3WK0A

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with orotidine 5'-monophosphate methyl ester
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wk0A00
3L67A 2RDTA 1QPNA 1VPXA 1H7RA 4U28A 3NM1A 3P5YA 1EUNA 2JKPA 2NWRA 3B4UA 2PRMA 2DORA 3L2IA 3OVQA 2EHHA 3ABQA 4N9BA 1VRDA 3BW4A 4X3ZA 4JS3A 1XC4A 4FX8A 2R91A 4WQ6A 1SO4A 5KZEA 3ABOA 4AWSA 1GQNA 3FIGA 1OABA 3PBVA 4O54A 5G4EA 2QUVA 5HR7A 3W7PA 3QZEA 2ABBA 3LCXA 5BNKA 1H7XA 3IV3A 1A5CA 2PCQA 1EP2A 5D04C 4NNAA 1R2SA 4Z1CA 4UC5A 1W3NA 1AG1O 3T44A 3TQKA 3AO0A 5GVJA 3MHUA 3PC0A 4M6QA 3NQCA 1JJKA 3GVGA 4RZ5A 5E93A 1Q6LA 3W7JA 1PHQA 2E6AA 1RPXA 3HJZA 3LRLA 3HPXA 3PB0A 3TROA 1W5QA 3BGJA 4LVGA 5L6UA 2QCEA 3NPXA 5IBXC 2ZYFA 3NQ7A 1DKWA 1HO1A 4C1LA 5HWMA 3LI0A 3E0IA 1IXNA 2PRLA 3F4WA 5F4SA 3MJYA 4GC4A 2Q8ZA 4C1KA 3VKJA 1F2JA 3HPSA 4CQ9A 3O06A 3EWZA 4DELA 1JCXA 5K9CA 3W75A 4ICNA 4FB7A 1VYPX 1F05A 3N19B 4TMCA 5HWJA 3THAA 4IX0A 1QNVA 1EWDA 2ZZ3A 4XKYA 4ZMGA 4O17A 3P8JA 1JR1A 4D2JA 3E12A 2TPSA 4O57A 2DZSA 1QPOA 1H1YA 4ADTA 3W7QA 3MBDA 3GKAA 4EWND 2H3BA 4GJ1A 3BG3A 3OVPA 1YDVA 3G8EA 1A50A 4JN6A 3Q58A 1SR9A 4K8HA 3SR7A 1FCUA 3KVLA 1H1ZA 2AQWA 1TPFA 3M41A 4LC6A 2ZZ6A 3W70A 1ME8A 1ALDA 3LM7A 3M43A 2J9ZA 3PS7A 2CW6A 2WJZA 4TIMA 4K7YA 4FIQA 4KWVA 3W7HA 1YADA 4O4VA 3MO7A 1OF6A 2NLIA 4W9TA 2YR1A 4DPQA 3LXAA 5K7JA 4HSOA 3EKZA 1V5XA 4N4PA 1VHCA 1Z48A 3W6YA 3TC7A 5LNRA 5AC6A 2EPHA 2YSWA 4FO4A 4WX2A 1YDOA 1FCBA 2FQIA 3EXRA 5K9DA 1MO0A 3DKJA 3EX1A 3M6YA 4RV8A 2J88A 5L9FA 4L4LA 5FEWA 4Q32A 5I3HA 4JICA 1TPB1 3U6WA 1IXPA 3LI1A 1QWGA 2QCCA 1Q6OA 2A0NA 1SSDA 2WNQA 3CLMA 4RKAA 2AAMA 3STEA 3C2FA 3NVTA 1P0NA 3TSBA 2RFGA 3LLDA 4NJJA 3NQ2A 1WXJA 3N9SA 3W1LA 3WJWA 3GAYA 4JY9A 1KBIA 5TIMA 1MZHA 1WQ5A 3FJ6A 3PSWA 2E1DA 3NQ8A 1JULA 3CC1A 1DHPA 1S5WA 2C6QA 5LHEA 1RQBA 4JX6A 2FLIA 2JGYA 4O11A 2A6NA 2YFOA 4MY9A 4ZQNA 4RR4A 3A24A 3VCRA 3G3MA 4AWTA 5G5IA 2XN0A 1W5PA 2ZRWA 2CLHA 3N2XA 1OYAA 5BOOA 5CSRA 1R2RA 1VQTA 3I68A 2V5BA 4KKXA 4UTUA 4O1AA 3KAOA 1W1ZA 5KINA 1I45A 2VFFA 4LVBA 1PS9A 3PUOA 4MVAA 2YFNA 4EOUA 2DU2A 4RJEA 1GT8A 1VLIA 2J9YA 1T0OA 3W87A 1VLWA 1YTKA 3EWYA 1FWRA 5C55A 3G3DA 3NYZA 3W7CA 3NM3A 3LCWA 2R8WA 2H3DA 3MHGA 1ZALA 3KVJA 3MW7A 3TNOA 3IGUA 2Y88A 1F76A 1AMKA 3MMTA 3G1YA 3MWAA 5D33A 4CQAA 3KVMA 3PVFA 4I9AA 3C2EA 1FDZA 1M7OA 3VNDA 5AC8A 5DN1A 5F1UA 2QCDA 5LNSA 1GTEA 1JCJA 4PODA 1RV8A 3FKRA 2CLOA 2QJHA 1SPQA 3OA3A 1TCDA 4UR8A 1YXDA 4QJ1A 1KFLA 1RVGA 3WFAA 4FF7A 1M6JA 3UYCA 1JCMP 3QW3A 3FS2A 3N9RA 5HUPA 2R14A 4LNYA 4KFPA 3C2OA 1GPWA 4O4WA 4MYAA 2YW3A 4DBEA 3EX4A 4IGHA 5HULA 3BPWA 3KXQA 3INPA 3NDOA 3LCGA 1FX6A 5EY5A 4B5NA 3O6YX 3S5YA 3ZWSA 1ZHAA 3W1AA 1QO5A 1YPFA 4J9JA 3W2JA 3L0KA 2Y70A 4UMBA 3T78A 4K7VA 2ZTKA 1G7VA 3GB6A 4QNWA 5KSWA 1WOAA 1AW5A 3S5ZA 2YX0A 1MXSA 3OIXA 1A5AA 2VEMA 4IMCA 4Y8FA 1KBJA 1X1ZA 4UNKA 2C18A 1ZNNA 3QC3A 4LS0A 2W0UA 1G69A 3ANYA 1XUUA 5KITA 3BGGA 1W56A 3TXVA 1LBLA 3E49A 1KM0A 4UTWA 2X30A 4LU0A 3HGOA 1H60A 4AB4A 3MHFA 3W7EA 2NXGA 1ME9A 3PG8A 1TRIA 3L5MA 3S1UA 4LVDA 4YLWA 3PG9A 3NL2A 4UXDA 3CEPA 2EF9A 2ZZ5A 3G1DA 1G6CA 3M44A 2WO5A 1O60A 1LROA 1FCVA 3Q37A 4ZZ9A 3JS3A 2H6RA 1DORA 1AL7A 4K6AA 4GXMA 3DU0A 1TV5A 3QPZA 1RD5A 4IMEA 2X1UA 5K3VA 3UQNA 1LRTA 1IXOA 5D2VA 3P5ZA 1WDWA 2X2GA 2A6LA 3BW3A 3WJYA 4JTUA 4O50A 4XWUA 4BR1A 3SSJA 4GUIA 4JTKA 1I2QA 1EEPA 1G4PA 2CFFA 3IIXA 4NX5A 5G2HA 3W22A 5IBXA 3HF3A 3RNDA 3O63A 2Y7EA 4PL2A 3LCFA 1ZJIA 2C0AA 2G96A 2CZDA 3UXDA 2A4AA 5G1TA 2VXNA 3LCLA 1OK6A 4H4IA 4HNNA 2ZZ4A 4FEZA 3CTLA 4N9EA 5FI8A 5HUOA 2NXHA 3RU6A 2C19A 3S8HA 1BKSA 2ZZ2A 3NQMA 1W54A 2A5HA 4MFEA 1EP3A 4FX7A 4LV9A 4NU7A 3USBA 5DCBA 3G0XA 3LX9A 3M5VA 1WAUA 5KZDA 3MI6A 2BLEA 3LRMA 1KV8A 4GRSA 3EWUA 3G1HA 1A5BA 3FEMA 3ZS4A 3DHFA 3DFQA 3NQ6A 3LHWA 1OYCA 1FWTA 2OT1A 4LVAA 2Q3RA 2VFEA 4KFNA 4HNVA 2P10A 3O05A 4GE8A 3KOFA 1D9EA 2Z0IA 3LHZA 1KM4A 3C52A 1TV8A 2ZRYA 3DAQA 3PY2A 5DXYA 4BF9A 3QMTA 3NQVA 3DGRA 4IQLA 3W7MA 3JR2A 3A22A 4S2CA 3F1QA 2GJNA 1IGSA 1K02A 4NNCA 1F7BA 4FIRA 3NQEA 4Z1AA 5CZ0A 3EKLA 3HGSA 2WKJA 1PL9A 4CLMA 3TQ0A 2NUWA 1TJPA 5AHEA 1KV5A 2TRSA 3W83A 2ZTJA 4R7JA 4LVFA 3KRSA 1EB3A 3WK3A 1W31A 5DCDA 4EF8A 2I14A 3W7GA 2CLFA 4O10A 1R46A 3NXFA 2GPTA 4I7UA 1X1OA 3UY8A 4LC8A 3NZRA 1F73A 1AK5A 1I2OA 1PCKA 1EA0A 1SO6A 4Z1DA 1B4EA 1QOQA 1LRNA 5CKSA 4GBUA 3GDRA 2E68A 4O28A 3M16A 3TQVA 3IRDA 3TSDA 1QMLA 2A85A 1X8FA 4JX4A 1SZFA 5AHLA 1PIIA 1LOQA 5TQLA 5DELA 4EVZA 3B0VC 2PURA 3DZ1A 1TPDA 3G1SA 3GIYA 3LB0A 5ABTA 1H63A 1XBVA 1VGAA 3MYOA 5HINA 2Q8LA 4EIVA 2BX7A 3BLIA 3DFNA 1JRBA 5J5DA 1H50A 4BI7A 1L6SA 1NVMA 4R53A 3HOJA 1OFOA 3MI3A 3QM3A 1KFBA 4LOCA 3A23A 2V82A 5FF0A 3E9AA 1I2NA 3W7DA 4E0CA 1SW3A 2QCNA 1TIMA 1TPEA 1WYIA 1VYRA 1XL9A 3R5EA 4TO8A 4QNEA 4YCPA 2DZWA 1HG3A 1PHWA 3UNDA 3N3MA 5FF7A 4NJHA 3WJZA 2V30A 3Q2DA 1ICSA 2Y63A 3EX3A 2IQTA 3RF9A 3FOKA 2QCLA 4UFHA 2ZZ7A 1SO5A 1ZY9A 2FDSA 3P81A 3N34A 5G2IA 2CZ5A 3C61A 5EBUA 2YXGA 3NOEA 1OFEA 1ZFJA 1LRQA 5FEZA 2QF7A 4MLRA 3R12A 1P4CA 2O7QA 4Z0JA 1TPVA 1I8JA 5F4WA 3LV6A 1QPRA 1N55A 4X22A 5D05A 5CSSA 1ICPA 4AMAA 3R2GA 3TAOA 2CZEA 3TK7A 3UY7A 4MJMA 1TTQA 3C6CA 2V9DA 1GOXA 2DJLA 1FDYA 4E38A 4RX0A 2Q3OA 1CX9A 3IVUA 3TFXA 4GFSA 5FF2A 5HQEA 3TW6A 3BG5A 4ZQMA 5HJLA 4LS2A 2TMDA 4NZJA 4CNPA 3HG5A 1SZEA 2JBMA 1G4EA 1ZAHA 2E5CA 3EWWA 4PA8A 2VFGA 2WSRA 3GXPA 3LHYA 3S1WA 4RZ6A 3I6RA 3L5LA 3NPWA 5F1VA 4G1KA 4XKYB 5A5WA 3DFPA 2NV2A 3C2RA 4AWUA 1JCLA 3G22A 1XBZA 4M19A 4LRTA 2EAWA 2WNZA 2NWSA 4E2BA 2EGZA 1XI3A 1HO4A 6TIMA 4DO6A 2HS6A 3QW4B 2FJKA 5U4NA 1ZAIA 2QKFA 3DXIA 1LDCA 5KTLA 1TO3A 4WJEA 4OGZA 3FYOA 1LM1A 1K7FA 1O94A 1JQVA 1SFJA 3HB9A 1TJRA 5DLCA 1T96A 1YDNA 4UNLA 3NNTA 2OZ0A 4H3DA 5LHFA 3ZFHA 3G1AA 3M5ZA 2F7FA 4NZFA 4WY0A 3MBFA 3PUEA 4PTNA 2EKCA 4O14A 4AHQA 2Y7GA 2X1TA 4WY0B 3PBWA 3QPYA 1GG1A 4RK8A 3S1XA 3AJXA 2QDGA 1DQXA 5BRBA 1M7PA 3P74A 2QAPA 2Y61A 3NR0A 1S5VA 5AB3A 4JTIA 3HPZA 2PE4A 3LCHA 3OEXA 3QMRA 3SZ8A 3PB2A 1EP1A 3TDFA 1MSSA 1PVNA 3A5VA 5TBOA 4QITA 1WOBA 3DH7A 1GEQA 3W1TA 5FEPA 1TB3A 3FYPA 1LP6A 3VFLA 2CWNA 1EX5A 5AHNA 3A5FA 4KFOA 2YPIA 4GUGA 1LLWA 1W3IA 4K36A 5G4WA 4N4QA 4OHQA 4N2YA 1VH7A 3STFA 3LOTA 1S3HA 2F84A 4KWWA 1MEHA 4FX6M 3EX6A 2CLLA 2QEZA 1W5MA 4IX2A 4ZQCA 2LLEA 1MEWA 4NXSA 1WBJA 3P7YA 4GUJA 1JUEA 4O1BA 3W7KA 4CNOA 3L5AA 4EF9A 2C1HA 2ZA2A 4R34A 3R8RA 1THFD 5KZMA 1KFKA 3GLCA 2G97A 3F03K 5LGZA 4O0ZA 2RHGA 3TIMA 3BW2A 4S2BA 4ORMA 4A2SA 1A53A 1KA9F 1VZWA 2WQPA 1DJNA 4UTJA 1B3OA 4OQVA 1KM2A 1VCFA 5D2YA 2WSYA 3HG3A 3M5XA 4O15A 2YCEA 4O1DA 2C3ZA 3KRUA 2B7NA 4ZQPA 5MHBA 1F5ZA 1LTDA 4WOZA 3P80A 2Y7FA 1L9WA 4QIUA 4AF0A 1ZCOA 3L0GA 4O19A 3W1XA 4AF0B 3HMJG 3W88A 1OYBA 1UUOA 2HSAA 3C56A 4NVTA 1BTMA 1TPUA 2BTMA 3IIPA 1DJQA 1HTIA 1FWWA 2QCDB 1VCVA 1FXPA 3WK0A 1Q6RA 3FFSA 4P2VA 1P0KA 3C0JA 1R47A 1SZGA 3G1FA 4HPJA 3GDLA 1SW0A 5C54A 5LNUA 4IXHA 1ML1A 4AXKA 2B0MA 2WNNA 3L0NA 2CLIA 3L66A 2J27A 4XUGA 1XUZA 3I7QA 4MIMA 4XTIA 3G24A 3GXNA 3IIZA 5AOUA 3HO8A 2X1RA 3TX9A 2OX1A 2FB2A 3HQ1A 3TUUA 3W1QA 3CM4A 3BG9A 3G1VA 4WXZA 3CU2A 3QSTA 5K9XA 3O07A 3VE9A 2V81A 3DI1A 5EA9A 4HPXA 2GQAA 3V75A 3ZR4A 2ZRUA 3GNDA 1SSGA 4UTKA 1W0MA 2Y6ZA 3G0UA 2D73A 3RFAA 1T8XA 5D03A 3KFTA 4JTFA 3PUDA 5K4ZA 4CQ8A 3L68A 3HIJA 3S6DA 2ISWA 2H8ZA 2A7RA 3MYPA 2OT0A 5HMSA 2VFIA 3C2VA 4LY8A 3O15A 1IF2A 4MY8A 3M9YA 1TREA 4BWLA 5CPOA 2ZA1A 5CPLA 3N2MA 5CZJA 3UWWA 4UTHA 3CPRA 1OFDA 2Z6JA 3MP4A 1J4EA 3OG3A 4PCFA 3GX9A 2Y7DA 4Z1BA 3W7LA 3LCIA 1XXXA 5I3IA 1PE1A 2VELA 3TFCA 5D37A 5LKYA 1LOLA 1TTPA 2VFDA 4DBDA 4ONVA 1NFBA 4RZ4A 3BO9A 4JDYA 1TSIA 1KTBA 5CG7A 3DFSA 1VJIA 4TX9A 2C13A 3LBMA 3NPUA 1QR7A 4MLJA 3LGEA 1LYXA 2V2CA 3NPVA 3OHIA 5H2ZA 3E96A 3OBKA 3TAKA 1AW1A 3S5OA 2A7PA 3GDKA 1FWSA 1JQXA 3E02A 4NJGA 2ATMA 1FBAA 3DKLA 1OFPA 2OMAA 3IEBA 1GTHA 1NEYA 2XN1A 1QPQA 1XBYA 3GXTA 4Y90A 4ORIA 3B03A 4CCEA 4O12A 1GVFA 3PWAA 4FNQA 1UASA 4N9DA 1FUYA 4UTMA 1UB3A 3UWUA 2JGQA 3W1MA 3SGZA 3S9YA 2ISSA 4HHPA 3W74A 4UTTC 1ONRA 5D38A 4UIOA 3NO5A 5AYYA 1BWLA 1H5YA 2GOUA 1K8YA 4IUOA 1GVSA 2HMCA 1OK4A 1ZAJA 1N8FA 1OFQA 5DY3A 1NSJA 2ZDRA 1KW1A 3CIWA 5DXXA 3RMJA 4FNSA 3KHJA 3TH6A 3NL6A 3VE7A 1W5OA 3TJLA 3FLUA 1Z44A 3W2NA 1OFRA 1ME7A 3TA6A 3UWQA 3GK0A 4M7TA 3W1NA 4IXXA 1LZOA 2Y85A 4JIQA 2FIQA 4FNRA 7TIMA 5SWUA 1NF0A 3T7VA 1I4NA 3O6DA 2FPVA 3GAKA 1K03A 1R30A 1VHNA 1K3UA 3RLVA 1B57A 3LV5A 1B9BA 3N14A 5D30A 3CT7A 3NEVA 4PL1A 1KFCA 4JTTA 3Q94A 4IWWA 3P8IA 4JY8A 3QJAA 1G4TA 4ML9A 2FFCA 4DEFA 2GQ8A 2BXVA 3P62A 3IVTA 1O5KA 2H8XA 1H62A 1G7UA 2ABAA 3WK2A 1SQ7A 3KRZA 3GKFA 4Z08A 1ZENA 2QCMA 1TRDA 5DBUA 4IMFA 3RK8A 2ZRVA 3A9IA 5EMUA 5D2WA 1KM3A 4UR7A 3DI0A 3SW6A 3O6CA 4Y9AA 2CZFA 2JK2A 4AVFA 3QSRA 3VI2A 3LXCA 1WA3A 1YPIA 2A1YA 5C6MA 4UFMA 2QJIA 4M7SA 2X1SA 3IGXA 3NAVA 4CCCA 5LSMA 3SJ3A 3QYQA 5KMYA 3HGRA 4UMAA 3LTYA 2ZA3A 2V2DA 2QCHA 4UFIA 1FY6A 2BSLA 2C14A 3W23A 5HNRA 3LDVA 5FF4A 4FXRA 4A29A 4YXGA 3LHUA 4R33A 3W2UA 4YCOA 3TMLA 4IPIA 3W84A 1HUVA 3JRKA 3CIXA 1XBXA 3GZ3A 5HWNA 4UTLA 2E6YA 1U83A 3UZ5A 1S5TA 4OE7A 4P61A 2BZNA 5G1YA 3W71A 1Z42A 2FPTA 3O8AA 1RR2A 2RDUA 1G67A 4NJIA 5AHFA 3T55A 1XDLA 1AW2A 4Y96A 4NJKA 2HS8A 2RKXA 3UZJA 1KM5A 3L21A 2BWGA 3K30A 4BI5A 1O95A 3UXAA 4UMCA 5BW6A 1YTEA 3T40A 4LV4A 4RXFA 2JKEA 4XTDA 2XFWA 3DHDA 1DBTA 5AC7A 1M5WA 4OV9A 3W1UA 4E2DA 4HNUA 1DL3A 3LHVA 3G8RA 4RXGA 5CPMA 4RLIA 2Y89A 3W9ZA 4NXKA 4MY1A 5LNVA 3P61A 1K7EA 4MYXA 1J2WA 5D2TA 4FNPA 1LBMA 1GJPA 1H51A 1TQXA 2WPBA 3LRKA 1A5SA 4YL2A 2C15A 2J24A 4OT7A 1XDMA 4AH7A 3W86A 1OX5A 5LZLA 3CHVA 1FCQA 4MZ8A 5LNWA 3UPBA 4N9CA 4LTSA 2VEKA 1Q45A 3G1XA 4UFJA 2Z1BA 1YYAA 4M6VA 2NX9A 4WXYA 1KTCA 2DP3A 1O4UA 1BEUA 1W5NA 4N02A 1TQJA 3UWZA 3W2KA 1GVQA 3QQ0A 2PC4A 4MPQA 3NQFA 1C29A 1FWNA 1JVNA 3IIOA 3W7IA 3TE9A 2QCGA 4LWWA 3PM6A 1TTIA 4HNTA 1XFBA 3BARA 1SFLA 3ELFA 4HSNA 5C5YA 3M1ZA 3IVSA 4LRSA 3IIVA 3R13A 5U7SA 3TW7A 4O16A 2NZLA 4ALDA 4JEQA 3GR8A 3HG4A 4WZHA 4N6FA 2DZTA 1RQEA 1LCOA 1VR6A 2GQ9A 1L6WA 4JTSA 4ZVJA 3W07A 4JTJA 2QDHA 3BLFA 2PRHA 4GNJA 1L2UA 3ABRA 2GJLA 1WBHA 4X2RA 1H61A 3CEUA 3PSVA 2VKZG 5C2XA 4HT3A 3NQGA 4TMBA 2E77A 2GVLA 4MJZA 4OBTA 4Q33A 3NA8A 1W3TA 4IJBA 3LERA 2GVJA 1DOSA 2V5LA 2W79A 5FESA 4LUIA 2YYTA 2ZRZA 3RLUA 3EXSA 5F2IA 5F2LA 4I7WA 3GDMA 3HG2A 2ZZ1A 1SUXA 4JTLA 2ZQ0A 2J9XA 1FQ0A 1T99A 1VC4A 3QRHA 3UWYA 3W73A 3DFOA 3M7WA 1X6UA 4ADUA 2FPYA 3GR7A 1EUAA 3R89A 1ICQA 4UTTA 4MUZA 2YGYA 1H7WA 3NL3A 3TR2A 4MFDA 3PAJA 3CQ0A 4K39A 1SZNA 3SGUA 4H6KA 5H91A 3UD6A 3B05A 4WD0A 2WOQA 2NX3A 5AFDA 5CGQA 1P5BA 2P0OA 2Z2UA 2YZRA 1OX6A 2YDAA 3LBCA 4TU1A 1QCWA 2I1OA 3GYEA 1YTDA 4LT9A 1K7XA 3ATYA 3PBYA 3NGJA 2P1FA 1ADOA 3FA5A 4O53A 4U4MA 4QSHA 4POCA 3HGJA 1TTJA 3H55A 3C3NA 5AHMA 1HFBA 3LTPA 3B0PA 3LXBA 4UCGA 3NG3A 1YLVA 3TMQA 4ADSA 2DZPA 4CNNA 4PEKA 4FNTA 4OWGA 2C16A 3W1RA 3THQA 3QFEA 2VC6A 1B4KA 4NX0A 5F2GA 2RDWA 1Q6QA 1OG0A 2OCZA 3P67A 3P60A 2ZBTA 2QUUA 1UCWA 4A3UA 2QR6A 1H7OA 5F2MA 3EX2A 3TSMA 2E09A 1FDJA 1RQHA 4JX5A 6ALDA 2G5WA 1QO2A 3WJSA 3LHTA 2ZCGA 3EB2A 3PULA 3I7RA 3W76A 1OX4A 1IIHA 2RH9A 1OX4B 1TMHA 4YMZA 1LORA 2OJPA 3EWXA 3TC6A 3HBLA 4IPJA 5AN7A 2B7QA 3CB8A 3QQ1A 3F4NA 2DZVA 2AGKA 4AHPA 2QAFA 1NF7A 3M0ZA 2VOMA 5I3JA 1TPC1 5D02A 1YXYA 4NUWA 3GDTA 2KZHA 2R94A 4O8RA 1YXCA 3O1NA 3TCEA 5AYZA 1JCNA 3QF0A 4A2RA 2W6RA 1XM3A 5BMWA 5D32A 3ZWTA 4QM1A 3TKFA 1HL2A 1OF8A 1F6PA 5EPDA 1D3GA 1VS1A 4UUIA 4N6EA 4Z0SA 3EWBX 5K4XA 4O18A 3G18A 3SY5A 5T26A 4K37A 1MEIA 4OV4A 1VYSX 3MUXA 1H7PA 1KFEA 1LBFA 4YWIA 2TSYA 3ABSA 1LLZA 2V8ZA 4PC8A 3W7NA 3W1PA 3N73A 1OHLA 3S1VA 2E6DA 5IM51 4BK9A 3BLEA 3U8GA 3W7RA 4AEOA 3SFKA 3NQDA 1P1XA 2I9EA 5K2ZA 1Q3NA 4I7VA 3H54A 1DV7A 3GNNA 3W85A 1X7FA 1EPXA 4XQ6A 3FKKA 1SW7A 2V2HA 4TR9A 5E0KA 3YPIA 3STCA 1GWJA 2QJGA 3OVRA 4UFLA 5I3GA 3O16A 4K38A 4JTGA 3DENA 4QAIA 1TPH1 2B7PA 3STGA 1GYLA 1XKYA 2Y62A 4AAJA 2JKAA 1GVRA 2Z6IA 4PH6A 4IOTA 1U5JA 3WK1A 1Z41A 2ISVA 3TXZA 1JRCA 2NXIA 3P82A 3W2MA 3QMSA 3DBPA 8TIMA 2FTPA 1KTNA 1O5XA 2A2IA 3S42A 1LOSA 5DBTA 5I3FA 3S0CA 3A21A 3UWVA 1JUBA 5E1QA 1RZMA 4HN4A 3IGSA 4M5PA 1PCWA 5BMXA 4BI6A 3TV8A 3SI9A 3SIZA 4DF0A 2QUTA 4MOZA 4JXCA 4MKNA 4LUJA 2V0TA 4MZYA 2NUXA 4A22A 3QEZA 1EIXA 3M5YA 4XBKA 1K8XA 4MZ1A 4A21A 2E5BA 4CCDA 4DPPA 1KLYA 1UJPA 1JUKA 1W37A 5FEXA 4ZQRA 1QFEA 4DXVA 4DQWA 5DCEA 2X16A 3W3OA 1TV7A 5EYWA 4LW7A 4LS1A 5CPNA 1TPWA 4FXSA 5LGXA 2WSQA 3I7SA 3C8FA 2YYUA 1UUMA 3MP3A 1I2PA 5AHIA 5I3KA 5J5RA 1FXQA 3WJXA 4O52A 3MP5A 1PV8A 2NUYA 1K8ZA 2J6XA 3QH2A 5CZSA 3M47A 4QISA 3PF3A 4BFAA 4NT0A 1KM1A 3BK0A 1KFJA 3LTSA 1OFBA 1DQWA 1GG0A 5A8GA 3B04A 4IMDA 1W8SA 2O7SA 3EEGA 3B0UX 3P84A 2NV1A 4XBSA 4ZQOA 2VFHA 1QAPA 3FJLA 4JR5A 4JYDA 1AL8A 3H53A 3W2LA 4HIBA 4AHOA 2GUUA 1CW2A 2XN2A 1SU5A 3C4UA 2VEPA 1QOPA 3L9CA 4O13A 4RCXA 3KVKA 1OJXA 2YW4A 1C8VA 3PBUA 2CU0A 1D3HA 2H90A 4GUFA 5CZTA 1JCYA 1OVDA 3T4CA 3CWNA 3V1PA 3W72A 3NQAA 3NZ1A 3TU9A 1IIGA 2QCFA 1QDSA 1N7KA 3G0SA 1V7YA 5AYXA 4JIPA 4JDBA 1KM6A 4L4MA 1H7NA 1E51A 3PR2A 4Q4KA 3BVJA 3BV4A 1VCGA 1C9DA 2ZFAA 1NAL1 5FF3A 4JYEA 3KX6A 4UFKA 5DY2A 4XZ9A 2E5DA 4WOQA 4O0KA 4O1CA 3EXTA 3LLFA 1J5TA 2CLMA 3MI2A 3W7OA 5HR6A 1BWKA 1OFAA 3ATZA 2VEIA 2HTMA 3S5NA 5EKYA 3NL5A 1F6KA 3L65A 4JGDA 2CLKA 4FHAA 3B06A 4K8EA 4JNMA 1CI1A 4GWEA 4WY0F 2FB3A 2B4GA 3SECA 3TJXA 1GZGA 1Y0EA 3B8DA 4JTEA 1IXQA 2A21A 5F4XA 5G2WA 3UPWA 2GVGA 4JTHA 4UTIA 1DVJA 1I2RA 1SO3A 1GYNA 4DO5A 4PFMA 2E6FA 4HKPA 1TYGA 2WV8A 2DZXA 4GUHA 4JYFA 2TYSA 4WUIA 3DFTA 4X9SA 1G4SA 2VENA 2UV8G 4NQ1A 1F74A 4FNUA 4NNBA 4S1FA 4M6PA 1WV2A 4JD4A 4ZL1A 2ALDA 1WX0A 2DJXA 4OU1A 2CLEA 1GVOA 4DO4A 2ZRXA 3CWOX 2G95A 4DF1A 2NX1A 4Y6GA 2A7NA 4QQ3A 5EL1A 1L6YA 3D0CA 1UBSA 5D09A 3U2OA 2ATSA 4UTWC 4BWLC 3I65A 1R2TA 4IMGA 5D2XA 1XCFA 2DZUA 1EWEA 2B7OA 1KLZA 4DF2A
chains in the Genus database with same CATH superfamily
2RUSA 2R1PA 3C8NA 3L67A 3KL3A 3M0HA 3WBEA 1J0KA 1XLAA 1QPNA 1VPXA 2RDTA 2J4GA 1H7RA 1A5KC 1NJJA 3NM1A 3P5YA 4XO7A 2DQXA 4DJEC 2O0TA 3L2IA 4PMQA 4J5NA 4MHBA 1VRDA 3BW4A 4JS3A 4LYPA 3K4AA 4A35A 3PBVA 4H19A 4F66A 5HR7A 3BSGA 3LCXA 2DH2A 1QASA 4B9ZA 4IQJA 1UJQA 4NZ5A 1E70M 4Z1CA 1W3NA 3RN6A 3T44A 2DT0A 3APGA 1PYMA 3K1GA 3NQCA 1J6OA 2VUNA 2Z27A 5E93A 4JTRA 3W7JA 2OQLA 4H9MA 2J7FA 2XZ7A 3L7RA 2PTDA 4ZXLA 2BHUA 2G3FA 3PB0A 4GPNA 3U9IA 1W5QA 1TFVA 1E4MM 4C1LA 3CQJA 5HWMA 3W29A 2PRLA 3SCQA 3H23A 1EYEA 2Q8ZA 4Q8QA 1F2JA 2IXUA 3SN0A 4CQ9A 3EWZA 4LEFA 1JCXA 1TE1A 3CQKA 1R9XA 3DEQA 4Q8PA 4ICNA 3N19B 1OC7A 4JL2A 4TMCA 3EMZA 4BS0A 4C7GA 2OKTA 1GZJA 4HK7A 3THAA 1QNVA 3TN3A 2ZZ3A 1XKJA 2X1IA 4O17A 4KCVA 4D2JA 8XIAA 3E12A 4O57A 2DZSA 1RCOB 4HA3A 4ADTA 3VTRA 1UW9A 4YVPA 2VQTA 4XK2A 3PTMA 3GKAA 4C6IA 4EWND 1TWDA 5ABFA 4GACA 3WLLA 3TYDA 3GIQA 3CL8A 1YDVA 1YHTA 3G8EA 5ABFB 1A50A 1UQYA 1MMFA 5CC6A 4K8HA 3TYUA 1FCUA 3W26A 1PBGA 4I6KA 2BASA 1H1ZA 4LNCA 1Q6CA 1J11A 2IPWA 4TIMA 3MO7A 3ARYA 3LXAA 3P6LA 3EKZA 3TTEA 1ZRQA 3UXKA 1VFLA 2YSWA 1A5OC 1YDOA 1FCBA 3EXRA 3VIJA 3QV6A 1MO0A 3EX1A 2ESCA 2Z24A 2V3FA 2J88A 4L4LA 5FEWA 3HU7A 1Q7QA 4HZ6A 2VZTA 2Z26A 3WO8A 1IXPA 2ZUVA 4JQ4A 3ARXA 3CLMA 3H6OA 3IK2A 3C3UA 1AJZA 1FHLA 1P0NA 1V79A 2PPGA 3WJWA 3BUVA 3GAYA 1P7TA 4Y9OA 1P7TB 1MFUA 4W8AA 4U3AA 1OGSA 2J78A 2XINA 2ZXQA 4WHBA 2JGYA 1DJWA 2XHYA 2CXEA 1XCXA 2YFOA 2DSKA 5A6LA 3RRXA 7TAAA 2PDYA 3AHVA 4CUCA 3OLEA 2X2YA 4EKJA 4B4HA 1HN1A 5EBAA 2GDVA 3T4WA 4C90A 4UTUA 2WC3A 4TV5A 3IARA 4MNKA 4PFHA 1HGWA 1GT8A 4AXNA 3SUUA 1VLWA 5A6KA 3E74A 4G7FA 3W7CA 1NH6A 3MW7A 4B16A 3FY1A 1LLOA 2Z1XA 1AMKA 2CPUA 4QFUA 3GFXA 3HM7A 1K9DA 1SVDA 3G1YA 5D33A 4CQAA 4I9AA 2WBGA 1M7OA 5AC8A 3LGDA 4GZJA 1GOMA 1JCJA 3FKRA 2QJHA 1OBAA 1TG7A 3OBAA 3F5KA 4M6UA 1JCMP 2XH2A 3FS2A 3N9RA 5HUPA 1XGEA 1S1PA 2DDXA 3U0HA 5CC3A 3N6HA 1EEXA 4FMVA 3NDOA 1IV8A 3SCSA 3O6YX 1JG9A 3W1AA 4L4OA 1PAMA 1R3QA 3IJIA 1V0NA 1FH7A 1G7VA 4QNWA 1XLKA 1OINA 3AJ7A 4H7VA 3VOCA 1TELA 1QATA 3OIXA 3EOOA 3S1GA 1KBJA 4UNKA 1O7AA 1BPLB 4TXEA 1WXYA 3UFYA 2W0UA 1W3KA 1W56A 3QLLA 3E49A 1KM0A 4UTWA 3OLGA 2X30A 3KDNA 3WD3A 4LU0A 4WEVX 4AB4A 4JFTA 3DCPA 3W7EA 4KERA 1TRIA 4C6LA 5BCAA 5HQLA 5PTDA 4YLWA 4DJEA 3I6EA 1YNYA 4D6FA 4UXDA 2ZZ5A 4JQ1A 1G6CA 3M44A 5AYBA 1Y5WA 4I5RA 1FCVA 1UKTA 4Z2HA 2FZ9A 3JS3A 2ACRA 1DORA 1F4AA 5I7GA 3MS8A 3E6EA 3QPZA 4IMEA 1KRCC 1XRSA 2A3BA 1WXZA 2V63A 1IXOA 1VEMA 3P5ZA 2X2GA 3BW3A 3N4EA 4Q7IA 2QPUA 3WJYA 4NF7A 4XZMX 4NI8A 3L4WA 3SJNA 4GCXA 2CFFA 5G2HA 1DJHA 3HF3A 4PTDA 4ATWA 1DHKA 1IT8A 1GPFA 1ZJIA 3T0AA 2F9RA 2BXZA 2G96A 2A4AA 4ZGYA 3GC2A 1OK6A 1HW6A 3RO8A 1MI3A 4FP1A 5FSDC 1O12A 1UH4A 3B4YA 1GOIA 1IZKA 3CTLA 4N9EA 1HKKA 2OGYA 2C0HA 3NQMA 4B2DA 1S2UA 4GNVA 1NELA 3GTIA 4LV9A 1Q13A 4NU7A 3G0XA 1WAUA 2Y5JA 3MI6A 1KV8A 3M0YA 4GRSA 3F4CA 3G1HA 3FEMA 3ZIZA 5I77A 1PSCA 1R3YA 2QGYA 3AXHA 3V18A 1FWTA 2VFEA 3A47A 4HNVA 2P10A 3KOFA 3LHZA 1E40A 3H2OA 1O5RA 4LPCA 5FL0A 5XIAA 1RCQA 3QMTA 1RLCL 4S2CA 2WC7A 4CN4A 1IGSA 3H7VA 3IJ7A 1K02A 4NNCA 2X42A 1J93A 5CZ0A 3EKLA 2PDLA 3H8AA 3HGSA 4RNFA 3QV7A 4CLMA 5C9XA 4BQ3A 5AHEA 1KV5A 1E0VA 2TRSA 3FV9A 3KRSA 1E1FA 3DYMA 3WK3A 1W31A 4EF8A 2G37A 1XD0A 2CLFA 3GVWA 1FWIC 1P43A 1R46A 1C90A 4O10A 2GPTA 1QNQA 3BAKA 3UY8A 2FTYA 4M0XA 3M6DA 2QUMA 1AK5A 4QG6A 1ZSXA 4UB9A 4Z1DA 2UY2A 5DQPA 4ICMA 3D3FA 2FHCA 4IL0A 3CMFA 4S3GA 2XFYA 3FGCA 1WZAA 1JZ3A 3FGCB 2WMIA 4AY8A 5TQLA 4EVZA 3UG5A 1MNSA 2WMIB 3DZ1A 4IJRA 5HINA 4XAPA 2PWFA 3AS0A 3GNRA 3AMDA 1JRBA 2ZUWA 2XH0A 1H50A 4QRNA 3RO6A 3HOJA 1OFOA 4NHVA 3QM3A 1B1YA 1ITCA 2IUZA 4G56A 1KFBA 4LOCA 2V82A 1SYTA 1XLMA 3W7DA 1SW3A 3LSBA 3AOFA 1WYIA 2D1ZA 3ARQA 4TO8A 4QNEA 4YPJA 4FXJA 1PHWA 2O9TA 5I23A 3Q2DA 2Y63A 3EX3A 3FOKA 4GX9A 1UR4A 1J0IA 3D47A 3A6OA 4HU4A 3L12A 5EBUA 1DIEA 4KESA 3I10A 1ADDA 5E5CA 1E56A 3FNDA 3R0KA 3HQNA 2QF7A 2VUYA 2O7QA 1PX4A 3VXGA 3Q4DA 1TVNA 3E2QA 1DP0A 1ZCCA 3W6MA 4J3VA 1N55A 4X22A 5D05A 5CSSA 3C5QA 3VKCA 3AUJA 4AX7A 1YDYA 3UY7A 4DZ5A 1FTXA 3WBYA 3C6CA 3TR9A 3FSTA 1PZ3A 1VP5A 2UY4A 3STPA 2Q3OA 4DUOA 2Q09A 3TFXA 4GFSA 3T09A 4ZQMA 5HJLA 1E9IA 2ZX9A 1TR1A 2GGJA 3A12A 3ITYA 3VA8A 5HJYA 4CNPA 2E25A 3HG5A 1SZEA 2JBMA 2QW5A 1ZAHA 1PDYA 3LN3A 3I6RA 2PBGA 1FH8A 2YB4A 2IXVA 4XKYB 3AIEA 3DFPA 1ITXA 2XFFA 1J0HA 1JCLA 4X9YA 4M19A 2WKLA 3EOLA 5LXEA 2EAWA 3OA5A 5GNYA 1HO4A 1XRTA 4BF7A 3ORWA 2HS6A 1EOMA 4PTMA 3VNMA 4FXFA 2AAAA 4XVDA 2G3JA 4UOJA 4AC7C 2XZ9A 5DMNA 1DTUA 2C8NA 5DMMA 5DLCA 3M0MA 4MMWA 4F2BA 1BF6A 1PX8A 4H3DA 2CHNA 1TA3A 1ZB5A 1ZJHA 4NZFA 4U5KA 4WY0A 1TA3B 3EA2A 3PUEA 3CYJA 2EKCA 1UR3M 2X1TA 4WY0B 3LBOA 3PBWA 3OQ8A 3QPYA 2WZIA 4P8VA 5I24A 3S1XA 3AJXA 4H2CA 2Y61A 2WW5A 5AB3A 2NLYA 3GXFA 3LCHA 3IWPA 1TMLA 3TDFA 1EP1A 4PR4A 5C9UA 1PVNA 5A6MA 1GEQA 1UWTA 1K6AA 5EMYA 3H4XA 1ZP4A 4CKQA 2OG9A 1RAKA 4ZOBA 1R7OA 4AVNA 4K36A 4QJ5B 3FAWA 2Y5SA 2F84A 4QROA 1W8GA 1ZJAA 2W3ZA 4LYQA 2CLLA 1W5MA 4HK5A 3MZNA 2LLEA 4AU0A 5A6AA 1JUEA 4O1BA 3CAQA 4DXKA 3L5AA 4EF9A 3KBSA 5KZMA 1KFKA 2A3AA 4ERIA 3TYCA 3F03K 4YVXA 3S46A 4OECA 3KW3A 5CBIA 4G7EA 4CCZA 4H8VA 4A2SA 2WMJA 1MXDA 1FWHC 4G7EB 3BQ6A 1B3OA 1VCFA 2PDFA 3WH7A 5DFAA 3ZYZA 5F7UA 4L80A 1WB0A 1XYMA 2UY5A 4MPKA 2BVDA 2Y7FA 4QIUA 3W81A 2OSWA 3AMGA 4IP4A 3W1XA 3W88A 2GWGA 3HN3A 2DZBA 3BWWA 3KOWA 3GBDA 3TYEA 1XV8A 1FXPA 3VIKA 3N13A 3R7MA 3MVTA 1R47A 4A8LA 4ZO8A 3OVGA 4QLKA 4IXHA 3VIMA 1P6BA 4K68A 3GZAA 3SCPA 2CLIA 3CASA 3A4WA 2H9AA 2V5KA 4C6MA 3I7QA 2H9AB 3HO8A 2OX1A 2FB2A 3G1VA 3CU2A 1BXBA 2OOGA 3O07A 3ZT6A 2V81A 5EA9A 3V75A 2PP0A 3ZR4A 2ZRUA 3G0UA 3NZPA 3DECA 3KFTA 4DI8A 3PUDA 5K4ZA 1J0JA 1ESWA 2FZNA 4C65A 3HIJA 2H8ZA 3MYPA 4AZ7A 2PLCA 3C2VA 4LY8A 2VVNA 2F6XA 5A2AA 2VD9A 4GYFA 4BWLA 5BXTA 1VRXA 3N6QA 4KEVA 9XIMA 3G2GA 3CPRA 3EA3A 3MP4A 1J4EA 2Y7DA 3TFCA 1PE1A 4ICCX 1B30A 5HNNA 1VJZA 4IZGA 1BGGA 2VFDA 4DBDA 2OEKA 1OY0A 3BO9A 2JEQA 2Y8KA 1VJIA 3NPUA 4LXFA 4MLJA 3FA3A 2GYIA 2OTDA 5CH9A 4GO8A 1M03A 1FWSA 2PD9A 4NJGA 2ATMA 1VFFA 3DKLA 2OWCA 1OFPA 4GYKA 2HQAA 1GTHA 1L8PA 4EXQA 4Z2LA 1QPQA 2PWVA 4AWEA 4US6A 4O12A 1IE7C 1ITQA 3PWAA 1E3ZA 2JF6A 2FVMA 1EC7A 3SGZA 3WENA 2ISSA 3QGKC 4PYSA 4UTTC 2QXWA 3JVAA 1A0CA 4GMEA 5D38A 4PRWA 4UIOA 3EDEA 4XAYA 1PWMA 2GOUA 2OLSA 1K8YA 3WUFA 3BAWA 3KP1A 1AQFA 1WP6A 2F8QA 2X0HA 2JIEA 4PMOA 1W5OA 1UMYA 3WQ4A 3GH7A 3W2NA 1ME7A 3SB0A 3GBEA 2P3EA 4QXIA 3DHPA 4M7TA 4IXXA 1H0IA 2FIQA 2HK1A 3VFCA 1BVZA 1XCWA 1K03A 1JZ4A 3CUJA 3VIPA 2E4TA 3KBWA 1B57A 3QN3A 2Q71A 1Y5VA 1F3XA 1XYBA 3IUHA 2FFCA 1JZ5A 4KWOA 2BXVA 4XG1A 4X60A 2ABAA 1SQ7A 5CC5A 2QCMA 4IPLA 1TRDA 4IMFA 3A9IA 1E4NA 3UBPC 3UR8A 2Z1SA 2WANA 5JU6A 3Q67A 2Y8VA 2NQ5A 3AXIA 2CZFA 2JK2A 2FGZA 1XIHA 1EJTC 4CQBA 2D3NA 4UFMA 2QJIA 1AJ2A 4U3CA 3OBEA 1IEQA 3RXZA 1RBOB 3EB3A 4HQVA 4XAZA 2GSJA 2J25A 5FF4A 3GO2A 4FXRA 4A29A 2VDHA 5CG0A 3GWQA 4JFUA 1I1XA 3JRKA 1XBXA 3GZ3A 4RL3A 5MF5A 3D3AA 3TJIA 4OUEA 4DBSA 4P61A 5EMJA 5G1YA 3SRFA 4B5SA 2RDUA 3GW0A 4NJIA 4AG0A 4IIDA 3I4EA 4GQQA 1Q7ZA 1AW2A 3BC9A 1F4HA 4MB3A 1EL3A 3KBNA 2I5IA 2BBFA 4PCPA 2FH6A 1EJ7L 2DVUA 3VIGA 3KWSA 3WMCA 2OZTA 1CXLA 4FLQA 3W4RA 3UXAA 1E55A 4UMCA 9CGTA 1N2VA 2JKEA 3HQOA 4AD3A 3L23A 3DHDA 1DBTA 1M5WA 3W1UA 3QBUA 5A2BA 4KS0A 3RPTA 2VGIA 1C7SA 4MY1A 2D23A 4HTBA 5D2TA 4FNPA 2WVTA 1CGXA 1CXHA 4H04A 4MDOA 4OT7A 3WQ8A 1XDMA 4AC1X 2UWFA 1JD9A 4F0LA 1F3TA 1R9ZA 1FCQA 2R82A 2Z1BA 1YYAA 2F2HA 1MYRA 2WYSA 4N02A 2VEGA 1TQJA 5JH1A 1GVQA 1E4IA 3QQ0A 1ODUA 2FFIA 4MPQA 1C29A 2PGEA 1UP0A 3UVAA 1VBUA 1CZ1A 1WE5A 4LWWA 1JFHA 2P5NA 3R4IA 3WELA 1LWIA 3TNBA 4HSNA 5HJXA 2PDIA 5C5YA 1LWJA 4WCJA 5U7SA 3VABA 3GH5A 4ALDA 3SRKA 1RQEA 2GQ9A 1NOFA 3H2EA 3CGTA 1W1TA 4CN6A 1UWAA 2W61A 3W07A 1EJWC 4GNJA 3ABRA 3UERA 2CC0A 3K13A 4EWJA 4F0HA 4X2RA 5EMMA 3PSVA 3WLKX 4TMBA 1OSEA 3BAIA 3OIHA 2EG7A 3V5FA 5D9NA 6PTDA 4RNIA 3GS6A 4IJBA 3W38A 2GVJA 4LCRA 3FDGA 4ZODA 2EG8A 5FESA 5CZKA 3H7UA 2PUZA 5F2IA 3URAA 3V7PA 2BNJA 2PGWA 2Z25A 1NWRA 2I5GA 3THDA 4M24A 3I3BA 2ZQ0A 4Y9MA 3FVDA 4L1WA 1VC4A 1F3EA 2P88A 3NZQA 1RJQA 1CGVA 2DVTA 2BDQA 4AW7A 3L4UA 1OT1A 6ENLA 3GR7A 2GGHA 5I09A 3QY6A 4UTTA 3VIFA 3FYYA 4MFDA 3CQ0A 4H6KA 3T8LA 3POHA 2J7DA 3IJQA 1XLFA 3UD6A 3W01A 3B05A 4I5UA 1XLJA 2WOQA 2NX3A 5AFDA 5FJIA 3LBCA 3GNOA 1QCWA 1VBJA 4GI4A 2I1OA 4CD7A 3E2SA 3TZFA 1RY8A 3ALGA 4KWSA 2P1FA 4GNKB 1ADOA 4BKNA 1J8VA 4O53A 5BU6A 4BHYA 1TTJA 3H55A 2QULA 5DT7A 5E0CA 3C3NA 4GQRA 1NWSA 3F4VA 4NRSA 4UCGA 3NG3A 4ADSA 1E5NA 4MJ2A 2C16A 3THQA 3T08A 4H7ZA 3QFEA 5F2GA 1GOWA 2QNEA 4LEQA 2P8CA 2ZBTA 5E9XA 2QUUA 2GZXA 1UCWA 2Y4SA 3L2MA 1E9YB 2GQ3A 1XYFA 3VM7A 3ARSA 1FDJA 4KRTA 1RQHA 4ZFCA 4UOQA 4A3QA 3WJSA 4PEEA 4U10A 1RP9A 2ZCGA 2V38A 1O1ZA 1UD2A 4RE4A 1E71M 2HE5A 3FHQA 5HBFA 3TC6A 4IPJA 3CB8A 5XIMA 2GOKA 1Z6KA 2AGKA 1D7FA 5JIPA 4A6GA 5EFDA 1VBGA 3W28A 1TPC1 5D02A 3VGEA 2CKRA 1JCNA 4KRZA 1XM3A 4S39A 4JIHA 4YU1A 1UWRA 1HL2A 3C2YA 1O1HA 1Q2RA 1VS1A 1ZBKA 4I6VA 3GDBA 4OV4A 1VYSX 3VINA 1KFEA 4YWIA 1CECA 1G9HA 3VIHA 3W1PA 1JI1A 3W7NA 2NQLA 4J3XA 3P93A 3R0UA 2E6DA 2ZE3A 5IM51 1P6WA 2CERA 4L65A 1XIDA 3MC5A 1OT2A 3KP0A 4P5UA 3UJEA 1QJWA 1XLHA 4H6QA 4PTXA 4AZCA 4I9MA 1CENA 1EPXA 1HJQA 1SW7A 4AZCB 2DT3A 2J47A 1NFGA 3STCA 2HRWA 1KCZA 6TAAA 1R9YA 5I3GA 2ZXDA 2C91A 4K38A 1R3RA 1CXEA 4PE8A 4XZWA 4AD5A 3STGA 4FOKA 2WCAA 2WZTA 3UU0A 1U5JA 1Z41A 2NSXA 2FDMA 3CUGA 3GHRA 3P82A 3W2MA 2HPMA 3N6JA 2FTPA 1KTNA 3S42A 1X7IA 1LOSA 5DBTA 1XDJA 2I57A 3V0TA 1Q2SA 3LG3A 4XB3A 3UWVA 1S5NA 1Z32X 3FJ4A 3VUSA 4HN4A 4M5PA 2OO6A 4BI6A 2HROA 3A9BA 3TV8A 3SI9A 4DF0A 4NRRA 1B0IA 4NILA 1WDSA 4MKNA 3KTSA 4LUJA 2NUXA 3WF0A 3QEZA 2WVSA 4HU3A 1QW8A 4CCDA 1HVQA 1B3ZA 1NU5A 1UJPA 1JUKA 4Q8WA 4J1OA 4ZQRA 1QFEA 5DCEA 5EB8A 1E4LA 4MWAA 2X16A 1PXGA 4V15A 4ZA0A 3L4XA 4MWAB 1EKOA 1GHSA 1TPWA 2ZUTA 4G8TA 3I7SA 3C8FA 4NP7A 1UUMA 3AHTA 5HA7A 3OODA 3ERPA 3M0VA 1BFNA 2QJMA 5J5RA 1FXQA 4YN5A 1UH2A 4LF1A 1PV8A 1KKRA 2NUYA 3H12A 4YWSA 1K8ZA 4G2DA 1UPMB 4BQ4A 1CB2A 3M47A 4G1NA 4QISA 3PF3A 1ISWA 4NT0A 1DXIA 1KFJA 3TJ4A 1GG0A 1PZ1A 1QK0A 4F40A 1W8SA 3CIVA 3EEGA 2NVAA 2NV1A 1MUWA 4XBSA 3V0UA 4ZQOA 2VFHA 2NQ9A 1QAPA 2PDCA 4YYCA 1M01A 4JR5A 3S83A 4KT2A 4HIBA 2GUUA 2XN2A 4PMXA 1SU5A 1N8IA 4O13A 3IPWA 1ISZA 2YW4A 3F2BA 4L4PA 3PBUA 1CXIA 2NQZA 1D3HA 5CZTA 1JCYA 4WVXA 1OVDA 2XIJA 5HDRA 3T4CA 5CAKA 2E9BA 1PZ2A 5BYWA 3NZ1A 1WDQA 1V8EA 3CUHA 1XFCA 5AYXA 4JIPA 4DJDC 3KRBA 1E51A 4Q4KA 1K77A 3BVJA 1C9DA 3O7UA 1UYQA 3AXMA 3T9PA 5LIUX 4G5DA 5DY2A 1HQTA 4L7ZA 3ZJ7A 4LANA 1IYXA 3OJGA 3XIMA 6XIMA 1HKVA 3ZLFA 1BWKA 2QJNA 2HTMA 3UWEA 2PF0A 3UF9A 5D9MA 4JGDA 4QHRA 3AYRA 1CI1A 4TVUA 2VI0A 2FJUB 4X0NA 3TJXA 4JPGA 1E0XA 3B8DA 5FJOA 4ZO7A 2VX7A 5F4XA 5M03A 4GZ7A 3IV8A 1DVJA 1I2RA 1X98A 1IR2A 2IKGA 1GYNA 1EBHA 4PUKA 2HV5A 1V3HA 3DDMA 5KETA 4EXAA 2XFRA 3JZUA 1B2YA 3DGBA 1F74A 2EBNA 4M6PA 1XG3A 2J13A 4OU1A 3OB8A 4BEQA 4O1FA 4DO4A 2G95A 3RYSA 1L6YA 3OZPA 2ATSA 2ISFA 1JZ6A 2DZUA 1EWEA 3KCOA 3N2OA 3ZR5A 4KCTA 1JDCA 1EUNA 5JUVA 2PRMA 3OVQA 2EHHA 3ABQA 3QXBA 4X3ZA 4FX8A 1SO4A 3FIGA 1OABA 1MW0A 4O0QA 5G4EA 3W7PA 3QZEA 2UY3A 2DUZA 2PCQA 3REQA 5C8BB 5LA2A 4UC5A 4JIRA 2PAJA 4GIAA 2XIIA 3FEQA 3LLXA 4M6QA 3GVGA 4RZ5A 3VM5A 1VD6A 2E6AA 1W3JA 3N4AA 2DPEA 3SQSA 4P8WA 1Z69A 3K2GA 3HPXA 2R24A 4LUTA 4PUNA 4LVGA 4QEHA 5L6UA 1EDQA 3E2VA 2ZYFA 3DOPA 1DKWA 1HO1A 4LUTB 2NT0A 3E0IA 1IXNA 1UG6A 3F4WA 5F4SA 3MJYA 4GC4A 2WHMA 4HOXA 2GJRA 3VD4A 4ENLA 2D0HA 3UZYA 4DELA 5K9CA 4FB7A 3ZSSA 4NYUA 4JQAA 2V5JA 5LXXA 4IX0A 2WJDA 1GNXA 1EWDA 3KOYA 1D3CA 5AC5A 4AEEA 2PLMA 3CT2A 1UA3A 3ZXWA 2EJAA 4Q22A 1K9FA 3LPFA 4NIRA 3B9DA 1V3JA 4J3WA 4IQDA 4GJ1A 2ON3A 3RILA 4TVCA 4AFYA 3BG3A 1LQ2A 4GZIA 3PUGA 1W1VA 2XUCA 1SR9A 1V6VA 3KVLA 4PUDA 3RLGA 2PWGA 1TPFA 4S3EA 4LC6A 3WIJA 4RV3A 3W70A 3RX2A 3WH8A 5IOBA 2XJ7A 4AISA 5LIYX 1YADA 4HK6A 4DPQA 5K7JA 4HSOA 3UR2A 1DIDA 3PANA 5HATA 3TC7A 1ONEA 5AC6A 4FO4A 4WX2A 4DHGA 1V0KA 4ZE5A 5K9DA 2X05A 3M6YA 1RCXB 2IS7A 4RV8A 4MNJA 5L9FA 4W84A 4Q32A 1TPB1 1V3IA 3NZGA 3BH4A 3LI1A 2QCCA 4XZBA 1Q6OA 4YYFA 3CHFA 2E1WA 3H4GA 2WNQA 1W1A1 3BJTA 4N7QA 3QV9A 3C2FA 3NVTA 4JFVA 1YQ2A 2RFGA 4MUPA 3NQ2A 3FSUA 4N0RA 1B9ZA 4WGXA 4DWSD 3VD7A 2E40A 2OVLA 5TIMA 1MZHA 3WQ6A 3FJ6A 2ZE0A 4I5XA 3NYDA 1JULA 3ZZ1A 3CC1A 4QLJA 1S46A 1S5WA 5LHEA 2FLIA 2OKOA 4O11A 2A6NA 1RP8A 4RR4A 3A24A 1XLCA 3VCRA 1CNVA 3G3MA 4AWTA 5G5IA 2XN0A 3EYPA 1KKOA 4HU0A 2ZRWA 1JYWA 3N2XA 2EO7A 5BOOA 3CPGA 3QHOA 1I45A 3PUOA 4MVAA 2Z28A 3LUTA 4EOUA 2ZVIA 4FSAA 1VLIA 3H22A 3GD6A 3E0LA 3EWYA 3B0YA 4AY1A 3VOFA 1W3LA 1NWUA 4ERGA 3NYZA 3G6LA 4GY0A 3LCWA 4ZOCA 3EA1A 3MHGA 1ZALA 4LB3A 3TNOA 4IT1A 2AQOA 2Y88A 2DW7A 1I6NA 4C6FA 3GHTA 3MMTA 3MWAA 2VURA 1DIOA 3G1RA 3VNDA 5F1UA 2QCDA 5LNSA 1F6YA 1SPQA 2XGIA 3GFYA 4UR8A 1YXDA 2JQXA 4AD2A 3OZMA 3URQA 1M6JA 3E2RA 4KFPA 3FK4A 1GPWA 4O4WA 3VX0A 4IGNA 2X7WA 2YW3A 3EX4A 3WNMA 1XIMA 3URBA 3KXQA 4MWAE 4D1IA 1OEPA 3LCGA 2PDPA 3IUIA 1DQUA 1FX6A 1XLGA 5EY5A 4B5NA 3II1A 4EAYA 3ZWSA 5FL1A 1QO5A 4JAWA 4RPQA 4J9JA 3UP8A 1UWQA 4NI3A 2Y70A 3T78A 1W9BM 1WOAA 3S5ZA 1MXSA 2QDDA 5XINA 1X1ZA 3TN5A 3QC3A 3B40A 3ANYA 1RJRA 1XUUA 3BGGA 1ITUA 3NGFA 2DIEA 3TXVA 1LBLA 4B3ZA 3R0DA 4HYVA 1QBAA 4M1RA 3AIBA 4GIRA 1ME9A 4EPEC 3ZJ6A 1XIIA 3WH5A 3L5MA 4JNYA 1TVLA 4HHLA 3D5HA 2J6VA 3TWBA 2HVOA 3PG9A 5M1TA 3CEPA 2EF9A 4BEUA 3Q65A 2Z7GA 4DUVA 3AQUA 1LROA 4KW2A 4PMDA 2D3LA 1J9YA 1JPMA 4J28A 4K1GA 1NQ6A 4GXMA 3UQNA 2POTA 2PDHA 4C91A 4DYKA 1VBRA 2A6LA 4B90A 1AQMA 1VFMA 4BR1A 3SSJA 8RUCA 1UKOA 1I2QA 1CWYA 3DC8A 3TTYA 3IIXA 5A2CA 3FX4A 3JW7A 3O63A 4F2TA 5G1TA 1KXTA 3LCLA 4H4IA 2G4JA 2XVNA 2P8BA 3VAVA 4LSBA 5FI8A 5HUOA 1JAKA 3B9NA 1HL8A 1W54A 1EP3A 2W27A 1V02A 2D2JA 4FX7A 4OOUA 5I78A 2VCAA 3LRMA 1V6YA 1A5BA 1PKYA 2W91A 3DHFA 2YDQA 2OB3A 3LHWA 2RDXA 3N3TA 2Q3RA 2GSEA 1MQRA 2E28A 3O05A 3SUWA 1RD6A 5GJMA 4GYJA 1D9EA 3CAVA 5FKYA 2R6OA 1K9TA 1KM4A 1KFWA 1X6NA 4IFKB 1JXJA 1RHCA 1C3FA 5DXYA 1OCBA 4BF9A 5I3DA 3GVVA 1S3TC 3IAQA 2XVKA 1Q6DA 4IQLA 3W7MA 3A22A 1UOZA 4HMCA 3WQPA 3VOGA 2QIIA 4HB7A 1NOWA 4Z1AA 2WKJA 5CSUA 2PDGA 1W9PA 1DEDA 1P0EA 4PBEA 3W83A 3CMGA 4R7JA 3WQFA 3WD2A 4HCLA 1E6SM 5DO8A 1EZWA 1L8NA 2I14A 3W7GA 2DIJA 4HA0A 4XVEA 3NXFA 4LC8A 3NZRA 1F73A 1ECQA 1H09A 2BS9A 3GDRA 4KQNA 4O28A 1LL7A 3M16A 3AISA 4PBGA 3IRDA 3KCJA 1DE6A 1XJBA 1US3A 3CBWA 3AYTA 1LOQA 4L61A 2TAAA 2PGFA 5DELA 2PURA 1TPDA 2HWGA 3G1SA 2VRQA 1KWGA 3LB0A 1H63A 1AJ0A 4C6BA 3MYOA 4EIVA 4UWMA 2BX7A 1LL4A 1Q8JA 3DFNA 2PDNA 1PUDA 3VUPA 4W87A 4KEUA 3TYAA 4BI7A 1NVMA 3NFUA 4V2XA 3ZT5A 3BSMA 2AL1A 3MI3A 3BAXA 1H1NA 3WBAA 3ZLHA 4AZ5A 1WZKA 5FF0A 4IH3A 3QY8A 4IPNB 3N18A 1XYCA 4HMNA 3FA4A 1VYRA 4RPPA 3R5EA 3GTXA 1LUCA 4H83A 1QI2A 1HG3A 3PWIA 4NJHA 1LUCB 4R3UA 1U1UA 1ICSA 3RF9A 3LM3A 2QCLA 4AIEA 1M9HA 1VJSA 1ZY9A 4X63A 2FDSA 5HOSA 3B97A 2CZ5A 5C2GA 1X96A 2EPLX 3C61A 3CO8A 3FCPA 2G3IA 2B31A 1ZFJA 1VKFA 3MUY1 1EC8A 1YPXA 3CHDA 3RPMA 1TE6A 4MLRA 1S2CA 3R12A 3LENA 1TPVA 5F4WA 3LV6A 4GBDA 5AVHA 2GGEA 5JBFA 1K4GA 3V1HA 4E8GA 4AEFA 1VF8A 1FWGC 3SCNA 3R2GA 3TAOA 2CZEA 3K5XA 2GSHA 3N12A 3TYBA 2V9DA 2HXTA 1NP2A 1Q66A 5FF2A 5HQEA 1E9LA 2PDMA 4IG2A 3RRAA 5BZAA 4PRTA 1XLBA 4IG2B 1DE5A 1V3MA 4E4UA 5FJRA 1I0BA 1QWKA 3MO4A 2BY2A 4FR1A 3EWWA 1T7LA 4PA8A 4DNHA 3LHYA 4RZ6A 1W6TA 1OADA 4G1KA 4DWSA 1J01A 2NV2A 4C7DA 3LPOA 1UZHA 4M8UA 1RBAA 4DWSB 2ZOXA 4GI6A 4HJFA 2BOFX 1QPKA 1XI3A 4W88A 4DJFD 6TIMA 4DO6A 1MWOA 1E6PA 1TO3A 4WJEA 4OGZA 3SCTA 3RITA 4GVIA 2HDJA 3UA3A 4HA1A 4H9ZA 3AZTA 3ES7A 3VGBA 4F79A 5I6SA 1IZCA 4RDVA 5FJPA 1KRMA 1TJRA 1Q65A 1T96A 1YDNA 2YCKX 4UNLA 3BAYA 3BMVA 2Q8XA 1QBBA 2A3CA 3K8MA 3G1AA 4F0RA 4UQBA 3M7SA 2YCLB 5EFFA 4O14A 4AHQA 3GIPA 4I9TA 5M5DA 2D2GA 3WKZA 5JQ9A 4IP5A 4M1BA 1TUFA 1WPCA 3AIVA 3DERA 5BRBA 2QAPA 2PE4A 1PKLA 3T07A 3KLKA 3OEXA 2AL2A 3QMRA 3PB2A 1UWIA 2W9MA 6XIAA 1R87A 3A5VA 2AL2B 3DH7A 3MWCA 2PLJA 4L9YA 3PZTA 1LP6A 2CWNA 1EX5A 3B8TA 3LMZA 5AHNA 3MUZ1 2YPIA 4PUEA 4KGLA 5G4WA 3U2ZA 3STFA 3LOTA 2G4FA 1ZBVA 4PMRA 1MEHA 3OU8A 2RGLA 3KEHA 4ZQCA 3GY1A 3BZJA 1JYXA 1TUXA 4GUJA 3W7KA 4CNOA 3VD9A 3R8RA 4NAFA 1THFD 4XO6A 5T91A 5I5RA 4CN1A 4Z2JA 1HT6A 4NAFB 5T8GA 3C0QA 3R10A 5LGZA 4O0ZA 3WQWA 5EMLA 3OGVA 4QBXA 4S2BA 4ORMA 1KA9F 4UOZA 1OIFA 3AROA 2WQPA 3PWGA 4EPBC 4OQVA 1WKEA 2E7FA 4IIHA 3P2VA 1U1HA 2C3ZA 1W1B1 1UZDA 1F5ZA 1UWSA 1L9WA 3L0GA 4O19A 1UMLA 5A6BD 4M51A 5AVNA 4B91A 1UBPC 3HMJG 1V3LA 2HSAA 3C56A 3UGRA 1YE4A 1A3WA 4ASTA 1TPUA 1X1NA 5HK4A 1HTIA 1FWWA 5ABGA 1A4LA 4CVWA 3FFSA 1A80A 2BY1A 3C0JA 4J2MA 4E4FA 1SZGA 3H7RA 2YL6A 1SW0A 4GJIA 3WDRA 2QF8A 5LNUA 4C5ZA 1CGYA 2DFAA 3L66A 4YTQA 2J27A 5AOUA 3UESA 1GUVA 2GUYA 1Q7MA 4HNLA 4DNMA 2XIBA 2ANUA 3BG9A 5FAJA 3WDQA 4H9VA 3O9NA 3PBGA 2DSZA 3QSTA 1W17A 2VHLA 1HKJA 3EPMA 1E1EA 2GQAA 3SQMA 1KNWA 4L9ZA 1W0MA 2D0FA 2Y6ZA 1TWZA 2D73A 1DJYA 5D03A 5HPCA 1QT1A 4JTFA 3L68A 4NSBA 3S6DA 3QHNA 1BD0A 3E38A 5JIWA 1SJCA 1JZ8A 3EB4A 4MY8A 2BGQA 2O9RA 3M9YA 1WKYA 3WQ5A 1KCXA 2OLAA 2W4XA 2ZA1A 3WF1A 1Z9AA 1OM0A 5CZJA 3UWWA 4KBXA 3OG3A 4C1NB 2EXOA 3GU1A 4LH8A 4Z1BA 1EH9A 1VPQA 3U2EA 4JDYA 2VNCA 3ABZA 4W4QA 1KTBA 5CG7A 2VX5A 4TX9A 5D4YA 2F6KA 3UEQA 1J2BA 3LBMA 1QR7A 3ECQA 1LYXA 2V2CA 3LEPA 3E96A 4LUSA 3OBKA 2VL4A 3ABXA 3N2CA 4LUSB 1DWGM 2PDWA 3UVIA 3GDKA 1JQXA 2ASHA 1FBAA 2DV0A 4FK9A 1JD7A 1V6WA 3ZLGA 3HURA 1K70A 1NEYA 3WFLA 3GXTA 3B03A 2FHBA 3DG7A 1UASA 1RH9A 4X2PA 2JGQA 1WZLA 4HHPA 4PRRA 1FHUA 1QI3A 4E4PA 3NO5A 5AYYA 1BWLA 3AALA 1I0DA 1ZAJA 1MVYA 4F48A 1N8FA 1OFQA 5DY3A 1NSJA 3EAUA 3KM8A 1EA9C 3LPGA 1DWFM 3QZ6A 4FI4A 4FNSA 3WUGA 1E6RA 3TH6A 3BAJA 9RUBA 1Z44A 3N2TA 1OFRA 3OW1A 3UWQA 3LY0A 1LZOA 2MUCA 2Y85A 2WM0A 4FNRA 2XGZA 1NF0A 1UIOA 5LIWX 3GAKA 1XLIA 3ID7A 2VZVA 1VHNA 1K3UA 3RLVA 4DLMA 1B9BA 3AU6A 1SJBA 3N14A 4GABA 3I3DA 1KFCA 4IWWA 2FH8A 3EOSA 1Y5XA 1YKWA 4QS6A 1G4TA 3PZVA 2OQHA 3DHUA 4HTYA 3EDDA 4Z08A 3JUGA 1XSKA 5DBUA 1SMDA 3RK8A 5EMUA 1KCLA 1JIBA 1KM3A 2R1LA 3O6CA 3OG2A 4Y9AA 2OXNA 2WHJA 1J0ZA 1WA3A 5C6MA 4CCCA 1QRQA 4CD8A 4H9TA 2YOCA 4MAZA 3HGRA 2XDFA 4UMAA 2ZA3A 2V2DA 1RK6A 4UFIA 4YNGA 3ONCA 2BSLA 3W23A 3BMXA 5HNRA 5GJNA 3LHUA 4YCOA 3W2UA 3GE7A 1TJ0A 2O4QA 1M1BA 2MNRA 1XP3A 4IPIA 1S2AA 2OWXA 2GLKA 3CIXA 2WVUA 2E67A 3LQGA 2NVCA 3EMCA 3PN8A 1U83A 1S5TA 3GXMA 2BZNA 3VDHA 3KOXA 5AHFA 1DJGA 4GGBA 2BHYA 5ECUA 5C9WA 2HS8A 1H4PA 3MSGA 3UZJA 4R85A 2WZEA 1KM5A 2EG6A 2BWGA 3K30A 4IJCA 4BI5A 3KS6A 5BW6A 5ABEA 1YTEA 2OZ3A 1YEYA 4RXFA 2PSNA 3QFWA 1CB7B 2RJHA 2YBUA 5AC7A 1GJWA 4OV9A 3T05A 2VMFA 3G8RA 2D22A 4DJFA 4RLIA 4NXKA 1ECEA 3Q45A 3P61A 3OPSA 1KCKA 1J2WA 2PODA 1W2PA 4B5XA 1TQXA 1H51A 4EK7A 2J24A 1RXOB 4HPHA 4N9CA 4LTSA 4QR6A 2VEKA 1KBLA 1NWTA 1HKIA 4K1WA 4UFJA 4M6VA 3BCFA 2NX9A 5HNUA 4FS9A 4WXYA 1KTCA 4AZGA 1RUSA 3UWZA 3W2KA 1GOQA 4HVXA 5DF0A 3FHAA 3WSUA 4ZSTA 4HNTA 3VCNA 3BARA 1HJXA 3ELFA 2PCEA 1EHAA 4JN7A 4H6EA 4W8LA 3M1ZA 3IVSA 4WJ8A 4LRSA 1F07A 3IIVA 3R13A 4OVXA 2FTWA 2E0PA 5BWFA 4C7FA 3ITGA 3T1GA 1LCOA 1VR6A 3QC0A 5RUBA 5B80A 2OYLA 4JTSA 3AHXA 3B8UA 2PRHA 1KR1A 1GVIA 4E3TA 2PC8A 2GJLA 1W1PA 4ERAA 3GXIA 4HNOA 1PX3A 2ZC1A 2E77A 3APYA 4D6JA 4Q33A 1PPIA 3NA8A 4MKSA 3HA1A 1PEZA 1Q63A 1W3TA 4Q6JA 3LERA 3CZKA 1DOSA 2V5LA 4LUIA 2PFHA 2ZRZA 2O55A 3RLUA 1E43A 2IQ0A 3U7BA 4TUFA 3QR1A 2O9OA 1XRFA 1BSIA 3GW3A 1DWAM 4JTLA 1XW8A 4WRHA 5I2UA 1FQ0A 5CJNA 4GFIA 4AD0A 1CCWB 4CGTA 3M7WA 1X6UA 2YJQA 1VIZA 3GHSA 2FPYA 2GGGA 5A6BA 1UR9A 3N04A 4MUZA 2D2HA 1H7WA 1SZNA 3VOHA 1NQKA 3QHMA 4I9JA 2PP3A 4WD0A 3MT1A 3J7HA 2P0OA 2Z2UA 2YZRA 5EGRA 1OX6A 1JGIA 2E8YA 3ATYA 3PBYA 3NGJA 2VP8A 1L0PA 3KZSA 3CQHA 3AIWA 2CWXA 2D0GA 5AC4A 3N29A 1HFBA 5I79A 3LTPA 2FZBA 4CNNA 4OBSA 2C1IA 2VC6A 3UT0A 5DMLA 5AYIA 1Q6QA 3FN9A 4KPLA 2J8TA 5ECVA 1G01A 1MXGA 1V4YA 4XSLA 4UNIA 3L4ZA 2C79A 7A3HA 4E8DA 2ZKMX 4Y9NA 4LAMA 1QI5A 3AWNA 4JX5A 4ZE4A 3EDJA 3FAXA 3LHTA 3I7RA 4CU6A 3ISIX 1OX4A 1IIHA 1EO7A 2DIKA 5E9AA 5JBEA 1OX4B 1LORA 4JKMA 2OJPA 1LG1A 3HBLA 2B7QA 1JZ7A 3NSNA 1XG4A 4W86A 3F4NA 3PPGA 1OGBA 2VM8A 2QAFA 3KTXA 2FZ8A 4NUWA 3GDTA 2R94A 4O8RA 1XPGA 4GIYA 1ZBWA 2NSOA 4QM1A 1GGOA 3ALFA 5EPDA 1IT7A 1UD8A 4UUIA 4N6EA 5K4XA 4C6PA 4O18A 1MEIA 4AY7A 4D8ZA 4Q8TA 4JCMA 2V8ZA 1MRAA 1OHLA 1CLKA 4BK9A 3SN1A 3LSCA 4ATDA 3MMDA 1MW1A 2PDKA 3SFKA 3NQDA 1P1XA 1Q3NA 1DV7A 3GNNA 3W85A 2OSXA 4NASA 1X7FA 8XIMA 4Y7EA 3FKKA 3R58A 2CNCA 3RJYA 2V2HA 4TR9A 1CGTA 2J7BA 2W92A 4QE5A 3EMQA 5DRCA 1UD4A 3SCRA 1NDWA 3DENA 4QAIA 1TPH1 5A8OA 1GYLA 4ZENA 2Y62A 2JKAA 3MANA 3UJFA 4S3CA 1YBQA 3ME3A 1JRCA 3QMSA 1YBQB 3DBPA 4S3JA 1O5XA 3VZZA 4YTRA 3TOPA 2PZ0A 2P50A 1ZPTA 3CZ8A 1JUBA 3UETA 1HJUA 3IGSA 2PDXA 3BCDA 4AVOA 3WY1A 1HKMA 3S3GA 3ITLA 3SIZA 2QUTA 3EWCA 1BYAA 1FWBC 4GYPA 2VCBA 2J8FA 2YZ5A 4HOWA 1JDEA 1DIKA 1EJXC 2V0TA 4A22A 4ZO9A 1XIGA 4O1EA 4NYYA 3M5YA 3E3HA 4XBKA 1K8XA 1NY1A 4MZ1A 1VAHA 3TOYA 4A21A 4DPPA 4GXWA 1G5AA 3O6AA 4ATLA 2QMKA 1C9WA 3W3OA 1TV7A 5LGXA 2PWDA 3FVMA 1XSIA 1WDDA 5I3KA 2QS8A 1KWKA 4O52A 3MP5A 4QLLA 2XPKA 4ZTYA 4HPNA 1HP4A 4UQ9A 3ITCA 5CZSA 3GUGA 1JPDX 3EPNA 4BFAA 1YMYA 1EDGA 2VR5A 1KM1A 1GYMA 3LTSA 1P48A 3RPDA 1DQWA 5DT5A 5A8GA 4MM1A 2O7SA 1UUQA 3WLJA 1FWFC 3SRDA 1FWCC 3MMUA 3FJLA 4Y8EA 3WLTA 3W2LA 4AHOA 1CW2A 1QOPA 2BG5A 3GXDA 3L9CA 1OJXA 4GVHA 2GL5A 3QV8A 3VIOA 2H90A 1R3WA 2JE8A 3VKBA 3W72A 3F5JA 2QCFA 3G0SA 1V7YA 3CV6A 3SN4A 1AD4A 4L4MA 1IT0A 1J79A 5FACA 3AI0A 1VCGA 4RW3A 5FA5A 4KIRA 3K4WA 3GR4A 3KX6A 4UFKA 3A4AA 4TTUA 4XZ9A 3U5UA 1QHOA 4O0KA 3EXTA 1GONA 3BURA 3S47A 1A3XA 1OFAA 1U30A 2NVDA 3S5NA 3SUSA 4AQLA 3SRHA 1OB0A 1A4MA 4K8EA 4JNMA 2WAGA 3GVQA 2OODA 3SECA 1UP3A 4UTFA 2IKIA 4D6EA 2A21A 4F9JA 5G2WA 4UTIA 1S2TA 3DYOA 3A3HA 5A3HA 3JZEA 5DEZA 4DO5A 4PFMA 3GTFA 2WV8A 2VJXA 3PJTA 5A95A 4FLSA 2QMJA 4F4RA 2ZX5A 1B3WA 4ECLA 5T9CE 1UKQA 4GX8A 5H6HA 2ALDA 2EPOA 2PWEA 2A3LA 2DJXA 2CLEA 3CB3A 3CWOX 2VRJA 1BF2A 4Y6GA 3S2JA 5EL1A 3D0CA 1W1YA 3AS3A 3WLSA 1H11A 3NIYA 3I65A 1R2TA 4BWLC 3WF4A 5LIXX 3AHZA 3VNLA 5CJMA 1U1JA 2JKPA 3EDKA 1XLEA 2NWRA 2FMOA 3B4UA 2DORA 5DX7A 4N9BA 2FZMA 2CEQA 4J35A 2R91A 4WQ6A 1P6CA 2R9RA 2WMGA 1GQNA 1H49A 4O54A 2QUVA 4L64A 2R1MA 3IV3A 1A5CA 5CEWA 4NNAA 1AMYA 4OTKA 1IEXA 3AO0A 3MHUA 1Q6LA 4LAZA 3N15A 1PHQA 3VNIA 4FPSA 3LRLA 1MUCA 1EGMA 3BGJA 3HV9A 3K46A 1QI0A 2QCEA 2Y8UA 2WB5A 3NPXA 2CHOA 3LI0A 1W9UA 3EOUA 4JIEA 4PGLA 1E3XA 3D6NA 3WD4A 1PO9A 4H2HA 2PEVA 3VKJA 3RM8A 5A8MA 3O06A 3U4FA 2QGHA 3W75A 2PWHA 1VYPX 4M29A 1F05A 5HWJA 3PJXA 4U33A 4XKYA 4AYSA 3BGAA 7XIMA 2TPSA 1FWDC 2ZADA 4JEJA 3TCSA 3MQTA 1QTWA 3WLPA 1OCNA 4DI9A 3APTA 1FP8A 4BF5A 2WHKA 1QUMA 1JDDA 3WEMA 2IPJA 4DY1A 3C0SA 2XU2A 3M41A 4D72A 3AWOA 4OZOA 1ME8A 1ALDA 1M04A 4ZSUA 3M43A 5FOOA 2J9ZA 2XIQA 4J3UA 2POZA 2CW6A 1MRQA 2WJZA 4FIQA 3BANA 1E73M 2NLIA 5CBBA 2YR1A 2VC5A 4EAMA 4N4PA 3W6YA 5LNRA 4FOJA 3TLQA 1O68A 2FQIA 2I9UA 1YW1A 1JDAA 1V51A 4JICA 4S23A 3U6WA 3UCCA 4WR3A 4GO9A 1AZ1A 2A0NA 3K8KA 3WQEA 2AAMA 3BDKA 3STEA 4C60A 5CAHA 3T42A 3TSBA 4NJJA 2BMBA 1WXJA 2E8ZA 3AS1A 4AZ6A 4JY9A 1KBIA 3U7VA 4JN8A 1S2VA 1A5UA 3PSWA 2NW0A 5I0DA 3ENLA 3BOFA 2WMHA 3B0XA 1QOXA 1TX2A 1HJSA 1KRAC 1XGDA 3HFYA 2C6QA 1RQBA 4JX6A 2X7VA 4R7WA 4MY9A 4ZQNA 3V36A 3G6MA 1V03A 4HGXA 1W9DM 2CLHA 4JQ2A 4QJ4B 3CTTA 5CSRA 4DZIA 4IL2A 1VQTA 4HOZA 1U22A 1KXQA 4D6IA 3KAOA 2J8GA 5KINA 1EZ2A 5M2FX 3M07A 4H9XA 1PS9A 4RJEA 4ZCWA 4UZSA 1T0OA 3A4JA 4PMZA 1EJRC 1KO0A 2GDUA 1FWRA 4XIMA 3G3DA 3NM3A 4XZHA 2R8WA 5CLTA 2ZIDA 2VO5A 3IGUA 2GJXA 2GJXB 4EXBA 2VWSA 3PVFA 5DN1A 2P53A 4RDYA 5G1MA 1RV8A 4C6EA 4DAIA 4DB7A 2QVHA 2PZNA 1I1WA 3OA3A 1TCDA 1AD1A 1KFLA 4QJ1A 1RVGA 2PB1A 5BRQA 3UYCA 3ARZA 4KRUA 2BXYA 1TZZA 4LNYA 1B31A 3C2OA 1LQ0A 4HCHA 4MYAA 4V1XA 4DBEA 2FVLA 2RAGA 3BPWA 4S3AA 3INPA 4NKCA 3WNOA 3WUEA 4D8LA 2WLZA 3UJRA 1ZHAA 2Z2BA 5MKGA 3PHAA 3W2JA 5MKGB 3L0KA 3WL0A 4K7VA 3GB6A 3GNPA 1U5VA 4H01A 3IJ6A 2YX0A 3AZSA 4R9XA 4Q4MA 4LJ3A 1C8XA 4IMCA 3VC6A 4Y8FA 1BRLA 1IWPA 1Z89A 1BRLB 1P0DA 1X39A 5CJ5A 3HGOA 1H60A 1DYSA 5I00A 2CHRA 1BVNP 4ZEPA 4N42A 4PBFA 1TV3A 1F9CA 3W53A 2AGTA 4XZLX 2PA6A 2AOSA 4F0MA 3G1DA 1O60A 4QDPA 1I60A 3LU2A 4J7RA 2XM2A 4PMJA 4ZZ9A 2PWUA 1ZQ5A 2H6RA 2QPSA 4GVGA 5IHSA 3IGHX 1AL7A 2J7CA 4YJ5A 1RD5A 3KL5A 2X1UA 3RM4A 1W3HA 1EHNA 1DXFA 1WDWA 1I75A 1Z3NA 2YA1A 1NDYA 4JTUA 5C71A 2OR2A 2XSBA 4XWUA 2E3ZA 3S4TA 1O66A 1EEPA 4NX5A 3W22A 2WM1A 4WF7A 3RNDA 2OOFA 1CEOA 3HV8A 2J77A 4PL2A 4Q4QA 1HJWA 4H00A 1B3VA 1PKNA 2G8ZA 4QDMA 4HNNA 1U5HA 4RE2A 2ZZ4A 4ROPA 3DN5A 3S2MA 1I9CB 1CGWA 2C19A 3S8HA 1BKSA 2ZZ2A 1SM9A 4U31A 4W5ZA 2A5HA 4MFEA 2JIWA 4XX6A 5A6JA 5DCBA 1CGUA 3LX9A 2XWDA 1XR2A 2ZX7A 4DJED 2G3NA 3EWUA 1IR1A 3BLOA 3ZS4A 3CL7A 2HK0A 3QKEA 4LVAA 1XD1A 4KFNA 3ZJ8A 4E5TA 3C52A 1CXFA 1TV8A 2ZRYA 1PTGA 3DGRA 3WLMA 3F1QA 2GJNA 2PTZA 4Q4PA 3NURA 3H21A 4TX6A 5CLWA 1BQGA 1UPPA 2XISA 1KGXA 3ZSTA 2F61A 1RALA 3F2CA 3TQ0A 2NUWA 1TJPA 2OYKA 2WKGA 5C9RA 3AXKA 1JEZA 2ZTJA 4H8UA 2VEFA 5DANA 5A8NA 9XIAA 4TQTA 4BCEA 4JL1A 2OEMA 3I3EA 1UKSA 1OZMA 1R85A 2WMFA 4I7UA 2CZVA 1R38A 3UJSA 1QNSA 1EF2A 1MZRA 3RJXA 2P76A 2NT1A 4DVOA 4Y2WA 1X8FA 3S2NA 1SZFA 2WBKA 1R3VA 6A3HA 1OZQA 1L6GA 4XIAA 4F0KA 1XBVA 1VGAA 5D9PA 2Q8LA 5B7YA 4F8XA 2E9LA 3BLIA 2G3MA 3VX1A 1BVWA 5J5DA 1CLXA 1L6SA 3T2PA 4R53A 3O2LA 3V16A 1GJUA 5HMEA 4IQEA 4L1GA 3E9AA 2HVMA 1I2NA 1OIMA 2QCNA 3KZPA 2ACQA 4XAGA 4XUYA 1S1RA 1W91A 4YCPA 2FZDA 2DZWA 5FF7A 1W9XA 3A13A 3U3HA 4JNZA 2V30A 4O8AA 4UFHA 1MNZA 4WDXA 2ZZ7A 2QT3A 3P81A 3N34A 4IP7A 1RPKA 2YXGA 1LRQA 5FEZA 1F61A 3OQEA 4Z0JA 1AZ2A 1TZ7A 1M7JA 2EKGA 2OSYA 1ICPA 2XIOA 3TN6A 4Y9PA 3MU7A 3TK7A 4ZB0A 4HHHA 1TTQA 2HZGA 3U48A 1A5MC 1GOXA 1FDYA 4OJYA 3NWRA 1BXCA 1CX9A 4Q4SA 1VFTA 3IVUA 8CGTA 2GFTA 3BG5A 1J6PA 4LS2A 1FFRA 1H2JA 2TMDA 2VT0A 3NXLA 4LY4A 4NZJA 3T2OA 1AH3A 1GORA 3HPFA 4KEZA 4EX4A 2WSRA 1FA2A 3GXPA 4MWAC 3NPWA 2YL5A 1JFXA 3GH4A 2EPNA 3S2LA 2BY3A 4WDWA 1J5SA 1DPMA 2BY0A 3C2RA 1BG9A 3G22A 2TODA 3WZ0E 4LRTA 4E2BA 4JHZA 2PGRA 2WHLA 4M81A 2FJKA 3ZO9A 1ZAIA 2IMRA 2QKFA 3RLHA 5KTLA 3FYOA 4R88A 4MB4A 3B8IA 1BYBA 1FHDA 1CT5A 4JTAA 3VGFA 1JQVA 1SFJA 5GNZA 3PTDA 3BCJA 3GRIA 3CZJA 2XVGA 4DXXA 1ODZA 2VOTA 2F7FA 4W89A 1F8MA 4PTNA 4A05A 3WBWA 2Y7GA 4OKDA 1GG1A 4W7WA 2F6UA 4OUIA 3CL6A 2QDGA 3MKCA 5TNVA 3P74A 4YS1A 1S5VA 4WSHA 4JTIA 1ADSA 3HPZA 3R79A 1V08A 2DT2A 2Q02A 3M0XA 5EU9A 1MSSA 5TBOA 4QITA 1WOBA 5D8WA 4EE9A 2Q6ZA 4CNTA 1R0MA 3W1TA 3A3XA 5FEPA 3H2AA 4H7CA 3TQPA 3A5FA 1KGUA 1E6ZA 5M3WA 1W3IA 3VIIA 1UD3A 4OHQA 2G0WA 4N2YA 1VH7A 4KWWA 5A8PA 4W93A 3N11A 4FX6M 1GW9A 2QEZA 1MEWA 5FAGA 4GQGA 3NSXA 1GVEA 2C1HA 2ZA2A 4R34A 1WCGA 3GLCA 1E0UA 3PZOA 2G97A 3CV1A 1DJIA 2RHGA 1HL9A 3MKKA 3BW2A 4QJ3B 4KCWA 1PKMA 4UTJA 5I07A 5BOFA 5JXQA 1C8QA 5D2YA 2WSYA 3QYSA 5LA1A 3F2DA 4G9PA 2YCEA 3KRUA 4ZQPA 5MHBA 3CNYA 1Q6FA 3ZVHA 2VGFA 1XIBA 3ZVHB 1GZ1A 4CU7A 3VPLA 4AUBA 3VILA 1GOOA 3TTQA 4NVTA 3NCOA 1BTMA 2FYMA 4IICA 2R1NA 4B15A 1Q6RA 1B90A 1JGMA 2Z00A 3ARVA 5E0FA 3G1FA 4HPJA 3GDLA 4D6GA 1MQPA 2WJEA 3VMNA 1ML1A 4AXKA 2B0MA 1U2YA 1XUZA 4WIWA 1SMAA 4XTIA 4PSPA 1VB9A 3G24A 3GXNA