA 3MCVA 3AOEC 3L4BA 1GCOA 3JD4A 4IBOA 3UN1A 3ZV4A 4YAJA 3PFFA 3LYLA 5G4KB 4KOAA 2D8AA 2HDHA 3S8MA 3BTVA 2HJRA 4YDRA 4CM7A 4BGIA 4YTEA 4D45A 1Y8QB 1JQBA 4P4LA 4BNYA 1GY8A 1P1HA 3H9UA 5I7FA 5G0TA 2ZB8A 2BHLA 3GEDA 3SEFA 4FPXA 5AXCA 3RC2A 3X2FA 3F1LA 3EVTA 1U5CA 3UHAA 1Q0LA 3ZU3A 3CZMA 2EP5A 5L4SA 4J2HA 2CY0A 1OFGA 4A10A 2DQ4A 2FOIA 2GRAA 3Q2KA 3INRA 4D79A 1E3IA 4BGEA 4CMAA 3U4CA 2Y0EA 1IB6A 3P2YA 5A9TA 1E7QA 2VZ9A 5L51A 3V1TC 1LX6A 4J9VA 1LTHR 4N18A 5EQDA 5IDQA 3DBRB 2LDBA 4YR9A 4UUPA 2C07A 1LSOA 4ZN6A 4K6CA 3K30A 2NNLD 1LI4A 1ISJA 1A9ZA 3KM0A 5ER9A 2I3AA 2RAFA 4H15A 1S7CA 3RFTA 2EKLA 4O0LA 5L7YA 4BS9A 4YRBA 1YQXA 4A27A 1RWBA 3ASUA 4YAEA 4RDHA 1UZMA 3HUDA 3WQRA 3E03A 3ONFA 3P5SA 4RF2A 1Y81A 4Y67A 4CMIB 1G6KA 5B4TA 3A4VA 1GZ6A 3U4HA 4DYDA 4Q9NA 1LLUA 4J0FA 1DRVA 3ZNNA 3ZU5A 3KTDA 4LCJA 2BMAA 4RVHA 3BZUA 4IDCA 5FI5A 1PS8A 5I8ZA 2X4GA 3DEYX 3NJ4A 3OBBA 3WGHA 1BMDA 2WD7A 4O63O 2WYVA 2F1KA 1YB4A 1KVQA 1PJLA 2I66A 3QHAA 3ONDA 4EUHA 1O94A 1P1JA 1B3RA 4XGKA 4JBHA 3O8QA 3PRJA 4ILKA 1F12A 4Q3DA 4UEJA 4HADA 2R00A 3UKOA 1SMKA 5JMWA 3IL2A 3DFUA 4F6LA 1CYDA 4U6QA 2V6MA 5F5LA 1FXSA 3AU8A 1PQPA 2TMGA 1LU9A 3RI3A 1HDYA 3CKYA 1LLQA 3FBGA 3D0OA 4BO3A 3TFOA 3BMNA 1DO8A 3ENNA 2AQKA 5B4VA 5U1PA 2H63A 5B4UA 3VH2A 3I5MA 1Z7EA 3O8QB 2B4RO 2EW8A 3U4IA 3GDGA 1N1GA 3QWBA 1P1IA 3AOGA 4FJ2A 4XQGA 1N9GB 1R4MA 4MP6A 4EZBA 4M89A 3BHIA 1A7KA 3EVNA 3QVTA 1DC3A 2OXIA 3LSYA 2X9VA 4FD3A 1DAOA 1E3LA 4CV0A 2PH3A 5EL0A 1QV6A 4DQUA 1BXGB 4INAA 3NTRA 1A4IA 4Q3BA 1NVMB 1FDTA 3FN4A 4IS3A 1NPYA 1WAMA 5DP1A 4R9RA 1P3DA 2C20A 3PGJA 4FFRA 4CQLA 1OC2A 3PJDA 2W4QA 3ROMA 3B6ZA 1LLCA 4XYGA 4YAKA 4NG5A 3TRIA 4D42A 3IKTA 3CMCO 4BMVA 4KTTE 2D5CA 1D1SA 2GZ3A 3DZJA 1H9AA 1Q7GA 2OMEA 1PGPA 4J9UE 2BFOA 2DUUA 1C0IA 1ZJZA 3E6AA 3RUCA 2NVUA 3EW7A 1PJSA 4OM8A 4ZQGA 5A9RA 1KETA 3IP3A 1N92A 3MJEA 1VJTA 3SJUA 4A0SA 2Z1MA 3GAZA 1X0XA 4PZCA 4QT0A 1X0VA 5JCXA 2OP0A 1UDBA 2NVUB 2HO5A 2ZIZA 4GL4A 3V2HA 4PLFA 1I8TA 2GPTA 3AI1A 4TROA 3IUPA 4JCOA 3V2UA 1MXFA 3IIEA 1E5LA 1TT5A 1ZCJA 3U09A 4FR5A 4JK3A 5TGDA 1Z45A 4E2WA 2PZKA 3SJ7A 5A9SB 1F0YA 3SXPA 1QYWA 1CRWG 3M2TA 1PGOA 5KOIA 4FN4A 4W7IA 3WGQA 2B83A 3S2EA 2G17A 1O95A 4CLRB 2W2KB 3ICPA 4UVDA 3JYPA 3VHRA 1T2CA 1X7DA 2VHWA 2X8LA 3TZ6A 5I8WA 3DMYA 1AHIA 1GU7A 4OMUA 5HRUA 2WE7A 2WE8A 4BNVA 2PH5A 4DLAA 3KYBA 3KEOA 4L4RA 4M49A 1S6YA 4IIVA 5U9CA 4NNJA 3KYCB 4IPTA 4MVJP 3H3FA 3G49A 1I3LA 1MC4A 1HSOA 4E30A 3RUDA 2ZJ0A 1YQGA 2RHCA 3IJRA 3NRCA 1I10A 4WCFC 4XKJA 1VM6A 2NTNA 1R15A 4FCCA 3ZU2A 1WW8A 1EE2A 2AG8A 3I83A 1ENYA 1ML3A 4R5HA 2I99A 4DWVA 4IGEA 1LRKA 4OAQA 3VTFA 1VL6A 1FDSA 2Y99A 5IN5A 3IS3A 5HS4A 2X5OA 2J3JA 1E6WA 1J49A 4MINA 3K92A 3UW3A 4BQPA 2UDPA 1H94A 3UAGA 1GPDG 4J7CA 3GMSA 2D5AA 4CLHA 4DC0A 2O2SA 3WYCA 1GQ2A 4ZQEA 1PGQA 1YOVB 4QO8A 3C1AA 4GH5A 2H5LA 3MJ4A 1EVZA 4IY1A 5KVCA 1F14A 1E3SA 1HLPA 1PZFA 2AQHA 4MVJA 4CM3A 1QYXA 2BFPA 3HJAA 5C7IO 1RJWA 1YQDA 4BKRA 3EHEA 4MPDA 2P5UA 2H1SA 4RVSA 4CMBA 2VNAA 3EZYA 4BHTA 2WJPA 2XOXA 2J5QA 4KTVE 3O4RA 4EYEA 5BR7A 1L7DA 4CM4A 1BWSA 2Y1OA 3E18A 4GVXA 3ZU4A 5JC1A 1H5QA 3HN7A 2IYOA 3C1TA 5JDCC 3KXDA 4MP8A 4Q39A 1BRMA 2PGLA 1CWUA 2WYWA 3BAZA 4JQCA 2NTJA 1K6JA 4GWGA 4UVEA 1YBMA 2PY6A 3GA0A 1D4FA 1EK6A 1YOVA 3K8ZA 5LCXA 2V6BA 2X0IA 3M6IA 5F1PA 3ITKA 4M86A 3TDKA 2WSBA 2O3SA 4DMMA 3MWDB 1DJQA 1UP6A 4WNCA 4HFJA 3O38A 2PZLA 3WJ7A 1JLLA 2Q50A 3BHJA 3FR7A 3AUAA 4WK6A 1TEHA 4E32A 4G81A 2OZPA 1IHYA 3GH3A 3ST7A 5C3MA 3KZVA 1XDWA 5L9AA 2GUGA 4HY3A 4UEOA 4BIIA 1QORA 3DZKA 3HHPA 2DPGA 3RU7A 4C7JA 2UYYA 3U3XA 3D3WA 3CMMA 1NTOA 2HRZA 2G76A 1BHSA 1YONA 2NACA 4XA8A 3RROA 3BMCA 3JQ8B 3Q6IA 4XZ3A 1KVUA 3ZDFA 5ENDA 4IXWA 4D46A 3KLMX 3LC1O 4FSHA 2PKQP 3A1NA 5H81A 3LF2A 4KDEA 4ZQFA 3EZLA 1LXCA 3QIVA 2EG9A 4CLXA 4TRJA 1XSEA 4N5LA 1R4NA 4JP2A 1R66A 2VOEA 1A4UA 2VOJA 2Q49A 4TZKA 1YBAA 1H6AA 2WEKA 4J49A 4RPKA 3WLEA 3BMCB 3JQ8A 7ADHA 1K6IA 2A9FA 3UGKA 1U8FO 4MVJD 1LJ8A 1P1RA 2DM6A 3DOOA 2OORA 4AVYA 3RKUA 4MP3A 3I6QA 3RFXA 2JFGA 4XDYA 1ZSNA 4J2OA 2LDXA 1Y6JA 1B26A 3FSRA 3OQ1A 4XYLA 4MVJI 3UF0A 3WWYA 4AL4A 1UXKA 5DCYA 3ZHBA 5GZ1A 2E4AA 1DLIA 3GZNB 1DDOA 3JQFC 3OA0A 4BL5A 2X9NA 3DC2A 4I8XA 5EINA 4IIUA 1Z74A 1P1KA 4PZEA 3VPHA 5C37A 1EUCA 2BFMA 3WFIA 1HT0A 5DF1A 5KNLA 1V35A 1J0XO 4ZQBA 2GZ2A 1X14A 1SCUA 5KKCA 1UH5A 3GR6A 5GY7A 3F1KA 1E7SA 4WOKA 3TZHA 4BKQA 1B14A 5K6AC 2VT3A 2G1UA 4EJMA 5JW6A 4K28A 2CSUA 5T8KA 3TF5A 3FCOA 4JROA 1N8KA 1I2ZA 1VI2A 3QWFA 4I5EA 3F3SA 4BVAA 4ND4A 3M1AA 3H5AA 3V1YA 5JDIC 1ZJYA 4TKLA 4BNIA 2BKAA 1F06A 4C7KA 1QYVA 1XYGA 2GCGA 4E6PA 3JYNA 5J23A 4NU6A 1LNQA 4WOJA 1F8FA 3DZGA 1P31A 1U3UA 5A9SA 4IQ0A 2PD6A 4CR7A 2HMTA 4DPKA 4RVFA 3EY4A 4MVJG 2YUTA 1QLHA 4EUEA 3P2OA 2GN4A 3ANMA 4I1IA 1IHXA 4PN3A 3EUWA 3ZH2A 5KWEA 4CLDA 4XJSA 3I9NA 4XB2A 2UUPA 1QKIA 3H5RA 4IDGA 2HMVA 2OO5A 3ZWAA 2VCYA 1ZMOA 1EUDA 4IDBA 4JP3A 1C3VA 1OBFO 3OA2A 3JTMA 3WOHA 1PJ3A 1W73A 1T24A 1YXMA 5K0ZA 2XXBA 5B37A 4ALLA 4XX0A 3AM3A 4DA9A 2EV9A 3QA9A 2DTEA 4DTIA 1E7YA 3JD0A 3BA1A 4RL6A 1W0CA 1EVJA 3VDQA 2D3TA 3VPGA 3PZBA 4CM8A 1ENOA 1HYGA 1V3VA 2QRKA 4W82A 3WLFA 4NK4A 2DTDA 4HX5A 3CINA 3ZWBA 4UUMA 1LDMA 3S2FA 3VZSA 2O7QA 4WLFA 1ULUA 3BMOA 3IC5A 4DXHA 1OAAA 5FYDA 3EC7A 3GRKA 2B5VA 4FW8A 1KVTA 3ZHZA 3GEGA 1PS0A 4B3JA 5JDIA 2EP7A 4CMEA 2EIHA 1QXSA 3NT5A 1E77A 3GFBA 4CQMB 2D4AA 4AJJA 3W4JA 1ISGA 1Q1NA 3PIIA 5FEUA 1ADGA 2BD0A 4OQZA 4OXNA 4LCEA 2PGDA 1HYHA 1PL8A 4O6VA 2GASA 4B7XA 1U9JA 4G5HA 3PK0A 2DFDA 3OJ0A 3TL3A 3F9IA 1CDOA 4IQ8A 4N5MA 1EZ4A 1HE4A 3PDUA 4MIOA 3ZN2A 3DO5A 4A26A 4JN6B 3RUIA 4E21A 5B1YA 3JQGA 4P38A 4B8WA 4R69A 3RC7A 3H9EO 4BMNA 2BGMA 2NVBA 1NWCA 2HMUA 3WNQA 1UR5A 2OL4A 3ZWVA 2NV6A 1LDGA 1QP8A 4FGSA 4KZPA 4XRGA 2C7GA 3DBVO 1LC0A 3FR8A 1FDWA 1YJQA 3L9XA 1B0AA 4IJKA 3JQ6A 2YHIA 4NHEA 3QRWA 4LK3A 5A1TA 3DBLA 1ZK1A 7MDHA 5DCUA 2AMFA 3E82A 3HB5X 2FR0A 5CAEA 5HWSA 3X2EA 2Y68A 3U4DA 2RH8A 2J3HA 5EIOA 4NBVA 3LZ6A 3UCFA 1D3AA 4ITUA 3BIOA 3KYCA 1NFQA 4BO2A 4Y6RA 2J6IA 5BSHA 5DNAA 4OQYA 1HEUA 1HXHA 5EN4A 2AW5A 3DBHB 5HBRA 4AJOA 4PG8A 2YJZA 3NTOA 3VZPA 1DBVO 1TLTA 1EVYA 4ZD6A 2HAEA 3A14A 4CMIA 4J91A 4X54A 1RYDA 3VC7A 5IZCC 1X1EA 3TOZA 3ZI0A 2FWMX 3RUFA 4E5YA 1C0KA 3AU9A 5ENVA 3I9JA 1ADFA 4D44A 4DL9A 4NFYA 5DDIP 5IDXA 3D5TA 1O6ZA 5F3RA 3DZIA 4EGFA 4BGUA 4ALIA 3VDRA 2YHIB 4UEKA 2WDZA 1ENPA 3PFWO 2FPGA 4R1TA 1ISIA 2AEMA 3AM4A 4YAGA 4A5OA 4PG6A 3AI3A 3A28A 3WYBA 1EQUA 1EUZA 2O7SA 3PHGA 3OP4A 3FTPA 5AXAA 5CDTA 3MEQA 5CEJA 2EKQA 3CTMA 3PIDA 4JGBA 4ND1A 3T7EA 5I9NA 4Z9FA 2AEFA 2JFFA 1W4ZA 3FF4A 3ORFA 3QV1A 2Y1DA 1VJ1A 3PWZA 2YV3A 3FWNA 4O59O 1X13A 4QX6A 4S1VA 3VZRA 1TVEA 2WWRA 2X86A 4UVGA 3DDNA 4BNTA 3GNQA 2X1HA 1DC5A 5JY6A 3H4VA 3G79A 4HBGA 3QW2A 4YJGB 4ZVVA 4GKVA 4CM9A 2Z95A 2C82A 2P9EA 3MJVA 4CQMA 1Q7BA 4WE3A 1SEVA 4PVDA 4RLSA 1MV8A 1DFIA 1PGJA 2PK3A 3FTNA 3GPIA 1CETA 2Y93A 1P74A 4FOSA 1C1DB 3UFXA 4BNXA 1Y9AA 1YKFA 1BW9B 4BKOA 5JAQA 1N1EA 2E37A 3HNPA 4Z3KA 3OEWA 4XDZA 2AEJA 3OSUA 3BHMA 4CLOA 3JQBC 2ZCVA 3FPCA 5KVVA 5KJEA 2V6FA 2YW9A 3ZHYA 3RBZA 1YB5A 4M8SA 5DOVA 3QY9A 4NDNE 4LSMA 1YVEI 1DFGA 4J16A 4U7WA 3NGLA 5IZ4A 3ASVA 5JS6A 3VH3A 5JAIA 1E92A 3LC7O 2NVWA 3KSUA 4GBJA 4JIGA 1HKUA 2A4KA 4GLLA 8LDHA 5B12A 5CDGA 3INTA 3RASA 3I9OA 4R4JA 3IUSA 3OECA 2ZK7A 2C29D 3RC1A 3ZW8A 5JBIA 4HKTA 4GX1A 1YDEA 4OSPA 3OICA 5JLAA 2NU8A 3WBBA 5ITWA 2JD2A 2PD4A 2Q4EA 1J5PA 3EDMA 2VWGA 4WGGA 4KWHA 3DOJA 4PCVA 1NQAO 2PD3A 1PL7A 2X0RA 2OBYA 2UVDA 4J1NA 1HDZA 1E3EA 2OGUA 3CIFA 5TT1A 5CDSA 5TLSA 3NUGA 3ZWWA 1X7GA 2JL1A 1MLDA 1AN9A 3K31A 2X5JO 3KVOA 2EJVA 1OC4A 1ZK0A 3OIFA 5A3VA 5L7TA 3GGPA 4W6ZA 1M6WA 1V3TA 5G4LA 1PIWA 1WXDA 4GMGA 3TWOA 1KBZA 3Q11A 4IUYA 1VSVA 1NAIA 3B1KA 3DL2A 1DAPA 2CNBA 4GX0A 2EKPA 1FDUA 2PA3A 5H82A 1NQTA 2A35A 1X7HA 3WGYA 3GMDA 1A71A 4XJTA 5I9LA 1T2FA 4O1MA 2VHZA 3DBRA 2CUKA 3GN2A 2HKIA 4JBGA 4RVUA 1SPXA 4FB5A 5FWNA 1H93A 4AJPA 3VTZA 3W8DA 4NFSA 4M54A 3OEYA 2QZZA 1U3TA 1T2DA 4QEDA 1PX0A 1E0DA 4EITA 3CSDA 4HXYA 1N7GA 2YQ4A 3P7MA 4MVJF 5CEEA 1CQIA 2FSVA 4PG4A 3K2EA 4DIFA 1PR3A 1NYTA 1JTVA 3UCEA 2DVMA 3AUUA 4CUJA 5T6BA 3DBLB 1H2BA 1QG6A 3OETA 5JMPA 1PEDA 3DZHA 4D7AA 4GX5A 4IZHA 5L7WA 3QLJA 5LC1A 2HUNA 2P2SA 5JYDA 4J1TA 4YYZA 4YJFA 1H6DA 1SO8A 3SC4A 4IINA 2UUOA 4GMFA 1PR9A 1MFPA 3MWEB 4FFPA 3IKVA 2XF8A 1JWBB 4XWYA 1Z6ZA 1YDWA 3U62A 2E48A 4BB6A 3V8BA 1DIAA 4ZRMA 1BW9A 4NZ9A 1KIFA 5COAA 3JYQA 4GSLA 2RH4A 4NI5A 3Q9UA 3JQAD 4HNHA 3W4IA 4B4VA 4YAIA 3NKLA 4RQUA 2WMDA 3KOUA 2X23A 5ICSA 1JKFA 5HA5A 1OZAA 3PLNA 1OOEA 1XKQA 3PYMA 1U5AA 1DPGA 2GGSA 4CMHA 3PDJA 5DBGA 3C8MA 3H8VA 3HQ4O 2BI8A 1D1TA 3H2SA 3ADPA 1EK5A 2Y1CA 4P22A 3SVTA 4IDAA 1DHRA 4BB5A 3BYZA 4AJ1A 2GYYA 1WDKA 1XELA 3B70A 3F6YA 1GYQA 2PKQO 3H7AA 2R6JA 1RM3A 2GR9A 3L77A 1NPDA 1PS9A 4AG3A 1Y5MA 4BOYA 2EXXA 1XGKA 4YCAA 2FP4A 1ZO8A 1SBYA 4EEXA 2IEDA 2X0NA 3F4BA 3R3JA 3RUAA 2C2XA 6LDHA 1GEGA 1I3KA 1M67A 2VTDA 5BQFA 3RCBA 1T4BA 1DJNA 4FIZA 4O5OA 4OHUA 2X7HA 1LA2A 3DTTA 5TS3A 2O4UX 3D3WB 2JCXA 3FNGA 1DC4A 1I0ZA 3QJ5A 1UXJA 5JNLA 3T4XA 1HETA 3QWHA 4QTZA 5JC8A 2J3IA 3HG7A 3OJEA 1LLDA 5EESA 1NWHA 3RFVA 3WMWA 2WM3A 3GN1A 1YL6A 4HUJA 3L9WA 4UUNA 3GQVA 3BTSA 1U4SA 4E2XA 1DFHA 4DGSA 1DHTA 3GNTA 4YXFA 1HZZA 4H7PA 4B7CA 3RU9A 4YPOA 3NYWA 3MJSA 1SB8A 1WMBA 4CUZA 4ZICA 4TWRA 2VUUA 2VRCD 4HV4A 3OMLA 3ULKA 4PG5A 4RJTA 1T2EA 4M1QA 5KKAA 4XYMA 1QLJA 3C7CB 4CL8A 4W7HA 1XQ6A 5DBFA 4JXKA 5G0WA 3LU1A 5IXYA 3FRJA 2DT5A 4NBTA 5T64A 3JQ9A 1LQUA 1ZH8A 5I9MA 3S2IA 4D3DA 1DXYA 1GQYA 4HFMA 4R1SA 2BH9A 2AQ8A 4CQMD 1DSSG 3RUHA 5CDUA 4BO0A 2GSDA 2W98A 1C1DA 3AK4A 3WYEA 4PLTA 4LW8A 1E1KA 3DXFA 3C7AA 1PJCA 4GQAA 4LMPA 4BNJA 2HSDA 3KB6A 3PGXA 2CVZA 1BXKA 3JQ7B 1A27A 1ZIDA 2VZ0A 4WCFB 4YVFA 4B7UA 3B1FA 4DIBA 4CPDA 4NK5A 3F46A 4NBRA 1HZJA 3K5PA 5KJFA 2DC1A 1HTBA 4JBIA 2PFGA 3MTJA 1XQ1A 1EE9A 4BO4A 2B5WA 1NBOA 1ONOA 3WSWA 4G65A 2FMUA 4E5KA 1ZSVA 1YH3A 4OH1A 4U0KA 4BNUA 4TQGA 4CR8A 1KYQA 2Q1TA 3GVXA 3O03A 4Y9DA 2W2LA 1AXGA 3JQEA 4YRDA 1BXGA 1V9LA 5JY1A 4TRNA 3WR5A 4KQXA 1UUFA 4URFA 4CODB 4XQ9A 2GNAA 3L6EA 1P0CA 3T7CA 4IJVA 4AFNA 3W1VA 4RDIA 4A03A 4DLBA 3K73O 5ILGA 5TNXA 1ADCA 3BTOA 5AQ1A 3OJLA 3MOIA 3QVXA 4WCDA 1PSDA 1ULSA 2IEBA 4L4SA 3IAHA 4A73A 2FSSA 1J4AA 3NDIA 3L6OO 2EF1A 1K89A 4R9SA 4Z6KA 4II3A 4BNGA 4CMCA 5JPIA 2E49A 3Q3CA 5T57A 1ISFA 1MG0A 1C14A 4B4UA 1ENZA 3UUWA 3NT4A 4MOWA 3OQ6A 4WCFA 1IPEA 1IUKA 3W8FA 4BNKA 4W99A 4YEDA 3WMXA 1GADO 1H6CA 2J5RA 3GT0A 2CF5A 3K6JA 1PU2A 2X22A 1UAYA 3PPIA 3GVPA 4PRKA 1CJCA 5L4LA 1GL3A 1P77A 4AJNA 2JD0A 1YB1A 3H9GA 3LF1A 5DZSA 3LK7A 4QUKA 1LC3A 2J8ZA 2ZATA 3GY0A 1IYZA 4BKPA 4DQXA 1EBFA 1ADBA 4ND2A 4ONEA 2G5CA 3H65A 1IOLA 1JW9B 1PJQA 2RCYA 4M55A 4XYBA 3WG9A 4B3HA 4CLEA 2VZ8A 3IJPA 3NGXA 2FHSA 3UCXA 2Q3EA 1H9BA 3Q2IA 3VH1A 1E6UA 3TZQA 5JCJD 1AUPA 4R1NA 2DLDA 4K9DA 2IXAA 4KP7A 4NJMA 5IAAA 4XEHA 4RZIA 1VE9A 2RBEA 3QVSA 5MDHA 2Q2WA 1GPJA 4PLPA 2EHDA 4XIYA 4OL9A 1EDOA 2BFAA 3WDSA 4DC1A 1Y1PA 4YJDA 2EERA 1LDYA 3JQDA 3R6DA 3AFMA 3GHHA 4HNGA 4IJWA 1GYRA 9LDBA 5KVSA 4OKNA 1XG5A 4EEZA 5DT9A 1B3BA 4MJLA 4TVBA 2DBZA 4BNMA 3GF4A 1O8CA 1QRRA 4QSMA 1PWZA 3JD3A 1V0JA 5JAMA 1TA4A 3V1UA 1IZ0A 1YBVA 2VT2A 4FS3A 5L3ZA 5KCZA 1M6HA 3AW9A 3TSCA 3EMKA 3RBVA 3PJGA 4RO0A 1JKIA 4DMLA 1E5QA 2YFHA 3W6UA 4MKRA 1PQWA 5CPBA 3LT2A 1YE3A 3GGGA 4L9RA 1DRUA 4WLNA 2IYPA 3TZKA 1P1FA 2E6UX 1N2SA 3WICA 3H3JA 2D59A 4IDDA 1P44A 1Y8RB 2DBQA 4IMPA 3E48A 3N58A 4KUEA 1MGOA 4RZHA 4WASA 4R3WA 5KVQA 4FC7A 2JJYA 4CM5A 2E82A 4J90A 2Q2QA 3DAGA 3RQSA 5EPOA 3CH6A 3F47A 3TFQA 5EQFA 3PJEA 2GERA 3PTZA 1U4OA 2DTXA 4YQYA 4PVCA 5TJ9A 3VKUA 3WS7A 1UXIA 4HFNA 1DIRA 5IJZA 1P33A 4EBFA 3I23A 2AE2A 4OXYA 3MOGA 2NQTA 1UJMA 4ALJA 1GUZA 4F46A 3NDJA 3AJRA 2C54A 2JFHA 4BNLA 2Q2VA 2VYNA 1XIVA 2AXQA 1LRJA 4GVLA 5IDWA 3QE3A 3WGGA 2VYVD 1AHHA 3VH4A 4XR4A 4Y98A 5CP8A 3ZWXA 4KUGA 3RD5A 4ZJUA 2BF7A 4OSOA 3FD8A 1K5HA 4RPLA 2ZQZA 5G0UA 5F1KA 1EBUA 4OGWA 5ER6A 3RC9A 1GQQA 1U1IA 1QYDA 3SC6A 3DAFA 3ABIA 3VOSA 1YL5A 5FF9A 3ZNOA 4D43A 1ZK2A 1FK8A 1P45A 4OYRA 4CM9D 2G0TA 2JD1A 1HDGO 4DYVA 4Z3DA 3ZWYA 2Z5LA 4RVDA 4DVJA 5IN4A 3B1JA 3DZBA 4M87A 2NM0A 1NNUA 3H5NA 4ALMA 2HK7A 2VYND 3N74A 5TQVA 3GLQA 1B16A 5CHEA 1TI7A 3E5RA 2ZB7A 3HN2A 4XIJA 4QFDA 4IGFA 3DQPA 3JQ7A 2Y1EA 1DEHA 5K6AA 2JCVA 1KY5A 1PTJA 3WGTA 4CV3A 1E7MA 4E5NA 3AFNA 2QYSA 3D5QA 4J7XA 1HF3A 4FGWA 4K1LA 1AGNA 4RVGA 1ZMTA 4PLWA 1RKXA 3ADOA 2OHXA 4K6FA 3LVFO 3S55A 1JA9A 3WIDA 2FY8A 1EMDA 3DONA 1YL7A 4IMRA 2YDYA 4PLCA 4YB8A 2G82A 3LDHA 4GPD1 4D3SA 2HMSA 1K3TA 3AUTA 2NTVA 4BMSA 2X5KO 3GK3A 1GD1O 4LSWA 4TSKA 4E5MA 4F45A 4JJFA 3C1OA 1FMCA 3FNHA 3OQBA 4CM8B 4DLLA 4DRYA 4EDFA 4E13A 4JJGA 3HADA 3JD1A 1UZNA 5EERA 2W2LD 3VZQA 1KVRA 4YA6A 4G2NA 1X1TA 1XU9A 2W90A 4ND3A 3GGOA 4ZU3A 1ZKMA 5IDYA 3BMQA 3AWDA 4JNKA 1H2HA 3JD2A 4AJHA 1ZXBA 3NTQA 4AJIA 1F8GA 1DC6A 4R1UA 4C4OA 4BNFA 2PGJA 2QIOA 1UXHA 2B37A 3M2PA 4Y8VA 3WXBA 5CEFA 3ZV6A 5FI3A 2C59A 1FJHA 1EFKA 1NR7A 4GX2A 3R1IA 1HE2A 3KUXA 2J3KA 1WMAA 4PZDA 3OFSA 1XA0A 4KWIA 4AJEA 2ZTUA 3AY7A 5AVOA 1NFRA 3PWKA 5FFFA 4YBZA 3GUYA 3SLGA 4D41A 2OBNA 5IFLA 4RCVA 2O3TA 3KYDB 2GD1O 1BDBA 1AE1A 4PLYA 3W4KA 1E7WA 2JKVA 2QRLA 2BLLA 4KMSA 1GDHA 4IXTA 4NPCA 1VC2A 2WD7B 4DIOA 2DU8A 3RIHA 5JSFA 1W6UA 2FR1A 1L1FA 1Z75A 4W4TA 3ON5A 1ZSYA 5DBIA 4I5GA 1J6UA 1MB4A 1BVRA 3D7LA 5G2OA 5A05A 3NV9A 3INGA 3GDFA 4D0SA 4Q3EA 4EW6A 1ORRA 3ETGA 2Q45A 3AI2A 1SZJG 5I7VA 1PZEA 3OJOA 3PYLA 4RPHA 1Q2XA 4BV8A 3KRTA 3MZ0A 3G0OA 1VJ0A 1DIBA 2CDAA 1M75A 2ZQYA 1L7EA 2CZCA 1NR1A 1SOWA 3DZFA 3E9NA 1P0FA 4BO8A 5F5NA 2VUTA 3H2ZA 2CFCA 1WDLA 3ZWMA 3I9MA 5A5EA 3GHYA 2EW2A 4PG7A 4MO2A 4E31A 4AICA 1I2CA 5GZ6A 4DBVO 3I52A 2ZYGA 4S3MA 3JQ9C 1JAXA 4R41A 1I30A 3D64A 3DTYA 3UH1A 3PVZA 5A4DA 3L4SO 3HB4X 1BVUA 1R0SA 1V6AA 4FFOA 3VKVA 4BO6A 3C7DB 3FHLA 3WTBA 4EI2A 1XLTA 2FZEA 1ISHA 5KTKA 3N7UA 1T26A 5GMOA 2VRCA 1O89A 4HFRA 1A9YA 2QYTA 4MKZA 4I9UA 4YRAA 1LRLA 2O48X 3PHJA 1GAEO 1I3NA 3D4NA 1KY4A 3WNVA 2YZ7A 2FPIA 4Q3AA 1EEHA 5TF4A 2ZTLA 3PP8A 4N54A 5COQA 4BV9A 2HQ1A 2HRBA 1FDVA 1NVTA 1WWKA 2FPPA 4QXMA 5C7OO 4J4HA 1HDRA 2B36A 1HE5A 2V65A 2XPCA 3L6DA 5CPFA 3K2BA 2EEZA 2NSDA 2JHGA 1R12A 3KLPX 1JKJA 3C85A 5KJ1A 2BI7A 2HK9A 1I33A 3DMTA 4PLZA 5L95A 3BMQB 1ISMA 4B79A 5AXDA 4BGVA 2A94A 1E3JA 4WEOA 4Y6SA 1PJBA 1ZZEA 4PLHA 3JQFA 3K96A 3TJRA 1K2WA 2J5KA 3PHIA 4N5NA 1ZBQA 1OI7A 2XAAA 5JE8A 2NLOA 2P9GA 5THQA 4DREA 5G0VA 3WQQA 2NU9A 4YJGA 5T67A 1LBEA 3KETA 2HJSA 4F3YA 1UDCA 3V2GA 8ADHA 5L4NA 3WX0A 4TKMA 4PLVA 4OO3A 2P9CA 1U3VA 4CV2A 3AUSA 1KC1A 4BNWA 1WDMA 5GZ3A 2ZB3A 2Y1FA 2CMDA 9LDTA 2QRJA 4NQZA 3F5SA 4WJZA 3WFJA 4QECA 3WWZA 5DCWA 3PQFA 3ZWNA 1QYCA 3ETDA 4OIMA 1KERA 2R2GA 3W8EA 1B8PA 2YDXA 1PJ4A 3WB9A 1U7TA 1T25A 4RORA 2P5YA 5A02A 1E3WB 3MTGA 3H9JA 3VAZA 4H16A 3G3EA 4CM6A 4YJHB 3CZRA 4OKIA 4PGFA 5THKA 1X15A 3D4PA 2JHFA 4F6CA 3ZWCA 5DN9A 3IP1A 4QO7A 5DOZA 2Y05A 4WUVA 3NX4A 1V8BA 5AYVA 1GV0A 1C1XA 4L75A 1ID1A 2BGKA 2GO1A 4DQVA 2PLAA 5HTOA 3ETEA 2I3GA 1EFLA 4B3IA 2ZB4A 1Y7TA 4B8ZA 3WGZA 4MVJE 1KC3A 1GZ3A 2AA3A 1B8VA 2NU6A 2TMDA 5TC4A 3UOGA 5G0SA 4I08A 4BQRA 1SNYA 3PHLA 3PI7A 1DOHA 3T4EA 3WTCA 3M1LA 2H6EA 1U7HA 4WNIA 2IZZA 2Y66A 1PQUA 1SC6A 1CQJA 1GUYA 1HSZA 4JX8A 4XD2A 1WVGA 2IODA 3RBXA 3EAGA 1Z73A 1GUFA 4E2YA 1K6XA 1O0SA 1QR6A 2YY7A 1WZIA 3OIDA 1PJTA 2I65A 3I3OA 4FJ0A 3E1KA 4IQGA 1DRWA 2QG4A 4NBWA 4WLEA 5ILOA 3QSGA 4FJ1A 3JSAA 4Z0PA 2H9IA 1PJ2A 3PJFA 4W9NA 4RLHA 3SX2A 3WSVA 2UAGA 3FBTA 3PHHA 4NBUA 2YFQA 1R16A 4XGIA 5LDGA 1AXEA 2YYYA 3LT4A 5L45A 2I5PO 3NAQA 3D3EA 4LRTB 4WKGA 2JCYA 2C5AA 5KJCA 2JAPA 4XR9A 2DKNA 5G4KA 2V6GA 5ES3A 1IY8A 4DBZA 1NAHA 4YQZA 3HZZA 2BRUA 4PFJA 3GEMA 2DPHA 4R5MA 4CMJA 4L73A 1XEAA 1Y5RA 1GCUA 1B7GO 4RF4A 2HMWA 2P4QA 4YT8A 2YQ5A 1XWFA 2OUIA 1PL6A 2O23A 1R0LA 3U49A 2IE0A 3IQDB 2W8ZA 4RF3A 4MVJH 3I9KA 5L40A 3Q9NA 4IDEA 1LQTA 2GDZA 1N5DA 3JQCA 4EJ0A 1PGNA 4KUHA 5TX7A 1NM5A 4JJIA 4GWKA 3TNLA 4IJUA 4UVHA 5TSDA 4LISA 5COBA 6ADHA 1ONPA 3GNSA 1H0KA 3HSKA 2YV1A 4ALKA 1NX6A 1VL8A 2IZ0A 2PWZA 3E8XA 5MGBA 3NEPX 1O5IA 3HDHA 3RAJA 4R01A 2IDZA 3PXXA 4FDAA 3DHYA 4NU5A 3CXRA 5BNIA 3GC6A 5JCJA 5KIAA 2CDCA 1LEHA 2UV8A 4OJNA 4WPGA 5F21A 3O9ZA 5JDCA 2XXJA 4BNZA 1BTOA 3ZHXA 4CL3A 1KVSA 2JAHA 2Y1GA 4GKBA 3HE3A 3AOEA 4A2CA 2IXBA 4DPMA 5BSEA 3H6KA 5JO9A 4XGNA 3PWSA 3W6ZA 4Y6PA 1G0OA 1VL0A 2WYUA 3FNFA 3R0IA 3HFSA 4NFHA 1LSJA 2GN9A 4CJXA 3ROPA 1TB4A 2VYVA 1V3UA 3GAFA 4P4GA 5IZCA 1NFFA 3ROQA 4YWJA 3JYLA 3ZCXA 3VPFA 1GZ4A 4KQWA 1WZEA 2FZWA 2NQ8A 4PLGA 4BO9A 4NMHA 4UAGA 4J1SA 1CIVA 4DUPA 1M2WA 1KOLA 3GG2A 2QQ5A 2SCUA 1LDBA 3UICA 1CF2O 4W9NC 1VSUA 3EYWA 3HFGA 4FBGA 4UUOA 4E5PA 4WECA 3IDSA 2EJWA 2Y67A 3RKRA 4D0RA 1ONNA 3DOCA 3K9QO 3HWRA 3OHSX 2OP1A 1DLJA 1NQ5A 5I7EA 3FNEA 3ONEA 3SBOA 2Q4BA 3ZW9A 3HDQA 4E12A 1B2LA 4NJOA 1T1SA 1WPQA 1ZEJA 1ZW1A 5BNTA 4R16A 4R51A 4I5FA 3L07A 2PV7A 4BUCA 1HDXA 2CD9A 2W2KA 1ZFNA 5HS6A 4ALNA 4D3FA 1ARZA 2B4TO 4OOEA 1MG5A 3STHA 1PWXA 4NR0A 1KEPA 3OH8A 5ITVA 2PZMA 4CMKA 1KEUA 1VKNA 4TMFA 4OOFA 1JU9A 1H6BA 3GVCA 3KO8A 2DBVO 2Q1UA 4U8GA 4J4BA 2C0CA 1Z82A 5JO0A 3SLKA 4IS2A 3G17A 4I9NA 4YT2A 2ZJ1A 1Q0HA 5F1OA 3GZ4A 1E1MA 3PLRA 4XCVA 1KS9A 1LUAA 3KSDO 2VQ3A 3IOYA 4ZA2A 4ESOA 5CG2A 5LDHA 1E6EA 2B35A 3LT0A 3JQAB 3H9QA 4FFNA 3WBFA 3LT1A 1SB9A 2GN6A 2X0JA 5EMHA 5IG2A 3CUKA 2DFVA 3U5TA 2VN8A 1RM4A 4J6FA 3RUEA 1JDJA 3PZRA 3GDOA 5CG1A 5HM8A 4YJHA 2AG5A 1NHWA 2BELA 2ET6A 3JYOA 3R3SA 5A03A 5A04A 4DPLA 4XQCA 1NXQA 5JYEA 4PIVA 3ANLA 3ENKA 2CF6A 4GLOA 3I4FA 1EDZA 1MXHA 1JWAB 1W8DA 5I7SA 4YACA 5T8KC 1R4NB 3V5NA 1SAYA 1UP7A 2HK8A 3DR3A 1C0PA 4CM4B 3E5MA 1ZNQO 1UAGA 3CE6A 3TN7A 3O26A 5IXSA 1MX3A 1NP3A 2VWHA 3OIGA 3P19A 4FC6A 4ID9A 3QQPA 4UULA 4OXKA 4CUKA 5KJ6A 2CVOA 2DUWA 3BMOB 4J1QA 2X9GA 4II2A 1GV1A 3U9LA 2NADA 3ZGYA 1RPNA 3F4LA 2ZYDA 4Q3NA 2B0JA 2VNSA 3ICCA 4RV9A 2BGLA 1I36A 3JQAA 4IDFA 3LC2O 2B4QA 3GVIA 3I1JA 2I67A 4YJFB 4CLRA 4QFCA 4L8VA 3GZNA 4EUFA 1QSGA 4U6SA 4FFMA 1T2AA 4GAEA 5DP2A 5DULA 1GTMA 1E1NA 2AE1A 3MJTA 3DFZA 4QQRA 1KEVA 4Z0TA 2DAPA 4MDHA 4J3FA 1RM5A 4E3ZA 2GF2A 1LSSA 4J7UA 2C2YA 2F00A 2FRDA 4GSKA 3QVWA 1IL0A 2PTGA 3VVBA 4CV1A 5TRTA 3JQGB 4ND5A 5JFOA 3A9WA 2P91A 4MVJM 3BTUA 3S2GA 3ZNPA 1WNTA 2CDBA 5U4QA 1YGYA 4FOOA 4Z0HO 1SOVA 1NPTO 1B15A 1JAYA 4B4WA 2A92A 1ZEMA 2VHXA 1HRDA 1FF9A 1C0LA 5JXWA 4BNNA 2ZKLA 1UP4A 3ZV5A 3GPDG 4PRLA 1HDOA 2OOSA 4WLOA 2Q1SA 2VHVA 1MUUA 3QVOA 2VRBA 1N7HA 2WTBA 4L74A 1YRLA 2O3JA 1MP0A 1G0NA 1ZK4A 1ZXLA 2PKRA 2HU2A 3OF2A 4EJ6A 2I6TA 4AJ2A 3HDJA 1XHLA 3GFGA 2O3QA 3TQHA 4K26A 4XYEA 5A3JA 2C7VA 3PYXA 2P68A 1IZ9A 3DBHA 4ZQHA 1Y9EA 3WIEA 4YT5A 4FFLA 1HDCA 4I5DA 1XU7A 3VPSA 4BNHA 3GUCA 5L53A 3G1UA 1U2DA 3C24A 3KBOA 4E33A 1HWYA 2Q99A 3ZNQA 1HL3A 1JVSA 1T4DA 4TZTA 3KYDA 1IE3A 4XB1A 2VWPA 3WGIA 3EGOA 4HWKA 1XCBA 1U8XX 2NWQA 1I32A 2YV2A 3GOHA 3ITDA 3QWAA 4H3VA 1UDAA 4IM7A 4R68A 3RSHA 4CMGA 4RPJA 1VLLA 3Q1LA 4Z9YA 4RQTA 4BO7A 3BXXA 1D7OA 4L76A 1U28A 1Y8QA 3E9QA 1BDMA 3GVHA 3JQBA 4KDFA 2X58A 3L4BC 1YJ8A 2C5EA 3ZWOA 1KEWA 1LSUA 1Y8RA 1E7RA 1M66A 3I6IA 3NJ8A 4NH4A 3PQEA 1WLYA 2QHXA 4J4TA 1TXGA 4YT4A 4UREA 3I4CA 1DIGA 1N9GA 1R4MB 3NT2A 3L0DA 1BGVA 2I76A 2O4CA 4UVIA 2NU7A 1U2GA 4Q3CA 3TL2A 3RJ9A 5TT0A 2ZTVA 3VVCA 2ZCUA 1LDNA 1RM0A 3KSZO 2PZJA 1HLDA 4N7RA 3PEFA 5C7LO 1TT7A 2Y0DA 4HP8A 4WLUA 5CFZA 4CMEC 4GGPA 5BNFA 5ICMA 1QMGA 2O3UA 5AOVA 2ILTA 2EWMA 4R54A 4L0QA 1HE3A 2GN8A 4JLWA 2RIRA 2I9PA 1JVBA 2HCTA 2ZTMA 4LN1A 4E2ZA 4TRMA 1ZK3A 2FN7A 1YWGO 2HLPA 2ZYAA 3CEAA 1CERA 3OJFA 5JAZA 3TZCA 3DAPA 4LRSB 5ADHA 4LVUA 5CDYA 3S1LA 3QWIA 1WP4A 2IRWA 2VWQA 4P8RA 3RVDA 3AM5A 3TOXA 3PQDA 1YO6A 4E4YA 2QW8A 1LDEA 1JN0A 2Z1NA 2B69A 1A7AA 2FR8A 3D1LA 4AJ4A 2PR2A 1GFSA 4J43A 1BG6A 3AY3A 1IULA 4TRRA 5IF3A 1GR0A 3Q0EA 3FPLA 3HDYA 2PNFA 2Y0CA 4MIYA 1TT5B 3G1TA 4LMRA 4GGOA
chains in the Genus database with same CATH superfamily
1UKVY 2X77A 5K9ZA 2PPLA 2OK7A 5TR9A 4CL2A 2IYNA 2QL7A 1P5HA 2OFPA 1SFRA 4L9SA 1GPKA 3TUJC 3O1LA 4F21A 3RBAA 4DIEA 4Q9IA 2VHYA 3WC4A 4H0NA 3EK2A 4G09A 2AHRA 4ZREA 3WKCA 5AI0A 4B3FX 1C9DB 3NH6A 4ILEA 4URZR 4D57A 3DDHA 3FMVA 1CIPA 4PZ9A 4MVCA 4LMBA 3M0EA 2ODNA 3Q40A 3DAYA 2CVQA 4DJTA 2D0IA 3AP2A 4MVYA 4ROSA 4HN4B 2X15A 1NMZA 1KZ1A 4IJMA 1GYPA 5B1SA 1YVDA 3N2KA 4FEAA 3IOCA 1QIIA 4PAMA 5KWSA 1RQNA 1EVIA 3QTTA 4NFLA 2QJOA 3PLAE 4TYWA 1V37A 4L6IA 3AF5A 2KHZA 4BKUA 3ZDBA 1N0UA 5TJHA 3DF7A 5CW1A 2OQVA 4HRYA 4BFUA 4I1RA 1X2EA 1BXRA 2AF3C 2QV7A 3DLTA 1L3IA 3KLOA 5GIPE 4ZGGA 2PUEA 5AXBA 2BZSA 1G5FA 4FHFA 3ECSA 3GJ5A 3DCYA 4AU1A 1HGXA 4CCSA 1XPRA 3MJCA 5IKEA 1Q7CA 2Z83A 3L79A 1XL1A 3PRHA 4U5QA 1FDIA 5CK5A 3UB4A 1JJ7A 1Z6TA 2R7KA 4BDSA 3QXHA 4E7OA 2RD2A 3ND5A 5BUCA 1Z29A 1NU6A 3F8SA 1UZLA 5AI5A 3QTLA 4U0JA 1CY7A 3E5NA 2GJ8A 5CA0A 2AT1A 1LTQA 4Z9XA 3C3XA 3FH0A 4GR4A 4U2BA 5GAJA 1UC9A 3JCZA 1R0KA 4W7SA 3U48A 2GWHA 2VDWB 2ATIA 3UVEA 1A5ZA 3GCZA 2BGJA 5L3QA 2D1YA 2VTEA 3B3JA 3T9DA 4Z7NB 1NASA 1PE0A 2WB4A 3CNOA 1OU0A 3JV7A 1SURA 2OTCA 2RAUA 3DHEA 4RJ2A 5CX1B 1KDYA 1TUBA 4DY4A 4YMGA 1E2HA 1DIHA 2D2IA 4NECA 1ECFA 2ECOA 2FPRA 3WKEA 2FMFA 5BSGA 1E3WA 3H1TA 4LI0A 2B61A 3PNLA 3D2CA 4H1UA 4GOND 4IFEA 1HKHA 1Y4SA 4D8YA 1J99A 5BSVA 3S7TA 1BXZA 1YIOA 1IEQA 4B4KA 1WHTB 1U3WA 2BE7A 1I24A 1FX1A 3PS9A 1Q0QA 1H5UA 3AJEA 5FWXB 1K75A 2ZJFA 3MFQA 3ZZNA 5K4GA 2GLXA 3T12A 3COSA 5A5FA 1VP9A 4IILA 1ZVMA 3QVGB 2FFJA 3AB3A 4PE5B 1SA0B 2Z2YA 5AUOB 1IK4A 2WABA 1P9LA 4HGOA 4CQLB 2FX2A 1U94A 1QCYA 2OK8A 5DGDA 1TM2A 2DBRA 5FTNA 2QRNA 3RS2A 1PUXA 2OM2A 2W8BA 1FDOA 2BFFA 2PRIA 1JB1A 2R84A 3H17A 4P36A 1XQYA 2OCLA 3A4YA 3I58A 3LVBA 4ZVRA 2X0EA 5I4BA 1M2OA 1WUIS 3ZY4A 1JYFA 1K9SA 1NHGA 2XLCA 4I6GA 3LHDA 5DI9A 5LKRA 2Z43A 3GG9A 4CT0A 5H83A 3UJ8A 2OWDA 2RHBA 2Q46A 4TV9F 4CM1A 1R37A 3LQ4A 1NXPA 3GRPA 2MYUA 2MSCB 3BQNB 3TAHA 2ZSAA 1D2NA 3AOEC 3L4BA 4GBMA 4UXIA 1EFCA 4O2AB 3JD4A 2XUHA 3ZV4A 1OB2A 4OI2A 1TECE 4ZMRA 4LXTA 5FAXA 3T35A 3TX2A 4EL0A 4N0DA 4L95C 3LYLA 4FHEA 5EYPB 2VEDA 3CW9A 3HZHA 3S8MA 2HJRA 2DHRA 2Z4SA 3BRSA 4YDRA 3WFZA 1RJEA 4H59A 4BGIA 4CM7A 3U16A 1Y8QB 3AEQA 3JAKA 3QQ5A 5CJJA 4YP1A 2G0AA 4QTUB 1NN0A 4P5DA 5G0TA 4JENA 4RTPA 1L4KA 2Q5EA 5HKLA 1NMSA 1TQ2A 3VUFA 4BFXA 1A7UA 3TR5A 2DQKA 4JI3B 1M54A 2CLOB 5TQ0B 1Q0LA 4FLEA 3ZU3A 1P61B 1US8A 1QR2A 1V96A 2VJOA 5L4SA 1CP2A 1EJ2A 2GKGA 3ZWDA 1C4OA 1FW8A 3CRNA 4A10A 4ECAA 4LF9B 1OVMA 2FOIA 2PUJA 3Q2KA 1K7YA 3INRA 4NP6A 4Q4JA 4D79A 4DCPA 2W6NA 2FI1A 1Z6PA 2HRCA 1JECA 4B85A 4CMAA 2XA9A 4UUAA 2I2WA 2Y0EA 3HV0A 3AIOA 5CLQA 4A1OA 3T54A 1DQSA 2XZTA 1UODA 3O0TA 4DG9A 5I9NA 2VZ9A 4HNQA 5L51A 5E8JA 3W8RA 1Y0BA 4J9VA 4D9IA 5EQDA 1E2KA 3DBRB 4W5NA 3ZTWA 4YR9A 4Z4GA 3P9NA 2R25B 4ZN6A 4LSGA 2NVOA 2ZWVA 1OAOC 2Q3HA 1C9EA 3K30A 1WF6A 2NNLD 4WK0B 3W5AA 1ISJA 2QZSA 3W1WA 3VBCA 5TGZA 3KM0A 4IX1A 1U81A 4U1RA 3QYFA 1N78A 3SOZA 2EKBA 2X5XA 4J07A 1F1JA 1FSPA 4I9GA 3WAGA 2H52A 1R10A 4BLTA 4YRBA 3K94A 4EKIA 2X3YA 5E7IA 1LB1B 2WHRA 3ASUA 4YAEA 4M46A 2BSAA 1KSGA 4BMYA 5ENZA 2B8WA 2PL1A 1EQAA 3JYHA 4LZAA 4ENRA 5HKKA 4MJ7A 3WQRA 3E03A 5CLIA 1F2TB 4UEQA 1P0MA 3I0NA 1VHTA 1GZ6A 2PCLA 1M8JA 3FIUA 1XUOA 2P3SA 3NYIA 1VFPA 2OXEA 2Q1YA 1DXOA 1LLUA 4JHLA 4JKYA 4Q9NA 4AUEA 1IZ8A 1I9CA 5ABPA 4LCJA 1DZ3A 2R6ZA 3RM3A 2BMAA 2VSYA 3BKWA 1WVIA 2G77B 4X93A 5AH0A 1PF7E 5I8ZA 1AZLA 2YR0A 4E88A 3FDFA 4ETWA 1UBMS 1BMDA 4Y9SA 5HZHA 3ZXUB 3DTNA 4EHHA 1T6NA 4XLLA 2GBCA 4NV1A 5CU7A 3WRYA 3W5CA 3NV7A 2DWUA 3ONDA 4GM1A 2V7BA 4EUHA 1IATA 2Z4RA 3WNBA 3EBOA 2Y4NA 3W6NA 2I71A 4QUIA 1BYUA 4PYJA 4RD4A 3SHTA 4UEJA 3M4JA 2ZUBA 4B1FA 2FEMA 4ISBA 1GTG1 4HADA 2R00A 3C3KA 4OJQA 5EMNA 2BEUB 5JMWA 2VP0A 4P4SB 4Y9RA 1XD2B 2BR4A 3RVMA 2RFLA 3AU8A 4JB3A 5K8LA 1XMOB 3LHSA 4X1IB 1EM6A 5JPDA 2CSXA 2A1TR 1B6TA 3EGDB 4NE9A 4IOJA 4UU8A 3RI3A 4F86A 3UMVA 3RSZA 1BS1A 3HA7A 4EPWA 2A9OA 2XD9A 3AG5A 4GPIB 1DO8A 3ENNA 4Q7JB 1AKYA 4QHYA 3SHQA 1JNXX 2FZKA 3V6MA 5U1PA 3ZI4A 2DZDA 3VV2A 3VH2A 5IBCA 5K6RA 4WINA 2QRHA 1TTPB 4P3XA 3WL8A 1ZCZA 4XM0A 4EKEA 2ZDQA 3IP6A 5EWMB 2XGGA 4NPAA 4XQGA 3WIUA 4YDSA 3OWOA 4M89A 1ODFA 2E4WA 1M2KA 1GNVA 1GG8A 4M4SA 3WZ2A 3QVTA 1DC3A 2OXIA 3LSYA 1DAOA 1E3LA 3HEBA 4F4UA 5EL0A 2PQ2A 1QV6A 3O2SB 1QRDA 1YZVA 1BXGB 3WK4A 1EXDA 3QSYA 2JCBA 1A4IA 2J9XB 3NTRA 1N2XA 1PP4A 1FDTA 2GN0A 3I0MA 2ZREA 3M5CA 2X8WA 1R9NA 3O83A 2IA5A 1SHLA 2GA8A 3HUTA 4M0MA 1OC2A 1U7PA 1MCZA 1JE0A 3OT1B 2JEOA 3ROMA 3UQYS 1JS1X 4ARSA 3VZCA 1LLCA 2DETA 4NG5A 5AJUA 2X5NA 1SXPA 4W9RA 4HQNA 3VO1A 3WL7A 4YGYA 4PPFA 2VHCA 3N2KB 3EXEB 5D01A 4YJ2A 1GFZA 4RKFA 4KTTE 1P5JA 1D1SA 1BS2A 2X8JA 2R8ZA 5G1PA 4IOKA 3DZJA 4HJRA 4LBZA 4J9UE 1Q95A 2CJPA 3VYUB 2DUUA 1C0IA 1ZM2A 2ZBPA 1V8DA 5K1ZA 3VU8A 4BRWA 1XLWA 4NCAA 4OM8A 2B8TA 2JIZD 1E0KA 2QJTA 1Z2NX 3TOVA 5A9RA 3E9EA 2RGCA 1JIVA 5CA1B 1FBNA 2Z1MA 1N2IA 3GAZA 2OGWA 2XGJA 2ZS9A 2O8DB 3KJHA 1X0VA 5KC8A 3KPVA 4GL4A 2FVXA 4I4CA 1FFGA 4PLFA 3STWA 2GPTA 3KKQA 4Q00A 1M1XB 3C74A 3IIEA 1E5LA 4LF4B 2H0RA 4JYBA 4HAOA 2EJUA 1OX5A 3JX9A 4FMCF 4NMWA 1JGTA 1T2VA 1SULA 2IPXA 5LB2A 2VP5A 1ND6A 3FUUA 4K81B 1PGOA 2DJIA 1M6NA 5GOTA 2HFKA 2KX7A 1VA4A 2WA1A 2OYSA 1VCMA 2VSFA 3JYPA 3AKDA 2X40A 3JVEA 5JALA 3NFRA 2BFNA 3TZ6A 4ENUA 1E1DA 2PX6A 4O4IA 5JWOA 2NYVA 5CB4F 2WE7A 2XMGA 3CNNA 2WU0A 3TEFA 2OGSA 5HFAA 3TPFA 2VHEA 1M0WA 1W0JD 3N5CA 3KWLA 2WD9A 1HYBA 2P7HA 4M49A 6REQA 3TG8A 4IIVA 5DBEX 1OWOA 3H3FA 1U11A 4M22A 2X9LA 5HX7A 4RAQA 4Z4IA 3RUDA 2ZJ0A 4LJ4A 4BMPB 3HCRA 1SQ6A 2ZIXA 3E9DA 3MVEA 4WN9B 4DMFA 5AM2A 1VM6A 1U1GA 2OV2A 5IC5A 3ASZA 3NBFA 1A5BB 5LLSA 3ZU2A 2ZRAA 1TMYA 3ZK7A 4PYQA 3UJHA 2G7MC 1EE2A 3EMDA 5DYTA 4UM7A 1IM2A 1U8ZA 3MAAC 4R5HA 2BUCA 3ZK8A 3U39A 4HS4A 1R9MA 2YQZA 4LY0A 2CCJA 2Y99A 2JJ1A 5HS4A 4WTOA 2H17A 2M1XA 4HDKA 4Z4QA 4BRUA 1KAGA 3GA5A 4TSFA 1G8SA 1CY6A 4WKBA 5C8XA 4NCJA 1C7EA 2UZAA 2G4LA 3HJNA 3ZCVA 5K09A 1GPDG 1GAQA 4NCBA 2R79A 3GMSA 1Z6AA 2A57A 2D5AA 4V38A 4YNBA 1CC1S 1NSYA 2NZUG 3O8OA 4MQFA 3CH4B 4M1YA 3H87A 4Q3OA 3GI1A 5HJ2A 3WYCA 1VL5A 1YCDA 2MOKA 4BV3A 1YOVB 4JA0A 4RK4A 1T8SA 2HSGA 3DOEA 4L3VA 5ED4A 1KFCB 4GH5A 3E9ZA 2CXRA 2V9ZA 3NS7A 3Q6MA 1ESDA 4IY1A 1H2WA 2JJQA 1C8BA 3D7RA 1SCAA 4WIAA 3IPXA 2I2AA 3QYJA 2HA4A 2GKOA 1RBZA 4CQJA 3C3PA 2PVPA 4XLTA 1NN1A 2V7UA 3PRYA 1KJWA 1LPPA 1JHRA 2EBUA 1JI0A 4D9NA 4O2RA 1RWWA 5C7YA 1JPVA 2OORC 1KY3A 1TU3A 1Y9JA 3EHEA 3QKRB 2VBIA 4MPDA 3DZ8A 3K6SA 3EIOA 1P72A 2P5UA 2UYQA 4GLJA 2H1SA 3F5DA 3N6XA 1L5HB 3EZYA 2A14A 3CR7A 3ILXA 4YP5A 1GRNA 5BSUA 3UJAA 3E7FA 5LD2B 4KTVE 3VR5D 3VRHA 2HMYB 2VATA 5BR7A 2OQRA 3C48A 2BT4A 4RL4A 3DGEC 3KLBA 4CM4A 2BFCA 3FOBA 3ZU4A 3TJZA 4MPRA 4GECA 3EDYA 4OL0A 3VSEA 5LNK6 4F4IA 3AO0B 2BDEA 4Q39A 3EXFB 3RR2A 1Y3FE 3AEKA 1B74A 2WYWA 3DO8A 3OLXA 3QXGA 4GT1A 4JQCA 2NTJA 1HOTA 4O2LA 5GONA 3EGXA 2Q3MA 1CY8A 1T4MA 2Y1XA 2PY6A 2WNHA 1D0SA 3C16C 2JDIA 1D4FA 3O2QB 3KCQA 3OPQA 4A91A 3K8ZA 5LCXA 1BWPA 3I12A 2FF7A 1HC7A 1KKLA 4CFZA 5I6DA 2IPLA 4D8UA 1P2GA 2NO9A 5FTKA 5F1PA 3Q3VA 5ICEA 3O8LA 3TDKA 4DMMA 5EMLA 1WG8A 2RGUA 2XMRA 1EP3B 1USKA 3NIFB 4WNCA 3RTDA 4FR0A 4J0GA 5J9FA 3AKEA 3FR7A 3VYSB 1V95A 3CCBA 1M2GA 1TEHA 1WM1A 1V26A 5H5JA 3LXRA 2IUUA 3CVYA 1DADA 4AT1A 3OZGA 4G0MA 4F5ZA 3DDZX 2OZPA 1IHYA 2IBMA 1WB9A 1Z3CA 2JBWA 4RE6A 1G98A 4HMOA 4KB5A 4UEOA 1DWOA 1NXSA 1UBGA 1P5FA 2ZYSA 3C2QA 2UYYA 2Q9BA 2ZULA 3HZOA 2Z3ZA 2R8XA 4R1TA 4GI3A 3D3WA 3U3XA 1BX0A 3CLVA 1C9NA 5KYUA 3OZTA 4QL3A 4C0SA 1GN9A 2NACA 1JF8A 4XZ3A 4DMRA 1YFJA 1KO1A 3N6RA 1TO1E 2BBWA 3KLMX 4GLBA 2ZJ7A 5BN3A 2QAGA 3KPWA 2DY0A 1N8TA 3EZLA 3TLXA 3U26A 1GRCA 1CLUA 1FU4A 2BGRA 2E1RA 4XFKA 3RVPA 4CLXA 4CKXA 4RULA 5JO0A 3MHPA 4TRJA 2CE2X 4MUKA 4GMHA 6ABPA 4WFJA 4KI7A 3ZGZA 3BWDD 5GGXA 1NT2A 5TF0A 4ZDIA 2C5SA 2X19A 3M4YA 1YBAA 1W5TA 1M5TA 1DL5A 1DTWB 3NBZC 3UT0A 4D8TA 4QRIA 2C04A 3GX1A 2AYZA 1TZMA 3LA6A 1RLUA 1K6IA 4FXOA 4BN5A 5I51A 2QTWB 3O4HA 2CLKB 4PAOA 1W5EA 2G9QA 1G41A 2J3DA 1P1RA 2DM6A 2ATVA 1DEKA 3MMZA 5DVZA 2X0FA 4GRIA 4DUGA 5FWYA 4DR5B 4WQMA 5DYYA 2MCFA 4MP3A 3RFXA 3NWPA 3T7IA 4YHHB 3BQ9A 4XDYA 3BEOA 4LQCA 4J2OA 3HYNA 2C5BA 4YFYA 2XODA 3FDZA 3OQ1A 3OLQA 3SSAA 3WWYA 4AL4A 2WF8A 2H1OA 5GZ1A 4TKZA 1B6SA 2WILA 3JZFA 2A9PA 3RHSA 4DWJA 3U7FB 4NNOA 1DLIA 2H3HA 1TMGE 1XXHB 2X9NA 3E81A 4IIUA 1Z74A 2VF2A 1FYDA 1I4DD 5C37A 3SR4A 2EFJA 5KYGA 4KNYA 2BTEA 3FPHA 1P17A 4PF1A 5DF1A 5KNDD 2C78A 5KNLA 1X1SA 4ZP1A 1RADA 3K35A 3TKAA 1SCUA 2XWPA 3GR6A 5KX5F 3GLIA 4BWVA 2F7SA 1ZJJA 2WWVD 4AD8A 1J8DA 2R7NA 1T5TA 3TZHA 3MS4A 3BWXA 1XDGA 5K6AC 1M1YB 1YU6A 3JWEA 4J0IA 4KVAA 2A5GA 1C3OB 1PLKA 2G1UA 3RSSA 1J8YF 3IUMA 1RU3A 3U7JA 5JW6A 1UJ6A 3E15A 2FFRA 4QBIA 5T8KA 1XZHA 1ATZA 2C1ZA 1I2ZA 3QWFA 3N8DA 2W6QA 1Y3DE 1Y6ZA 3I28A 4O1HA 4BVAA 4ZU6X 5BMVF 1N77A 1EWQA 5A0TA 3V1YA 2IOYA 2CLMB 1QH9A 3LOQA 4BNIA 1BMFD 2WV7A 3AETB 4YRLA 3X3HA 3I9FA 4OVKA 1A3CA 3H5VA 2GCGA 1QQ5A 5ANRB 1LNQA 3FZEA 1KF0A 3T3DA 5G3YA 3IILA 1P31A 2G1PA 1K7XB 1NI4A 3AR8A 3FROA 3GUHA 3TECE 1C41A 4IQ0A 1WHSA 4CR7A 4DPKA 2DXIA 2NO0A 2O0KA 3MLBA 5AFSA 2O7NA 1V8OA 3KVNA 2QD4A 2YUTA 4KQGA 4GE3A 5DISB 1SU6A 4EUEA 5FPTA 1CDDA 2GN4A 4FFVA 1QKJA 4NZMA 4DF3A 4YR7A 3LL4A 1R5BA 3EUWA 4PN3A 3P0JA 4CLDA 4XJSA 3O5AA 5EXSA 1O1YA 3I9NA 3RJMA 4E09A 3G0GA 1QKIA 2A6PA 1KJIA 2OO5A 1NJ1A 1E2DA 3KFVA 1KXJA 5KNBA 2CJWB 4X20A 1A8UA 3UT5B 3D8RA 4I1YA 3P9PA 4EHFA 1W0JA 4K9QA 4B3CA 1UF9A 3LV8A 2FJUA 4MH0R 2WKRA 2QMOA 1OBFO 4RADA 3JTMA 4L15A 3TRFA 3WOHA 5LIPA 2AI1A 3R7BA 2GCEA 1PJ3A 2CEAA 1U31A 1YBFA 3ZE9A 3C5WP 4V02A 3NHUA 3EA4A 1T5DX 1YXMA 1E79D 1XVUA 2HM7A 1P7CA 3PTAA 4XX0A 4K9LA 2O06A 2HF7A 4DA9A 2O2DA 3O8DA 1OH8A 1JJIA 2IUFA 2ZAMA 2F4VB 3P8ZA 2DTEA 5FOTA 4DTIA 4HUTA 1ODTC 3ZIDA 4RL6A 3LYUA 3PGLA 4C05A 1NSTA 4CM8A 5KYXA 3WLFA 1G2QA 1AKRA 4NK4A 1TJPB 5KI6A 3KJEA 3BGIA 5CM2Z 2VHUA 4GKJB 1GSAA 3LG2A 4Q03A 5KDOA 4G5FA 3NHRA 6CHYA 3KWFA 2K7ZA 4QYIB 2GOYA 3VZSA 4Q05A 1EXNA 3EPJA 1J0BA 3BMOA 3DHWC 2OGZA 1PR5A 4LDRA 5FLEX 5ALVA 4MTLA 4DXHA 4ZCSA 4AY2A 1TPZA 5FYDA 3EC7A 4PN7A 5A4MS 1GRQA 1XKLA 1WTAA 4HZIA 3V9PA 1GGJA 5FXMA 5ECWA 4CMEA 4X45A 2QPTA 1IMJA 1QXSA 4AC9A 2VDUE 1RI2A 4P0QB 4G89A 2PUHA 5EE3A 1E77A 3GFBA 4MWGA 4CQMB 5KYKA 1V1MA 2D4AA 3LW8A 4FNGA 1Z36A 1ISGA 5FEUA 4OXNA 1K27A 4LCEA 4RZXA 3QUTA 2X9QA 5CGQB 1K8XB 4AZ3A 2XZLA 2V45A 3OFND 2GASA 3SQDA 1J5EB 4NESA 4IZOA 2DFDA 1A2QA 2PSJA 4A4DA 4N5MA 1EZ4A 1X7WB 1MIHA 3ZN2A 1FUYB 2CHGA 2P0YA 5EHGA 4E21A 4B8WA 1BH6A 4R69A 3RC7A 1KI2A 3X44A 4BMNA 2NVBA 4NOKA 3WRVA 3B2NA 3WNQA 4IXNA 5A3QA 4IUDS 1G5HA 5ISMA 1UR5A 2TMKA 2PLNA 3R7LA 2NV6A 2PZBA 1TKAA 1X1BA 2QN2A 3DBVO 5AVZA 1LC0A 1D9ZA 1MZVA 2I8CA 1YJQA 3L9XA 3FZQA 3P2JA 4QOGA 4RVOA 3JQ6A 2YHIA 3E7XA 4NHEA 3TLBA 1E2FA 3VYVA 1WEHA 1SC3A 2RGNA 4PYNA 5DCUA 5JBNA 1ULZA 1FOEB 3DCIA 5CAEA 4K9OA 2WFAA 4I4NA 1QHEA 5FKJA 5BQPA 3V48A 3L0YA 5EIOA 1KEKA 1V7PC 3LZ6A 1D3AA 1KI9A 4OM7A 5FUXA 4MGHA 2JRCA 2R66A 1D0VA 3IB6A 5LMZA 1YK0A 3KYCA 3GD7A 3REFA 3IQEA 2J6IA 2GEJA 3E5HA 3IIJA 4JR1A 4MW4A 3ADDA 1T6BY 1HEUA 4FUQA 2XDAA 4IJ5A 4HYTA 5EIXA 4OA5A 1KJQA 2W6PA 5ERYA 5EN4A 1RABA 2AW5A 1EH5A 5HBRA 3SXJA 4AJOA 1LK7A 3VYWA 2WIBA 1DBVO 3QXCA 2P0AA 4KO4S 4LOKA 1UBUS 2HAEA 2O2XA 2NYAA 3VU0A 5D6OA 3I1FA 4W63A 1GCAA 5FIUA 4F92B 5LUAA 4C43A 4F38A 2H1VA 4XPIA 1HT1E 3VC7A 5IZCC 3UB3A 4K3VA 1NVVQ 2HCRA 2FWMX 2ZDHA 1T3ZA 4GICA 3ESDA 3CN7A 4TMTA 1X7YA 5I01A 2ZT5A 1T3GA 1PTJC 5LQDA 2ORVA 3WLMA 1O4VA 3EN0A 1K06A 1W88B 1SBZA 1W30A 2Q5IA 3A36A 3D5TA 1BWQA 3L7LA 3V1NA 2GM9A 3QBTA 4B2YA 2R8EA 2YHIB 2H51A 4EY8A 1ENPA 3DGFC 3GCDA 3PFIA 3QU9A 1ZIXA 3TLGB 3A4TA 2XQVA 2VUHB 2FPLA 3AI3A 5BV8A 3A28A 3U6BA 2JGNA 1EQUA 1EUZA 1AKVA 3PHGA 5CEJA 2Q1XA 2EKQA 1KYXA 3TUZC 4W5QA 1C3EA 2J3QA 1Z62A 3ZD9A 3H42B 3DBIA 4AROA 1HR0B 1F1BA 5CUQA 3RUPA 2B21A 2JFFA 3IVMA 3QMPA 1JHMA 5SZKB 3FPGA 2JARA 2PGAA 4MR9B 3QV1A 5DGXA 5K3FB 3QLVC 3CG0A 4HAUA 4UM5A 1VJ1A 3PWZA 3G0BA 3FWNA 4O59O 4X20B 4F56A 2CVFA 1A2BA 1G16A 4QX6A 4S1VA 3VZRA 4LS3A 1TVEA 4FDLA 3PX2A 2JLYA 4ZAGA 2ZRKA 1N25A 1H0SA 2X86A 3M9WA 4PO1A 4Q7LA 3W9BA 5DSZA 2RI1A 3I64A 4F0JA 3HFRA 1XQXA 1YJAA 4KQ6A 1DC5A 1O96A 3IRUA 4YJGB 2Z95A 5CA1F 2LBPA 4CQMA 1Q7BA 1ZA2A 2GZHA 2W2OA 3OX2A 1MV8A 1QV9A 1DFIA 3GPIA 4P35A 4ZAFA 3IYLW 5DFAA 5BV7A 1WA5A 4BRZA 3WLQA 5AW4A 1I7DA 1C1DB 1KPIA 1YKFA 1L4BA 2GVNA 5EXEA 4L8GA 4JC4A 2CN1A 5EIAA 3RFFA 5FOQA 3K70C 3VHQA 1UDRA 1V1RB 4XDZA 2DULA 1ZKDA 1I3CA 3B38A 3IXQA 3OSUA 2A9KA 2ZCVA 4C4ZA 3L5KA 4LF8B 5DHPA 1BQEA 1UMDA 3QM1A 3DD5A 2AOXA 2OAGA 2E2WA 3DNMA 1LNZA 1XCGB 2BGNA 3KSBC 4GUDA 4D74A 4JLJA 2ETXA 3KKKA 3K0AB 5C18A 1ULBA 1E92A 1XO1A 1N5RA 3AHCA 2PYDA 3BD8A 1VPLA 3PGMA 1GNPA 4GBJA 1HKUA 4QE3A 4JCCA 2WSIA 1QVRA 4BZZA 3NCHA 3Q2OA 2FUNB 4G0OA 4LBYA 4MV8A 1IONA 2C3PA 2QLJA 4H2DA 1B1AA 1XWWA 4BQQA 3ZDXB 3H99A 3N0VA 4MCIA 4R4JA 3IUSA 4WBNA 3OECA 3HCBA 1OB5A 3EG9B 1VZ2A 1CJMA 3ZW8A 3CUVA 3F8TA 1XRSB 4OSPA 1YDEA 2CXHA 2XSZD 3EZ2A 2JD2A 5DHQA 1N6LA 2WJVA 3KAQA 4WGGA 2D00A 4KWHA 1CUAA 4K0RA 4PNEA 1NQAO 4M1ZA 3IDAA 2Z8YA 4EY6A 2E18A 3II6X 3FBWA 5ICFA 3AESA 2LKDA 4OB6A 2OGUA 3CIFA 3JAKB 5TT1A 5HSGA 1ZM9A 3DW1X 1JIKA 3VR1A 5CDSA 3AR7A 4WNAB 5TLSA 2RH9B 3F74A 1X7GA 1XK6A 1Y3AA 2QMEA 1AN9A 3QU7A 1E58A 4OQLA 1LJUA 3ZJVA 2EJVA 4GYKA 4ARAA 4AZSA 1ZK0A 4EG8A 5KYYB 2D8MA 3N87A 3MYRA 3Q8WA 5L7TA 2XUFA 1F2DA 1SQ0A 1ZOOA 1FTSA 1M6WA 1QIDA 1U3GA 2C2HA 2QJWA 3MMPA 3PXEA 4GO1A 4WHMA 4YP7A 4EA6A 1YFLA 1A50B 5G4LA 3OIWA 2SKEA 3VMMA 1XZBA 2HK6A 3C97A 3FTCA 3QPDA 3PBKA 4UATA 3P9RA 3Q11A 3FUTA 5E2IA 4F8YA 4V1CB 3DL2A 3B9BA 4L3WA 1RQXA 2CNBA 3MWFA 4GX0A 2FETA 1FDUA 4ZDWA 1OXMA 3K1YA 3H04A 4XWAA 4YAWA 1NQTA 1M34E 3GMDA 4RETA 2ZJ4A 4XJTA 2A7QA 1JR3D 1FW6A 2C03A 2IYFA 3LKDA 1XRRA 1T2FA 4O1MA 3U7IA 4URXR 3DBRA 2CUKA 4JBGA 4RVUA 1ADJA 5FWNA 1C1HA 5DHSA 3CRQA 3OEYA 1NONA 4MYUA 4A0GA 4GQBA 1PX0A 1E60A 2DECA 5B7GA 2GJAA 3CSDA 1PAUA 3P9XA 1N7GA 1QQ6A 2YQ4A 1PL0A 3CV3A 3I04M 4A6XA 1CQIA 1EVEA 4ETMA 4KG7A 1Z2PX 5JD3A 1NYTA 1VMKA 2QVBA 2PSSA 5GJBA 1E2UA 2QVXX 5I3CA 2FGJA 4IHAA 1YR1A 2ZT7A 4XH9B 4Q16A 4KN8A 5E7JA 2XUAA 4R6WA 5K7SA 1TEZA 3A2KA 1T2UA 2UZ4A 4BYGA 1OQAA 1SRQA 1M9NA 1G3IA 5L7WA 4LJKA 2NZYA 4DJFC 4G01B 4IQ4A 3OZ7A 3UJ6A 3UV7A 5JYDA 1N33B 4YJFA 1SO8A 4F8EA 3OPYB 4IINA 4BMOB 5HJ7A 3I32A 3ZLBA 2UUOA 1YZLA 2QTNA 3VSDA 2PX2A 3ID6C 3IKVA 2XF8A 4D9HA 2WWGA 1XTIA 3LIIA 2QLNA 2DPXA 3NAMA 3WQHA 3NBXX 4IIYA 4OHWA 4BB6A 4QUJA 1PEYA 2GXQA 1ORIA 5HK8A 4OXIA 3V8BA 4IGIA 4EG6A 4B0PA 4PRYA 1CF9A 1IEVA 3O47A 5COAA 5DXAA 2ZVJA 1OAOA 4NI5A 1SD5A 3Q9UA 4RGYA 4HNHA 5AI4A 4YAIA 4H0CA 1TF7A 4BIMA 2DFPA 2OZKA 5J2UA 1NXTA 1X9IA 2QE7D 2XGOA 4A0QA 1RLIA 1TRKA 4HPWA 3CX3A 3ED5A 2XTZA 3HB9A 3BDVA 3OPXA 5HA5A 4YMVA 5BUQA 2VS1A 2XYRA 3GROA 2BFEB 1VCNA 4GDMA 2C5HA 3PLNA 1IQRA 3DVRX 4UU7A 5ITZB 3PYMA 1U5AA 1DPGA 3MUOA 4DEVA 5KNBH 1U8TA 1POXA 3H97A 3S2UA 1V48A 1VG9B 3CWQA 2G8LA 1EP9A 3MW8A 5EE9A 4HEA6 2NU7B 2CDRA 3ADPA 1RYMA 1ZLXA 3SVTA 4IDAA 2ZZMA 1DHRA 4JXZA 4X8LA 3WHKA 2XB4A 3ZD6A 3SS7X 4ZARA 1N0VC 3VHXB 4RA9B 3UMSA 2GARA 3F6YA 1GYQA 3V46A 1BKYA 1NV8A 5JHGB 1L1EA 2CCKA 4INPA 3EXAA 4B17A 2PX5A 1NPDA 3OZAA 1K68A 4YAUA 1XGKA 4Q4DA 3ZPXA 4EPXA 3M89A 2WTEA 3SC2A 2W0SA 1E4VA 1ZO8A 2IPNA 3CVJA 5KAMA 5KHLB 2X0NA 3N5KA 2UVPB 3RUAA 1I3KA 1OBHA 3E8MA 2BTOA 4UCQA 5EZYA 4DSUA 3KELA 1AJEA 1MQAA 2XWJI 2W2XA 3IMEA 3IX7A 3NR2A 3ZC3A 1AF7A 3V1MA 5BQFA 2QVCA 2ZZKA 1O77A 2GUWA 1UKCA 5TS3A 3NP7A 3VBEA 1I0IA 2R1VB 3BB3A 2B94A 4GMKA 1NVVR 1GZ7A 1I0ZA 1RLMA 1UBNA 3HB1A 3EFHA 3KKLA 3PEEA 1QOPB 3UANA 3R5HA 1QUFA 3W06A 4RTQA 1ILWA 3EEQA 4ZZ3A 4QTZA 3TLCA 4FLFA 1HTWA 3HG7A 3PCXA 4QSHA 1MKYA 2I87A 1P2TA 3HJUA 1HV8A 1PR0A 3NVDA 1MH1A 4KXMA 4PC3A 1I5EA 1M2EA 4X41A 3ZEAA 3ZYZA 1I7PA 1K08A 3H5IA 1KMCA 5HTKA 3L9WA 3DE4X 3BTSA 4I81A 2ONJA 1V45E 1SXJD 1GLGA 5ESRA 1UWVA 2IWRA 5MN6A 2FFQA 4GW3A 1BOFA 4A6DA 3RU9A 5SY4A 2HWWA 5C8VA 1CXZA 3ESQA 4GMDA 5CFNA 1Q0RA 5JXGA 4ZICA 4TWRA 1XEWX 2QSYA 2ATEA 1IOZA 3P9SA 4ZVLA 3ULKA 5CVDA 1LV7A 1NGSA 1I0LA 2VDLB 4RJTA 3LPCA 2V8BA 4MICA 4V0OA 1DBPA 5JNUA 1WABA 5JAUA 4AX8A 3EA0A 4R9VA 4IWYA 4WKPA 3W2EA 4JXKA 5G0WA 1DT5A 2DT5A 1Y1SA 4KSYA 4F84A 3KEFA 3WE7A 3QFFA 5I9MA 3A6PC 2XVAA 4ZV9A 4FEGA 2OV3A 4R1SA 1KTIA 3H1BA 3JWPA 3RUHA 3P4UA 3SVLA 2W98A 3ELUA 2B3DA 3PUIA 3ENWA 3RVJA 1XLTC 3H1PA 3AYZB 3BD9A 3DXFA 5H68A 3IBFA 4LMPA 2FLWA 2OZVA 2PWYA 2GCNA 5CFLA 2CVZA 2VG8A 1MEJA 2AVNA 2HFJA 1E9CA 1RKUA 4U4AA 4V3CA 1VTKA 5DEOA 2FPMA 4B7UA 1E8NA 1KO8A 4NK5A 2IV7A 1FYWA 4NBRA 3E7WA 3OUTA 1R9JA 3QHPA 3ELWA 3TR0A 4D26A 3DLAA 4KXLA 1NBOA 1ONOA 3WSWA 4Z4EA 2FMUA 2Y2VA 1G59A 2COKA 4OH1A 5IARA 4TQGA 1Y7LA 3GVXA 1DEXA 4M98A 4QQFA 3JQEA 3ORRA 4I6JA 4TV9A 2OLEA 3T5MA 2ZSFA 3FFAA 5JY1A 5E2BA 2XADA 4NVRA 4EDHA 1UUFA 2M1ZA 4MB2A 5AJTA 3NTUA 4UXJA 4CODB 3L8YA 4TTIA 3UXMA 1I2DA 2IP2A 2G67A 2O52A 3DTVB 4G9EA 3LT5A 4G5XA 5G53C 3W7AA 1SIBE 1U8YA 1NI5A 2LNDA 2QV0A 3HXMA 2KBEA 4QEZA 4HVAA 4EJ2A 1JLHA 3W1VA 1R8SA 3A6ZA 4DLBA 1P39A 1A88A 1NBAA 4W5RA 3QELA 4YRQA 3OJLA 3MOIA 4C08A 2J9RA 2YVQA 3KD3A 4KQ1A 1A9TA 5KREA 2E0IA 4B5KA 1IQUA 2PXXA 2FSSA 1J4AA 1TIBA 2B4AA 4EO7A 5I7OA 3KL2A 1ACLA 1K89A 4R9SA 2CD7A 4BVFA 4I19A 3K20A 2OV8A 1KSFX 5KTNA 1QTIA 2PQ6A 4KNVA 5T57A 5BN3B 5J5AA 5CD9A 1AK9A 1ENZA 3CLTC 4ML3A 4URUR 1AZTA 4WBSA 4GPZA 3D8SA 1IIBA 3LYHA 2IIVA 4MQ5A 1R18A 3K1JA 3PQ2A 4TS4A 4YRSA 3TPZA 3IIKA 3QEMA 3IRVA 1N2ZA 3HLYA 1UAYA 1CJCA 5EJEA 2Y3IA 2FPIB 1RXVA 2JD0A 4G85A 1YB1A 4E11A 2NZVG 4XM1A 3GUZA 3DYVA 5JH7B 4H6PA 5GM1A 2WC1A 1QF7A 3S3TA 4JVMA 2BHRA 1X1AA 4BKPA 1KAOA 4ND2A 3H65A 1HLFA 4PNHA 5HIJA 1JW9B 4CLEA 4B3HA 3R7WB 3ACDA 3SEQA 2VZ8A 1G20B 2PL5A 4DW8A 2FHSA 4H4DA 4UMEA 1RKBA 3FJOA 3K5WA 5BYJA 4HX2A 1E6UA 3A6GA 1AUPA 3U7QB 1JZTA 4HYQA 1N2GA 2EL7A 2MMGA 3R0VA 4NJMA 5GONF 2WR8A 1VE9A 3QVSA 1FS6A 1GPJA 4TWBA 1QIFA 3MTAA 5GM2A 1Z35A 3LBNA 3HVRA 2RC5A 2EZTA 1Y42X 2G71A 2Q5CA 3BCUA 1EGMB 3FHOA 4YJ2F 1Y1PA 4PHCA 1DAGA 3R6DA 1KK3A 1PDVA 1UQUA 1W5BA 4HNGA 4IIFA 1E1QD 2D74A 3W77A 5CGZA 3QXSA 4M2LA 1XG5A 4WRRA 4RABA 2AKYA 2PH1A 2HTEA 2OZLB 4MJLA 1M1UA 2Q9CA 4TVBA 3EH1A 3GF4A 1O8CA 1Q0PA 5G02A 2JS7A 4OHZA 3T52A 3JD3A 5JAMA 1IXKA 2H4HA 4YHBA 2GRUA 1LWNA 4EHBA 2VT2A 4FS3A 1TVKA 2ID7A 4LRYA 1G2PA 2GEUA 4LQDA 1LBHA 3EMKA 3OU7A 4JD5A 2JLAA 1VXOA 1L5LA 1W5FA 1FRQA 1SQ5A 4NYIR 4QUDA 5JFGA 2C0PA 3HXQA 3LGXA 1E5QA 2YFHA 4MKRA 4EJSB 3VXKA 3U7RA 1EXWA 2HF2A 2YJ4A 5CPBA 4CT4B 4K9KA 4LQLA 4YCBA 5C4IA 3ITNA 1AA6A 5K5EA 3CSUA 3LRXA 2QUKA 2IYPA 3I8SA 1LPNA 1P1FA 2AMLA 4JDUA 1NVAA 5H9VA 3TZKA 3QGMA 5I3ZA 5KB3A 4UBKA 1N2SA 1JSXA 1Z4QA 4YJKA 1DG3A 3H5TA 1XDDA 1PCXA 2WT9A 2YXPX 2PGXA 4MLCA 5FPHA 2JHAA 3GT7A 2DBQA 4IMPA 3RTEA 1XJQA 3KP1A 3GJRA 1L8OA 2Q5JA 4WXYB 3DDWA 4PEVA 4TV9B 4DHEA 1T8UA 3QA3E 3DFFA 2FPPB 4YRIA 1IDN1 2XBLA 1W85A 2R6DA 3PD0A 4NZYA 4ZVNA 4CM5A 1A82A 1OT5A 2CJWA 1HK7A 4J90A 1U3FA 3A4NA 3F47A 4ZVTA 1E6CA 4BQSA 5EQFA 2WA2A 4RY2A 3CKLA 1UWLA 2O0MA 2JGRA 3PJEA 3QF4A 4LQ4A 5DYGA 4OU5A 5TJ9A 4L2IA 1I3OA 1AXRA 1DIRA 1NW9B 3TVYA 3QBVA 1KMHA 2ZRBA 2AE2A 1F0NA 3MOGA 2NQTA 5SZIA 3WADA 1UJMA 5E3HA 3H0EA 4Z51A 1X1QA 4KGDA 4IL5A 2C9BA 5E1MA 2BR3A 3NDJA 2JFHA 2LIPA 4HXGA 4TLDA 1RI4A 1XIVA 1OBOA 3M9XA 5AK4A 5GADl 1C9KA 1W36B 3WLIA 4AIIA 2F67A 2LKCA 4Y98A 1FQOA 3T0FA 4MYSA 1SHZA 3EG5A 3ZWXA 4AZ3B 2R87A 3RD5A 1WBJB 1VCHA 3EIWA 2EEPA 3CUTA 4I1VA 4OSOA 1FYXA 4JJ6A 2WF9A 1GILA 1VJGA 4RPLA 2H1HA 5DJ5A 4RM3A