3WJKA

Crystal structure of octaprenyl pyrophosphate synthase from escherichia coli
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
319
structure length
306
Chain Sequence
MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMITEENYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNANVGDDLNEGKPTLPLLHAMHHGTPEQAQMIRTAIEQGNGRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQVLPDTPWREALIGLAHIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Octaprenyl diphosphate synthase
publication title Crystal structures of ligand-bound octaprenyl pyrophosphate synthase from escherichia coli reveal the catalytic and chain-length determining mechanisms
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 121
structure length 306
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.5.1.-:
pdb deposition date 2013-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3wjkA00
5HN7A 5HNAA 2ZEVA 2J1OA 4LFEA 3P5PA 4N9UA 4KPDA 5I1UA 3LGKA 5IN8A 3ID0A 3KROA 3KRFA 2Q58A 1UBYA 5EATA 2QISA 4MC3A 3CP6A 3G4FA 4LLTA 1FPSA 3KRCB 3EGTA 1EZFA 4LXWA 1YYSA 4EA0A 3WCBA 3P41A 3ZMBA 3WEJA 3TC1A 5ILJA 2Z52A 4P0XA 3VJ9A 3P5RA 5DHIA 5B01A 1V4JA 2Z78A 4QXSF 3Q2QA 2O1OA 3WCDA 3DYHA 1YYRA 4WK5A 4JZXA 2E8UA 3TFPA 1YHMA 4KKMA 1WL3A 2Z4ZA 2AZKA 3SDVA 2ZCRA 3WEFA 3LGZB 3B7LA 4PVYF 4RXDA 3ACYA 3OABB 1ZW5A 3WCGA 4DZWA 3KROB 5B03A 3WEHA 1YHKA 4OKMA 2Q9YA 3ICNA 3LK5A 2J5CA 2Z4YA 3N5JF 5E8LA 4OGUA 2EWGA 2ZCSA 3S9VA 1VG3A 3RBMA 4NKFA 3AQCB 3WCHA 1JFAA 5JV2F 3LLWA 3TFVA 4PVXF 4LA5A 3N0GA 3WCLA 3WSAA 1VG4A 1DI1A 3NRIA 3ICMA 1N23A 5DJVF 1HXCA 4NUAA 3ZL6A 3WCIA 5DGSF 3PYAA 2ZY1A 5B0LA 4MC0A 4N1ZF 5DGMF 2PS6A 1HXAA 4DXJA 4DI5A 5IK6A 4GA3A 2AZJA 3UCAA 3TS7A 5ILKA 2VF6A 2PS8A 1N1ZA 2E91A 4EA1A 4KVYA 3V1VA 4NG6A 3CKEA 5A0IA 5B02A 2E95A 5IVGA 2RAHA 1WY0A 5DGNF 5ERMA 2F8CF 1WL0A 3SDTA 2DH4A 3DYFA 5JV1F 3KBKA 5CG6A 2OPMA 3SDUA 5DIQF 2E90A 5DJRF 3WEGA 4FP4A 4ZQ8A 3SDRA 3CC9A 4KVIA 3ZCDA 1WMWA 2PS7A 4K10A 2Z4WA 3N1WF 1YJ4A 5IMIA 5EROA 5ILDA 1YV5A 1WKZA 3PDEA 2E4OA 4F6VA 4JXNA 2F92F 4F62A 4KVWA 4LZCA 1HM4A 5B00A 2Q80A 2F89F 4KVDA 4RXEA 2OA6A 4KUXA 1N1BA 1JFGA 2ONGA 4H5CF 1N24A 4DWBA 3DYGA 4OMGA 1PS1A 4NFKF 4F6XA 5IMPA 3LVSA 5ER8A 5IL8A 3KRAA 2ZCQA 3WCFA 4RXCA 1V4EA 3WJOA 2E92A 2AEKA 4LZ0A 1YYTA 3TFNA 3OACA 5DW7A 3RYEA 4KFAA 3WEIA 5EAUA 3VJBA 3V1XA 3WJKA 2Z4XA 3G4DA 1UBXA 3N1VF 4L2XF 3KRFB 1VG6A 3OYRA 4JXYA 2AZLA 1YHLA 5AHUB 4LFVF 3LOMA 3VJ8A 3WSBA 1DGPA 1N20A 3N45F 5H9DA 4LFGA 3BNXA 3RMGA 4XQRF 3AQBB 2OGDA 4Q23A 4LLSA 4UMJA 1UBVA 2AELA 4DHDA 3Q1OA 5DHKA 2F8ZF 3S4JA 2J1PA 4E1EA 5DZ2A 2ONHA 3KRPA 2E94A 2Q9ZA 3N3LF 3ACXA 1UBWA 2ZEUA 3MZVA 3ZOUA 2E8WA 4KQUA 4LPHF 4LIXA 3WCEA 2OPNA 5HN9A 3M00A 5IM1A 1RQIA 2E8XA 4DEMF 3PKOA 2AETA 1V4KA 3N6KF 5AFXA 4E9UA 4JYXA 4LPGF 3V66A 4JVJF 1V4IA 3ACWA 1VG2A 5IKAA 3NF2A 2P1CA 2ZCOA 3BNYA 1VG7A 5ILZA 3ADZA 4RXAA 4MC8A 3Q2ZA 5B0MA 5A0JA 2Z7HA 3OABA 5A0KA 4RYPA 3QKCA 5IKHA 1YQ7A 1WL1A 4KWDA 2Z50A 3KRPB 1KIZA 4KK2A 2H8OA 4LUUA 3LMDA 3WCAA 3AE0A 1HXGA 3N5HF 3P8LA 1RQJA 5AELA 4JZBA 1HM7A 2FTZA 5CG5A 5EASA 3ASXA 5JV0F 5IMNA 5JA0F 3WEKA 3NPRA 4LTVA 5ERNA 4DWGA 4KPJA 5C05A 3MAVA 5HN8A 4E9ZA 5E8KA 5DJPF 3VJEA 4GAXA 2F9KF 4NFIF 3VJCA 1V4HA 2PS5A 3KB9A 1HX9A 3N0FA 4H5EF 3NPKA 3WCJA 5E8HA 4P0WA 4H5DF 3N3DA 3WJNA 4HD1A 2PS4A 3QQVA 3SDQA 4EA2A 3EFQA 3WCCA 4LTZA 4OKZA 1YYUA 4LOBA 2E8TA 2Z7IA 5IK0A 3N46F 3N49F 3RYWA 3EZ3A 3M02A 2E8VA 2I19A 5AYPA 4GP2A 3M01A 4LZ3A 2FORA 3KRAB 3IPIA 1N21A 3WCMA 3LJIA 3PH7A 3PYBA 1YYQA 2E93A 3WC9A 3W7FA 4P0VA 5ILIA 3LSNA 4GP1A 4OMHA 3M0GA 5B0IA 5B0JA 3OACB 5ILYA 1WL2A 5ILHA 2Z4VA 3KRCA 5IL3A 3VJAA 4FJQA 5JUZF 3LEEA 3APZA 4XQTF 2F7MF 3ZMCA 5KSXF 5B0KA 4NKEA 4RNQA 3Q30A 1N22A 3AQ0A 3LG5A 3P8RA 3WE9A 1KIYA 1RTRA 4KQ5A 4NFJF 3LZ9A 3ICKA 2F94F 4LA6A 3SAEA 3M9UA 4XQSF 3LDWA 5IK9A 3IBAA 4KQSA 4QPFA 3ICZA 3VJDA
chains in the Genus database with same CATH superfamily
5HN7A 5HNAA 2ZEVA 2J1OA 4LFEA 3P5PA 4N9UA 4KPDA 5I1UA 3LGKA 5IN8A 3ID0A 3KROA 3KRFA 2Q58A 1UBYA 5EATA 2QISA 4MC3A 3CP6A 3G4FA 4LLTA 1FPSA 3KRCB 3EGTA 1EZFA 4LXWA 1YYSA 4EA0A 3WCBA 3P41A 3ZMBA 3WEJA 3TC1A 5ILJA 2Z52A 4P0XA 3VJ9A 3P5RA 5DHIA 5B01A 1V4JA 2Z78A 4QXSF 3Q2QA 2O1OA 3WCDA 3DYHA 1YYRA 4WK5A 4JZXA 2E8UA 3TFPA 1YHMA 4KKMA 1WL3A 2Z4ZA 2AZKA 3SDVA 2ZCRA 3WEFA 3LGZB 3B7LA 4PVYF 4RXDA 3ACYA 3OABB 1ZW5A 3WCGA 4DZWA 3KROB 5B03A 3WEHA 1YHKA 4OKMA 2Q9YA 3ICNA 3LK5A 2J5CA 2Z4YA 3N5JF 5E8LA 4OGUA 2EWGA 2ZCSA 3S9VA 1VG3A 3RBMA 4NKFA 3AQCB 3WCHA 1JFAA 5JV2F 3LLWA 3TFVA 4PVXF 4LA5A 3N0GA 3WCLA 3WSAA 1VG4A 1DI1A 3NRIA 3ICMA 1N23A 5DJVF 1HXCA 4NUAA 3ZL6A 3WCIA 5DGSF 3PYAA 2ZY1A 5B0LA 4MC0A 4N1ZF 5DGMF 2PS6A 1HXAA 4DXJA 4DI5A 5IK6A 4GA3A 2AZJA 3UCAA 3TS7A 5ILKA 2VF6A 2PS8A 1N1ZA 2E91A 4EA1A 4KVYA 3V1VA 4NG6A 3CKEA 5A0IA 5B02A 2E95A 5IVGA 2RAHA 1WY0A 5DGNF 5ERMA 2F8CF 1WL0A 3SDTA 2DH4A 3DYFA 5JV1F 3KBKA 5CG6A 2OPMA 3SDUA 5DIQF 2E90A 5DJRF 3WEGA 4FP4A 4ZQ8A 3SDRA 3CC9A 4KVIA 3ZCDA 1WMWA 2PS7A 4K10A 2Z4WA 3N1WF 1YJ4A 5IMIA 5EROA 5ILDA 1YV5A 1WKZA 3PDEA 2E4OA 4F6VA 4JXNA 2F92F 4F62A 4KVWA 4LZCA 1HM4A 5B00A 2Q80A 2F89F 4KVDA 4RXEA 2OA6A 4KUXA 1N1BA 1JFGA 2ONGA 4H5CF 1N24A 4DWBA 3DYGA 4OMGA 1PS1A 4NFKF 4F6XA 5IMPA 3LVSA 5ER8A 5IL8A 3KRAA 2ZCQA 3WCFA 4RXCA 1V4EA 3WJOA 2E92A 2AEKA 4LZ0A 1YYTA 3TFNA 3OACA 5DW7A 3RYEA 4KFAA 3WEIA 5EAUA 3VJBA 3V1XA 3WJKA 2Z4XA 3G4DA 1UBXA 3N1VF 4L2XF 3KRFB 1VG6A 3OYRA 4JXYA 2AZLA 1YHLA 5AHUB 4LFVF 3LOMA 3VJ8A 3WSBA 1DGPA 1N20A 3N45F 5H9DA 4LFGA 3BNXA 3RMGA 4XQRF 3AQBB 2OGDA 4Q23A 4LLSA 4UMJA 1UBVA 2AELA 4DHDA 3Q1OA 5DHKA 2F8ZF 3S4JA 2J1PA 4E1EA 5DZ2A 2ONHA 3KRPA 2E94A 2Q9ZA 3N3LF 3ACXA 1UBWA 2ZEUA 3MZVA 3ZOUA 2E8WA 4KQUA 4LPHF 4LIXA 3WCEA 2OPNA 5HN9A 3M00A 5IM1A 1RQIA 2E8XA 4DEMF 3PKOA 2AETA 1V4KA 3N6KF 5AFXA 4E9UA 4JYXA 4LPGF 3V66A 4JVJF 1V4IA 3ACWA 1VG2A 5IKAA 3NF2A 2P1CA 2ZCOA 3BNYA 1VG7A 5ILZA 3ADZA 4RXAA 4MC8A 3Q2ZA 5B0MA 5A0JA 2Z7HA 3OABA 5A0KA 4RYPA 3QKCA 5IKHA 1YQ7A 1WL1A 4KWDA 2Z50A 3KRPB 1KIZA 4KK2A 2H8OA 4LUUA 3LMDA 3WCAA 3AE0A 1HXGA 3N5HF 3P8LA 1RQJA 5AELA 4JZBA 1HM7A 2FTZA 5CG5A 5EASA 3ASXA 5JV0F 5IMNA 5JA0F 3WEKA 3NPRA 4LTVA 5ERNA 4DWGA 4KPJA 5C05A 3MAVA 5HN8A 4E9ZA 5E8KA 5DJPF 3VJEA 4GAXA 2F9KF 4NFIF 3VJCA 1V4HA 2PS5A 3KB9A 1HX9A 3N0FA 4H5EF 3NPKA 3WCJA 5E8HA 4P0WA 4H5DF 3N3DA 3WJNA 4HD1A 2PS4A 3QQVA 3SDQA 4EA2A 3EFQA 3WCCA 4LTZA 4OKZA 1YYUA 4LOBA 2E8TA 2Z7IA 5IK0A 3N46F 3N49F 3RYWA 3EZ3A 3M02A 2E8VA 2I19A 5AYPA 4GP2A 3M01A 4LZ3A 2FORA 3KRAB 3IPIA 1N21A 3WCMA 3LJIA 3PH7A 3PYBA 1YYQA 2E93A 3WC9A 3W7FA 4P0VA 5ILIA 3LSNA 4GP1A 4OMHA 3M0GA 5B0IA 5B0JA 3OACB 5ILYA 1WL2A 5ILHA 2Z4VA 3KRCA 5IL3A 3VJAA 4FJQA 5JUZF 3LEEA 3APZA 4XQTF 2F7MF 3ZMCA 5KSXF 5B0KA 4NKEA 4RNQA 3Q30A 1N22A 3AQ0A 3LG5A 3P8RA 3WE9A 1KIYA 1RTRA 4KQ5A 4NFJF 3LZ9A 3ICKA 2F94F 4LA6A 3SAEA 3M9UA 4XQSF 3LDWA 5IK9A 3IBAA 4KQSA 4QPFA 3ICZA 3VJDA
chains in the Genus database with same CATH topology
5HN7A 5HNAA 2ZEVA 2J1OA 4LFEA 3P5PA 4N9UA 4KPDA 5I1UA 3LGKA 5IN8A 3ID0A 3KROA 3KRFA 2Q58A 1UBYA 5EATA 2QISA 4MC3A 3CP6A 3G4FA 4LLTA 1FPSA 3KRCB 3EGTA 1EZFA 4LXWA 1YYSA 4EA0A 3WCBA 3P41A 3ZMBA 3WEJA 3TC1A 5ILJA 2Z52A 4P0XA 3VJ9A 3P5RA 5DHIA 5B01A 1V4JA 2Z78A 4QXSF 3Q2QA 2O1OA 3WCDA 3DYHA 1YYRA 4WK5A 4JZXA 2E8UA 3TFPA 1YHMA 4KKMA 1WL3A 2Z4ZA 2AZKA 3SDVA 2ZCRA 3WEFA 3LGZB 3B7LA 4PVYF 4RXDA 3ACYA 3OABB 1ZW5A 3WCGA 4DZWA 3KROB 5B03A 3WEHA 1YHKA 4OKMA 2Q9YA 3ICNA 3LK5A 2J5CA 2Z4YA 3N5JF 5E8LA 4OGUA 2EWGA 2ZCSA 3S9VA 1VG3A 3RBMA 4NKFA 3AQCB 3WCHA 1JFAA 5JV2F 3LLWA 3TFVA 4PVXF 4LA5A 3N0GA 3WCLA 3WSAA 1VG4A 1DI1A 3NRIA 3ICMA 1N23A 5DJVF 1HXCA 4NUAA 3ZL6A 3WCIA 5DGSF 3PYAA 2ZY1A 5B0LA 4MC0A 4N1ZF 5DGMF 2PS6A 1HXAA 4DXJA 4DI5A 5IK6A 4GA3A 2AZJA 3UCAA 3TS7A 5ILKA 2VF6A 2PS8A 1N1ZA 2E91A 4EA1A 4KVYA 3V1VA 4NG6A 3CKEA 5A0IA 5B02A 2E95A 5IVGA 2RAHA 1WY0A 5DGNF 5ERMA 2F8CF 1WL0A 3SDTA 2DH4A 3DYFA 5JV1F 3KBKA 5CG6A 2OPMA 3SDUA 5DIQF 2E90A 5DJRF 3WEGA 4FP4A 4ZQ8A 3SDRA 3CC9A 4KVIA 3ZCDA 1WMWA 2PS7A 4K10A 2Z4WA 3N1WF 1YJ4A 5IMIA 5EROA 5ILDA 1YV5A 1WKZA 3PDEA 2E4OA 4F6VA 4JXNA 2F92F 4F62A 4KVWA 4LZCA 1HM4A 5B00A 2Q80A 2F89F 4KVDA 4RXEA 2OA6A 4KUXA 1N1BA 1JFGA 2ONGA 4H5CF 1N24A 4DWBA 3DYGA 4OMGA 1PS1A 4NFKF 4F6XA 5IMPA 3LVSA 5ER8A 5IL8A 3KRAA 2ZCQA 3WCFA 4RXCA 1V4EA 3WJOA 2E92A 2AEKA 4LZ0A 1YYTA 3TFNA 3OACA 5DW7A 3RYEA 4KFAA 3WEIA 5EAUA 3VJBA 3V1XA 3WJKA 2Z4XA 3G4DA 1UBXA 3N1VF 4L2XF 3KRFB 1VG6A 3OYRA 4JXYA 2AZLA 1YHLA 5AHUB 4LFVF 3LOMA 3VJ8A 3WSBA 1DGPA 1N20A 3N45F 5H9DA 4LFGA 3BNXA 3RMGA 4XQRF 3AQBB 2OGDA 4Q23A 4LLSA 4UMJA 1UBVA 2AELA 4DHDA 3Q1OA 5DHKA 2F8ZF 3S4JA 2J1PA 4E1EA 5DZ2A 2ONHA 3KRPA 2E94A 2Q9ZA 3N3LF 3ACXA 1UBWA 2ZEUA 3MZVA 3ZOUA 2E8WA 4KQUA 4LPHF 4LIXA 3WCEA 2OPNA 5HN9A 3M00A 5IM1A 1RQIA 2E8XA 4DEMF 3PKOA 2AETA 1V4KA 3N6KF 5AFXA 4E9UA 4JYXA 4LPGF 3V66A 4JVJF 1V4IA 3ACWA 1VG2A 5IKAA 3NF2A 2P1CA 2ZCOA 3BNYA 1VG7A 5ILZA 3ADZA 4RXAA 4MC8A 3Q2ZA 5B0MA 5A0JA 2Z7HA 3OABA 5A0KA 4RYPA 3QKCA 5IKHA 1YQ7A 1WL1A 4KWDA 2Z50A 3KRPB 1KIZA 4KK2A 2H8OA 4LUUA 3LMDA 3WCAA 3AE0A 1HXGA 3N5HF 3P8LA 1RQJA 5AELA 4JZBA 1HM7A 2FTZA 5CG5A 5EASA 3ASXA 5JV0F 5IMNA 5JA0F 3WEKA 3NPRA 4LTVA 5ERNA 4DWGA 4KPJA 5C05A 3MAVA 5HN8A 4E9ZA 5E8KA 5DJPF 3VJEA 4GAXA 2F9KF 4NFIF 3VJCA 1V4HA 2PS5A 3KB9A 1HX9A 3N0FA 4H5EF 3NPKA 3WCJA 5E8HA 4P0WA 4H5DF 3N3DA 3WJNA 4HD1A 2PS4A 3QQVA 3SDQA 4EA2A 3EFQA 3WCCA 4LTZA 4OKZA 1YYUA 4LOBA 2E8TA 2Z7IA 5IK0A 3N46F 3N49F 3RYWA 3EZ3A 3M02A 2E8VA 2I19A 5AYPA 4GP2A 3M01A 4LZ3A 2FORA 3KRAB 3IPIA 1N21A 3WCMA 3LJIA 3PH7A 3PYBA 1YYQA 2E93A 3WC9A 3W7FA 4P0VA 5ILIA 3LSNA 4GP1A 4OMHA 3M0GA 5B0IA 5B0JA 3OACB 5ILYA 1WL2A 5ILHA 2Z4VA 3KRCA 5IL3A 3VJAA 4FJQA 5JUZF 3LEEA 3APZA 4XQTF 2F7MF 3ZMCA 5KSXF 5B0KA 4NKEA 4RNQA 3Q30A 1N22A 3AQ0A 3LG5A 3P8RA 3WE9A 1KIYA 1RTRA 4KQ5A 4NFJF 3LZ9A 3ICKA 2F94F 4LA6A 3SAEA 3M9UA 4XQSF 3LDWA 5IK9A 3IBAA 4KQSA 4QPFA 3ICZA 3VJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HN7 A;  5HNA A;  2ZEV A;  2J1O A;  4LFE A;  3P5P A;  4N9U A;  4KPD A;  5I1U A;  3LGK A;  5IN8 A;  3ID0 A;  3KRO A;  3KRF A;  2Q58 A;  1UBY A;  5EAT A;  2QIS A;  4MC3 A;  3CP6 A;  3G4F A;  4LLT A;  1FPS A;  3KRC B;  3EGT A;  1EZF A;  4LXW A;  1YYS A;  4EA0 A;  3WCB A;  3P41 A;  3ZMB A;  3WEJ A;  3TC1 A;  5ILJ A;  2Z52 A;  4P0X A;  3VJ9 A;  3P5R A;  5DHI A;  5B01 A;  1V4J A;  2Z78 A;  4QXS F;  3Q2Q A;  2O1O A;  3WCD A;  3DYH A;  1YYR A;  4WK5 A;  4JZX A;  2E8U A;  3TFP A;  1YHM A;  4KKM A;  1WL3 A;  2Z4Z A;  2AZK A;  3SDV A;  2ZCR A;  3WEF A;  3LGZ B;  3B7L A;  4PVY F;  4RXD A;  3ACY A;  3OAB B;  1ZW5 A;  3WCG A;  4DZW A;  3KRO B;  5B03 A;  3WEH A;  1YHK A;  4OKM A;  2Q9Y A;  3ICN A;  3LK5 A;  2J5C A;  2Z4Y A;  3N5J F;  5E8L A;  4OGU A;  2EWG A;  2ZCS A;  3S9V A;  1VG3 A;  3RBM A;  4NKF A;  3AQC B;  3WCH A;  1JFA A;  5JV2 F;  3LLW A;  3TFV A;  4PVX F;  4LA5 A;  3N0G A;  3WCL A;  3WSA A;  1VG4 A;  1DI1 A;  3NRI A;  3ICM A;  1N23 A;  5DJV F;  1HXC A;  4NUA A;  3ZL6 A;  3WCI A;  5DGS F;  3PYA A;  2ZY1 A;  5B0L A;  4MC0 A;  4N1Z F;  5DGM F;  2PS6 A;  1HXA A;  4DXJ A;  4DI5 A;  5IK6 A;  4GA3 A;  2AZJ A;  3UCA A;  3TS7 A;  5ILK A;  2VF6 A;  2PS8 A;  1N1Z A;  2E91 A;  4EA1 A;  4KVY A;  3V1V A;  4NG6 A;  3CKE A;  5A0I A;  5B02 A;  2E95 A;  5IVG A;  2RAH A;  1WY0 A;  5DGN F;  5ERM A;  2F8C F;  1WL0 A;  3SDT A;  2DH4 A;  3DYF A;  5JV1 F;  3KBK A;  5CG6 A;  2OPM A;  3SDU A;  5DIQ F;  2E90 A;  5DJR F;  3WEG A;  4FP4 A;  4ZQ8 A;  3SDR A;  3CC9 A;  4KVI A;  3ZCD A;  1WMW A;  2PS7 A;  4K10 A;  2Z4W A;  3N1W F;  1YJ4 A;  5IMI A;  5ERO A;  5ILD A;  1YV5 A;  1WKZ A;  3PDE A;  2E4O A;  4F6V A;  4JXN A;  2F92 F;  4F62 A;  4KVW A;  4LZC A;  1HM4 A;  5B00 A;  2Q80 A;  2F89 F;  4KVD A;  4RXE A;  2OA6 A;  4KUX A;  1N1B A;  1JFG A;  2ONG A;  4H5C F;  1N24 A;  4DWB A;  3DYG A;  4OMG A;  1PS1 A;  4NFK F;  4F6X A;  5IMP A;  3LVS A;  5ER8 A;  5IL8 A;  3KRA A;  2ZCQ A;  3WCF A;  4RXC A;  1V4E A;  3WJO A;  2E92 A;  2AEK A;  4LZ0 A;  1YYT A;  3TFN A;  3OAC A;  5DW7 A;  3RYE A;  4KFA A;  3WEI A;  5EAU A;  3VJB A;  3V1X A;  3WJK A;  2Z4X A;  3G4D A;  1UBX A;  3N1V F;  4L2X F;  3KRF B;  1VG6 A;  3OYR A;  4JXY A;  2AZL A;  1YHL A;  5AHU B;  4LFV F;  3LOM A;  3VJ8 A;  3WSB A;  1DGP A;  1N20 A;  3N45 F;  5H9D A;  4LFG A;  3BNX A;  3RMG A;  4XQR F;  3AQB B;  2OGD A;  4Q23 A;  4LLS A;  4UMJ A;  1UBV A;  2AEL A;  4DHD A;  3Q1O A;  5DHK A;  2F8Z F;  3S4J A;  2J1P A;  4E1E A;  5DZ2 A;  2ONH A;  3KRP A;  2E94 A;  2Q9Z A;  3N3L F;  3ACX A;  1UBW A;  2ZEU A;  3MZV A;  3ZOU A;  2E8W A;  4KQU A;  4LPH F;  4LIX A;  3WCE A;  2OPN A;  5HN9 A;  3M00 A;  5IM1 A;  1RQI A;  2E8X A;  4DEM F;  3PKO A;  2AET A;  1V4K A;  3N6K F;  5AFX A;  4E9U A;  4JYX A;  4LPG F;  3V66 A;  4JVJ F;  1V4I A;  3ACW A;  1VG2 A;  5IKA A;  3NF2 A;  2P1C A;  2ZCO A;  3BNY A;  1VG7 A;  5ILZ A;  3ADZ A;  4RXA A;  4MC8 A;  3Q2Z A;  5B0M A;  5A0J A;  2Z7H A;  3OAB A;  5A0K A;  4RYP A;  3QKC A;  5IKH A;  1YQ7 A;  1WL1 A;  4KWD A;  2Z50 A;  3KRP B;  1KIZ A;  4KK2 A;  2H8O A;  4LUU A;  3LMD A;  3WCA A;  3AE0 A;  1HXG A;  3N5H F;  3P8L A;  1RQJ A;  5AEL A;  4JZB A;  1HM7 A;  2FTZ A;  5CG5 A;  5EAS A;  3ASX A;  5JV0 F;  5IMN A;  5JA0 F;  3WEK A;  3NPR A;  4LTV A;  5ERN A;  4DWG A;  4KPJ A;  5C05 A;  3MAV A;  5HN8 A;  4E9Z A;  5E8K A;  5DJP F;  3VJE A;  4GAX A;  2F9K F;  4NFI F;  3VJC A;  1V4H A;  2PS5 A;  3KB9 A;  1HX9 A;  3N0F A;  4H5E F;  3NPK A;  3WCJ A;  5E8H A;  4P0W A;  4H5D F;  3N3D A;  3WJN A;  4HD1 A;  2PS4 A;  3QQV A;  3SDQ A;  4EA2 A;  3EFQ A;  3WCC A;  4LTZ A;  4OKZ A;  1YYU A;  4LOB A;  2E8T A;  2Z7I A;  5IK0 A;  3N46 F;  3N49 F;  3RYW A;  3EZ3 A;  3M02 A;  2E8V A;  2I19 A;  5AYP A;  4GP2 A;  3M01 A;  4LZ3 A;  2FOR A;  3KRA B;  3IPI A;  1N21 A;  3WCM A;  3LJI A;  3PH7 A;  3PYB A;  1YYQ A;  2E93 A;  3WC9 A;  3W7F A;  4P0V A;  5ILI A;  3LSN A;  4GP1 A;  4OMH A;  3M0G A;  5B0I A;  5B0J A;  3OAC B;  5ILY A;  1WL2 A;  5ILH A;  2Z4V A;  3KRC A;  5IL3 A;  3VJA A;  4FJQ A;  5JUZ F;  3LEE A;  3APZ A;  4XQT F;  2F7M F;  3ZMC A;  5KSX F;  5B0K A;  4NKE A;  4RNQ A;  3Q30 A;  1N22 A;  3AQ0 A;  3LG5 A;  3P8R A;  3WE9 A;  1KIY A;  1RTR A;  4KQ5 A;  4NFJ F;  3LZ9 A;  3ICK A;  2F94 F;  4LA6 A;  3SAE A;  3M9U A;  4XQS F;  3LDW A;  5IK9 A;  3IBA A;  4KQS A;  4QPF A;  3ICZ A;  3VJD A; 
#chains in the Genus database with same CATH topology
 5HN7 A;  5HNA A;  2ZEV A;  2J1O A;  4LFE A;  3P5P A;  4N9U A;  4KPD A;  5I1U A;  3LGK A;  5IN8 A;  3ID0 A;  3KRO A;  3KRF A;  2Q58 A;  1UBY A;  5EAT A;  2QIS A;  4MC3 A;  3CP6 A;  3G4F A;  4LLT A;  1FPS A;  3KRC B;  3EGT A;  1EZF A;  4LXW A;  1YYS A;  4EA0 A;  3WCB A;  3P41 A;  3ZMB A;  3WEJ A;  3TC1 A;  5ILJ A;  2Z52 A;  4P0X A;  3VJ9 A;  3P5R A;  5DHI A;  5B01 A;  1V4J A;  2Z78 A;  4QXS F;  3Q2Q A;  2O1O A;  3WCD A;  3DYH A;  1YYR A;  4WK5 A;  4JZX A;  2E8U A;  3TFP A;  1YHM A;  4KKM A;  1WL3 A;  2Z4Z A;  2AZK A;  3SDV A;  2ZCR A;  3WEF A;  3LGZ B;  3B7L A;  4PVY F;  4RXD A;  3ACY A;  3OAB B;  1ZW5 A;  3WCG A;  4DZW A;  3KRO B;  5B03 A;  3WEH A;  1YHK A;  4OKM A;  2Q9Y A;  3ICN A;  3LK5 A;  2J5C A;  2Z4Y A;  3N5J F;  5E8L A;  4OGU A;  2EWG A;  2ZCS A;  3S9V A;  1VG3 A;  3RBM A;  4NKF A;  3AQC B;  3WCH A;  1JFA A;  5JV2 F;  3LLW A;  3TFV A;  4PVX F;  4LA5 A;  3N0G A;  3WCL A;  3WSA A;  1VG4 A;  1DI1 A;  3NRI A;  3ICM A;  1N23 A;  5DJV F;  1HXC A;  4NUA A;  3ZL6 A;  3WCI A;  5DGS F;  3PYA A;  2ZY1 A;  5B0L A;  4MC0 A;  4N1Z F;  5DGM F;  2PS6 A;  1HXA A;  4DXJ A;  4DI5 A;  5IK6 A;  4GA3 A;  2AZJ A;  3UCA A;  3TS7 A;  5ILK A;  2VF6 A;  2PS8 A;  1N1Z A;  2E91 A;  4EA1 A;  4KVY A;  3V1V A;  4NG6 A;  3CKE A;  5A0I A;  5B02 A;  2E95 A;  5IVG A;  2RAH A;  1WY0 A;  5DGN F;  5ERM A;  2F8C F;  1WL0 A;  3SDT A;  2DH4 A;  3DYF A;  5JV1 F;  3KBK A;  5CG6 A;  2OPM A;  3SDU A;  5DIQ F;  2E90 A;  5DJR F;  3WEG A;  4FP4 A;  4ZQ8 A;  3SDR A;  3CC9 A;  4KVI A;  3ZCD A;  1WMW A;  2PS7 A;  4K10 A;  2Z4W A;  3N1W F;  1YJ4 A;  5IMI A;  5ERO A;  5ILD A;  1YV5 A;  1WKZ A;  3PDE A;  2E4O A;  4F6V A;  4JXN A;  2F92 F;  4F62 A;  4KVW A;  4LZC A;  1HM4 A;  5B00 A;  2Q80 A;  2F89 F;  4KVD A;  4RXE A;  2OA6 A;  4KUX A;  1N1B A;  1JFG A;  2ONG A;  4H5C F;  1N24 A;  4DWB A;  3DYG A;  4OMG A;  1PS1 A;  4NFK F;  4F6X A;  5IMP A;  3LVS A;  5ER8 A;  5IL8 A;  3KRA A;  2ZCQ A;  3WCF A;  4RXC A;  1V4E A;  3WJO A;  2E92 A;  2AEK A;  4LZ0 A;  1YYT A;  3TFN A;  3OAC A;  5DW7 A;  3RYE A;  4KFA A;  3WEI A;  5EAU A;  3VJB A;  3V1X A;  3WJK A;  2Z4X A;  3G4D A;  1UBX A;  3N1V F;  4L2X F;  3KRF B;  1VG6 A;  3OYR A;  4JXY A;  2AZL A;  1YHL A;  5AHU B;  4LFV F;  3LOM A;  3VJ8 A;  3WSB A;  1DGP A;  1N20 A;  3N45 F;  5H9D A;  4LFG A;  3BNX A;  3RMG A;  4XQR F;  3AQB B;  2OGD A;  4Q23 A;  4LLS A;  4UMJ A;  1UBV A;  2AEL A;  4DHD A;  3Q1O A;  5DHK A;  2F8Z F;  3S4J A;  2J1P A;  4E1E A;  5DZ2 A;  2ONH A;  3KRP A;  2E94 A;  2Q9Z A;  3N3L F;  3ACX A;  1UBW A;  2ZEU A;  3MZV A;  3ZOU A;  2E8W A;  4KQU A;  4LPH F;  4LIX A;  3WCE A;  2OPN A;  5HN9 A;  3M00 A;  5IM1 A;  1RQI A;  2E8X A;  4DEM F;  3PKO A;  2AET A;  1V4K A;  3N6K F;  5AFX A;  4E9U A;  4JYX A;  4LPG F;  3V66 A;  4JVJ F;  1V4I A;  3ACW A;  1VG2 A;  5IKA A;  3NF2 A;  2P1C A;  2ZCO A;  3BNY A;  1VG7 A;  5ILZ A;  3ADZ A;  4RXA A;  4MC8 A;  3Q2Z A;  5B0M A;  5A0J A;  2Z7H A;  3OAB A;  5A0K A;  4RYP A;  3QKC A;  5IKH A;  1YQ7 A;  1WL1 A;  4KWD A;  2Z50 A;  3KRP B;  1KIZ A;  4KK2 A;  2H8O A;  4LUU A;  3LMD A;  3WCA A;  3AE0 A;  1HXG A;  3N5H F;  3P8L A;  1RQJ A;  5AEL A;  4JZB A;  1HM7 A;  2FTZ A;  5CG5 A;  5EAS A;  3ASX A;  5JV0 F;  5IMN A;  5JA0 F;  3WEK A;  3NPR A;  4LTV A;  5ERN A;  4DWG A;  4KPJ A;  5C05 A;  3MAV A;  5HN8 A;  4E9Z A;  5E8K A;  5DJP F;  3VJE A;  4GAX A;  2F9K F;  4NFI F;  3VJC A;  1V4H A;  2PS5 A;  3KB9 A;  1HX9 A;  3N0F A;  4H5E F;  3NPK A;  3WCJ A;  5E8H A;  4P0W A;  4H5D F;  3N3D A;  3WJN A;  4HD1 A;  2PS4 A;  3QQV A;  3SDQ A;  4EA2 A;  3EFQ A;  3WCC A;  4LTZ A;  4OKZ A;  1YYU A;  4LOB A;  2E8T A;  2Z7I A;  5IK0 A;  3N46 F;  3N49 F;  3RYW A;  3EZ3 A;  3M02 A;  2E8V A;  2I19 A;  5AYP A;  4GP2 A;  3M01 A;  4LZ3 A;  2FOR A;  3KRA B;  3IPI A;  1N21 A;  3WCM A;  3LJI A;  3PH7 A;  3PYB A;  1YYQ A;  2E93 A;  3WC9 A;  3W7F A;  4P0V A;  5ILI A;  3LSN A;  4GP1 A;  4OMH A;  3M0G A;  5B0I A;  5B0J A;  3OAC B;  5ILY A;  1WL2 A;  5ILH A;  2Z4V A;  3KRC A;  5IL3 A;  3VJA A;  4FJQ A;  5JUZ F;  3LEE A;  3APZ A;  4XQT F;  2F7M F;  3ZMC A;  5KSX F;  5B0K A;  4NKE A;  4RNQ A;  3Q30 A;  1N22 A;  3AQ0 A;  3LG5 A;  3P8R A;  3WE9 A;  1KIY A;  1RTR A;  4KQ5 A;  4NFJ F;  3LZ9 A;  3ICK A;  2F94 F;  4LA6 A;  3SAE A;  3M9U A;  4XQS F;  3LDW A;  5IK9 A;  3IBA A;  4KQS A;  4QPF A;  3ICZ A;  3VJD A; 
#chains in the Genus database with same CATH homology
 5HN7 A;  5HNA A;  2ZEV A;  2J1O A;  4LFE A;  3P5P A;  4N9U A;  4KPD A;  5I1U A;  3LGK A;  5IN8 A;  3ID0 A;  3KRO A;  3KRF A;  2Q58 A;  1UBY A;  5EAT A;  2QIS A;  4MC3 A;  3CP6 A;  3G4F A;  4LLT A;  1FPS A;  3KRC B;  3EGT A;  1EZF A;  4LXW A;  1YYS A;  4EA0 A;  3WCB A;  3P41 A;  3ZMB A;  3WEJ A;  3TC1 A;  5ILJ A;  2Z52 A;  4P0X A;  3VJ9 A;  3P5R A;  5DHI A;  5B01 A;  1V4J A;  2Z78 A;  4QXS F;  3Q2Q A;  2O1O A;  3WCD A;  3DYH A;  1YYR A;  4WK5 A;  4JZX A;  2E8U A;  3TFP A;  1YHM A;  4KKM A;  1WL3 A;  2Z4Z A;  2AZK A;  3SDV A;  2ZCR A;  3WEF A;  3LGZ B;  3B7L A;  4PVY F;  4RXD A;  3ACY A;  3OAB B;  1ZW5 A;  3WCG A;  4DZW A;  3KRO B;  5B03 A;  3WEH A;  1YHK A;  4OKM A;  2Q9Y A;  3ICN A;  3LK5 A;  2J5C A;  2Z4Y A;  3N5J F;  5E8L A;  4OGU A;  2EWG A;  2ZCS A;  3S9V A;  1VG3 A;  3RBM A;  4NKF A;  3AQC B;  3WCH A;  1JFA A;  5JV2 F;  3LLW A;  3TFV A;  4PVX F;  4LA5 A;  3N0G A;  3WCL A;  3WSA A;  1VG4 A;  1DI1 A;  3NRI A;  3ICM A;  1N23 A;  5DJV F;  1HXC A;  4NUA A;  3ZL6 A;  3WCI A;  5DGS F;  3PYA A;  2ZY1 A;  5B0L A;  4MC0 A;  4N1Z F;  5DGM F;  2PS6 A;  1HXA A;  4DXJ A;  4DI5 A;  5IK6 A;  4GA3 A;  2AZJ A;  3UCA A;  3TS7 A;  5ILK A;  2VF6 A;  2PS8 A;  1N1Z A;  2E91 A;  4EA1 A;  4KVY A;  3V1V A;  4NG6 A;  3CKE A;  5A0I A;  5B02 A;  2E95 A;  5IVG A;  2RAH A;  1WY0 A;  5DGN F;  5ERM A;  2F8C F;  1WL0 A;  3SDT A;  2DH4 A;  3DYF A;  5JV1 F;  3KBK A;  5CG6 A;  2OPM A;  3SDU A;  5DIQ F;  2E90 A;  5DJR F;  3WEG A;  4FP4 A;  4ZQ8 A;  3SDR A;  3CC9 A;  4KVI A;  3ZCD A;  1WMW A;  2PS7 A;  4K10 A;  2Z4W A;  3N1W F;  1YJ4 A;  5IMI A;  5ERO A;  5ILD A;  1YV5 A;  1WKZ A;  3PDE A;  2E4O A;  4F6V A;  4JXN A;  2F92 F;  4F62 A;  4KVW A;  4LZC A;  1HM4 A;  5B00 A;  2Q80 A;  2F89 F;  4KVD A;  4RXE A;  2OA6 A;  4KUX A;  1N1B A;  1JFG A;  2ONG A;  4H5C F;  1N24 A;  4DWB A;  3DYG A;  4OMG A;  1PS1 A;  4NFK F;  4F6X A;  5IMP A;  3LVS A;  5ER8 A;  5IL8 A;  3KRA A;  2ZCQ A;  3WCF A;  4RXC A;  1V4E A;  3WJO A;  2E92 A;  2AEK A;  4LZ0 A;  1YYT A;  3TFN A;  3OAC A;  5DW7 A;  3RYE A;  4KFA A;  3WEI A;  5EAU A;  3VJB A;  3V1X A;  3WJK A;  2Z4X A;  3G4D A;  1UBX A;  3N1V F;  4L2X F;  3KRF B;  1VG6 A;  3OYR A;  4JXY A;  2AZL A;  1YHL A;  5AHU B;  4LFV F;  3LOM A;  3VJ8 A;  3WSB A;  1DGP A;  1N20 A;  3N45 F;  5H9D A;  4LFG A;  3BNX A;  3RMG A;  4XQR F;  3AQB B;  2OGD A;  4Q23 A;  4LLS A;  4UMJ A;  1UBV A;  2AEL A;  4DHD A;  3Q1O A;  5DHK A;  2F8Z F;  3S4J A;  2J1P A;  4E1E A;  5DZ2 A;  2ONH A;  3KRP A;  2E94 A;  2Q9Z A;  3N3L F;  3ACX A;  1UBW A;  2ZEU A;  3MZV A;  3ZOU A;  2E8W A;  4KQU A;  4LPH F;  4LIX A;  3WCE A;  2OPN A;  5HN9 A;  3M00 A;  5IM1 A;  1RQI A;  2E8X A;  4DEM F;  3PKO A;  2AET A;  1V4K A;  3N6K F;  5AFX A;  4E9U A;  4JYX A;  4LPG F;  3V66 A;  4JVJ F;  1V4I A;  3ACW A;  1VG2 A;  5IKA A;  3NF2 A;  2P1C A;  2ZCO A;  3BNY A;  1VG7 A;  5ILZ A;  3ADZ A;  4RXA A;  4MC8 A;  3Q2Z A;  5B0M A;  5A0J A;  2Z7H A;  3OAB A;  5A0K A;  4RYP A;  3QKC A;  5IKH A;  1YQ7 A;  1WL1 A;  4KWD A;  2Z50 A;  3KRP B;  1KIZ A;  4KK2 A;  2H8O A;  4LUU A;  3LMD A;  3WCA A;  3AE0 A;  1HXG A;  3N5H F;  3P8L A;  1RQJ A;  5AEL A;  4JZB A;  1HM7 A;  2FTZ A;  5CG5 A;  5EAS A;  3ASX A;  5JV0 F;  5IMN A;  5JA0 F;  3WEK A;  3NPR A;  4LTV A;  5ERN A;  4DWG A;  4KPJ A;  5C05 A;  3MAV A;  5HN8 A;  4E9Z A;  5E8K A;  5DJP F;  3VJE A;  4GAX A;  2F9K F;  4NFI F;  3VJC A;  1V4H A;  2PS5 A;  3KB9 A;  1HX9 A;  3N0F A;  4H5E F;  3NPK A;  3WCJ A;  5E8H A;  4P0W A;  4H5D F;  3N3D A;  3WJN A;  4HD1 A;  2PS4 A;  3QQV A;  3SDQ A;  4EA2 A;  3EFQ A;  3WCC A;  4LTZ A;  4OKZ A;  1YYU A;  4LOB A;  2E8T A;  2Z7I A;  5IK0 A;  3N46 F;  3N49 F;  3RYW A;  3EZ3 A;  3M02 A;  2E8V A;  2I19 A;  5AYP A;  4GP2 A;  3M01 A;  4LZ3 A;  2FOR A;  3KRA B;  3IPI A;  1N21 A;  3WCM A;  3LJI A;  3PH7 A;  3PYB A;  1YYQ A;  2E93 A;  3WC9 A;  3W7F A;  4P0V A;  5ILI A;  3LSN A;  4GP1 A;  4OMH A;  3M0G A;  5B0I A;  5B0J A;  3OAC B;  5ILY A;  1WL2 A;  5ILH A;  2Z4V A;  3KRC A;  5IL3 A;  3VJA A;  4FJQ A;  5JUZ F;  3LEE A;  3APZ A;  4XQT F;  2F7M F;  3ZMC A;  5KSX F;  5B0K A;  4NKE A;  4RNQ A;  3Q30 A;  1N22 A;  3AQ0 A;  3LG5 A;  3P8R A;  3WE9 A;  1KIY A;  1RTR A;  4KQ5 A;  4NFJ F;  3LZ9 A;  3ICK A;  2F94 F;  4LA6 A;  3SAE A;  3M9U A;  4XQS F;  3LDW A;  5IK9 A;  3IBA A;  4KQS A;  4QPF A;  3ICZ A;  3VJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...