3WJAA

The crystal structure of human cytosolic nadp(+)-dependent malic enzyme in apo form
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
562
structure length
562
Chain Sequence
b'RRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-dependent malic enzyme
publication title Structural characteristics of the nonallosteric human cytosolic malic enzyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 198
structure length 562
sequence length 562
chains with identical sequence B
ec nomenclature ec 1.1.1.40: Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)).
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wjaA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 3wjaA01
4JP3A 2Q3EA 1HDZA 5I7FA 2DLDA 4RZIA 3CZMA 3RC7A 3EDMA 1TEHA 1J4AA 2Q1TA 3V1YA 1LLDA 1Z45A 3QQPA 2CUKA 3M6IA 3AM5A 4IJWA 3E8XA 2OFPA 3HQ4O 5C7LO 1LI4A 3AFMA 3F1LA 4BO7A 4I5EA 5L4NA 3R3SA 4F3YA 2GDZA 3AUTA 5GZ6A 2AQIA 4WGGA 4RJTA 2O48X 4I9UA 1QMGA 4AICA 4CMKA 2WD8A 4LCJA 2JKVA 5COBA 4CMBA 1EQ2A 4CODB 3HUDA 4HFMA 1X7HA 4CM8A 4JK3A 4MIYA 4XJTA 1E5QA 3L07A 3K92A 3O8QA 4FFOA 4MO2A 4O63O 4J16A 1WDKA 4FFPA 5DBFA 3ZWOA 3ZWAA 4XYLA 1ZFNA 1R0LA 4NK5A 3R1IA 4FJ0A 2PH3A 4ZQHA 4NBTA 1R4NB 2FZWA 4J1NA 4R1NA 3JQ9A 3MWEB 3Q9UA 4DXHA 2J8ZA 5ITVA 3LQFA 3I52A 3OQ1A 1BXGA 1GYQA 3E5RA 4MP6A 3GFGA 1YL5A 2BLLA 3ZNQA 4WLEA 3FR7A 5KJ1A 5CEJA 3L6DA 2PZJA 1ZUD1 1L1FA 3AJRA 3TNLA 4PG8A 5I7VA 3GDFA 4Z3DA 1AN9A 3P5SA 2BGMA 1ISIA 4OXKA 1KERA 2ZB8A 1I33A 3JQ6A 3O38A 2A4KA 3GHHA 3PYXA 4BO9A 1E3WB 3I4CA 3CZRA 1S6YA 4CR7A 1QP8A 4MVJP 4NBVA 5A1TA 4LMPA 4O59O 1NHGA 2FR8A 4RPJA 1PGJA 1PR9A 1GV1A 3UN1A 5COQA 4DMMA 3VVCA 5ITWA 3DOCA 3VZSA 3C7AA 3EGOA 1A7AA 4LISA 1LSJA 2QW8A 3O9ZA 3H2ZA 3ONEA 1UXHA 5IDQA 4A2CA 1GZ3A 4E2XA 1RM4A 4YCAA 3HG7A 4J49A 4TKLA 1KC3A 5L4LA 2IRWA 2OXIA 4CM5A 1UP4A 2EHDA 4HX5A 4F6CA 5ADHA 4MKXA 1PS8A 1HE4A 5EESA 3BMCB 3DZHA 3WG9A 3RUEA 1P1JA 5TQVA 4RPGA 4KTTE 4EUEA 1U9JA 2Q1SA 4YRAA 3FR8A 2B4QA 4K26A 3IJRA 2CF6A 3IUSA 1P31A 1CWUA 4RV9A 4O6VA 4AJJA 3MJCA 4UVGA 1EVZA 1Y7TA 3P7MA 1F12A 2XXBA 4BNZA 2GN4A 3G49A 3H5AA 3OEYA 3AY3A 3LC2O 4TRJA 3ENKA 3GG2A 3GZNB 3DBHB 3JQAA 4WEOA 1V9LA 2ET6A 3GF4A 4EJ6A 1VJTA 4EEXA 2I66A 1Z7BA 3NT2A 4EI2A 1LRKA 3EVTA 1J0XO 4XGNA 4Z9YA 1JVBA 1DJNA 4U7WA 4J4TA 4JN6B 4I9NA 4XDZA 5U4QA 1WVGA 4PLVA 5ICSA 1FDUA 4XQ9A 4W7HA 3DZFA 3RBVA 2UAGA 4BKQA 2Q50A 3JV7A 2VYVA 4DL9A 5K0ZA 3E9QA 2FSSA 3LDHA 5DF1A 1GPDG 1A71A 4QEDA 1M76A 2FMUA 3TOXA 4GAEA 4FW8A 3PEFA 4XYGA 5BT9A 1N9GB 4YAIA 3DBLB 3OP4A 4N18A 5JAMA 3PGJA 1N7HA 3BMNB 3ZNNA 4BO2A 2ZTVA 4FIZA 1E7MA 3WR5A 2C5EA 2CSUA 3MTGA 4RF2A 1VLLA 1P3DA 3RU7A 3NKLA 1NBOA 3CTMA 1JLLA 2ZB3A 1W4ZA 1C0KA 1PX0A 5EERA 4JBGA 2ZCUA 4AJ1A 1LX6A 4XRGA 2GN6A 5ER9A 1BVUA 3IL2A 3QE3A 5CG1A 1NAHA 4HNHA 4IDCA 2AG5A 3N7UA 1PU2A 4J4BA 2BH9A 1EMDA 3RI3A 4IPTA 4FB5A 1GDHA 2YV1A 1DFHA 4ROSA 4R1TA 4UEOA 3AI2A 1YB1A 2C2YA 4FPXA 5JDCC 5FWNA 4CQLA 1QLHA 2ZQZA 4YAJA 3CSDA 2IDZA 2BFMA 3PHGA 2DBRA 3H8VA 4FDAA 3UFXA 1SC6A 5JDCA 3V1TC 3NDIA 4KUHA 1QYVA 3NV9A 4Q3CA 1A27A 3AU8A 5IDYA 2OORA 4YT4A 5A4DA 1I30A 3D3WA 3QVWA 1KVTA 4NBWA 4ND3A 4G81A 4CM4A 3I23A 5FYDA 3RBXA 2GZ2A 1TI7A 4GGPA 5I9MA 3GMSA 4DYVA 4R16A 3VZPA 4FGWA 2O3RA 2J5QA 2VT2A 1Y9AA 1YJQA 1EVIA 3E9MA 1U5CA 3LU1A 3U0BA 4WASA 3V8BA 5A5FA 1H2HA 4I1IA 2NVUB 4XWYA 4F6LA 4A7PA 1YGYA 2FPGA 5KJFA 5A03A 3CUKA 4YRBA 1CQIA 2NWQA 1E1NA 2JCXA 2ZIZA 4FC7A 4W6ZA 3WXBA 2PGLA 2ZCVA 4Y6SA 2LDXA 1EZ4A 4DPLA 3I5MA 1P1FA 3PDJA 4DIOA 2O50A 3I9JA 1U3TA 4IJKA 3ROMA 3FI9A 3UOGA 4IJVA 3TZHA 3JSAA 1YWGO 1EUCA 3QVTA 2F00A 2RHCA 1LSUA 3NTQA 4TVOA 2TMDA 3GPIA 4C4OA 5TT1A 3VH4A 3K2BA 3TOZA 4J1SA 1FDWA 4YAEA 3WFIA 4JCOA 1MB4A 4MJLA 2AQHA 3U4CA 2C7GA 1E5LA 4YACA 3ZI0A 4NJMA 4WNCA 3JQDA 4QUKA 5KKCA 4IGEA 3OM9A 4GPD1 1ONPA 4BKPA 3I9NA 2I67A 5DP1A 4BKOA 1DRVA 1V8BA 5CDGA 3NRCA 2IXBA 1NFFA 2NU7A 1MG5A 1ZJYA 3OA0A 2VRCA 1I3NA 1RYEA 1Y6JA 3GT0A 3NX4A 3STHA 3WB9A 4BNNA 1GZ6A 1Q7BA 1M66A 1Z75A 2HO5A 3OH8A 3V5NA 2P9EA 1LJ8A 4Q3BA 3MJTA 2JD0A 4YWJA 2UVDA 3WDSA 3FF4A 1YDEA 3CKYA 3U4IA 5IN5A 4XX0A 1HDXA 1F8GA 3NGXA 1HXHA 3GFBA 1FK8A 1GCUA 2V6FA 4E21A 2C82A 1YRLA 3PTZA 5K9ZA 3HE3A 2C7VA 1K6JA 4AJ2A 5A3VA 4GLOA 3VH2A 4AL4A 3JQAD 3D3EA 5F1PA 2RH8A 1PJLA 4CV3A 2CVQA 4OKNA 3WGQA 1JAXA 1GY8A 4OSOA 1XIVA 4YJHB 1WXDA 1JU9A 4XIJA 1O5IA 4DYDA 2VYVD 5B4TA 1ML3A 1P33A 4MVJA 2CDAA 1L7DA 5TRTA 4ALNA 5JLAA 3WJ7A 2X4GA 4NR0A 5C7IO 4PIVA 4ZA2A 3TQHA 4A0SA 2C20A 4M8SA 4YT8A 3TL3A 1E6EA 4UAGA 4E5YA 3KOUA 1Y8QB 1HYGA 3SEFA 3AOGA 3FHLA 3DHNA 1IULA 1OC4A 1RYDA 3KZVA 4FFMA 5EN4A 1E92A 4P38A 5IZCC 5B37A 2YHIA 3D0OA 1K6IA 1DSSG 2NLOA 2GPTA 3HADA 1N92A 4CR8A 3IS3A 1NX6A 4LW8A 1T1RA 5IZCA 2W90A 5J23A 4PCVA 3QVOA 1EQUA 2DC1A 3GNTA 4RDHA 2P5YA 1A9ZA 3RUDA 4WCDA 4J4HA 1WLYA 5I9LA 3OECA 3PXXA 1YS4A 4ZQFA 3GA0A 3JQCA 1NVGA 3KYCB 1HL3A 5KVSA 2WEKA 4TVBA 4XB2A 5EL0A 4QXMA 1U7TA 2Y0CA 2W2LA 4RF4A 4PRLA 3V2UA 3Q2KA 5DP2A 4BNHA 3U62A 1R4MB 2BGLA 4YJFB 1E6WA 3ZV4A 5JC8A 4J90A 3DQPA 3RUCA 1HDYA 4AG3A 3T4XA 4R68A 2QHXA 3BTVA 3GHYA 1J49A 1OMOA 3KLPX 1DFGA 2IE0A 3DO5A 1HDRA 1NTOA 2IZ0A 3LT1A 4EDFA 2WDZA 3LF1A 3UVEA 2OMEA 4MVJG 2HCTA 1NYTA 3PDUA 4BMSA 5DZSA 2IYPA 4PLZA 1K6XA 3ROPA 4B4OA 4Y6RA 5T5QA 3GNSA 3GG9A 1B7GO 2DTDA 5JNLA 1HZZA 4LRSB 2J3KA 4WOKA 3DL2A 2EEZA 4BB5A 3L9XA 4GL4A 1UZNA 3WOHA 1KVQA 3JQGB 3DDNA 5JYDA 3GGGA 3QV1A 1N2SA 1NWCA 3LLSA 3ZNOA 4DIFA 1R16A 1PGNA 3ZHXA 4DC1A 1ISHA 3PHHA 3ENNA 3WLFA 2BFAA 1GEGA 2G17A 1QYXA 3OBBA 2GRAA 4PG6A 3ANNA 4E33A 1E3IA 3C1TA 4ND1A 2ZJ1A 1NR7A 3QA9A 5F5LA 4YYZA 3ANLA 4PVCA 3MOGA 4B4VA 4EW6A 4FS3A 1PGQA 4YT5A 1CDOA 2E48A 3INRA 3BA1A 2EV9A 2VHYA 3NJ8A 3C8MA 3PHIA 4E30A 2CNBA 4WECA 4FC6A 4BGIA 4RGBA 1V3TA 4MVJM 1NVTA 1RWBA 1YBMA 3FPCA 2NADA 3QWHA 5I7EA 3MJSA 1A5ZA 4HY3A 3DBRB 4BO3A 2DUUA 2VN8A 4TRRA 1ZBQA 1ZEMA 1EK6A 3KSUA 5HS6A 2R6JA 2AEFA 2EERA 4FN4A 1XDWA 4K6CA 2VYNA 1LDEA 1UUFA 2Y68A 5ENVA 3TL2A 1ARZA 4OXYA 4A73A 1D1SA 2GN8A 1G1AA 1LRLA 4H3VA 4IMPA 1UP6A 1X7DA 2VRCD 4J43A 4FFLA 4LCEA 1CERA 3WMWA 2VWHA 1SZJG 4F46A 1ID1A 1ZXLA 2ILTA 4A03A 4CMCA 3CMMA 4PG4A 3GVIA 1B8PA 2PR2A 4JJIA 1ZK4A 4HBGA 4QFDA 3D4NA 1T2FA 4D79A 1I36A 3WWYA 1YVEI 2P2SA 1Y5MA 3AWDA 2X86A 3GVCA 4CMGA 3QWIA 1B14A 4BNTA 4D43A 5KJEA 1NM5A 2X23A 4E2WA 2EG9A 4GKVA 2B36A 2FWMX 5B4UA 4Z0PA 1V3VA 2Y1GA 3VTFA 3ZGYA 4PLYA 5DT9A 5L9AA 5HWSA 1X1TA 1U8FO 4QTZA 1SEPA 5LDHA 3HDYA 3ONFA 1ZEJA 5CDSA 1TT5B 4EITA 1WP4A 3DBVO 4BO5A 1Z82A 2IZ1A 4GH5A 1U3UA 3IAHA 1NFRA 2DBVO 3PRJA 3Q9NA 4MVJD 4N7RA 5TSDA 2X5OA 2VWGA 1H6DA 2Y1DA 3IP3A 2I3AA 2AQKA 2V65A 1OZAA 1DAPA 4M1QA 4NU6A 1PQPA 3Q2IA 2WYWA 4FJ1A 3WGGA 1E7QA 1MFZA 3SLGA 5C3MA 1I3LA 1T2EA 4QX6A 4HV4A 1JKIA 2CDBA 1ZSNA 3BTOA 1ZK1A 2EIHA 5KJCA 4IJUA 1BWSA 3H4VA 5F21A 2WTBA 3AI1A 5T8KA 1YKFA 4LSWA 2CY0A 4IUYA 4RVGA 3BHIA 4KMSA 1F14A 2EW8A 3DTYA 1NPDA 2RIRA 1UAGA 5DN9A 4BIIA 1C1XB 1XU9A 2PFGA 2Q2WA 5AYVA 1VI2A 1SOWA 5JY6A 4UUMA 2GD1O 3P2YA 1KETA 4GVLA 4KQXA 4H7PA 2NQTA 5CEEA 4I08A 2HMTA 4RF5A 4PLGA 4A26A 4OSPA 2DBQA 2OBYA 1LNQA 2W2LD 2EF1A 3VKVA 1VC2A 5DBIA 3UUWA 1ENPA 2C0CA 3BTSA 1PWXA 1EUDA 2VHZA 2ZQYA 3HSKA 3MZ0A 4MP3A 5A9SB 2DQ4A 1NPTO 2PH5A 2O3TA 3PIIA 2Q1WA 3N74A 4M49A 3DFZA 4ND4A 3DMTA 3RUFA 4NH4A 3FSRA 4GSKA 4BNXA 1I0ZA 5G0TA 1H6BA 5CG2A 3NDRA 4IS2A 4RORA 4KP7A 3PJFA 5IDXA 1ZMTA 3PWSA 4FJ2A 3ZU2A 5T64A 2PNFA 1EVYA 1I32A 3HB5X 1HYHA 1JW9B 3EMKA 4O0LA 3I6QA 5CFZA 3D64A 3PGXA 4FGSA 3GGPA 4O1MA 3ZN2A 1AUPA 1Y8RA 4J6FA 4R5MA 1X0VA 2CF5A 3R0IA 3ZZNA 4CUZA 1IY8A 1GAEO 1GQ2A 1E6UA 1BW9A 4W99A 5TT0A 3DB2A 4H16A 3BMOB 3NUGA 4WCFB 3ROQA 1O9BA 1IHYA 4CLOA 4DQXA 1PL8A 4AJPA 3WSWA 2H5LA 1T2CA 3TPCA 5CDYA 1H94A 2QQ5A 3ZWPA 3GGOA 1YBAA 2OZPA 4BO1A 4M87A 4L4RA 4QT0A 3GY0A 1DRWA 3G1UA 3F47A 1EK5A 3IP1A 2HMVA 3G17A 1ENYA 1L7EA 5BSGA 4YJGA 2DPHA 3ZW9A 1ULUA 2D1YA 1I10A 3F46A 1HTBA 1PL7A 4KDFA 2G76A 1FMCA 1QKIA 1YB5A 2VRBA 4XD2A 3RC2A 3RVDA 3ZWBA 2FOIA 4WLUA 5JC1A 1K3TA 3WTBA 1F06A 2B4RO 2LDBA 3QIVA 1KVSA 2VYND 5FI3A 1HDGO 5LCXA 3AUUA 3U5TA 2Z1NA 2QRKA 4ZICA 4HADA 2IEDA 1BMDA 3RKUA 2B69A 1SNYA 1T25A 4J1TA 3BMQB 4NIMA 1YJ8A 2BGKA 3PVZA 3VZRA 2VUSA 1YBVA 1HYEA 1V6AA 1BG6A 1PQUA 4CPDA 3UGKA 2FHSA 5BQFA 1XEAA 1WPQA 4JGBA 2O3JA 2X8LA 3Q11A 3DZKA 1Z74A 4TRNA 3RQSA 3NYWA 3H7AA 2X0JA 4PLHA 2EXXA 1DAOA 2C07A 2X5KO 4D3DA 1LDYA 5BR7A 4RLHA 1G6KA 2JD2A 5IXYA 1CEQA 3JQ9C 3RUAA 2YFHA 1LQUA 1QYWA 2YQ4A 4XGIA 3JYNA 1VL6A 3JQEA 4E5MA 3HWRA 1RPNA 1E7YA 4IIUA 3I83A 5DCWA 3ICPA 3GAZA 3CE6A 5DCUA 4Z9XA 5L7TA 2HDHA 4Q3AA 4BKUA 2AEMA 1CIVA 5TF4A 3FNEA 4JLWA 4A27A 1V3UA 1KEWA 1M6HA 2C59A 2YZ7A 5KVCA 1VPDA 4YJDA 1R4NA 4U0JA 1E3SA 3N58A 1LC0A 4C7JA 2Z5LA 2X22A 1HLDA 2DT5A 1WNTA 1PJ3A 3L0DA 4XZ3A 4YDRA 1YOVB 3JYQA 2HK9A 2HSDA 3L4BA 3ZWMA 5U9CA 1SMKA 4KWHA 4JXKA 2VOJA 1GCOA 2JJYA 1KEUA 4D3FA 4KZPA 1E3WA 4ZHSA 3QHAA 2UDPA 4DWVA 3O4RA 4I5GA 4S1VA 3G79A 1YB4A 3WLEA 4AJHA 2R2GA 4Y67A 3OHSX 3BTUA 4G65A 1RM5A 2D3TA 3QWFA 3LLVA 2IEBA 1EDOA 3DZBA 2E4AA 2NACA 1NQ5A 3JQBA 4IY1A 5G4KB 3D4OA 4RDIA 4Z9FA 4PZEA 4BVAA 5FFFA 4XA8A 1MC5A 5BSEA 1EVJA 5TIIA 1AXEA 3L9WA 5EQDA 1MLDA 3LC1O 1M6WA 4AJNA 3E03A 3ZWVA 2XPCA 3EZYA 4K6FA 4LRTB 2RHRA 5AVOA 3IQDB 1XGKA 3TZKA 3GMDA 5BSHA 4A5OA 1JVSA 4RPLA 2A94A 3BMCA 1UP7A 1N1EA 1T2AA 4JBIA 1GUZA 2AW5A 2PKRA 4GMFA 1VKNA 2EKLA 3PWZA 2C5AA 3NTRA 3ICCA 2YV2A 4U5QA 3SC6A 5EINA 3KTDA 4XEHA 2EGGA 2XF8A 4RPHA 5F1KA 1KVRA 1NR1A 4EUFA 1K0UA 4TQGA 2PZLA 4PG5A 5TC4A 3DAPA 1LDNA 4O5OA 3VPXA 1PJSA 4CM1A 3V2HA 3ON5A 2PV7A 4Q39A 1BGVA 1XU7A 1ENZA 2DFDA 1QXSA 5HS4A 4N54A 3D7LA 3PK0A 1S7CA 3GZNA 3TRIA 2DTXA 1UZLA 3DBHA 3TZ6A 3C24A 4ALKA 5IN4A 3WBBA 4B4UA 2W2KB 5LC1A 5I7SA 4IXWA 4CQMB 2J3HA 5F5NA 4OXNA 1T24A 1OC2A 3S2IA 1GTMA 2WYUA 4Z3KA 2VHWA 1E0DA 1KBZA 1A4UA 1PJCA 3BHJA 4KUEA 5F1OA 2EKQA 5BNFA 1GPJA 2HKIA 4NBUA 5DOVA 1YQDA 5COAA 2X9GA 1K89A 3RKRA 4NZ9A 5BNTA 3EK2A 3PFFA 4PLFA 2NUAA 3VH1A 2Q46A 3NEPX 2GZ1A 3IJPA 2VCYA 3KHUA 1NPYA 1DOHA 1HETA 4B3IA 2AMFA 1MA0A 1QLJA 3QRWA 2FPIA 1DO8A 1N9GA 1X0XA 3DBLA 3AOEA 3OMLA 1BRMA 4PVDA 4ESOA 3BMNA 3KB6A 4HFNA 4CLXA 4DREA 3OICA 2YJZA 1MUUA 1P1HA 3BHMA 3UICA 2PA3A 4XGKA 2H9IA 1UDCA 4IQGA 3TFQA 3TN7A 4BO6A 3P2OA 1P1IA 3WGHA 3INGA 2Q4EA 3R3JA 3MWDB 1U7HA 3K9QO 4ZQBA 1IL0A 1EBUA 1J5PA 5I8WA 2GZ3A 3H6KA 2C2XA 4FFNA 2BFOA 1HE3A 1I3KA 1UXIA 1E3EA 3BXXA 4LSMA 3I9OA 4CJXA 4M89A 1KY5A 1MXFA 1LBEA 1VSVA 3RWBA 2WJPA 1ISMA 1W8DA 4R4JA 3F5SA 1QYDA 3UW3A 1CYDA 3AFNA 3FN4A 4R9RA 4TKMA 4RF3A 3D5QA 2HMWA 2NM0A 5KKAA 1QG6A 1X1EA 3E82A 3ZNPA 4DRYA 2WSBA 3RU9A 5JYEA 2PLAA 2Y1EA 1H9AA 1JA9A 2BI7A 4YB8A 1I3MA 3G1TA 5IAAA 1CETA 4DUPA 1E7WA 5L40A 3DAGA 2G1UA 3PZBA 3WGOA 3IDSA 4PG7A 2RAFA 1U3WA 1C3VA 1ZNQO 4WLVA 4PGFA 3VDRA 2YFQA 3QJ5A 4JNKA 4AJOA 2NVUA 3C3XA 1GADO 1QYCA 3TZQA 5B1YA 1E1MA 5L45A 1A7KA 5IXSA 2ZTMA 4IBOA 1O89A 4W9NC 4RVUA 1ISGA 3E5MA 1PR3A 4FQ8A 4CUKA 3H9UA 4R51A 4W9NA 5A04A 3GC6A 3U49A 3A9WA 4NDNE 2FR1A 1F0YA 2VZ0A 1XG5A 3PJEA 3FRJA 1B0AA 1EDZA 1NQAO 3GEDA 1UAYA 2NVWA 3S55A 2V7PA 2GLXA 5DDIP 3VDQA 1KC1A 3W8DA 5IZ4A 3ZWWA 5JFOA 4F45A 1U2DA 4DVJA 4TRMA 4WLFA 5KJ6A 3VPFA 3K2EA 1DFIA 1E3JA 1OBFO 3K96A 2H1SA 4DQVA 2P9CA 5KWEA 2JAHA 4WEQA 4PLTA 2JD1A 3KETA 3WNQA 4B7UA 2O4CA 2WMDA 2E49A 5JS6A 2BD0A 5T57A 2D0IA 2QYSA 1GUYA 4I5FA 4XR9A 1O8CA 1Y1PA 3KYDB 3EZLA 5FF9A 2HJRA 2OHXA 1PWZA 4MIOA 1LDMA 3FCOA 4R3NA 5T67A 3WJAA 3AU9A 4BNUA 4CLHA 4QQRA 1UXKA 3GLQA 4RVDA 3WGZA 1TA4A 1BHSA 1HKUA 1HE5A 1IYZA 2HLPA 5TJ9A 4D3SA 3GQVA 1IE3A 3VPSA 1ORRA 4ID9A 1EE2A 1TXGA 3LYLA 2D5AA 5FEUA 4DLLA 3C1AA 3W4JA 1ZVMA 3DZGA 3GOHA 3GN2A 4OGWA 4NHEA 5CDUA 5JBIA 1UR5A 2ZB4A 2B4TO 4MOWA 1IZ9A 1LC3A 3PQEA 3S2EA 1SO8A 1UJMA 4G2NA 5TJHA 3U09A 3GZ4A 1DC6A 1XKQA 2BF7A 2FY8A 4OH1A 3H65A 2HMUA 1W73A 4YJHA 1E7SA 1MX3A 1M75A 4J2HA 3EC7A 4TZTA 3VPGA 3K73O 4I5DA 1BDMA 2CZCA 2Q1UA 3DHEA 4MVJH 4TWRA 3OIGA 3KSZO 2VHXA 8LDHA 2FZEA 3ULKA 1BSVA 1YL6A 3ITDA 3DZIA 3W6ZA 2QYTA 3WYCA 1Y8QA 4PFJA 2BKAA 2GERA 1JWAB 3KBOA 1WDMA 2BI8A 2P5UA 4JIGA 2Q99A 1BDBA 1Q7GA 1WMAA 2G5CA 4BQRA 3A06A 1XHLA 4OYRA 2C29D 4BMVA 6LDHA 3BYZA 3JQFA 1D8AA 3E48A 5A02A 1D4FA 2AHRA 1QSGA 4AJIA 4IQ0A 4XJSA 1JAYA 3OSUA 4E4YA 2GUGA 3RD5A 1I2CA 4YAGA 4BQPA 3KYCA 2A92A 3DXFA 1WZEA 1TVEA 2J3IA 1B8VA 1E1KA 4B8ZA 1MC4A 3RFTA 5AXBA 3UH1A 3I9MA 1ZJZA 2JCYA 3U4DA 4BOYA 4YPOA 4DA9A 1R4MA 3HZZA 4YJFA 5TX7A 4E12A 1IUKA 1VM6A 1BVRA 2AE1A 5IF3A 1GL3A 3LSYA 5I9NA 1PEDA 4HXYA 2E37A 3OF2A 4D41A 3SJ7A 4GMGA 1NQTA 3GK3A 1J6UA 3F6YA 4JBHA 1XR3A 4EZBA 1H6AA 2W98A 3HFGA 5ENDA 4WLOA 3WQRA 1PIWA 1H6CA 4NFHA 3DHYA 4EBFA 3D5TA 4XKJA 4IDFA 3E1KA 4DC0A 3QW2A 3SLKA 1XQ1A 5TGDA 2CVOA 1C1DB 3FWNA 2PZMA 4RLSA 1T1SA 1U28A 1YQGA 5H83A 3JQGA 5HM8A 5JPIA 4R69A 3KXDA 1UDAA 4CV0A 3MTJA 3ETGA 4E31A 3F1KA 2BMAA 1FDTA 2JFHA 3IMFA 3W6UA 1ONOA 1PJBA 2YV3A 1B3BA 4BNGA 5ICMA 3I9KA 2VT3A 1OOEA 4OAQA 4E5NA 1F8FA 3RAJA 2BFPA 3WX0A 3X2FA 2O23A 5H82A 1CRWG 1ZSYA 3PWKA 1FDSA 4YVFA 1VRWA 4YBZA 2VTEA 2WD7B 1C0IA 3WIEA 2CMDA 3BAZA 4XYBA 4R5HA 2F1KA 3DBRA 4CM6A 1HZJA 3FBTA 4JJFA 4Y9DA 3PYMA 3JYPA 1FXSA 4XYEA 4ZGWA 3WMXA 3U9LA 4ALMA 4PRKA 2BRUA 1HEUA 2P4QA 3MOIA 4IXTA 4U6QA 3VVBA 4BO0A 1ZW1A 3HFSA 1YXMA 3ZH2A 1LRJA 1LSOA 4BB6A 4ALIA 3S2GA 4IDGA 1O6ZA 3FNGA 1U1IA 3G0OA 4R41A 2ZB7A 3OJFA 2FR0A 8ADHA 2YQ5A 4IZHA 4E3ZA 1RJWA 1XYGA 3QLJA 3ZV5A 3S8MA 3C7CB 3GVPA 3W1VA 2D8AA 3ABIA 4CM7A 2C54A 1DHTA 1YDWA 3JQ7B 5AXAA 3D1LA 4R01A 4CM9A 3GAFA 5KTKA 1NNUA 1XA0A 5DNAA 3K30A 1IPFA 4MPDA 3AW9A 3B70A 4IIVA 1F17A 2GSDA 4CUJA 1Y5RA 2Y99A 3ADOA 4KDEA 4QO8A 1JN0A 4BGUA 2J6IA 4U6SA 1A4IA 3PPIA 1B16A 1DRUA 1BXZA 1HSOA 3ZU4A 1XELA 3ZDFA 4EJ0A 5H81A 4FOOA 3FD8A 1TT5A 3B1JA 5T8KC 1C0PA 4BGVA 1PJ2A 4J9UE 1PZEA 3ZU5A 3JCZA 4WK6A 4RVFA 3E18A 4AJEA 3GEMA 4FR5A 2VUUA 1LU9A 1RKXA 2B5VA 3T4EA 1NVMB 3VOSA 3CMCO 4ALLA 4CMIB 1I24A 1Z7EA 2I99A 3AM4A 5ER6A 4CV2A 1U4SA 3JQ8B 1HF3A 4IDAA 2Z1MA 1RM3A 1GR0A 5ILGA 3H9EO 4NFYA 3QVSA 1DIRA 1C1XA 3C7DB 2VZ8A 4XCVA 1E77A 4K1LA 3FNHA 4DBZA 1PJ4A 3AUSA 2B35A 3GUCA 2CD9A 3DMTC 1OAAA 3L6OO 1NHWA 5C5IA 4CR6A 4TZKA 2IYOA 2DU8A 4D0SA 4MVJF 2TMGA 3DAFA 3LT4A 3OQ6A 4FBGA 4GBJA 4MINA 3ST7A 5EQFA 3RJ5A 1H93A 2YDXA 4RO0A 4EYEA 2Q49A 5JDIA 4XQEA 4JX8A 1ADGA 2PGDA 5EPOA 1PL6A 1H5QA 3AY7A 3HDJA 4GSLA 5TNXA 2ZYDA 3GN1A 5A9SA 2PD3A 1N7GA 4L4SA 4MVJE 3T7CA 1UXGA 4QSMA 3L6EA 2CVZA 2DPGA 2OBNA 2NQ8A 4M86A 4H15A 1Q2XA 2B37A 2P68A 2PD6A 1GQYA 1R0SA 2NV6A 2FSVA 1Y9EA 3UCEA 2XOXA 4CLEA 4CM3A 3SJUA 1EEHA 2YDYA 4PLPA 3KRTA 4UUOA 2E82A 3WNVA 2J5KA 4OHUA 5BSFA 4NU5A 4GI2A 4GVXA 3RFVA 4HKTA 1M67A 3HDQA 4J0FA 4FD3A 3JD3A 4J7CA 4W4TA 4KWIA 1AE1A 2NU9A 5MDHA 1I5RA 4MKRA 2VNSA 4JP2A 3D4PA 3OJOA 3PQFA 3W4KA 2AQ8A 1T26A 3BMOA 4WCFA 5IFLA 3WSVA 4CLRB 3S1LA 2O7SA 3PLRA 3JYLA 3ZCXA 5ILOA 3SVTA 5KNLA 1MXHA 4DMLA 3EVNA 4Q3DA 3WS7A 1ZXBA 5KVQA 2HK7A 5JSFA 5JW6A 2ZKLA 4HFRA 4P22A 1DC4A 4PLWA 4BO8A 4MDHA 5IJZA 4IMRA 3K8ZA 2X9NA 3V1UA 1PQWA 2Y0EA 1JTVA 3CIFA 3EY4A 2O7QA 1DB3A 3LF2A 4IINA 4CMJA 4BGEA 1NFQA 4YA6A 3Q3CA 1PZFA 3U3XA 1X14A 3VPHA 3EYWA 2HMSA 5JE8A 4RVSA 1D7OA 4M54A 3MJ4A 5ES3A 2Y66A 1T4DA 1H0KA 4AJ4A 2O3SA 1NQOA 1P0CA 2GR9A 1SCUA 3GRKA 3BMQA 3H9JA 5GZ3A 1ADCA 3GVHA 5AOVA 4JJGA 4CM8B 1PTJA 3LT0A 4IQ8A 5I8ZA 2VWQA 3ETEA 3O8QB 2X0IA 5L53A 3AI3A 4FSHA 5CPFA 4B8WA 2EP5A 2D59A 3F4LA 4E32A 1LA2A 2Y93A 5DOZA 5GMOA 3ITKA 1E7RA 4JROA 4CM9D 4OM8A 4DTIA 4OOEA 2IZZA 4MIEA 4NG5A 4DBVO 4D42A 3CH6A 4OMUA 4KUGA 4L9RA 1SEVA 2X6TA 3GPDG 7MDHA 1CF2O 4GWKA 5CEFA 4BKRA 1BXGB 2YW9A 1IB6A 1X15A 1ZIDA 2AE2A 4GX2A 3FTNA 3L4BC 3DTTA 4E2ZA 1C14A 2NU8A 3VKUA 4ZQEA 4EJMA 1LXCA 4IDBA 2IODA 3IC5A 2W8ZA 5IDWA 1LEHA 1G0OA 4QFCA 3NTOA 4N5MA 3ZWCA 3O26A 1LUAA 4IM7A 4I8XA 4XIYA 1O0SA 1LDBA 2UUOA 5FI5A 1U3VA 3KLMX 3LVFO 3VH3A 4BNVA 3NJ4A 2ZYAA 4DIBA 4II3A 1JWBB 1P74A 1YONA 5CAEA 3ZW8A 5A9TA 4DPKA 1YOVA 3K6JA 7ADHA 2EW2A 4A10A 3WTCA 1K5HA 3JQBC 1KY4A 2A9FA 1QV6A 4LVUA 3TFOA 1B26A 4JQCA 3UCXA 2HRBA 3INTA 1V35A 4URFA 2JFFA 4Z0TA 2AA3A 4WKGA 2E6UX 4Q3NA 4CMHA 3JD0A 3LC7O 4D45A 3HNPA 2NTVA 2EWMA 1SB9A 4FFRA 3VC7A 3BZUA 2QRLA 4BL5A 1SAYA 2GO1A 1ADBA 1B15A 4TMFA 4UVEA 2DUWA 1VKOA 4BHTA 5G4KA 1DXYA 2FRDA 3WYEA 2V6BA 4ZRNA 3ZWXA 1N5DA 1DC5A 3W4IA 4L75A 4XQGA 1PJQA 3QWBA 2PKQO 2WYVA 4II2A 5C7OO 5AQ1A 3H2SA 4EUHA 2G82A 1BTOA 2Y1OA 1PSDA 2V6GA 4WOJA 5LDGA 1O95A 5L7WA 3TWOA 1P44A 2WM3A 1WMBA 2WWRA 3EUWA 3NDJA 3H3JA 1GV0A 3JQAB 3WWZA 1LDGA 1H9BA 4OOFA 5HA5A 2I3GA 2W4QA 1NAIA 3A14A 1WAMA 1Y81A 3MJEA 2I6TA 1SB8A 4E6PA 2EKPA 3Q1LA 4AVYA 1TB4A 3GH3A 2BELA 1YQXA 1PS0A 4UUPA 3QSGA 1DBVO 1PS9A 3AOEC 4CMEC 3DWFA 4D7AA 2W2KA 5HRUA 1O94A 4CQMA 1AGNA 2D4AA 3DOJA 1I8TA 3I9LA 3UXYA 4BNLA 3HDHA 1HRDA 2I76A 4L8VA 4CMEA 2PGJA 2P91A 3UCFA 3H3FA 1KIFA 2YYYA 4BNMA 4DQUA 1Z6ZA 1E1LA 2VOEA 3QY9A 4RQUA 2I5PO 3OFSA 1GZ4A 3PJGA 3VAZA 4S3MA 3JYOA 4BNYA 3HB4X 1V0JA 3LK7A 2NSDA 4UVDA 4N5LA 3GEGA 3WYBA 1KYQA 1IZ0A 1E3LA 2JAPA 2P4HX 5EJ2A 5L7YA 5DULA 3ZU3A 4XB1A 3FNFA 3W8FA 4CQLB 5L4SA 2J5RA 2UUPA 4BV8A 2DVMA 3TSCA 2R00C 4AJLA 1I01A 2NTJA 4LN1A 2PY6A 3KM0A 3OQBA 2WE8A 1XWFA 1P0FA 2VUTA 4CV1A 5KCZA 1SOVA 1VL8A 2GN9A 4ALJA 2J3JA 2R00A 4IZIA 5F3RA 4R1UA 4DPMA 4LMRA 3D3WB 1A72A 1ZK2A 5JAZA 5THKA 3GVXA 4CM4B 3LT2A 1TT7A 5A05A 4PN3A 1VJ1A 2VHVA 4LVCA 5G2OA 3L4SO 1DIHA 1W0CA 4J9VA 3OJEA 2PD4A 4B79A 1A9YA 4XDYA 1ADFA 1KEVA 4QECA 4E5PA 2A35A 5GY7A 5JCJA 5L3ZA 4UULA 4P4LA 3K31A 4J7UA 1K2WA 5IG2A 3GNQA 1VE9A 3L77A 3PIDA 2O2SA 3A4VA 5KVVA 5CDTA 3OETA 4D44A 3RCBA 2AG8A 2GF2A 4J1QA 1U2GA 3WBFA 2DFVA 4ZU3A 3T7EA 5JO9A 3FPLA 4BS9A 1QORA 3IUPA 4ZD6A 1DEHA 5AXDA 2PWZA 1Q0LA 3CINA 3B1FA 1SPXA 5MGBA 4GX0A 3C85A 3K5PA 1C0LA 4PZDA 2VWPA 2Y1FA 4L76A 3SX2A 4CLDA 1ZK0A 4KOAA 3AK4A 3OIFA 2NNLD 3F3SA 3M2TA 1B3RA 1MGOA 2DM6A 2HK8A 4RVHA 4BNJA 4TROA 4CL8A 5G4LA 3G3EA 3CXRA 3FTPA 1DJQA 4NFSA 3WGTA 5A9RA 1Q7CA 5AXCA 4NJMB 3HJAA 5G0WA 3KSDO 5TLSA 2RH4A 5A5EA 4BNFA 3M2PA 1FF9A 4IDDA 3ANMA 2CDCA 2JHFA 4IS3A 4ND2A 1WZIA 1EFLA 1DLJA 1R0KA 4NJOA 4XR4A 4ONEA 4E2YA 1EBFA 4K9DA 4QO7A 4HWKA 4AJKA 9LDBA 2PK3A 3V2GA 4YQYA 3SXPA 4YQZA 5A3JA 4B3JA 3M1AA 3JTMA 1X7GA 2B83A 2DKNA 3HN7A 2OP0A 2VQ3A 3OA2A 4ILKA 4OKIA 3H9QA 1NWHA 1UXJA 2VTDA 1GFSA 3AM3A 4HUJA 4YEDA 1AHIA 3KYDA 4GKBA 4W7IA 3ZWNA 4OQYA 3O03A 1NASA 1JKJA 4AFNA 1HSZA 2Z95A 1ZCJA 3AY6A 3C1OA 1NXQA 2QZ9A 3UKOA 4BNIA 5GZ1A 1SBYA 3GRPA 4DLBA 5T6BA 2Y67A 2NU6A 4MKZA 5CP8A 4B7CA 5JAIA 2WE7A 2X7HA 5JCXA 3H9GA 3NAQA 4UUNA 2D2IA 1UZMA 4WPGA 4XQCA 1OI7A 3I1JA 1I2BA 1P9LA 4WUVA 4WNIA 1DPGA 4P8RA 2GCGA 3ROKA 3KO8A 1VSUA 3IOYA 3QWAA 4R9SA 3HHPA 2HQ1A 3RC1A 1U5AA 4CQMD 2VZ9A 1LLCA 1R37A 3SC4A 3PFWO 3ONDA 1DIAA 3WGYA 2PTGA 4B7XA 2EGHA 1GQQA 1HDOA 1FJHA 2Q2VA 2YHIB 4GX1A 3JQFC 1D1TA 1ZH8A 2X58A 5JXWA 3KEQA 5U1PA 3F5QA 4YRDA 2OGUA 4Q9NA 3DC2A 3WQQA 1PGOA 4BNWA 4YXFA 1R66A 2RBEA 2H63A 3PLNA 4LK3A 3OJ0A 5BNIA 5CHEA 2X1HA 2GNAA 9LDTA 3TDKA 3RSHA 1NP3A 4NPCA 4E0BA 4NBRA 2QX7A 4Q3EA 3PI7A 3NT5A 1BXKA 2HUNA 3IIEA 2O4UX 2XXJA 1QV7A 3F4BA 2ZYGA 1ZKMA 4W82A 1MFPA 2FPPA 3VHRA 2XAAA 3TJRA 1GYRA 2ZATA 1MG0A 1XSEA 4L0QA 1WDLA 4EEZA 4OL9A 3LZ6A 4M55A 3KEOA 1VL0A 1GU7A 1H2BA 1I2ZA 2JL1A 1XCBA 3WICA 1LTHR 1GEEA 1P1KA 1IOLA 2ZJ0A 4K28A 4DLAA 4E5KA 2JFGA 2I9PA 2G0TA 3I6IA 3ZV6A 4UEKA 1M2WA 2AEJA 3ZHYA 1R15A 3TF5A 1Q0HA 3SBOA 3QP9A 5JY1A 2Y1CA 3M1LA 2DBZA 4D0RA 3PJDA 1ZK3A 4ZJUA 3DZJA 2UV8A 1AXGA 4UEJA 5JCJD 3WFJA 5G0VA 3DR3A 4MVJI 5JMWA 4GWGA 5JMPA 3RC9A 2CFCA 3VTZA 3ZV3A 2O3UA 4BMNA 2VNAA 1GUFA 1YL7A 4YTEA 5HBRA 1DIGA 1YE3A 4L74A 3DOOA 1PJTA 4CMAA 2IXAA 2V6MA 4ZN6A 1PZHA 4G5HA 2YUTA 4RCVA 2EJWA 3PP8A 5DCYA 2EP7A 4UREA 4INAA 4DGSA 1HLPA 3X2EA 1CQJA 2QIOA 3DEYX 4N5NA 4U8GA 4XRRA 2PKQP 1XLTA 3RROA 1JQBA 4B3HA 4IDEA 1KVUA 3RASA 1ONNA 1U8XX 1WWKA 1C1DA 3B1KA 2GYYA 4R1SA 3GDOA 2AXQA 1HWYA 5L95A 1UDBA 4GX5A 1Q1NA 3CEAA 5G0UA 3DFUA 2X0RA 4L4XA 2NVBA 3B6ZA 2QZZA 1OFGA 3HN2A 3WIDA 3QVXA 4RPKA 1GD1O 4NNJA 3JD2A 3PHLA 3FWZA 4NI5A 4FOSA 3Q0EA 1R6DA 3Q6IA 5B4VA 3U4HA 4YR9A 4Y98A 5JO0A 5TS3A 1N1GA 3EHEA 2Q2QA 3WGIA 1QRRA 3B20A 2HAEA 3KYBA 2HU2A 2WD7A 3CPSA 4J0EA 2OOSA 1FDVA 3COSA 3IKVA 2Q4BA 1ZZEA 1PGPA 2Y05A 3E6AA 2I65A 3TZCA 3H5NA 3W8EA 4R3WA 2X9VA 1KS9A 4ND5A 3UF0A 4U0KA 4NMHA 1DHRA 1HDCA 2OO5A 4RZHA 3EW7A 4YT2A 2X5JO 1P45A 4HFJA 1T2DA 4OO3A 3VZQA 3GUYA 4PZCA 4IGFA 4ZRMA 1IPEA 1EFKA 4HNGA 3BIOA 1YH3A 1ZO8A 3PHJA 1ENOA 4NQZA 3JQ7A 3R6DA 4EGFA 2EJVA 3WQSB 2ZTLA 1T4BA 4OIMA 2NTNA 2FN7A 1RM0A 3MEQA 2QG4A 1JKFA 2HRZA 3DMYA 1LLUA 3FBGA 3I3OA 4KQWA 3UAGA 3ORFA 3AUAA 4FCCA 3OIDA 1DC3A 3DONA 4CL3A 3P19A 3RUIA 2JHGA 1XQ6A 4R54A 4Y8VA 1N8KA 2X0NA 4Z6KA 3NGLA 2Q45A 5EMHA 4D46A 4WJZA 2OP1A 4ITUA 2GASA 4J2OA 1G0NA 2PZKA 3GR6A 3ASVA 3EAGA 4MP8A 4ZVVA 2GGSA 1YO6A 2BHLA 2O3QA 2B5WA 3ETDA 3JD1A 4KTVE 3KV3O 4RQTA 1QR6A 1LQTA 4P4NA 2POQX 1LLQA 1UH5A 3KVOA 4CMIA 3IKTA 3S2FA 3ZHZA 1VJ0A 3RBZA 3JQ8A 5THQA 3MCVA 2DTEA 4GLLA 2P9GA 3PZRA 5JDIC 4GGOA 6ADHA 1P77A 3ZHBA 1ZMOA 3ASUA 4J7XA 4ZQGA 3NT4A 1DDOA 4J91A 1PZGA 5A06A 1DIBA 2D5CA 3RUHA 4OQZA 3A28A 1Q0QA 1KEPA 3F9IA 4RL6A 5K6AC 3RIHA 4TSKA 4BUCA 2QRJA 4I9HA 5G0SA 1IHXA 2UYYA 4J3FA 1W6UA 1HT0A 3RFXA 2RCYA 5K6AA 1ISJA 2B0JA 1ISFA 4OJNA 4XYMA 3E9NA 4WE3A 3ZWYA 1EUZA 4BV9A 1B8UA 2ZTUA 1CJCA 4BO4A 1LSSA 4C7KA 5JAQA 2YHUA 2ZK7A 1X13A 3OEWA 4UVHA 4BNKA 5B12A 1Y8RB 5DBGA 1JDJA 3ADPA 3I4FA 4PLCA 4LGVA 3OJLA 4WLNA 1GYPA 4YAKA 2Y0DA 1AHHA 1BW9B 2OUIA 1DLIA 4WCFC 1KOLA 4P4GA 2SCUA 1Z73A 2DAPA 3H5RA 4CLOB 4Y6PA 1MP0A 4Z0HO 3RJ9A 2O2YA 3UHAA 3PYLA 3GDGA 1R12A 2FP4A 2JCVA 3MJVA 1U4OA 1HE2A 3PQDA 4HP8A 5C37A 1TLTA 4X54A 4B4WA 5EIOA 1ZSVA 5L51A 4YJGB 1B2LA 1MV8A 4L73A 3JD4A 5KIAA 4NK4A 2YY7A 1D3AA 4UVIA 1P1RA 3KUXA 2OL4A 2HJSA 4GQAA 4CLRA 2H6EA 1WW8A 3A1NA 5KOIA 1ULSA 5HTOA 4E13A 1EE9A 5CPBA
chains in the Genus database with same CATH superfamily
4MWGA 2FFBA 4JP3A 1MH9A 1SCNE 3CY6A 3BPSA 2IYSA 2R97A 3GROA 3PCRB 3QUBA 4IGAA 1UBTS 1D4AA 2FW9A 4D4JA 1EAYA 4FMCF 2X4LA 5H70A 1FSGA 4DLPA 1N77A 1W44A 5ES4B 1FYWA 2BMWA 3HKDB 4G63A 1WBBA 2JBAB 1RZ3A 2ANCA 3AT1A 4EYGA 2XOKA 2XHZA 2IWRA 4C78A 2QXYA 1OFUX 3R0XA 1MPXA 4F72A 3M6IA 4HH4A 3K6KA 1NW7A 4B5LA 1NXWA 3H5TA 1PEKE 3HU5A 2OFPA 3Q9SA 3R3SA 3NAMA 4LOHA 4P4UA 5HUHA 5SV2A 3AUTA 5DXAA 5GZ6A 4LX8A 2IPXA 4KG7A 4MUHA 4CT5A 3OF3A 3N3BC 5EZYA 2DH5A 1Y3AA 4ZARA 1ZH2A 3D8RA 4I9UA 3V4PB 1TYCA 3OTOB 4R1QA 2IH4A 2UZ3A 1OBHA 2JKVA 3EISA 1P1BA 2CXXA 3OLVA 4LCJA 3S2ZA 2XW6A 1EQ2A 3QVUA 3U39A 1PVOA 1XZLA 1X7HA 3S4YA 1A2QA 2FW6A 3IB6A 1ZNZA 4MIYA 3K92A 5MN5A 1MJFA 2UUCB 1QHNA 3OE4A 1XBTA 3O8QA 3QU5A 1CDZA 1IZZA 2FWIA 1F6WA 4A16A 4BLRA 4MWTA 4J16A 1AGPA 4HNTA 1ODTC 1OXUA 2H1HA 3M9XA 3LE8A 1A9PA 1I4LD 2AR7A 2GH1A 2IQIA 1RE1A 1E0SA 1JHDA 2AJTA 2OSVA 1ZIXA 2ZIAA 3OHMA 2EFJA 4ZYWA 2QROA 5G41A 4CNQA 1PKEA 2YRXA 2W4MA 1LZLA 3P4UA 5DPMA 4R1NA 3JQ9A 2GNOA 2N3ZA 5ITVA 3OQ1A 1F4VA 2OV2A 2SKEA 5B36A 2YS7A 3E5RA 4L8WB 5JQGF 1YZKA 3FR7A 1FNCA 3JARA 1MA3A 2BM1A 3W90A 5KJ1A 4PG8A 1O5OA 1ZUD1 3BD9A 3IA2A 2CHFA 2IUTA 3BIXA 3GDFA 1H4VB 5B3JC 3GPBA 1KYZA 2PX4A 3E9YA 4EY5A 1KERA 1LX7A 3JQ6A 4W7SA 2YWGA 2FX3A 1SKYE 3O38A 5EP1A 1SU4A 1TVCA 1NG9A 3OIUA 4ZVNA 4MMZB 1S6YA 1QP8A 2Y1XA 4NBVA 4DCNA 4KRGA 4RPJA 2V0CA 5LKRA 5COQA 1N9ZA 1BC5A 1GG5A 1MU0A 4QOFA 4DMMA 2XOEA 3DOCA 5ALSA 1VRVA 1DBWA 3KD2A 5J2TB 3MWYW 5CYOA 3DB1A 1S8OA 2BHSA 4PPGA 3SZMA 1TZJA 1OI4A 2C3PA 2A14A 4QU5A 3T34A 3ONEA 1UXHA 3Q4GA 4A2CA 4PZUA 1F0KA 1RM4A 3GLSA 4YCAA 3HG7A 5JHGB 4X20A 5FOTA 5M04A 3KSBC 2Z4RA 1E3MA 4RV5A 2WKRA 3SKVA 2HH9A 3RHZA 4CM5A 5C4MA 1UP4A 2FUNB 3QVVA 4IZOA 2CW5A 4RJ2A 1CZRA 3KT3A 4N9QA 3K1YA 3SSNA 4I36A 1YR1A 3ROZA 3WZ2A 4Z4IA 4RH0A 4AF8A 5I5EA 1L1EA 4S24A 5IC4A 1KXJA 3HCOA 1U9JA 2Q1SA 4NEGA 1WSAA 3RFFA 2VQEB 2DHCA 5AI6A 1K08A 2QE6A 3FCSB 3KNZA 2VPIA 2QMQA 1JX6A 3MJHA 2QVYX 4XWTA 1TJ5A 4WXRA 3SU8A 4Y7DA 4F97A 3MMZA 4TN1A 5LPNA 3FWHA 3KXKA 1J1UA 3IMGA 2XT6A 2C78A 4CFZA 2YCLA 1Y7TA 2HA6A 1YR2A 3GBPA 2QTCA 4YAUA 5BUZA 2G9QA 1F12A 3SXUB 4G36A 5EHIA 3GAMA 2H52A 2QUIA 2R4QA 3G49A 3H5AA 4AKHA 3AY3A 3LRPA 4Q9HA 3LC2O 2OGSA 3GG2A 3LHIA 2IBTA 1CLUA 2OV6A 3TTWA 4EJ6A 1OI2A 1FS5A 3I5AA 2YV5A 2JHPA 1DJNA 4MRAA 1QVRA 2QGFA 3HSSA 1REQB 2D5BA 1WVGA 1WXXA 3IXLA 4IAOA 3OLZA 4PLVA 5T3UA 5JANA 1OAOC 4OQLA 3RBVA 1MQ9A 1RKVA 2UAGA 4P5DA 3JV7A 1RTTA 1XROA 3VU8A 5CYPA 3NKFA 3BGWA 2ERCA 2CV0A 3DMHA 3TOXA 5FUQA 4GAEA 2NO9A 4NS1A 3SQXA 4FW8A 4IVPA 2XWSA 3CHYA 3PEFA 2SECE 4XW2A 4EKIA 4KK3A 2A5GA 5HE9A 3KQNA 1OT3A 2Z0MA 2FPXA 1D5CA 1E89A 3W6PA 3DBLB 4YAIA 2FW1A 5KYXB 4Z51A 1U90A 1Q57A 1N5LA 1YD7A 2GD0A 3RTGA 3BMNB 5EVCA 3IUJA 1GLNA 2PRIA 4MRRA 1E7MA 4HPJB 4QQKA 4RF2A 2BFCB 1ABBA 1E2UA 1T35A 5K20A 1CUAA 4JOQA 4DRXB 2N9UA 1VI5A 4QASA 1UKVY 4DS3A 1C0KA 1PX0A 1CZOA 3LA8A 3RSQA 1WUTA 2ZCUA 3IOMA 1LX6A 1Z0AA 4HNSA 3F8WA 4LTDA 1VYTA 2GN6A 1N2ZA 4V1CB 2EEPA 1NAHA 1JXQA 2NYVA 3MM4A 3GWGA 1Q77A 2D5IA 3OLWA 1DXQA 2AG5A 5FAXA 4FDTA 3N7UA 3R8XA 4C08A 2E87A 2R1TB 4Y2GA 1KSJA 3A1TA 5ELLA 4V0RA 2Q29A 1M3SA 4X7PA 1PT5A 4X6UA 4HLCA 2YV1A 3INYA 4FOTA 5D3MA 4HVLA 1DFHA 2CLCX 3GELA 2AZXA 3AI2A 2E7ZA 3NU1A 2D1SA 1KFEB 1Q0RA 3LX6A 1C8BA 4V24A 3WIBA 1KHHA 3EDCA 3DL7A 2IDZA 2BFMA 3PHGA 5D86A 2DBRA 2ZZKA 4RV4A 4D5EA 4DLSA 4FDAA 1SC6A 4YJ3F 2JLAA 4DR6B 1PVVA 2HUPA 1A3CA 1QYVA 1UT6A 2BT4A 2VJQA 4KUHA 5DI3B 5H9VA 4Q3CA 1A27A 4WJLA 5HE8A 5IMSA 1L7AA 4ABTA 2YXNA 4YT4A 4JA0A 3HMQA 4K9KA 4CM4A 2BCGY 1KMCA 4G81A 2DEUA 1CIJA 5FYDA 4RIGA 3RBXA 5JTUA 3OPVA 4I1YA 4JBNA 1QGOA 1GJRA 3D81A 4GGPA 4R8KA 1GZ5A 5A2QA 2G9UA 2J1LA 2E5WA 3E5NA 3LO8A 3OFVA 4EL0A 3IIKA 4R16A 4YMTA 1GKIA 2HYIC 4G09A 4MYTA 1Y9AA 4R2MA 1TA9A 1NP6A 4LV8B 1YJQA 3EWNA 3PX2A 3PR1A 4EW3A 5EE1A 5EJIA 4C04A 3LU1A 5DSZA 1E5XA 4IYRA 3WAKA 3SKYA 4LJRA 3CX3A 2GF0A 4A7PA 4AZTA 4PR3A 4AYWA 2BW0A 2FZVA 1Y63A 4QD3A 1B23P 1E1NA 1TQ4A 4LZOA 4WINA 2JCXA 2ZIZA 3HCFA 3LI2A 1OYOA 3GCZA 2B1JA 4BQEA 3PC8A 4GE3A 4K87A 3QXCA 3BVPA 2GYVA 4UTVA 1NX9A 1TM3E 3ZD7A 3NPMA 1NOKA 2UVQA 1EZ4A 1ESEA 4MKHA 3C15C 3O84A 3I5MA 1P1FA 3JAWA 3K0KA 4Z4HA 2R11A 3I9JA 1ODJA 1U3TA 1T3LA 1E2EA 2VSXA 3AMVA 4H31A 5CW1A 3KQOA 3MPOA 4HN4B 1BMTA 3L8ZA 1KYWA 5JSHA 2O1EA 4IJVA 2IU3A 1JEDA 3EEFA 5CT9A 5K3OA 4QOGA 1EUCA 3I9V6 1XTKA 2RSLA 3PR3A 1DQRA 1LSUA 3KZCA 2FW7A 3NTQA 4TV8F 4TVOA 2DWCA 3GPIA 5YASA 4U7DA 1D9XA 4DJFC 1LK7A 1FDWA 3D6MA 4Q7EA 3HB9A 2AUMA 2AJDA 2GCIA 4G1FA 4MYSA 2XYVA 5CVCA 3HLTA 4ARUA 3M6UA 1CZLA 2C7GA 2OM2A 3L92A 3DEFA 2VTBB 3IBFA 1CYEA 3ZTTA 2GPJA 2P35A 3TX2A 4C21A 4XWAA 3PQ3A 4AKEA 4D3ZA 4D6YA 3H6HA 3T8YA 3TPFA 1J42A 1ZS9A 2I7VA 2AFRA 4QICA 3ELBA 1Y4DE 1ONPA 4GPD1 4BKOA 2I67A 5DP1A 4BKPA 1DRVA 1Y8CA 4PAWA 2HRRA 4BWVA 3VPAA 3SFVA 1DEXA 1NFFA 2NU7A 3VO9A 3GT0A 1I3NA 1CB7A 3WB9A 4C9BA 3ZE6A 3QPWA 2J9YB 3TSZA 1SXIA 4AS1A 2P9EA 1TAQA 4DT1A 5TPZA 5CRIA 5FJJA 3QX7A 1DCMA 2NNWB 2R6R1 1Z15A 1EP2B 3U3OA 3VBEA 2ZRPA 2FPKA 2QP9X 3GXBA 1ZGCA 1U2TA 1SQ6A 3CKYA 3U4IA 2YOHA 5ALFA 1H0SA 3NWEA 1HNWB 2WU3A 3HVJA 3AKEA 2W6JD 2E4ZA 4FYMA 2FCRA 4YAOA 2IFTA 3ZZTA 1IN8A 2R87A 3W5DA 5EI5A 2HWUA 4H4DA 4CKWB 1GCUA 1UJ2A 5CB0A 1JR3E 4E21A 2C82A 2YWEA 3FFAA 4F3TA 1YRLA 5T6MA 2BGUA 3R77A 3FAKA 2NPIA 2RKOA 4GBMA 4UOEA 5JZBA 5K9ZA 2IZ5A 2QRVA 3K9HA 4LJSA 4RYDA 3VH2A 4M1MA 4CF6A 3JQAD 1R9MA 3D3EA 1BS1A 4HB4A 3NFYA 5BSRA 1PJLA 2CVQA 4G0MA 5K8IA 3WGQA 2UZ1A 2NX2A 3C87A 5CTJA 3VOAA 2ORED 2JGIA 4H6VA 5H59A 1ZAKA 5LQJA 3U7QA 5LP6B 2QD5A 4BWFB 3W5IA 3LGAA 4Q7LA 1JU9A 1XVUA 1O5IA 2Z43A 1P33A 3D6JA 4MITA 1RRGA 5DM60 2CDAA 5LA6A 4DCSA 3UMYA 2O8FB 4L07A 3WJ7A 4S12A 1G7TA 1KKUA 3NC0C 1QAQA 4P7KA 1ZCFA 1UKYA 4EHFA 1N2IA 1PN3A 2YXEA 1HMPA 1MTOA 3QFRA 4PSCA 2X2OA 1UOQA 2DQSA 4RIIA 4BXOA 3LP8A 4H35A 1IULA 3VNSA 4EF4A 2AS0A 3CR7A 1ZMXA 3GA7A 4DCVA 3TNFA 3GARA 4DJDC 2A5DA 5EN4A 2JEOA 4DLYA 1A8PA 4EABA 4KBFA 4KWTA 3D0OA 5FLKA 5FQNA 5GV8A 2NLOA 5CK4A 2GPTA 4YP5A 4WX2B 1O1YA 1N92A 3HADA 1JB9A 3FJ1A 1U94A 3VAAA 4F6RA 1UC9A 1Q1ZA 5IZCA 1PDVA 2W90A 4Y9UA 4LOAA 2I2FA 4TLLB 1U8ZA 3QVOA 5ICFA 2NMVA 2FZKA 4NYIR 4E3WA 3RUDA 1DQYA 3N2LA 4MR8A 3KVYA 1WLYA 3W8RA 2P30A 5H3LA 4QSHA 2E4WA 1QR2A 3EZFA 5KVSA 3QUQA 4Q4CA 3N2KB 3D6VA 3IR7A 4LBWA 4XB2A 1Y37A 4Q4AB 4IZ6A 5EL0A 5P21A 3SC3A 5HK9A 2Q1YA 4LE1A 4K9LA 2HPVA 3CBQA 3FF1A 2JI4A 1BE6A 3KALA 5EQTA 4A6PA 3AJ8A 1Z0FA 2P2NA 2GM9A 1W47A 3II6X 4WZAB 5IHPA 2PRJA 3DM5A 4M99A 2YVLA 3DQPA 4N7MA 1KI7A 1P0QA 1FE8A 3BTVA 3GHYA 3KLPX 1FA9A 2P0YA 3MYRA 8AT1A 3J81k 4DV5B 2R6HA 1DAHA 4RD0A 4WFKA 3DO5A 3K16A 5C1IA 1G7SA 1UZAA 4LF8B 1F2DA 3HY6A 4FHZA 2IZ0A 3LT1A 1QF9A 4G37A 5DGXA 3MRSA 4HL6A 4IJMA 2IK8A 4MA5A 4MVJG 5ARCA 2HCTA 1NYTA 3PDUA 4OQQA 3V2IA 2QRGA 1LFDB 4RD4A 1RI1A 5KQRA 4A15A 4FMCB 1X86B 2IYPA 1K6XA 4EDHA 5T5QA 3TYXA 3FLEA 2IYFA 3NCHA 3TQSA 2FUG1 2XBMA 3KSRA 2GN2A 2DTDA 1XF1A 3ERCA 1PAUA 4HVAA 5JNLA 3TJMA 1HZZA 4LRSB 2G77B 4L2IB 3WZLA 4JD5A 5HIIA 3DL2A 3T1HB 2EEZA 4FGKA 3B52X 4GL4A 1KVQA 3RTCA 1VJ5A 2COEA 2VHEA 5JYDA 1DKQA 4PE5B 3BC1A 3EY9A 1RBMA 3O3MB 3O95A 4LVNA 4BRZA 2FWNA 2V1UA 2ZB2A 3C4QA 3CVJA 3WY9A 2BFAA 2GJ8A 1C1HA 5B3LA 2VG8A 4ECAA 3SVLA 4B3MB 4TOIA 2G9RA 3CPEA 1PT9A 3NHZA 2QX4A 1C8LA 4ND1A 4FE4A 3DDWA 3AJAA 2WJAA 3T15A 3ANLA 5AMXA 3AVWA 1NURA 2EYQA 2ACVA 4EW6A 3P9QA 1G9SA 4YT5A 4FFSA 2C2ZA 5DNYB 1NUHA 1VLZA 1FX0A 2HFJA 3BA1A 1US8A 3S1AB 4ARZB 1W4LA 3NBYC 4FYJA 3DOEA 3K15A 3PC6A 4M9QA 2UYCA 4HRXA 2WPNA 4MVJM 2BE9A 3T54A 1YBMA 2AGVA 3QWHA 4PIPA 1P2VA 3MJSA 5CBPA 5BNZA 4QDOA 3DBRB 4RC9A 1ECCA 2XT0A 1ZBQA 3WQBA 3F8TA 4MS3B 2PS3A 3RTEA 2OV3A 3A3KA 1PDOA 2Y1KA 2DOKA 4K6CA 4J8PA 2YZNA 2WWFA 1SHZA 5JQGB 2JI9A 1K0FA 3JX9A 1K8RA 3OQMA 1DUIA 1XHEA 4UE2A 5DVZA 4BCDA 4D97A 4H6XA 5EHGA 3E5HA 1TLFA 4IMPA 4JDUA 3UFBA 4AF7A 1X7DA 2VRCD 4J43A 5I7RA 1N0VC 2ZIEA 3BRWA 1MRZA 2VWHA 1SZJG 3LPDA 4INJA 3PBKA 1POXA 3HLYA 4MVWA 4PGMA 1GP2A 4DIKA 3H0CA 4JYBA 3SIXA 4IOKA 2OHHA 3E9ZA 1N6PA 1NQWA 3PU6A 4XOIA 2PR2A 3VRHA 2XNDA 5IC6A 2RG7A 4GQBA 4JJIA 4HBGA 4QFDA 4GR5A 1KYXA 1RAIA 1CVLA 2XUJA 5AM4A 5C4IA 4G1UC 4MH0R 1PD0A 2X86A 3ZJTA 5SZJA 4FEEA 4LJ7A 1XV5A 4D57A 2IP1A 4HUQB 2B82A 5IH7A 4RMGA 4BNTA 1T15A 1QGDA 4RH3A 3E3MA 3RF7A 5LZ2A 2ZBRA 2X23A 3RJTA 3W5AA 1JDVA 1JXMA 2EG9A 4CKZA 5EEGA 1EJBA 4X93A 2HLDA 2PNJA 1P4RA 2GZSA 3LXRA 4PLYA 3R6WA 1AKUA 3GDHA 2H7XA 2DLNA 5AVVA 4C5CA 1X77A 5LDHA 4CCYA 5CDSA 1DTWB 1Z0SA 3DVAB 5L3VA 3MMSA 3Q7PA 3FMOB 3D2LA 3I2JA 4JIMA 4A91A 4ZFNA 1S2DA 3FSGD 4MGYR 4N7RA 1NFRA 3ESDA 3B1WA 2X5OA 2E4UA 1FLDA 1MEOA 2VWGA 1G5FA 2Y1DA 3P2EA 1E79A 3CV3A 3WRYA 4CKCA 4B73A 4I55A 3Q6MA 2J0VA 3KAQA 3HI4A 3CVXA 3IXMA 4QYIA 1DNPA 1PQPA 5FWXA 4WZBE 3GP8A 4MV6A 1X80B 4RMNA 2WFMA 4QX6A 4HV4A 1OX4B 1T4GA 4PWYA 3TQFA 1RSZA 1IZ8A 3RYFB 3BTOA 2VAPA 4E46A 4IJUA 1CULC 2WTBA 1WULS 3FVQA 4JENA 4JX9A 2V7TA 4FZJA 1UODA 2CY0A 4RVGA 1I4DD 2PL9A 3BHIA 4KMSA 2HT6A 3SZUA 2RIRA 1UAGA 3ZHVA 4BBAA 3JWIA 4GRIA 4BTVA 2NXJA 5KSWB 4R83A 4PC1A 2Q2WA 3AHJA 2J0QA 3NV7A 1VI2A 1SOWA 2PJRA 2VA8A 1UJ4A 2B4YA 4UBJA 3E70C 3TKYA 2HJ9A 3P2YA 3DYIA 3B3AA 2W6PA 2WYIA 4J29A 4JH0A 4MB6A 5ED4A 5AM5A 4OSPA 1Z6XA 5EXXA 2VDKB 4MK4A 2W2LD 1ATZA 2H8GA 1VC2A 3L0PA 1TCCA 4C89A 4DNXA 4H0FA 3DW1X 2EX1A 4TUYF 4WQMA 3ODPA 4PNPA 4DCUA 2DETA 1JJAA 1PWXA 3MZ0A 5DLYA 1R6AA 1M6EX 1HL7A 4LYDA 1NPTO 1J99A 4Q9AA 2O3TA 2ZETA 3WK7A 4AP6A 2XDAA 2ATCA 1N2JA 4AN4A 2GARA 2PGXA 5E6UB 4BU1A 5JD5A 1QRUA 4GSKA 4YV7A 4GI7A 1IZ7A 1RHMA 2LCFA 2PQ2A 3BWDD 2CT8A 3KAKA 1QQAA 1I0ZA 4GBGA 1H6BA 1PQYA 5CG2A 5A4IS 1C80A 2YRWA 3EDYA 4XTCS 2VS1A 5IDXA 1ZMTA 2AI1A 3R6GA 1SVWA 2J0UA 4FJ2A 5IM4F 2BAGA 3T3NA 1RPAA 4NCJA 3EVFA 3CF4A 1I6KA 1I32A 1PVDA 1VHLA 2X13A 3EMKA 2IOFK 2WM9B 1YE5A 3L1HA 4PBTA 3EXIB 3UT6A 3I6QA 4M0UA 5CFZA 3D64A 2PPVA 3CRVA 3UZUA 4GM0A 2ZIXA 3TXAA 1Y33E 2YX1A 1G8PA 2AB0A 4D8XA 5LXTA 2CF5A 1YNSA 2D2VA 4ZMBA 8ABPA 4MPTA 2ZU6A 3AUXA 1IY8A 1GAEO 1GQ2A 2TRSB 1L4UA 4LYHA 4R81A 3R5SA 3R7DA 1XL1A 1QVWA 1GGVA 5L8VA 3HWX1 1ETUA 4WCFB 1AA6A 4WY5A 3N2ZB 1IHYA 4UM7A 2WF7A 4YJ3B 4V38A 3SHQA 4AJPA 4BEBA 2VPQA 2ODNA 3BJRA 3TPCA 4DLWA 3ENQA 4F3NA 1QHGA 2P2LA 4NH0A 3WYNA 3G0HA 3TEJA 2OFOA 1E94E 4RCZA 4BO1A 4M87A 3YASA 4QT0A 4AWXA 5KOHA 5BV8A 2C42A 5AT1A 5I4KA 1ZUIA 4REMA 3F47A 4FHDA 3GJ7A 4QWMA 3BE5A 4TMYA 4I1RA 4YJGA 3KZ1E 3E0XA 3ZW9A 1GAXA 1JLMA 4YPVA 1P5JA 3WLMA 5EKUA 4BKMA 5CB4F 1OU4A 1F8XA 5BWNA 4QIHA 2EU8A 1BEZA 3NOXA 5FNVF 4KR9A 1DQNA 1TZBA 1MX9A 3GEPA 4KDFA 4C29A 1WUIS 4AYTA 1B6GA 2VRNA 1KJYA 1FTQA 2WFAA 5D3QA 2WTXA 3RFCA 4Z7OB 3KWJA 5I4IA 1YU6A 5FI3A 1KVSA 4KGZA 3QE9Y 2MWMA 5JD4A 3DE4X 4YGXB 1AGXA 5AKHA 1Z2DA 2X76A 1PJAA 4ZICA 4HADA 1RLOA 2IEDA 2Q21A 4ON9A 3M3HA 4RA6A 1SNYA 4J1TA 3FIJA 3V4FA 2ODTX 2V5VA 2B4AA 4NIMA 3RSFA 1T43A 1Y9DA 1ICIA 1M33A 1YBVA 1KI8A 2DJ5A 2HA7A 4ESHA 1BG6A 1PQUA 2CCKA 4PAGA 5HCIA 5D7NA 2FHSA 2GZRA 1FTWA 1W1IA 2I7XA 3ELWA 1AHPA 2ZWVA 2X8LA 4MVCA 1Z0DA 2C92A 4R2WA 2ZJ2A 3AFOA 1YVRA 3GYBA 4X0EA 4TV8B 4OBEA 1UBUS 3ZZ0A 4QPZA 4G0OA 4M8NE 1UZUA 2CN1A 3IERA 4O4JF 1YTLA 4S2EA 5BXQC 3IEMA 2XQGA 1Y4AE 5EPUA 4J0DA 3T99A 2KLBA 1G6KA 3PUVA 2ZWOA 1YB7A 1E20A 1QYWA 2FSGA 2YQ4A 1SVNA 4GHWA 1ZI9A 1RRPA 1SUDA 4KLZA 3JQEA 3K0FB 4M1TA 3GAZA 3HKEB 3HUFA 4Z9XA 4YMVA 3GV0A 5L7TA 5F1YA 4Q3AA 2NU8B 1D04A 2AEMA 1V26A 3FMVA 1CIVA 1L3BA 3NTLA 5TF4A 5C5DA 5C8ZA 3FNEA 4JLWA 2Q3CA 2AXPA 3QX8A 1CU1A 3K9NA 4M36A 4RIHA 2Q5OA 1M6HA 2C59A 3MN1A 2HV9A 2WIFA 1O96A 4U2FA 2EBFX 4JVMA 1G21A 3LWNA 1SIUA 3KJQA 3MWEA 4HHEA 1NSYA 4C7JA 4JYAB 1WXEA 3GJSA 3ECCA 2P4UA 3ABOB 5FPPA 4XZ3A 5TQ0A 5JADA 4V0LA 5T7BA 4R2XA 1VMDA 2HK9A 2BUAA 2QPOA 2J32A 2C9ZA 5E8JA 1SMKA 1T5SA 3STWA 4HCJA 5FFMA 4Z4FA 4RCYA 5GOZA 4JXKA 3MUNA 5BQPA 5CA1A 2JJYA 4BWGA 2P3SA 2XQVA 1QTIA 4HDKA 4LHXA 5DW0A 4EVSA 2FZ5A 1MOPA 1O2DA 2WQZA 2X19A 3QHAA 3FKSD 3NIBA 1IPHA 1NQXA 4NENB 1ID8A 2AHOA 4AJHA 4GMXA 1WIWA 2XNCA 1L0BA 2X4DA 4HSGA 3OHSX 1QIFA 1FPQA 1S9HA 5LDDC 2V97A 4OCZA 2IEBA 1EX1A 2AYXA 1LPNA 3I9V1 1EDOA 2FWRA 4PZPA 4TXHA 3ZY3A 4FYHA 2IHJA 3RVJA 4W6QA 2HREA 4OMFG 4RE5A 3I05A 4IY1A 4I0WB 5G4KB 4RDIA 4RTJA 4PZEA 3F73A 2F55A 4KGDA 4Q03A 1MC5A 4JR0A 5BSEA 2ZBVA 4JVSB 1KO5A 4KLCA 1AXEA 3L9WA 5EQDA 3PQCA 1FLNA 4FGLA 5K3CA 3WYFA 4AJNA 4BGDA 3U60B 3EZYA 3LLCA 1BX3A 1NRIA 3P9YA 4II7A 1CVIA 3W6NA 2PS9A 3LZDA 5BSHA 1W0KD 3CWZA 3L7KA 1RYZA 4NONA 4RPLA 4OHOA 3K1TA 1N1EA 4AG5A 4JBIA 1GNPA 2AW5A 4GMFA 3JWPA 4QA9A 2EKLA 3KQMA 5KC8A 3AEUA 2C5AA 2XUIA 3IJEB 5LIPA 2VK4A 5ALPA 3AL2A 3ZWQA 3HA7A 3RAFC 1FXWA 4LI3X 2EGGA 1GIAA 2LKDA 2XTZA 4GPIB 4TPKA 5CCEA 2A3NA 2MT9A 5F1KA 2R5WA 4BE7B 1NR1A 4M1WA 4OHRA 2O8DB 1UK8A 3GOQA 3K0BA 1NBHA 5TC4A 4WGFA 4O2RA 4O5OA 5GIOE 2JLRA 1XNRB 1FYFA 3LIPA 4CM1A 2HQOA 2VBGA 2ZYIA 3SNHA 2ZI3A 1BGVA 3R5HA 4YDQA 4RU1A 3W2IA 4L85A 5HS4A 1CJMA 2YCBA 3FPJA 3EDQA 1SVOA 2X1VA 3DBHA 3GZNA 4YS6A 5C4GB 5B2ZA 5IN4A 3K0AA 2D7DA 1TYDE 3BUSA 5LC1A 4D3YA 4EPXA 4P53A 5I01A 2Y8EA 5E0KB 1T24A 4BFVA 2Z3WA 3RAGA 4EG6A 2YKGA 4A2QA 4EUNA 4GLFA 4KPGA 1KBZA 1VE5A 2J6BA 5KTRA 3UY4A 2NPFA 3QX9A 1V25A 3C3AA 5F1OA 1EGHA 1G98A 4RQBA 4XDGA 4PSAA 1NVBA 4RTPA 1YQDA 4ZHQB 2Y4NA 2X9GA 1K89A 1TJPB 3UUGA 3VH1A 1CNEA 3TAHA 5AHWA 3D7SA 3NEPX 4CDGA 1O6CA 1TKAA 4LBVA 1W19A 1Z4MA 1T8PA 1X0XA 2JFOA 4GP7A 4LXGA 4ESOA 3NBXX 2YMLA 2RJOA 5A7FA 2XUFA 3EOZA 2IOHA 4C4AA 4S05A 3JZMA 1QFSA 3K9GA 2C3MA 1W49A 1L7OA 3OICA 3VR5A 3KJGA 1FSSA 3G0GA 4DREA 1YQUA 2ZR0A 2ZWPA 2EBUA 3QPBA 3H1TA 4GZ5A 4M98A 1XK6A 3M3DA 3EYAA 4LC0A 3BWCA 4UCWA 4XGKA 3NC4A 4IQGA 1Y9ZA 3RS4A 3TLCA 1XLVA 4RFSB 3DOUA 1RHQA 3OKCA 4KQ1A 3ZDEA 4A8PA 3FA2A 4FD2A 1T6NA 4ZU6X 4UKDA 5M7EA 4DLKA 1CUYA 3MWDB 1U7HA 4I9FA 1F0NA 2G8NA 3I34X 2QMYA 1XNHA 1WE2A 1AUVA 1STOA 1UADA 4TYQA 2C61A 4XVRA 1MABB 1PJRA 2GZ3A 3H6KA 4Y0VA 3N1UA 1NF9A 1HE3A 1UXIA 1EWYA 1AXRA 1NL3A 2FDXA 3C3CA 4KQEA 5AKLA 4R8RA 2VI5A 3ET5A 3Q7RA 1U8CB 3UJBA 3B6JA 4M89A 4CJXA 1LBEA 3RWBA 5TF0A 3ZUGA 2XADA 2ZZMA 3PCXA 4Q24A 7REQB 3CNLA 1XE3A 3T61A 3F5SA 4W5TA 1QYDA 3UW3A 4QRHA 1CYDA 4L3OA 4BU0A 3O92A 4EEKA 3N75A 2QG6A 3AFNA 1DELA 1CUCA 1L4NA 2CB9A 3GAAA 1N3LA 3NZEA 3NYRA 3QHPA 1TAGA 2HMWA 3W7VA 3CC8A 4DRYA 5JYEA 3RU9A 2WZBA 3IXQA 1LJUA 4A5SA 1TYZA 3JATB 3CT6A 3PUKA 4HAVA 4BBPA 3LLUA 3BWEA 1J56A 3FBWA 3VR4D 4DUPA 1S2OA 4TYWA 5L40A 3U3MA 4FCTA 3PZBA 1RPTA 3CJQA 1PSWA 2RAFA 1U3WA 1ZNQO 3A6DA 3EASA 3H17A 4K03A 4NWIA 2YFQA 2Z83A 1TQ2A 3B36A 4JJKA 1JIXA 1W2WB 1IXYA 4AI6A 1NXSA 3C3WA 3GGSA 5B7GA 1E1MA 2HPZA 1G20E 2SKCA 2WWGA 1O89A 2XIQA 4CN9A 4RUKA 1W93A 4ITRC 4W9NC 5DM70 2I6FA 5AICA 3OZCA 3R41A 5EIWA 3AIMA 5JD6A 5JI2E 3PSAA 4C4TA 2VJKA 3H9UA 1T3TA 1VYHA 3F6RA 1SK9A 1THZA 2O57A 4MRVA 2JANA 1B0AA 3LPNA 4NV0A 3TW8B 3PR2B 5F23A 4N0DA 2WQ6A 4CEJB 2AZ4A 1UAYA 5JEEA 3BRCA 4S1TA 5IBPA 3RVSA 1U1EA 2GLXA 1ZIOA 1R5BA 3F2VA 2NUBA 2YJTD 4HDMB 4PPNA 2HWWA 5DDIP 5IZ4A 4Y2HA 5BR1A 5TV2A 4QJBA 3A1VA 2CLDX 2Q2OA 1XRNA 1FOEB 5LBIA 3I2IA 5KJ6A 3HFJA 3L7CA 3RG8A 4DF3A 3HGMA 4INZA 1V71A 4CDMA 4ENPA 4RTNA 1FB5A 1CUBA 1ZM9A 2JAHA 2JD1A 3IJ5A 5LR6A 1HT1E 5C8YF 1NMYA 1X2EA 1YDFA 4C6SA 1YZ3A 2W6ID 2E49A 3AETA 4YAFA 4ZAWA 2QV7A 2D0IA 4RETA 1R0BA 4X7BA 1GUYA 4JJZA 2G4VA 2XKAA 3A9VA 3BJIC 4LSGA 2J41A 1NT2A 3HN6A 3IBTA 1OD6A 1VP3A 3EZLA 5FF9A 4F9EA 4CEHB 1WPXA 5AHKA 5A3SA 3UJ9A 4DQKA 4KRXA 3LXUX 3WRVA 3FCCA 4MIOA 4HGOA 3P5BA 1H1LA 7ABPA 3CEJA 3GEIA 3WAJA 2PKEA 4CLHA 3AU9A 4FT2A 4KH0A 3CX8A 5IJ0A 4QQRA 3WGZA 1Z0UA 3PEEA 1BHSA 3OE7A 4YONB 3TI7A 3IVRA 3W79A 5BN4A 1HE5A 5EHQA 3IR5A 4MS1A 4ZXFA 1P2FA 5CU7A 1P4AA 3AVQA 1EE2A 1KJIA 3RFUA 4LMAA 2XVYA 5FEUA 3C1AA 5EJ5A 1VCMA 4C0QC 1NJSA 2C2WA 4JBLA 4I4TF 1Y8ZA 2QLJA 3BG5A 1J2UA 3AW8A 3ECSA 3HXOA 1RRFA 3MA0A 2QJOA 3Q87B 2ZWIA 2UKDA 2J3QA 2GLTA 3ORYA 4FFBA 4M83A 4EPYA 2QIPA 4EY4A 2IKQA 1FEZA 1N2CE 1UJMA 2B61A 2OUKA 4G2NA 4TUYB 1Q6YA 2DBYA 3SOZA 1DC6A 1W76A 1XKQA 3VU9A 2XMPA 4F4HA 5DX1A 4MUXA 2HMUA 3TLGA 1EHIA 2YMQA 3D0RA 5FR1A 3SC2A 1I6LA 1MX3A 1M75A 1OV6A 1WXWA 3CNNA 3QU2A 3EC7A 4FBMA 2CVHA 4TZTA 3VPGA 5BN1A 2VXBA 2IEAA 2HU7A 2OOKA 4NJEA 1NU8A 1Y5NA 4TT3A 4J7AA 4POAA 2A1TS 2CZCA 4PX2A 3CEMA 1OXBB 1WCV1 2BHTA 4LWQA 4P32A 4QTYA 4BDSA 1D4ZA 2W5UA 2Z8YA 2GPBA 1Z2NX 3ITDA 1JJ7A 1RYYA 3DZIA 3F6PA 2GVZC 2Y2VA 2Q0SA 4HZGA 3W6ZA 1WZCA 4PFJA 2BKAA 1V8ZA 1R10A 1WDMA 2E85A 3PXBA 4ZZ1A 1WVMA 1Q2UA 3Q3IA 1E69A 1WMAA 4TS4A 4US2R 1R6TA 5CFMA 2QGNA 3IP7A 1GGEA 3LWZA 6LDHA 5J2UA 3K0SA 2ZE5A 3ABZA 1NC1A 3QLVC 5F9HA 3K5WA 3M4YA 4G5XA 1JTFA 1QSGA 3PSHA 2A3RA 1SBHA 1ADYA 1GLGA 3RRFA 2O8FA 4MI6A 1QO9A 1FFSA 5HKKD 4R3UC 1KZ4A 1T9GS 4KE6A 4MHTA 1XZFA 2J5BA 2WZCA 4YALA 2KLHA 2ZUEA 3H7IA 4G0ZA 1FTGA 2D7JA 2ZVDA 4QU9A 3DXFA 1WZEA 4MYCA 3TMYA 3VISA 5EIBC 4YRGA 4QNRA 2RGNC 4URHA 3OX1A 3SZ3A 2XXAB 3SJZA 3G9XA 3I9MA 4FTWA 2CEAA 3ZBTA 1ZJZA 2QS9A 2MJLA 2CXSA 2JCYA 3N2IA 4M21A 5FUYA 3RWOA 3U4DA 3CLTD 4BASA 4YPOA 5CB4B 5CFOA 2EKZA 1N7JA 5JTTA 2IPNA 4IV5A 1HTTA 4JEUA 1YMVA 3BK7A 1Z12A 3M82A 4FUTA 2FEWB 3HRIA 4NZNA 1BCRA 4OUDA 4R6XA 3EFOB 5B57C 3U7IA 3KQSA 4BP1A 2YZGA 2PQ0A 1PEDA 2C4TA 2CXUA 2PYZA 4HXYA 3UK0A 3OF2A 4NZYA 3AEYA 1CXZA 3E3AA 4D41A 1JWLA 1J6UA 2DPYA 4M8LA 3UAGA 4CTNA 3FLMA 4E5SA 4ND8B 4URXR 3ZJ4A 5HZHA 2LPMA 1J8FA 8ATCA 1H6AA 2XVMA 2J9FA 1QH1A 4BPRA 5DIZA 3HFGA 3N0VA 2WJHA 3A6GA 1S89A 5ENDA 4JQSA 5LZ4A 3WQRA 5HM6A 3DHYA 4PYJA 1Z6TA 3KQUA 4DSZA 1H2WA 4UJ5A 2BTQA 2I2CA 3WK6A 2WAMA 3IT0A 4IDFA 3A6HA 1RCUA 4W1SA 1T5HX 1WUKS 3SLKA 5TGDA 4GOND 1SKUA 1U0NA 2PZMA 4RLSA 1T1SA 1U28A 3WKCA 2DB3A 1BNCA 4RX1A 3P9IA 1KARA 3JQGA 2IGBA 1ZOPA 4LRQA 1BS9A 4WRRA 4X1YA 5H83A 5JFTA 2WTAA 3Q7QA 3IOCA 3NDPA 1E9BA 4GKKB 3IILA 1V7ZA 2MTBA 3BKWA 4O4JB 4X90A 2HO4A 5DNEA 3DA8A 3ND9A 1HO3A 1IQPA 4H7HA 2JFHA 1FRVA 3W6UA 1XZAA 3KWFA 1ONOA 1P2UA 4AMYA 2XF2A 1BWRA 4BNGA 1MB0A 5AM0A 2BFPA 2VH2A 3OU7A 4PCUA 3TTXA 3DT6A 2MR5A 3DTVB 2VJCA 3TW0A 5ALHA 1Z8DA 4EZIA 4HYTA 4LRUA 3VOBA 1FDSA 2HIMA 4PXAA 1U0TA 3A4IA 1Z9BA 3HFRA 1VRWA 4YVFA 5JHHB 3Q8KA 2P3LA 3LW8A 1KO1A 4KVFA 2XUAA 2NPOA 5T4BA 3T3GA 3RHTA 2ZJOA 1U98A 3FBTA 3FB4A 3PYMA 5FWDA 3UXEA 3QIAA 3LQ1A 1WXQA 4R8LA 3VYTB 4PXYA 3WMXA 5AM3A 5DRYA 3IBYA 3COPA 4U6QA 3J7TA 4BO0A 2Q5JA 1Z8NA 1RR6A 4JI5B 1MVLA 2VF8A 5TARA 2H2WA 1KIAA 1YXMA 5H0IA 2H1FA 2PUBA 5F51A 1PF7E 4QGSA 4S2UA 5HJEA 5FBVB 5KUTA 4PGGA 5AVWA 2BCEA 2AI3A 2YQ5A 4GU5A 2H3EA 3IEPA 1RJWA 1XYGA 4Z7JA 5DSTA 1Z4JA 2H06A 4BN5A 1PKXA 5A3QA 4JXXA 2OESA 2BYTA 3DWEX 1GGHA 2GYUA 2C54A 1FFGA 4O8ZA 5HFNA 2BR3A 3UA4A 2XEDA 2BGJA 3GAFA 3IDAA 1IPFA 3FVRA 3AW9A 4UHDA 1GPUA 3B70A 1F17A 4LF5B 3ZK8A 1NV9A 3HV2A 1JG7A 3R9XB 1Y5RA 4QO8A 1GGFA 4XGQA 3EF1A 4HATA 2WD9A 3PPIA 3ZU4A 2GBCA 1XELA 1JG3A 3VNVA 3L82B 4EGAA 4RTMA 5H81A 3WL5A 1Z36A 2JEYA 3B3FA 2XA9A 3QF4A 3C48A 3K0CA 3B1JA 5EPEA 1UJNA 1C7QA 1FU8A 3KX2A 1AMNA 1WDTA 3K0EA 3EPJA 2Q5QA 5C80A 2JHCA 5E2IA 1RXVA 3NEAA 1VBMA 3SICE 2VJMA 4GP9A 3DEKA 4M0KA 4Q1EA 3VJRA 3HCWA 1XVTA 1PZEA 2DY1A 1XXHB 3PUIA 3OUZA 4RKEA 4UUBA 5FNVB 2VQFB 3MPUA 1VKJA 4BTLA 3E18A 1XAIA 3GEMA 4FR5A 4M6WB 3ZIAA 3FCAA 2W4IA 1RKXA 1IOVA 5KOJB 5FPTA 1PR5A 1RAFA 5IX8A 1SXJE 2LNDA 3NOQA 2OCYC 3IPLA 3WBKA 4CMIB 1XQ9A 1Z7EA 2I99A 3AM4A 1TYEB 2O5RA 4LOKA 2FH5B 4WK2B 5ER6A 1HF3A 1N1DA 3KT6A 4IDAA 4FFVA 4WIAA 4YJ2F 5DGHA 3GLFB 2AR9A 1RXEA 5TPWB 4C01A 2HPAA 1I3OA 2YC4C 4FSDA 5ILGA 5CA0F 4P3OA 4Y18A 1TUBA 3IE2A 2QTLA 3QVSA 2I9KA 1L7VC 4PTYA 3PKZA 1C1XA 4DMUB 5F2KA 1NIJA