3WK0A

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with orotidine 5'-monophosphate methyl ester
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
molecule keywords Orotidine 5'-phosphate decarboxylase
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wk0A00
1VS1A 1RD5A 2VENA 3INPA 3M47A 1SO4A 4MJZA 4UC5A 1X1ZA 1OJXA 1T0OA 3BV4A 1CI1A 3T78A 4Z1CA 2Y61A 2QDHA 1XBYA 4JTJA 4HPXA 5G1YA 3O8AA 3OBKA 2FQIA 4XTDA 2EAWA 2X1SA 4UTKA 1VCVA 3BPWA 1W1ZA 4UFMA 3EKLA 4S2BA 4ZQMA 1KM2A 3R2GA 3U8GA 4O1CA 3CEPA 1JUKA 3KRSA 1O5KA 3QF0A 3NM3A 3UD6A 4E0CA 5CZ0A 5H91A 4R53A 3LTYA 1KM1A 1OF8A 5AB3A 4LRTA 5E1QA 5HNRA 1GTHA 2O7SA 1I45A 3FKKA 2A5HA 3W07A 1GZGA 1ML1A 2E6AA 2ZBTA 1HO4A 2XN1A 1VCGA 4MZ1A 4QAIA 3Q94A 2WV8A 4Q32A 1PHQA 4AAJA 1DL3A 1LDCA 5D38A 5SWUA 1MEIA 3Q37A 2TSYA 2C18A 1FDYA 4CQ8A 3MP3A 4MFEA 3W70A 3RU6A 1O95A 3O1NA 5J5DA 3PY2A 5TIMA 4LRSA 1QPNA 4NU7A 5AHIA 3W73A 1VR6A 4WXYA 3DENA 1H62A 2B7QA 2ISVA 1OFEA 3DZ1A 4GNJA 1OK6A 1SFLA 4Z08A 3I7QA 3WJSA 4O15A 1F74A 4HSOA 4OHQA 3BG9A 4O54A 2ZZ3A 3NQAA 3C3NA 3M5VA 2C1HA 1H61A 2WPBA 4IJBA 1H7PA 4Z1DA 3W2JA 4ORMA 2E68A 1KM5A 4X3ZA 2V30A 3HJZA 1RQBA 1MEWA 4DPQA 2I14A 3EXTA 1SU5A 4IUOA 1HO1A 3C4UA 2CZDA 3IVTA 2Z1BA 4QJ1A 5DCDA 1DQWA 1LP6A 3W7PA 2E5CA 2AAMA 3QPYA 5AC7A 1DJNA 2VC6A 3G1HA 4CQAA 3TH6A 1A5SA 1LLZA 3S5NA 3PVFA 2B0MA 1QOPA 4NUWA 4YL2A 5BNKA 4UTMA 4XTIA 3PULA 3D0CA 3W7NA 1EUNA 1H51A 3NL6A 4AF0A 2RH9A 5K9CA 3HO8A 1DBTA 3BARA 1JJKA 2IQTA 1D3HA 3W7CA 2C14A 4JTKA 4K8HA 4LTSA 1LRQA 1W5NA 1FX6A 3L5LA 2A7RA 3GR7A 3W1MA 3FFSA 4LVFA 1DHPA 1X1OA 3BLIA 5E93A 4UTJA 4MYAA 4NVTA 4X2RA 4O10A 3WK0A 1WXJA 1ZFJA 5CPNA 3WJXA 3KVJA 2FPTA 5C6MA 5IM51 3TAOA 4RR4A 1R2RA 3LCLA 2QJGA 1XBXA 1RZMA 5CZSA 5LSMA 1OFPA 3EX2A 4O0KA 1FWNA 4Z0SA 4HNNA 1YDNA 1RR2A 2ZZ5A 2PRLA 5HINA 4HNTA 2CLLA 2CLKA 4H3DA 4JDYA 3IGXA 4XZ9A 3T7VA 3QYQA 4UTWA 3NG3A 3NPWA 4H4IA 1SFJA 4OV9A 1WDWA 4BI5A 1DKWA 3FKRA 3EWUA 4DBEA 3NZ1A 4DF0A 1TO3A 3P67A 4HSNA 1W3TA 4HKPA 3G8RA 3ZWTA 3B0UX 2OJPA 1M5WA 3QJAA 3NQ6A 5DCBA 4OGZA 3TXVA 3LHYA 3GXNA 3G22A 1JQVA 1V7YA 2YW4A 1S5TA 1OABA 3TCEA 1LOQA 3KHJA 4Y6GA 1UBSA 1QCWA 3UY7A 1X6UA 2HSAA 1YADA 1FXPA 5LKYA 1I8JA 1LCOA 3QMRA 3CU2A 3I7RA 3VCRA 5AHFA 3N2XA 5DBUA 5D04C 4J9JA 1H7XA 3K30A 4EF8A 4TR9A 5CGQA 5DLCA 3W75A 4MLRA 1GVFA 3MMTA 3AJXA 3UZ5A 2GUUA 3N3MA 2ABBA 2E6YA 4YWIA 3P5YA 4R34A 3HMJG 2J27A 1KV5A 3G1VA 3L2IA 5HQEA 1G7UA 2CZFA 3EWWA 3RK8A 3BLEA 4FEZA 4K39A 4TU1A 4E38A 4W9TA 3CM4A 1TPFA 1K7XA 3QW4B 3H54A 2Y7DA 3LCWA 2GPTA 3CTLA 4O13A 3E9AA 3DFNA 1H7OA 1OYBA 1VYRA 2FTPA 1TPUA 3P7YA 1M6JA 1SPQA 2Q3RA 3W2KA 2E1DA 1TPVA 1LLWA 3M5ZA 1TQJA 7TIMA 3MYPA 2DORA 4MZYA 3NO5A 1AW5A 3PM6A 4HIBA 4N9CA 4ICNA 4IMCA 3ABQA 5LHEA 3IVSA 5AOUA 2CWNA 1DOSA 3THQA 3W7IA 4N9DA 2NXIA 2Y62A 2J24A 4D2JA 4GUJA 4JXCA 3L67A 1W54A 2WNQA 3IV3A 1G69A 3R8RA 1TPWA 1R30A 4E2BA 4HNVA 1OHLA 4FIQA 5D2WA 3GDTA 3QPZA 4O28A 3W22A 3FYPA 3FJ6A 3UWVA 4B5NA 1TPH1 1P5BA 3NZRA 3SZ8A 1TV5A 2ZA1A 1X8FA 3TC6A 5FEPA 2OMAA 4EIVA 3DI1A 3W1NA 2VFFA 4EWND 1ZJIA 4FNUA 2QJHA 3NL3A 3C0JA 3TSBA 3TQVA 1K3UA 1Z44A 5D32A 1NSJA 1KFCA 3NQMA 3ABSA 3T4CA 1W3IA 3NL2A 3TMLA 1Q6OA 3QW3A 1C29A 3W71A 3P74A 1H50A 4LVBA 3HGSA 5AHNA 5FF3A 1TPC1 3HG5A 2J6XA 3NQFA 5EPDA 4WUIA 5CZJA 3DBPA 3P84A 1PCWA 4JDBA 1WAUA 1GVQA 3CIWA 1ICPA 1KFBA 5D37A 4MKNA 2QCEA 2TMDA 2BXVA 3HGRA 5AYYA 3W74A 4LV9A 3NQ7A 5CSRA 1YTKA 3C2FA 2X1UA 4N6FA 4GBUA 1WA3A 1L6SA 3VE7A 1ZAJA 3B05A 1TB3A 3ZFHA 3IGUA 3PSWA 4JICA 2NZLA 1Q3NA 1O5XA 3O07A 1WBJA 1TV8A 4JTUA 3W6YA 1XM3A 2QCCA 1SQ7A 4OQVA 5EBUA 3NQDA 1F6KA 1YTEA 2V5LA 2VEKA 1EUAA 1GG0A 3W7QA 3S5ZA 2ZDRA 4PEKA 3NGJA 1K7FA 4JTLA 3P82A 3M16A 1W0MA 3GXTA 3VNDA 4AF0B 1DJQA 1F6PA 4TX9A 3UZJA 5I3GA 1VLIA 2DZXA 3MJYA 3IIOA 5K3VA 2WJZA 3DAQA 4UFIA 3WJYA 1EWDA 2HMCA 3I65A 3LRKA 4K7VA 2X1TA 2QCMA 3EWBX 5CG7A 3DFPA 5AHMA 1AW1A 2G97A 2Z2UA 4LT9A 3W7MA 1FWTA 3W1QA 1BEUA 5FESA 3W2MA 4DPPA 3FJLA 1THFD 3A5FA 3S6DA 4M5PA 2WSYA 1TJPA 3NQGA 4CNOA 5FF7A 1Z42A 1G4EA 3L66A 2VEIA 4RZ4A 1I4NA 4UFLA 2CLMA 4IX2A 1EB3A 4U28A 1C9DA 2FJKA 4TMBA 1I2QA 1FWSA 2CW6A 3L5AA 1Q6LA 1K8XA 2DU2A 3GDKA 3ABOA 3QC3A 3W7HA 1N7KA 4TMCA 3LLDA 3LLFA 5I3FA 3TQKA 5K4ZA 3N14A 4LS0A 5G5IA 3IIXA 2AQWA 2ABAA 1SO3A 2RDTA 2Y6ZA 4IMEA 4LUJA 4CNPA 1R2SA 1OFBA 2DZSA 4LS2A 4NNBA 1LM1A 5KSWA 2OCZA 2YGYA 3QH2A 5EL1A 1LTDA 2E77A 2VEMA 2C15A 3LXCA 1QAPA 5HUOA 4AH7A 3RF9A 4KFPA 1JUEA 3W84A 3HQ1A 1SUXA 1ICQA 3OHIA 4QITA 4AB4A 4QISA 4MVAA 5LHFA 2VFGA 4UTTC 2R91A 4JTSA 3UPBA 3R89A 1L6WA 1E51A 3NQCA 2W6RA 5GVJA 4UFHA 1KW1A 3NPXA 4QIUA 4BI7A 2Y7FA 1W5PA 1YPFA 4IPIA 1MZHA 4IXXA 3BO9A 4N9BA 3B0VC 3W23A 1FWRA 2YYTA 3TKFA 3LCFA 3TDFA 1KLYA 3FS2A 2TPSA 3NXFA 2YXGA 1ZENA 1G67A 4N4PA 4NXSA 4DXVA 3G3DA 1OFAA 3UWUA 3P8JA 1G4SA 5F1VA 1LRTA 3HG3A 3HBLA 1UJPA 3GYEA 4O11A 3EWYA 2HS8A 1SZEA 3OVRA 2PRMA 5F2GA 4OV4A 3STGA 1SZGA 3DU0A 1P4CA 3LCGA 4LY8A 1CW2A 5HJLA 4UTHA 3NR0A 1KFEA 3TV8A 3W7DA 1WQ5A 1QO2A 5LNVA 3EX1A 2QCGA 2RDUA 3W1PA 1I2NA 4UXDA 5G4EA 4JNMA 1TPB1 2X16A 2A6NA 6ALDA 5CZTA 4Q33A 1OX4A 1KM6A 4O57A 3DXIA 3W86A 4O53A 5AHLA 5D33A 3G0XA 4IMFA 3PSVA 3LCIA 3I6RA 4O14A 5G2HA 1VYPX 2XN2A 4WOZA 3ZS4A 3HPSA 4IMGA 1KFLA 5IBXA 4WY0A 3U6WA 4ZQPA 5J5RA 3TR2A 1I2RA 1P0KA 1V5XA 3C52A 2P0OA 1HUVA 3F03K 1TTJA 3LI1A 4LUIA 3P5ZA 3PB0A 1TIMA 3T55A 1GEQA 2FB3A 3O6DA 2P10A 1KFKA 2PC4A 1F7BA 2H8XA 3NNTA 1IXQA 4UIOA 4L4MA 2OZ0A 3M1ZA 1N55A 3KRUA 1U83A 2NXGA 4NNAA 4HPJA 2CLIA 1EX5A 2QDGA 4O4WA 2FPYA 3U2OA 3NOEA 3ZR4A 3V1PA 3TW7A 1ME7A 3L68A 1JVNA 4GWEA 2BLEA 1OFOA 1TRDA 3P81A 4ZZ9A 4NX0A 3JR2A 1ADOA 4I7WA 4UFJA 2VFIA 3GR8A 5HWNA 2NUYA 5F4SA 3R12A 1XC4A 2VOMA 4UR7A 2Q8LA 2DZPA 2WNNA 1GQNA 2OX1A 1EPXA 1OYCA 2GVGA 5LGXA 2QCLA 3I68A 4FNPA 3GDRA 2YFOA 2UV8G 3QRHA 4JGDA 1OFRA 4RJEA 4YLWA 2A1YA 2OT1A 1XFBA 3TE9A 1XUZA 1KBIA 3QFEA 1MSSA 3PBVA 2Q3OA 2DZTA 5LNUA 1KM3A 3UXAA 3TQ0A 3W87A 1LBFA 1KFJA 2Z6JA 2H6RA 2WQPA 3IRDA 4ZQRA 3HIJA 1PHWA 4PODA 1GWJA 1IGSA 3TJXA 3MWAA 1NF0A 5U4NA 1RV8A 3TJLA 2WSQA 1L2UA 1LBLA 4IMDA 4O17A 3UPWA 5G4WA 1VPXA 5HR6A 2C13A 4O1AA 2I9EA 3GX9A 2ZRVA 1YLVA 4YMZA 3A23A 1D3GA 3LCHA 1RVGA 4TO8A 5DXYA 2WO5A 3TUUA 4HN4A 1W3NA 4N6EA 5CPOA 5I3IA 4UR8A 1Q6QA 4JTHA 4ADTA 3PWAA 4MUZA 2GQAA 3NA8A 2A21A 1KTBA 3S5YA 3DKJA 1HTIA 4PCFA 4JTTA 5KMYA 5AN7A 3GXPA 3LXBA 4L4LA 3RNDA 3W2LA 5G2WA 1XBZA 3SIZA 3LV6A 4XQ6A 3LTPA 2ZA2A 1Z41A 1KV8A 3PUOA 3T40A 3UWWA 1QO5A 1MXSA 3CPRA 2FPVA 5FEWA 1TPDA 4JY8A 5LNWA 4AHQA 3QQ0A 2V2CA 3O6YX 4M6VA 3DGRA 2CLFA 3GNNA 1SW0A 3W7GA 8TIMA 3G8EA 3LX9A 3OVQA 3KFTA 4UMBA 5AFDA 5DN1A 3W1TA 4MYXA 2QCHA 4UNKA 3W3OA 3DH7A 4A29A 1VLWA 2X2GA 3NM1A 3RLVA 2ZCGA 5BW6A 5CKSA 2VKZG 5D09A 4WX2A 5D2VA 3OG3A 2LLEA 1LRNA 2F84A 3EXRA 4U4MA 4FX7A 5FI8A 2NWRA 3SY5A 4PL2A 3TW6A 4FX8A 1SSGA 4KKXA 3E49A 4IXHA 4FNSA 3QQ1A 1VGAA 5ABTA 2YDAA 3WK1A 1LROA 3EX6A 4EVZA 2C0AA 3HG2A 1TREA 3W7KA 2ISWA 2NUWA 1SR9A 4FHAA 2QCDA 2J9ZA 2TRSA 4M6QA 3MI3A 3LHZA 1K8ZA 2BWGA 4ZMGA 1H60A 3GB6A 3L5MA 2G5WA 2Y70A 4ORIA 1Y0EA 4ONVA 3BG5A 1C8VA 4ZQOA 2QCNA 2ZZ4A 3M5YA 1IF2A 3DFTA 3OA3A 4FNQA 4MIMA 3THAA 3TIMA 1ME8A 1NAL1 1RQHA 1FCVA 2QF7A 4HNUA 4C1LA 3O6CA 3W1UA 3HGOA 2J9YA 1W5MA 1VRDA 5D02A 3W7LA 1TQXA 1EP1A 4Y9AA 3FOKA 2NLIA 3P60A 2Z6IA 1GT8A 2RKXA 1ZALA 1PS9A 4NJIA 1KLZA 5LNSA 4JYEA 1A5CA 4UFKA 3SGZA 4KFNA 2FFCA 2BX7A 4NT0A 5CSSA 4N9EA 3WK3A 3KRZA 3PBYA 1OX4B 3LM7A 5F1UA 4PA8A 3P80A 3ABRA 1PV8A 2YSWA 3QZEA 5KITA 4FO4A 1KBJA 1QPOA 1O60A 3O63A 1AK5A 3M6YA 4JYDA 4O19A 4WY0B 1TTQA 4WOQA 3A22A 4A22A 3LDVA 5C55A 4MY1A 2CU0A 4LNYA 1VCFA 3W83A 2ZZ2A 3HPZA 1XL9A 1TPEA 1VJIA 4LU0A 4KFOA 5EYWA 4R7JA 1XI3A 3M41A 4FF7A 3C61A 2J9XA 3VKJA 3W1LA 4LVDA 4DO5A 2HTMA 2ZTKA 2I1OA 3L9CA 3UYCA 3E0IA 3LTSA 3UWQA 3W7EA 4LVAA 1XDLA 4RKAA 5HMSA 4CQ9A 2ZZ6A 3GAKA 3GLCA 1W5OA 1ZNNA 4Z1BA 3F1QA 2JGQA 3M43A 3G0SA 3W76A 4S2CA 1ONRA 3SECA 2ZRWA 1H7RA 5G1TA 5F2LA 4HHPA 3PG8A 3QSTA 1H7NA 4FB7A 1EP3A 4BWLA 5BMXA 1XKYA 5FEXA 1LYXA 3PBUA 3W72A 3H53A 4MJMA 3HG4A 4FIRA 1QPRA 4UTWC 5K2ZA 2ZRXA 2X30A 4Z0JA 4CCCA 1Z48A 4PC8A 5HULA 1VZWA 5TBOA 2WKJA 4JYFA 4M19A 2EKCA 1TV7A 3UWZA 4IX0A 2BTMA 1XBVA 3LI0A 3W1RA 4ZL1A 3BVJA 3LXAA 3UY8A 2H90A 1EEPA 3Q2DA 3VFLA 1OVDA 5D2YA 2YCEA 2Y88A 3TK7A 2V2DA 2W0UA 1OX5A 3F4NA 3MYOA 4JTGA 4NX5A 3G1DA 3PC0A 3S1XA 4JEQA 4AXKA 2YPIA 1HG3A 4JN6A 4QNEA 2H8ZA 3C56A 4UTLA 1HFBA 3BW3A 3QM3A 1JCXA 3TU9A 3TSMA 4G1KA 3W1XA 1SZNA 4O50A 1QR7A 1VQTA 3BG3A 1GPWA 1ALDA 4AHOA 3IIVA 3NEVA 3B04A 3L0GA 3O06A 4K37A 4JTEA 4DEFA 1XUUA 1GVSA 3NYZA 4BFAA 3M0ZA 1QPQA 1JCNA 1KTCA 3BLFA 3BK0A 1SW7A 3DHDA 3ELFA 5A5WA 3S8HA 3T44A 3EXSA 4JD4A 2YX0A 1FXQA 4LWWA 4JX5A 5DY2A 3E12A 2Z0IA 3GNDA 1KA9F 5DBTA 4UTUA 2E5DA 1B3OA 3CQ0A 3MUXA 3S9YA 1AG1O 4GUHA 3RFAA 3TXZA 3RLUA 3R5EA 1YXCA 3CIXA 4LOCA 2A6LA 1QMLA 3LRLA 1SO5A 3B8DA 3G1YA 1DV7A 3VE9A 2J88A 1UCWA 1PCKA 1PIIA 1NFBA 4GUIA 1OX6A 2QR6A 4O8RA 1S5VA 5EMUA 2B4GA 3N73A 1K03A 3SI9A 1OK4A 1AW2A 3HGJA 2V9DA 4WY0F 3NPVA 1L6YA 4TIMA 5G2IA 3YPIA 3MHFA 5LNRA 3EX3A 4XBKA 1WOBA 1O94A 4JIQA 3LHVA 1JCLA 2G96A 1H1ZA 1YPIA 3S5OA 1G7VA 4AWUA 2QEZA 2V2HA 1XDMA 3GKFA 3O16A 3TNOA 6TIMA 5T26A 1R47A 1A5AA 5MHBA 3QEZA 2R94A 4A2RA 5K7JA 2ZZ7A 4MY9A 2B7NA 4O1DA 2QCDB 3L0KA 4CCEA 4K7YA 2GJLA 4DO6A 2A2IA 3EEGA 1W5QA 1W56A 2Q8ZA 3QMSA 2RDWA 2A7NA 3E02A 2ZQ0A 5D2TA 3PB2A 1QOQA 3DFQA 3LGEA 2QUVA 1GOXA 2DJLA 3B4UA 1BKSA 5CPMA 3CLMA 4LS1A 1R2TA 4P61A 2YR1A 1GYNA 1L9WA 4X9SA 1F73A 4O1BA 4LVGA 3EWZA 1T8XA 5F2MA 1YYAA 2YYUA 1S3HA 3HOJA 4WXZA 2G95A 3GIYA 3UWYA 4O52A 3OEXA 2PCQA 3MBDA 4N02A 3HPXA 5D05A 3EX4A 3KOFA 3GDLA 4WZHA 4AHPA 5DY3A 5FF4A 5I3KA 4UCGA 1A53A 1W31A 1YXDA 2EF9A 1QNVA 3NPUA 2ATMA 4O16A 4Q4KA 5K4XA 3A24A 2V5BA 3C2EA 4MFDA 1LBMA 5AHEA 4PL1A 4DO4A 1VC4A 4FNRA 2VFDA 2XN0A 1CX9A 4FXSA 5KZDA 4PTNA 2FLIA 1H1YA 5KTLA 1Q6RA 1YXYA 2V0TA 3DKLA 2GVLA 2C16A 5DELA 4GXMA 2ZRYA 3P62A 3ZWSA 3G24A 2CLOA 5DCEA 1F5ZA 2FB2A 1YDOA 5C54A 4BI6A 2QAFA 3W7JA 2E6DA 3SSJA 2EGZA 2HS6A 4BWLC 4NQ1A 1OFDA 3STEA 3C8FA 2GJNA 4JTFA 3E96A 4MY8A 1ZCOA 3EKZA 3LHWA 3MHGA 1Q45A 4NJJA 3CC1A 2QJIA 4Y8FA 3EWXA 3LCXA 1GVRA 2GQ9A 1NEYA 1OF6A 1KM4A 4ML9A 2QKFA 1F05A 4IQLA 2H3DA 3GZ3A 4DBDA 5D2XA 3N34A 2A0NA 3NDOA 4AEOA 2GQ8A 4CLMA 5C2XA 2ZFAA 2C6QA 4BR1A 2V8ZA 3W88A 3G1SA 2VELA 1JULA 2H3BA 3KXQA 4XWUA 2RFGA 1B4KA 5L9FA 4MLJA 3G18A 3DHFA 5KZMA 3WJWA 1UB3A 2QUUA 3G3MA 1BWKA 1PL9A 2E5BA 2Y85A 3IGSA 4IWWA 4GUFA 3UXDA 4DF1A 1D9EA 2OT0A 2VFHA 3W9ZA 3MP5A 2WSRA 4M6PA 4ADUA 3CWOX 1DORA 2GOUA 4R33A 2JKEA 3NL5A 4NZJA 5AC8A 5BRBA 1GYLA 1FQ0A 4K8EA 3VI2A 2B7OA 2ZRZA 3BGGA 5BOOA 1FUYA 4ALDA 2A4AA 1MEHA 3IIPA 3IVUA 1FDZA 1FDJA 2A85A 4NJHA 5K9DA 5A8GA 1VHNA 4CCDA 3MO7A 3N9SA 1LOSA 1TSIA 4C1KA 1ZAHA 1U5JA 4A3UA 3O05A 3CWNA 3MI2A 4RZ6A 3NQVA 3S1WA 4Y96A 4XKYA 3F4WA 3SFKA 1ME9A 2JGYA 1P1XA 2TYSA 3PR2A 5BMWA 1OFQA 3EB2A 4EOUA 3B0PA 1T96A 3PUDA 1YTDA 4LW7A 3W1AA 3P8IA 2D73A 3MBFA 3PBWA 1I2OA 4I7VA 1H63A 4RXFA 3STCA 1KTNA 3KX6A 2ALDA 1IXNA 5LZLA 3NAVA 2BZNA 1K8YA 2CFFA 1JCYA 4RV8A 4M7SA 4BF9A 3MP4A 3RMJA 4DELA 1SSDA 2C3ZA 3CT7A 4POCA 3GDMA 1WOAA 1VYSX 4GFSA 3LB0A 1ZHAA 2Y89A 1ZY9A 1NF7A 2BSLA 1AL8A 1W37A 5D30A 2DP3A 3KAOA 1IIHA 3L0NA 3NQ8A 3FLUA 5F4XA 3DI0A 3PF3A 1TTIA 2Y7GA 3ATYA 5F4WA 3G1AA 3ATZA 4O18A 2RHGA 4O12A 4AMAA 1OG0A 4UTIA 3N9RA 1MO0A 1R46A 4N2YA 4WD0A 4AWTA 5HR7A 5L6UA 3N2MA 4AVFA 2Y7EA 4XBSA 3LHUA 1G4PA 3LBCA 1EA0A 1H7WA 1I2PA 2O7QA 2PRHA 4RXGA 3P61A 3QMTA 1J4EA 1FBAA 1UUOA 4RCXA 3S1UA 2FDSA 2E09A 3DFOA 4UNLA 3TFXA 2JK2A 2E6FA 3SJ3A 4MZ8A 2NV2A 4E2DA 1TTPA 4P2VA 4QNWA 4OBTA 1BWLA 1OYAA 2YFNA 4XUGA 1J5TA 2WNZA 3LV5A 4Y90A 4YCOA 5KINA 4ZVJA 3GAYA 5AYZA 1JR1A 1DVJA 1GG1A 3GK0A 2VXNA 3H55A 5IBXC 4UTTA 3NQ2A 2VEPA 1B4EA 4BK9A 1WX0A 4IPJA 1FCUA 4OWGA 3KVMA 1FCBA 3UQNA 3TSDA 1QDSA 3W2UA 1JCJA 2DZWA 1G6CA 3TMQA 1TJRA 2F7FA 4RLIA 4KWVA 1WYIA 4HT3A 5EY5A 1DQXA 3GVGA 3MHUA 4I9AA 5EKYA 3TROA 4JX6A 1JCMP 4S1FA 3B06A 5LGZA 2YW3A 1LORA 4ADSA 1LZOA 1LOLA 2R14A 5D03A 2C19A 4JIPA 5U7SA 1EWEA 2NV1A 1GJPA 4MPQA 1AL7A 5TQLA 2ISSA 3CEUA 4FNTA 4Z1AA 3MI6A 4K6AA 3R13A 4A2SA 3NVTA 3S42A 3STFA 1G4TA 3TC7A 4N4QA 4PH6A 4UUIA 2NUXA 2CZEA 4UMCA 2P1FA 1H5YA 4YCPA 4O0ZA 1HL2A 1IIGA 3BGJA 3BW2A 3V75A 4JY9A 2XFWA 5AYXA 3M9YA 3G0UA 3TA6A 3MW7A 4RK8A 5FF2A 4YXGA 4GUGA 4IGHA 3TFCA 1ZAIA 1PE1A 3W7OA 1WV2A 4QSHA 3WK2A 2QAPA 3PG9A 3CHVA 3DFSA 3IEBA 1EP2A 2EHHA 2WOQA 2B7PA 1J2WA 3Q58A 5HUPA 1M7PA 1RQEA 3CB8A 2NX9A 2PURA 3C2OA 4GRSA 4CNNA 4QQ3A 4I7UA 1UASA 5C5YA 4OU1A 2PE4A 1SZFA 4IOTA 4M7TA 4O4VA 1A50A 4WQ6A 3JS3A 4NZFA 3SGUA 5K9XA 3G1XA 3KVKA 4FX6M 2JBMA 3JRKA 2Y63A 5HWJA 3LRMA 2GVJA 3UNDA 3C2RA 3AO0A 3LHTA 2CLEA 1TYGA 3B03A 2V82A 5H2ZA 1TMHA 1BTMA 3W85A 1WBHA 3USBA 4K36A 2CZ5A 4NJGA 1QFEA 1F76A 2ZA3A 3WJZA 3HB9A 3C6CA 5KZEA 4EF9A 1KM0A 3M44A 1K02A 4DQWA 3PAJA 4JS3A 3OVPA 4JR5A 1PVNA 1FY6A 3I7SA 4H6KA 1QWGA 1UUMA 3PUEA 1XCFA 3KVLA 5FF0A 1FWWA 3PS7A 3GKAA 5DXXA 3S1VA 4NXKA 1NVMA 3L21A 3SR7A 3IIZA 1GVOA 4GE8A 3W7RA 3OIXA 1P0NA 2DZVA 5HWMA 5FEZA 4UMAA 4RZ5A 4A21A 3A5VA 2AGKA 3C2VA 4XKYB 3A21A 2EPHA 1FCQA 3ANYA 4ZQCA 5I3HA 3FA5A 2NXHA 2QUTA 1JUBA 2NX3A 4QM1A 2X1RA 1X7FA 4FXRA 2QCFA 3N19B 4RX0A 1JRBA 1S5WA 2FIQA 3TAKA 2KZHA 2JKPA 4JX4A 4KWWA 2NX1A 5F2IA 1YDVA 3LERA 1RPXA 4LC6A 2ZRUA 1SW3A 2VFEA 3M5XA 2YZRA 3QSRA 2JKAA 3FYOA 1JRCA 3SW6A 4OE7A 1W8SA 4OT7A 2CLHA 2ZZ1A 3G1FA 2ATSA 1TCDA 3LOTA 1IXPA 1IXOA 3WFAA 1TRIA 4AWSA 3NQEA 1VH7A 1ICSA 2A7PA 2NWSA 4NJKA 1K7EA 3O15A 3HF3A 3S0CA 2V81A 1F2JA 2W79A 4PFMA 1JQXA 1B9BA 4WJEA 2DZUA 4ZQNA 3A9IA 4GC4A 2ZTJA 4DF2A 3M7WA 2ZYFA 3TX9A 5I3JA 1B57A 4GJ1A 1EIXA 1XXXA 3FEMA 5E0KA 4X22A 4LC8A 4JTIA 1GTEA 4MOZA 1A5BA 1VHCA 3L65A 1O4UA 2R8WA 4NNCA 3BW4A 3FIGA 1N8FA 1SO6A 1M7OA 2DJXA 3LBMA 1AMKA 1T99A 4LV4A 5CPLA 3W2NA 5AC6A 4K38A 5EA9A
chains in the Genus database with same CATH superfamily
1XLLA 3T07A 1EO7A 4H9ZA 5BXPA 1T0OA 4M82A 1CI1A 3NFUA 3T78A 3R0UA 1J6OA 2J4GA 2CETA 2OELA 4HSHA 3PTQA 5G1YA 4WVXA 1XX1A 1FWIC 3N13A 5ABEA 4YTUA 5A6SA 5C9ZA 3GFXA 4UTKA 2GYIA 1V6TA 1E1EA 3EKLA 4S2BA 4URIA 5LXXA 1NDWA 1XH1A 1KNWA 2CKSA 3U8GA 2AL2B 4QAWA 1AJ2A 3ERPA 4C1NA 1JUKA 3UJFA 1WNOA 4BQ5A 1A5LC 3QF0A 2BGQA 3NM3A 4GC3A 5H91A 1KM1A 3WLQA 4LRTA 4BZYA 5E1QA 2IQDA 4OVXA 4XAYA 2O7SA 2PDKA 1I45A 1ISWA 4LYQA 3W07A 3GG0A 6XIAA 1VCGA 3GD6A 2QULA 3M6DA 2WV8A 1H49A 4LH8A 4ZO8A 1V3HA 4PSPA 1TZZA 1DL3A 5D38A 1FRBA 1MEIA 3Q37A 2BOFX 1ZZMA 3EPOA 3F4DA 4QHRA 4JHOA 3RU6A 2V68A 4MF4A 5F7UA 1HF6A 4ML4A 5MKGB 5AHIA 1XIGA 1S38A 4MSSA 1FA2A 2PEVA 2B7QA 2ISVA 5BZAA 4AZ7A 1OFEA 2P88A 1SFLA 3CL6A 4Z08A 3WJSA 1F74A 3BG9A 3H7UA 4PSRA 2ZZ3A 3C3NA 2QHAA 3GZAA 3HM7A 1H61A 1KRMA 4Z1DA 1OT2A 1QU4A 1KM5A 1IWAA 3HJZA 5DMLA 5I00A 1B31A 3EWDA 4L6HA 4DM2A 1EPVA 1TWZA 2JFEX 2QT3A 4W88A 2CZDA 3WMLA 1KBLA 2HK1A 3W7PA 2E5CA 3QPYA 3T81A 1DJNA 3QY8A 4CQAA 2J7CA 4GIEA 2B0MA 3DCPA 4NUWA 2PPGA 2VRJA 2WYSA 3PULA 4I9MA 1WKYA 1MXGA 4XAPA 3M0KA 4F9DA 2RH9A 4CD6A 3ITTA 3HO8A 5XIAA 1JJKA 2IQTA 3WF3A 3G6LA 2GLKA 4LTSA 3XIMA 3SCQA 3GY1A 1WZMA 3L5LA 3ZYZA 3TWBA 2BXYA 3W1MA 3V5FA 1R85A 5FOOA 3FFSA 3MPGA 2GDUA 3WIJA 2OZ8A 4ATDA 1TX0A 2DZBA 3CUZA 3WJXA 4HU0A 1GK8A 2AOSA 2F9RA 1R2RA 4LF2A 4F48A 3FY1A 3N2OA 4KCWA 1YDNA 1RR2A 4HNTA 2CLLA 4JDYA 3T7VA 4UTWA 3NPWA 4B5XA 1SFJA 3L4WA 1WDWA 2XYLA 3VK5A 1PO9A 3RPTA 4DBEA 1VFHA 2YA1A 3WFLA 1UA3A 3VKKA 1GQIA 5DCBA 4OGZA 3GXNA 3V18A 3G22A 1VBRA 4S23A 5A95A 3IUIA 2Y8KA 4IIEA 3K46A 1LOQA 1JZ6A 4D6FA 2DZAA 2IKGA 1UBSA 1E9IA 3POHA 4K3ZA 1C8QA 3L7RA 3RAOA 4A3HA 3E0VA 2OLHA 2EXOA 1YADA 3MY9A 2B31A 2XIMA 3KM8A 3CT2A 3CUHA 5CPQA 1UQZA 4LB4A 2CESA 5AZ0A 4J2PA 1RK6A 2V38A 3TN5A 1MW2A 2DPEA 2JF7A 4OIFA 2X7VA 3CZGA 3MKVA 4R34A 1KV5A 3G1VA 5C9XA 1EJSC 3WF4A 1W3JA 5E5CA 3LLXA 4TV6A 2CZFA 3EWWA 3RK8A 2DQXA 1W1A1 4A35A 3CM4A 2Y7DA 3SCWA 4O13A 1PZ2A 2IPWA 3DFNA 4XZBA 4CVWA 3ZO9A 1VYRA 1E9ZB 2Q3RA 3SRDA 2ZXAA 3CAQA 1LLWA 2VO5A 4GKTA 7TIMA 1AW5A 4OBRA 5FD0A 4IMCA 1FHUA 2CWNA 2X41A 4WRHA 3WUBA 1I60A 5ECVA 4GQBA 3BAIA 2OWWA 4D2JA 2PODA 4GUJA 4JXCA 1W54A 1BYCA 3WNKA 1G69A 3AROA 1TPWA 1JDFA 1X97A 1QTWA 4E2BA 2J7FA 1IEQA 4C6FA 3QPZA 1HKVA 2FTYA 3DFHA 2JIEA 3FJ6A 5BU9A 2XFFA 1FHVA 1TPH1 3ALFA 7PTDA 3KL5A 4NY2A 1X8FA 3LU2A 2ISDA 5CC3A 4EIVA 4M8UA 3WG6A 1ZJIA 4PMDA 1KXHA 4NP7A 3SUSA 1V03A 1Z44A 2X8RA 3UJ2A 3AMDA 3NSMA 4QLLA 3VILA 1W3IA 1N82A 3QW3A 2BHZA 3BLKA 3P74A 2W5FA 1H50A 3HGSA 3ZR6A 4FF5A 4BQ2A 3NQFA 2VC5A 3GVRA 3UJSA 3VGEA 3DBPA 2PSNA 1X7IA 4RUBA 4ZODA 4DZHA 5I23A 1GVQA 3CIWA 4AQLA 1DXEA 3P93A 3HGRA 4FS9A 3KOYA 4XSLA 1RA5A 3ARRA 1ISXA 4XSMA 4FK9A 3W74A 3VUSA 1DTUA 3ONCA 4LV9A 5CSRA 2DIJA 2OZTA 1YTKA 4JFTA 3PP7A 1OWQA 1L6SA 3SUVA 2WJDA 3S46A 1J79A 2UY5A 2NZLA 2VEGA 4MB4A 2QPXA 3O07A 4JTUA 4M0XA 4OQVA 3NQDA 2V5LA 5T9CE 1PYMA 1JI2A 5HANA 4PEKA 1FFRA 3TOPA 1K7FA 3MKKA 3VX0A 3SFWA 4PRTA 1XIHA 1CXEA 3GXTA 3VNDA 2DT0A 1DJQA 3EZ4A 4BF7A 4TX9A 3UZJA 5K3VA 2WJZA 2AQVA 1XPYA 3EWBX 5CG7A 3T6CA 5C2CA 4HOWA 3RX2A 2G97A 4LT9A 4R9XA 1BEUA 1HJUA 4DNMA 4M5PA 4PTMA 2WSYA 4MPKA 2HNEA 1EDTA 4H8UA 1G4EA 4L1GA 4YTTA 4RZ4A 2W9MA 4HA0A 2VM8A 1NIUA 4NASA 4GXWA 2CW6A 3L5AA 1D2KA 4F0KA 2DU2A 3B9AA 3W7HA 2PWHA 5A8PA 2ZC8A 3LLDA 3LLFA 1R5YA 4LS0A 4EE9A 3BAWA 3IIXA 2VC9A 2OSXA 4XKMA 3QZ6A 3MUIA 1K9TA 1FWCC 3D46A 3VIKA 4LUJA 3KOZA 3ABZA 2DFAA 1OFBA 2DZSA 4LS2A 1TWDA 2BMBA 2E77A 4DXXA 3Q4DA 2HE8A 3SY1A 1H0GA 4R9OA 1LQ0A 4H83A 5GJMA 3KS5A 2F2HA 1Q6DA 4AB4A 1UH3A 4YTRA 4IQJA 5HPOA 4FOJA 3B9DA 3M4HA 4FLRA 4UZUA 1NWRA 5GVJA 4B9YA 5LA2A 1KW1A 4QIUA 2DH3A 4IPIA 1MZHA 2R82A 4FOUA 4V1YA 3BO9A 1E56A 4L5ZA 8A3HA 2ZWYA 3ZVHA 3TDFA 2E1WA 3PN8A 5A6KA 4MUPA 2ALRA 1ZENA 1OC6A 2H9AA 3UA4A 4GIYA 3RGTA 4O11A 4CEXC 4P8XA 3RLHA 3OVRA 3TTOA 2YDSA 4JFVA 5F2GA 1XKJA 3STGA 1SZGA 5C9WA 2ZOXA 1CW2A 5HJLA 2X42A 4UTHA 2WHLA 3CJPA 3A9BA 2XH2A 2INFA 5GPRA 2QCGA 4UXDA 1MUWA 2X16A 1J18A 4IL2A 5D9OA 6ALDA 3KTSA 1DJYA 3BAYA 4G8TA 1MXDA 3W86A 4O53A 2GGJA 3AXHA 1BF2A 1KCZA 2CHOA 4IISA 3PZTA 4MNJA 1HP4A 3ZS4A 1UKSA 2YCLA 4WY0A 4ZA0A 4AW7A 3TR2A 1P0KA 1V5XA 1IE7C 1YNYA 1HUVA 5B7YA 3LI1A 1CTNA 3PB0A 1UP2A 3H4GA 3T55A 2DVTA 3G77A 4REQB 1UR2A 2FB3A 1O7AA 4GVHA 1RP9A 5DMNA 1F7BA 3CH9A 3NNTA 1V6YA 1IXQA 4UIOA 2OZ0A 3M1ZA 1PTDA 2VVSA 4A4AA 4GJIA 3H24A 3N18A 4OJYA 1AQMA 3N29A 2PMQA 1U83A 2J7DA 2OEJA 3H7VA 2YA2A 1A0CA 3HU7A 4S3JA 1EX5A 2FPYA 3U2OA 3B8WA 3NOEA 5B7ZA 3VDBA 4IGNA 4NX0A 1PWMA 4Z1YA 4Y9MA 4PMZA 3A64A 2DZPA 1GQNA 3BWWA 4MKVA 4FNPA 4D71A 3WH9A 1GOKA 1KR0A 2O9RA 2A1YA 2OZ3A 3TE9A 2FMOA 4Z2KA 2GDVA 2V6AA 4OTKA 4QS6A 2Z6JA 4AC7C 2H6RA 1E6XM 2WQPA 2XGIA 1JD9A 4KIEA 3SJNA 4Q8TA 4PODA 5BCAA 1GWJA 2WVVA 5U4NA 2WSQA 4IMDA 4O17A 1WPCA 5G4WA 3CQHA 2KX9A 1S1PA 3WBEA 1YLVA 1SR0A 1RVGA 5HJYA 1W3NA 4N6EA 5CPOA 3TYEA 4NAEB 3O2LA 2C1GA 5I3IA 1Q6QA 3QHNA 2PDFA 3NEHA 4ADTA 5E9AA 3IK4A 1DE5A 5M3WA 4O8AA 1D7FA 1HTIA 3PTDA 3MJMA 3WNOA 3GXPA 2WMJA 2D2HA 4J3UA 3DBNA 3RNDA 4RE2A 1PPIA 3SIZA 3LV6A 1VRXA 3VGGA 3VFCA 3PUOA 3EMQA 5CLTA 1QO5A 5HDRA 3QR3A 3H26A 2WKLA 2FPVA 4AHQA 1K77A 2OPJA 1SW0A 3W7GA 8TIMA 3G8EA 3OVQA 3FAXA 1VPYA 2QCHA 5T91A 3W3OA 1OGGA 4UTFA 4R27A 1MQRA 1R9YA 1QXLA 3EXRA 3VVGA 2GJXB 2NWRA 4QS5A 3SY5A 3WDQA 4FX8A 3L4XA 3APTA 2IKIA 6CGTA 2CBVA 2VZOA 2Y0FA 1VGAA 4I3GA 1A5NC 4EVZA 1TREA 3NZGA 2QS8A 1H4PA 3ICJA 4ZMGA 1PXGA 1ITCA 1F6YA 3L5MA 1XLKA 4ORIA 3BSMA 3BGAA 2FTWA 1XLMA 2HXUA 3VMNA 2QCNA 1IF2A 3TIMA 4MIMA 1XHGA 1RXOB 1RQHA 2O4MA 3E0FA 3IJ7A 1R6WA 2FDMA 3O6CA 3W1UA 5FAGA 3TLLA 4HPHA 1VRDA 5D02A 4XAFA 4Y9AA 4QG8A 3VKCA 5I77A 1MQQA 1PS9A 2DT2A 1A5CA 3HZ3A 4UFKA 1SYTA 4KFNA 4NT0A 3FA3A 2GQ3A 3PBYA 4Q4MA 1QUMA 3O6AA 1TUFA 3HURA 3XINA 3LM7A 3BCDA 4IIHA 3T0AA 3MMDA 3WUEA 3KE0A 4CEUC 3UA3A 4HCDA 4AUBA 1PV8A 3QZEA 2IS7A 1RY8A 4QDWA 4JYDA 4S3KA 4AY7A 1TTQA 4WOQA 3KUMA 4IH3A 3WDJA 5BXTA 1NWSA 2Q09A 2FVMA 2ZUUA 1LUCB 4KF1A 2ZZ2A 1A5UA 1LL4A 3ZOAA 2NQJA 3LENA 5IOBA 1JGIA 5EYWA 4HYVA 2FGZA 3PZUA 3M0YA 1N8IA 3M41A 1EZ2A 2CKRA 5A8MA 3E0IA 1E0TA 4WKFA 3U2CA 4CQ9A 5CBJA 2ZZ6A 3GLCA 5AY7A 3AZTA 4Z1BA 1QI0A 3M43A 3WLJA 4GACA 3FYYA 3F2BA 4WSKA 4Y8EA 3WMCA 3P0WA 1H7NA 1XSKA 4CD8A 1P0DA 5AVHA 3V5OA 4QCEA 3H53A 1R9ZA 4LANA 1DPMA 2X30A 1Z48A 2PUZA 3VDGA 5HULA 3GXDA 4B5VA 3V4BA 2HWGA 5TBOA 1F07A 2EKCA 3WBAA 3LI0A 1O5QA 4IL0A 1KXQA 1T40A 4D9PA 1EEPA 3R8HA 2FMNA 2YCEA 2PGWA 3GTHA 4IZGA 1E70M 4D6IA 1KCKA 7ENLA 4JTGA 4LQ1A 5EMLA 3VOFA 1SMAA 3RG6A 3QR1A 4UTLA 1HFBA 1YNPA 1C8YA 3QM3A 3EDEA 5C8BB 2BHYA 4G1KA 1SZNA 1CIUA 1GPWA 4RL3A 3NEVA 3B04A 4JOMA 2PP1A 2PTWA 2FZ8A 4JN7A 4PUEA 1MUMA 4DEFA 4GGHA 3NYZA 4BFAA 2VCBA 1DHKA 2WMFA 3AYTA 3DHDA 3ELFA 2FGBA 4JD4A 2GSEA 1FXQA 2YX0A 2QUMA 3PWGA 2YDQA 3GBEA 3M64A 3B8VA 5DY2A 3E12A 2Z0IA 2XIBA 2BHUA 1P1MA 1B3OA 1UYQA 3CQ0A 3MUXA 4GUHA 3TXZA 2XDFA 2WBKA 5I7GA 1DV7A 3OQEA 1PCKA 1ZP4A 4XZHA 3BUVA 2QR6A 2NQHA 2XSBA 1YNQA 2B4GA 3RCYA 1UBPC 3ZM8A 4B2DA 3HGJA 2PDWA 2IKHA 1L6YA 4TIMA 5G2IA 3YPIA 3MHFA 1C7TA 5LNRA 3EX3A 4E6MA 1TR9A 1EF3A 3CZLA 3ECQA 1WOBA 1O94A 1ECQA 1H1ZA 3IK2A 2QMJA 2V2HA 4PMOA 4Q7IA 1FWGC 3O16A 2R94A 2ZZ7A 4E4UA 2A79A 2B7NA 1EEXA 2QCDB 4G1NA 4XZMX 4KS0A 2A2IA 2NV9A 1QI2A 4JIHA 3GC5A 2DT3A 4A8NA 4B92A 3E02A 1S5NA 3PB2A 1BXNA 1GOXA 4HNCA 1BKSA 1PEZA 1XLIA 2FHFA 5A6TC 4MWAC 1F73A 5C70A 5F2MA 2Z29A 2YYUA 3W6LA 1S3HA 1S2AA 3BMWA 3HOJA 4O52A 1B30A 2F61A 3ITCA 3BXWA 5D05A 3EX4A 3KOFA 4WZHA 3BAJA 4AHPA 3RLGA 5DY3A 2BB0A 5FSEC 2BVYA 4UCGA 3KWSA 3V0UA 4Q4KA 5K4XA 3C2EA 4L6DA 2PWDA 4FNRA 1EIBA 4FXSA 2EPNA 4PTNA 3WEOA 1H1YA 1YXYA 2V0TA 5H8PA 2GVLA 4ZOBA 5ENLA 1TA3B 5DELA 3OO2A 4GX8A 1O68A 2UY4A 4MWAB 3ZWSA 4HZMA 4GVGA 4OUEA 2WAGA 5C54A 3GTNA 3RXZA 4H01A 3S2LA 2QAFA 3S9IA 1KRCC 1B5TA 4U2YA 2EGZA 4US5D 1XCXA 4NQ1A 1OFDA 1Z89A 4JTFA 2DT1A 4G2DA 4GXPA 3VO0A 4EXBA 4MKSA 5CC7A 3APYA 3HN3A 3LHWA 4NJJA 1M1BA 2QJIA 2VUNA 2GQ9A 3URQA 3CAVA 3B4YA 2PF0A 1KM4A 4ERIA 1C3FA 5G1MA 3ZXWA 3AHXA 3GZ3A 5D2XA 4DWSB 1G9HA 2A0NA 2VGGA 3N34A 1D8CA 4G7FA 4HB7A 5B80A 1Q65A 2ZFAA 4BR1A 4IQDA 3G1SA 5JMUA 2P8CA 1WUFA 1ZL1A 2H3BA 5A1AA 2RFGA 4RW3A 5L9FA 1B54A 3G18A 1Y5XA 3PANA 3C86A 3HPFA 3ITLA 1W3KA 4S3GA 4WKAA 3ARQA 1NP0A 2E5BA 3AYRA 2Y85A 4PCNA 5JVLA 5AYIA 2OQLA 2PGRA 3L4VA 4IT1A 1M41A 4QROA 4C6LA 3QBUA 3LG3A 2GOUA 2JKEA 3VI2A 2J77A 1M01A 2B7OA 2ZRZA 3BGGA 4GO8A 4ALDA 4E4PA 2O4QA 1FDZA 3TTEA 1JDCA 4HJWA 1BRLB 4CCDA 1US3A 1LT7A 4C1KA 4A3UA 1J0ZA 4DJDD 1T5AA 4Q6XA 5BMWA 3WL1A 1QNOA 3TC3A 2Q8XA 1PIFA 1RJPA 1YTDA 1UD2A 1LWIA 4PEEA 2D73A 3AS2A 3S5SA 3II1A 1XR2A 5C9UA 4I7VA 1H63A 3OG2A 3STCA 3KX6A 1M04A 1GORA 1BAGA 2ALDA 3EB3A 1Q6CA 1IXNA 2XGZA 2CFFA 9RUBA 1C90A 4RV8A 4M7SA 3MP4A 3RMJA 2OR2A 1Q66A 4KPLA 4DBUA 3U0HA 1EYWA 3ZJ8A 3CWHA 3QPEA 1DEDA 4HN8A 2BSLA 8XIAA 1OG6A 3A4XA 1OC5A 5F4WA 4K2SA 2R9RA 1Z69A 4HMCA 3GR4A 3R79A 3WUFA 1XQKA 3REQB 1GEHA 4ZGYA 3RRXA 3TZFA 1OGSA 4JIIX 4UTIA 3VNJA 1MO0A 3W82A 2RAGA 3GC4A 1WUEA 3DGBA 4PCTA 3EMCA 4AVFA 2Y7EA 1G4PA 1HP5A 2PRHA 3P61A 4H04A 4CUCA 3R8GA 4F2BA 4CU8A 4J28A 3IUDA 4J40A 4RCXA 3S1UA 2GL5A 4U3AA 1HGWA 3V0SA 2E6FA 4FLOA 4XD6A 4OBTA 1BWLA 2YFNA 2WHJA 4XUGA 4CQCA 2WNZA 4KGJA 2VGIA 2VCCA 3QV8A 3H21A 5ABFB 3PHAA 2F8QA 5HOSA 1B4EA 4PTDA 3GNPA 3G5EA 1FCUA 2X40A 3AQUA 1J0YA 1JCJA 1TMLA 2QMKA 1TJRA 4QP0A 1DQXA 3GHSA 3GVGA 2ZX8A 3DC0A 4JX6A 3MMUA 3B06A 3GG1A 3WDPP 1LORA 2O9PA 4E4FA 2C19A 4LCQA 3VIJA 1JCTA 3KWXA 5U7SA 1S46A 3VIPA 1F8MA 1AL7A 2WSPA 3LK6A 1BVZA 1PB0A 1QHZA 3R25A 3RCMA 4GY7A 3FSTA 2BGSA 1R87A 4PH6A 4UUIA 2NUXA 3BQ6A 3UETA 3LZ5A 4PUKA 1PZ1A 4QE5A 3WBWA 3BW2A 4N7QA 1YX1A 4Q8UA 2D20A 4REQA 4GUGA 3TFCA 2WJEA 1XLDA 1PE1A 1WV2A 4QSHA 3WK2A 2QAPA 4RE4A 2CXEA 3PG9A 3W0KA 2ESCA 1C8XA 3CB8A 4F9JA 1V0MA 3MUAA 3OLGA 2PURA 2VDHA 5FJOA 4GRSA 1XYFA 4M81A 3WLNA 4J3VA 4OU1A 3SBFA 4IOTA 3MCOA 4M7TA 3JS3A 3CUGA 3CQIA 1J11A 2VRKA 2BVTA 1Q7MA 4F0SA 1W8GA 4FX6M 1AQFA 5LA0A 1CEOA 3UNDA 3F5LA 4UQEA 3AO0A 4DBSA 5H2ZA 2OQYA 3USBA 1KFWA 4LBUA 4JPGA 2PDPA 1F76A 1UOZA 2G3MA 4KGLA 4H6KA 2XVGA 1XCFA 3VC5A 1IV8A 5G4HC 3LM3A 5DFAA 4GZJA 3HJEA 4PCSA 1HN1A 3MDWA 4QFUA 3BICA 3VNIA 3T0DA 3C0LA 3BCFA 2PGFA 2DZVA 5HWMA 3OYZA 4QJ3B 2IPGA 1NELA 4ENLA 1F4HA 1LJYA 2ZUMA 4RZ5A 4DNHA 3IUHA 3A5VA 4XKYB 2J79A 2VJXA 3ANYA 5I3HA 2NXHA 1HKKA 2QUTA 5I24A 2NX3A 3F2CA 5BWAA 5IRPA 4FXRA 1V3IA 2QCFA 4RX0A 1OGBA 3ITOA 2KZHA 2Y24A 4KWWA 2PWUA 1RPXA 1P6WA 2YZRA 2FVLA 2JKAA 3AIWA 3VNLA 1AUSL 3UCDA 1XGDA 3SW6A 4OE7A 2O92A 2CLHA 3G1FA 3V16A 3VOHA 2ATSA 2Y8VA 4ECLA 3EPNA 3R10A 4E8CA 1TRIA 3O0FA 1K7EA 3HF3A 3S0CA 2XH4A 5E6ZA 3WFZA 4PFMA 1B9BA 3W53A 4ZQNA 2ZYFA 3MVTA 4MJ2A 1XD1A 4GJ1A 1XXXA 3CQJA 4GBDA 1ZPTA 3WQDA 4LAZA 5E0KA 4L7ZA 2YXXA 2Z27A 3VD3A 5FCZA 4DWDA 1XG3A 1GVEA 1EXBA 2XH7A 1Y7VA 1DWFM 3L65A 1O4UA 1ODUA 2R8WA 2XU2A 4IQEA 5JH2A 1F3EA 4HD5A 3SQSA 3W2NA 3GM8A 5EA9A 1WXZA 1L6FA 1NDZA 3INPA 1UC4A 4UC5A 5RUBA 4NZ5A 2QDHA 4HBKA 1OCBA 2EQDA 3BTNA 4GH1A 3N04A 4HPXA 4GGBA 1ZP3A 3OBKA 3FEQA 2OGJA 3AMGA 1O1HA 3LS9A 2VQTA 3BPWA 4ZQMA 2V67A 5CSYA 1EO5A 4O1CA 1JPDX 4MJ4A 3VXGA 2HCVA 1UKPA 4AG0A 2G3FA 4V27A 3CV1A 3SGGA 1M3UA 2PZNA 1GZGA 4H7CA 2ZBTA 1HO4A 2XN1A 1DJZA 3GG7A 2ICSA 2CZVA 3H6OA 3AALA 1PDZA 4Q32A 1PHQA 3AS1A 3TTYA 4ZFCA 5HK4A 1EA9C 2C18A 4Y9OA 2J8GA 1O95A 1K4HA 4ERAA 1LG1A 3PY2A 3MT1A 2D2GA 2W61A 3KP1A 3AWOA 4KWUA 1UR9A 3DENA 3RJYA 4QTGA 1GONA 4AY8A 4E8DA 1LUCA 2VGFA 4PMNA 3RR1A 1E72M 3WEZA 4O54A 5EMKA 1AD4A 1K1DA 2PDBA 1J0KA 3MKCA 2WNWA 3V35A 4ORMA 5HJXA 2E68A 1EH9A 4FXJA 4X3ZA 4A8RA 2V30A 3V7PA 4GNKB 1RQBA 4ACZA 5CG0A 2OKTA 1E6ZA 2I14A 1EC8A 4IUOA 3K1GA 4JTDA 3QGKC 3C4UA 4JQ4A 3RX3A 2Z1BA 2Z7KA 4QJ1A 4A8IA 4QRNA 2W3ZA 2AAMA 2VC6A 1LLZA 3LGGA 4H00A 4PMRA 5FJTA 4YL2A 2IXUA 4XTIA 5JUVA 3D0CA 4Z2HA 2G3NA 3NL6A 4AF0A 4Q4OA 1RPKA 1O1ZA 3KBJA 2G0WA 3W7CA 4JTKA 1K8CA 3L4YA 1WDQA 1W5NA 5AVNA 1FX6A 3UW6A 2XVLA 2A7RA 3WQOA 3UZXA 1WAWA 4LVFA 3BLIA 5E93A 1QW8A 4UTJA 4MYAA 4ATLA 3M0IA 4QEEA 2WBGA 4Q4PA 1TMQA 1WXJA 5CPNA 4EXAA 1YEYA 1ISZA 3KVJA 5C6MA 3TAOA 4C6EA 3RM9A 1XBXA 4KW2A 1FWNA 4Z0SA 4HNNA 4C6OA 4A8LA 2ZZ5A 2PRLA 5CJMA 3MSGA 1PZ3A 3TZNA 3NG3A 2Z1VA 4H4IA 4CD4A 1W9VA 4PULA 2ZUTA 1XGZA 4YTQA 3KDNA 2V5KA 1W3TA 3ZWTA 3B0UX 3A47A 1M68A 4Q4RA 7REQB 1KBBA 4W93A 1JQVA 2R1KA 1KGUA 3T2PA 1S5TA 3TCEA 3ARVA 5DF0A 2QPUA 1JPHA 3ZJ7A 3G1RA 3FAWA 4PBGA 3QV6A 1A49A 3C3UA 3CIVA 3T2OA 1LCOA 1KGWA 1ECEA 3U9IA 4PZVA 3VCRA 3OBEA 4FAMA 1CGVA 1DP0A 4I90A 1OD8A 1JL8A 4V15A 3A12A 4MLRA 3BANA 4V28A 2HISA 1XG4A 3P5YA 4GA8A 3WQEA 4UQ9A 3HMJG 1B1YA 2FKPA 3AS0A 3UXKA 5CXPA 5HQEA 3DDMA 3CUIA 3UGRA 5BYWA 2NSOA 3BLEA 1E6SM 1R3QA 4LALA 4W9TA 1BSIA 1K7XA 3QW4B 3H54A 1CLKA 3LCWA 4BHYA 4YN5A 2Z24A 3UJRA 3CTLA 4W8AA 3CQKA 5HA7A 2FTPA 3P7YA 1M6JA 1XIBA 4AXNA 1E73M 3W2KA 1TPVA 1TQJA 3TLQA 2C79A 3NO5A 3PFRA 1V7AA 4GH3A 2VRQA 4PUJA 2OYMA 3IVSA 5LHEA 3VGHA 1Q7ZA 3T8LA 1EKOA 3QTGA 2Q01A 2DSKA 2WNQA 4C1NB 4NIRA 3RJXA 3R8RA 3T4WA 1UA7A 1R30A 4HNVA 5D2WA 4O28A 3W22A 4NAFB 4J1OA 4QQUA 4MDPA 3UWVA 1VFLA 4B5NA 1T41A 3NZRA 4GINA 4DY1A 3FJ4A 2PP0A 3NSNA 3W1NA 2WZTA 4JIEA 3OLDA 3NL3A 3WQCA 4EPKA 1CXFA 3TQVA 5D32A 1AJZA 3MANA 1MW0A 4MADA 1NSJA 5FJRA 3KCLA 3HV9A 1TA3A 3NQMA 4K68A 3CB3A 3EAUA 4H41A 3S47A 2PC8A 5AHNA 2JF6A 1OQFA 1TPC1 3DG6A 2J6XA 4G9PA 2DY3A 4WUIA 2WCSA 1IQ8A 3PNUA 3V5CA 3K2GA 2UY2A 1GJUA 1QNRA 4XB3A 3ZJKA 4PBEA 4HNLA 5EMMA 2XWEA 1R3YA 3MA8A 4AD3A 3WMSA 4GCXA 4EKJA 1S39A 5GJNA 3UFYA 1EJUC 3BJFA 3GO2A 2FJUB 1WA3A 1ZAJA 2E9LA 3A13A 3IGUA 2BY3A 1Q3NA 1O5XA 3MSYA 3W6YA 2EBNA 1XM3A 4LUTB 3WD2A 1YTEA 3P2VA 4AD0A 4ES4A 1LWHA 2BFGA 3HMCA 1ONWA 3L4TA 3NGJA 3QHMA 4JTLA 1HVQA 3THUA 2Y5SA 3S2NA 5BROA 1YPXA 5I3GA 1VLIA 2DZXA 4LUYA 4RNHA 3DAQA 4UFIA 3WLSA 2HMCA 2XFYA 3WEMA 3SN1A 4GNVA 4K7VA 4P7QA 2ODOA 1L2QA 1H1NA 5FSDC 4I9JA 3OBAA 1AW1A 1Z9AA 1FWTA 4GVIA 3W1QA 1XYCA 4DPPA 3FJLA 1GQJA 1G94A 1R3WA 4WHBA 5HATA 3AZSA 3GVVA 2QIWA 4UFLA 1X98A 1EB3A 4U28A 3MDUA 4EWJA 1K6AA 4TMBA 2D0HA 4HGXA 1FWSA 1NM9A 4E3TA 1Q6LA 3QC3A 4TMCA 4W85A 3TQKA 1X39A 5G5IA 4WGXA 1YKWA 5DRIA 4BJHA 2Y6ZA 4IMEA 3FN9A 4CNPA 1HIZA 4L1WA 3ID7A 1TR1A 4HMEA 4IFKA 4W8LA 5KSWA 1RA0A 5EL1A 2BODX 2QNEA 3NSXA 4F2UA 2C15A 2NQLA 3H4XA 2PWGA 4IIGA 3UR7A 4U31A 3W84A 1TV2A 3LNPA 1SUXA 4QISA 4MVAA 4V2XA 1GGOA 3GQYA 2OB3A 4JTSA 3UPBA 3R89A 4LAOA 3TYDA 3FDKA 3VDCA 2JEQA 3NQCA 1JYWA 4AEEA 3IS4A 2Y7FA 1H2JA 1XIEA 2EG6A 3AYSA 2ADAA 1FH8A 1FWRA 3SIMA 3VIFA 1L8NA 5HBFA 2ACSA 1KLYA 2D0FA 1BKHA 3WLIA 4QE4A 2TPSA 4KRTA 1JF6A 1H09A 4DXVA 3G3DA 1SMDA 4HPNA 4D6CA 2Q02A 3HG3A 2Q71A 3HBLA 3VAVA 2Z2BA 3MSRA 2HS8A 2Z4GA 4O0QA 2J8TA 4WK9A 3DU0A 4PTWA 4LY8A 1LL6A 3NR0A 1ODZA 2O55A 5I6SA 1QO2A 4H9XA 2YCJA 3QFWA 1V4YA 3EX1A 2J25A 2RDUA 3BLPX 1H41A 1TKKA 1E0UA 1JYXA 2W66A 4RDWA 2MANA 4O57A 2V3EA 3DXIA 3C0SA 3G0XA 1I1XA 2HRWA 3L2LA 3PSVA 4O14A 4WOZA 1CDGA 2VR2A 1VBHA 4JTAA 4JIRA 4S3AA 4GIRA 3BSHA 4B91A 2E28A 4YYFA 4KETA 3F03K 4PUDA 4Q4QA 2BNJA 4LNCA 1TTJA 3KOXA 3VINA 1GEQA 4AYSA 2P10A 1UP3A 1XRTA 3W25A 1MZRA 4WKHA 4TOQA 1ZS2A 3KRUA 1U5HA 4NNAA 5HXMA 2QDGA 3WF2A 3WDRA 2YOCA 1NP2A 4IMAA 3L68A 4GWEA 3P81A 4HTYA 2BVDA 5LA1A 2VFIA 3GR8A 5HWNA 3SCUA 4YHEA 3R12A 5E70A 1XIJA 4UR7A 2Q8LA 3TW9A 1Y5WA 5AYBA 1JFXA 2OX1A 4E3VA 3GDRA 2YFOA 4B5UA 4EANA 3CAWA 4RJEA 1VFSA 1QI3A 1XFBA 1KBIA 1XISA 2DZTA 1PTGA 1KM3A 1X38A 1FWBC 3W87A 1LBFA 3WLHA 3IRDA 3P6LA 4HZ8A 4YHGA 1EC7A 1CENA 1IGSA 2DGAA 4IP7A 3TJXA 3CUXA 1KGXA 3ANVA 3EOOA 5TAOA 3UPWA 2IXVA 4IHCA 4C6CA 1E1CA 3N2BA 4XZNX 4O1AA 4JQ3A 3AC0A 1AA1B 3GX9A 1HKWA 2GFTA 3A23A 2FVKA 4TO8A 5DXYA 3F4VA 2YBVA 4GG9A 1OIMA 1XYBA 3AS3A 3RILA 3NA8A 3S5YA 1YQ2A 1BSLA 2YLLA 3NQBA 4QBXA 3LXBA 1X6NA 5G2WA 1XBZA 3EEZA 1R3VA 3UG3A 2FH6A 1KV8A 2AKZA 1XIFA 3VU2A 4RNIA 2Y5JA 2VZSA 3CPRA 3THDA 5FEWA 1TPDA 3CBWA 2VWSA 2V2CA 3O6YX 2CLFA 1DJGA 3GNNA 3WNPA 2VR5A 3LX9A 4UMBA 5DN1A 4ZFMA 3W1TA 4GJJA 2INEA 4UNKA 3DH7A 4XK2A 1VLWA 2X2GA 3LY0A 3VTRA 3NM1A 1K4GA 5D09A 1TX2A 1PDYA 4X63A 1UKTA 2LLEA 2F84A 4U4MA 3BDKA 1W1IE 3CPUA 4KKXA 4DJEC 3VDAA 3E49A 2VMFA 3QC0A 4FNSA 4MM1A 3QQ1A 4IICA 5CC6A 2JALA 4F40A 4AZGA 4QXIA 1LROA 3LYEA 2V5CA 3EX6A 4GYPC 4XO6A 1FKXA 3HG2A 2KAUC 5ECUA 2J9ZA 4M6QA 4MB5A 3WDHA 3V36A 3LHZA 1RUSA 1K8ZA 2F2KA 3ZVHB 1XIIA 4W86A 2INZA 4UWMA 4ONVA 5BRQA 3CNYA 4ZQOA 2ZZ4A 2H9AB 3DFTA 4FNQA 4FR1A 3S2CA 4N42A 2Z25A 1U1JA 1ME8A 1NAL1 1MVYA 4GQRA 3DEQA 3KP0A 1DYSA 3VKAA 4Q7NA 3K5XA 2ZDSA 3P60A 2Z6IA 3ITYA 1TCMA 5GNZA 2FH8A 4ZSUA 1EGZA 3GUGA 3MSDA 2BX7A 2V63A 5CSSA 4KERA 3WK3A 2QDEA 1JAEA 2HPIA 3WD0A 5AECA 1ZBKA 4PA8A 3P80A 1XLAA 1A47A 3ABRA 3K13A 4HZ6A 1FWHC 3KTXA 4XVDA 1QPOA 1AK5A 2YCLB 4GK8A 4WY0B 4F2TA 3OQ8A 4C90A 1EQPA 4A22A 5C55A 2ACUA 1DJWA 2CU0A 5M5DA 4LNYA 7XIMA 1VCFA 4XUYA 5LIUX 3W83A 1ZSXA 4TXEA 2IMRA 4R7JA 3LUTA 1R3TA 4UB9A 3I4KA 4HJFA 2RJGA 3W1LA 4LVDA 1POJA 4DO5A 4FALA 2I1OA 3UYCA 3S2JA 1VENA 3V3WA 4RKAA 4UOZA 3GAKA 4W87A 4GZEA 1ONEA 3TVAA 4S2CA 1ONRA 3ANUA 1ISYA 4FB7A 3PZVA 4BWLA 4MDOA 3EOSA 2XSXA 1XKYA 1BG4A 1LYXA 1JNDA 3OJGA 1V51A 4DM1A 3SSZA 1QPRA 2QVNA 4L64A 1XSIA 2WKJA 4JYFA 4M19A 2RGMA 1NQKA 3VNKA 1XBVA 4LCRA 4US6A 3G6MA 2HK0A 1WP6A 3UY8A 3Q2DA 3VFLA 3C8NA 3Q65A 4S39A 3KLLA 3P3BA 2W0UA 5CCZA 3DIPA 1TVNA 3MQTA 4S3BA 1XLHA 3CHDA 3MYOA 1OZMA 3G1DA 3PC0A 5C7VA 3SRFA 1WZLA 1QI4A 4AXKA 2YPIA 1CXIA 4C65A 3ZJ6A 2Z26A 1VP5A 3C56A 3LPOA 1GNXA 3BJTA 4PMJA 5BXRA 3GH5A 4UQCA 2VGBA 3TU9A 3W1XA 3L4ZA 1QR7A 3WO8A 4AHOA 2W4XA 3L0GA 3O06A 4PTVA 4JTEA 4PBFA 5BRPA 3PNZA 1V6UA 4YYCA 1GVSA 7REQA 1VEPA 3M0ZA 1QPQA 1KBKA 4WJXA 3BLFA 2HVMA 1KKRA 1SW7A 1KQYA 4PFHA 1HT6A 1VEMA 3T44A 4W84A 1FTXA 2PDHA 1IEXA 3VOGA 4DYKA 4UTUA 3S9YA 4A05A 2QVHA 4H8VA 2WVTA 1M65A 2MNRA 4PRWA 1SO5A 4Q6JA 3G1YA 5HQMA 1XF0A 2J88A 1UCWA 3M0VA 4CNTA 4LUSA 2IPFA 4O8RA 5FJJA 2TAAA 1V77A 3N73A 2QJJA 3SI9A 5CSUA 2UY3A 3UVIA 4B3KA 4JFSA 1XINA 4HZ7A 3TYBA 4F0HA 1BYBA 3OVGA 2WM1A 2WCGA 3IWPA 3B9OA 3I3DA 3VNYA 3LHVA 5AC5A 2G96A 1IR2A 1G7VA 4AWUA 4C60A 4YJ5A 1XDMA 3GKFA 3STPA 4L4PA 1A5AA 1ITUA 1BQGA 3NDZA 3NJ3A 3CZEA 3FGCB 1ZBCA 1X96A 4CCEA 4K7YA 3M07A 3FVDA 5CZKA 3PPCA 4B4FA 1W56A 2Q8ZA 4WEVX 4Q8PA 3SEPA 1V08A 1T6MA 5A8NA 2C91A 3Q67A 2NW0A 1Q8AA 2DJLA 3B4UA 1E6RA 1AH4A 1UUQA 2ON3A 1GKRA 2PTYA 5CPMA 1R2TA 1GYNA 3GTIA 4X9SA 5I3DA 4LVGA 2P3EA 1QNPA 3EWZA 4R88A 1CXHA 4WXZA 2G95A 3UWYA 1FHLA 1PAMA 3OEXA 2PCQA 3WLRA 2EEXA 3BJSA 4LYKA 1TE6A 4QSFA 1A53A 3APGA 4NAFA 2UZ9A 1W31A 1QNVA 4OBSA 1PKMA 3VUPA 1KR1A 3GHTA 4O16A 4MNKA 3IPWA 1HXJA 1OBAA 4ZEPA 3RM4A 5TD4A 4AD1A 4DO4A 3G2GA 3FNDA 1ZCCA 3N11A 2VT0A 1CX9A 1JDEA 3LNMA 3FDGA 1Q6RA 4Q8QA 3DKLA 1JGMA 3D3AA 4GXMA 2ZRYA 3TYAA 3OHMB 4W8BA 4XBJA 1XRFA 5JBFA 1QBAA 1W1TA 3W7JA 2J47A 1E5JA 1Q85A 3C8FA 2GJNA 2P5NA 4ZENA 3S6TA 3OW1A 1UOKA 3MHGA 1Q45A 2XPKA 4DJED 1GVRA 3B3DA 1JZ2A 3WN6A 2YCIX 4ML9A 1F05A 3AIRA 4IQLA 2H3DA 3ZSTA 4R7OA 1RH9A 4FMVA 3NDOA 3EYPA 3EOUA 4LUTA 5LIKX 5C2XA 4R7WA 3VABA 3GBDA 4XAGA 3H2CA 3KXQA 3PTKA 2D24A 5E6YA 2WCAA 1B4KA 2CLPA 4CN1A 3DHFA 3WENA 5KZMA 1XPGA 3WJWA 2QUUA 2CERA 4ILSA 3G3MA 2CC0A 3CUFA 1BWKA 1PL9A 1WKEA 2UBPC 4GUFA 3UXDA 1ZJAA 3MP5A 3GNRA 4XG1A 3E2VA 1AH3A 3CWOX 2VZTA 2DSZA 1XJBA 4R33A 5AC8A 3TONA 1FQ0A 4GIAA 3S6OA 4EAYA 4B5WA 5C2GA 3IVUA 1WB0A 5BOEA 1PTAA 3H2AA 4GYJA 4DUWA 3N6HA 1E4LA 2OOGA 1TSIA 3W29A 4OOUA 1BGAA 3VGBA 1YMYA 3SDOA 4DUOA 3KCOA 2O9TA 2XGBA 4J5NA 2GVYA 3K8KA 4IFRA 3F4WA 3SFKA 1ME9A 3LBOA 4DUVA 1OFQA 2QGYA 4D8ZA 2C0HA 3EB2A 4EOUA 2PDQA 1T96A 3PUDA 3TNBA 1UROA 4F8XA 1QW9A 5EU9A 3W1AA 3P8IA 6REQA 1RBAA 1BPLB 4TV5A 3WQWA 5LZLA 3MWCA 4GLEA 1UD5A 1XQLA 4EXQA 1JCYA 1NOWA 4BF9A 1EGVA 1SSDA 3GDMA 4LEFA 5A8OA 2Y89A 1ZY9A 2AL1A 1LLOA 1W37A 3PZOA 3T0CA 2DP3A 3L0NA 2CITA 3DI0A 3B8TA 2Y7GA 3BCJA 5CJ5A 3N2TA 2E8ZA 1PWLA 3U3HA 1PYFA 4O12A 4AMAA 1JPKA 4L61A 2O56A 1PKNA 2WK2A 4N2YA 4AWTA 5L6UA 1C92A 3N9KA 1Z32X 4W7UA 3LHUA 2O7QA 1HW6A 3U2EA 3TFXA 3DFOA 1RBOB 2NVDA 1VAHA 4MZ8A 2WMIB 3SQMA 5I06A 3KL3A 4CKQA 1J5TA 4Y90A 1HKJA 4GI8A 3GAYA 1F4AA 4Q7BA 1DVJA 3TJIA 3VZYA 3NZPA 5XINA 1QHPA 1JXKA 3UQNA 3TSDA 5EB8A 1G6CA 2F7FA 1OZQA 1WYIA 4HT3A 5EY5A 3TROA 2AKMA 5LGZA 4Y2WA 1XV8A 1LOLA 4H9YA 4HK6A 1HKIA 1EWEA 5CBBA 4HHMA 4KEVA 1GOOA 4R3UA 4D1JA 4GQ0A 2PWFA 1XGEA 4FNTA 4IIBA 1ZJBA 1DIDA 3MI6A 4K6AA 4MMWA 4TTUA 4A2SA 3A3XA 1XC6A 3VOIA 1E0VA 3S42A 3STFA 1G4TA 5CQ1A 3TC7A 1EL3A 3S2MA 1MMFA 3F5JA 1RBLA 4RPQA 1HL2A 3OZOA 5T8GA 1IIGA 2WVSA 3V75A 4GI6A 4TVDA 3U7VA 3QY7A 5AYXA 3M9YA 3G0UA 2FZBA 3MW7A 3IJDA 4RK8A 4GPNA 4HP5A 1CGUA 1Z8AA 3IJIA 1D7KA 3SCVA 1PX8A 3IANA 3S83A 4L6OA 2PWVA 2XG9A 3DFSA 3QV9A 2E67A 2ZXBA 4C5YA 1P6BA 3HQNA 2WKGA 2ZWZA 3C2OA 1HQTA 3WBYA 3CLWA 3E5PA 1XLBA 4I7UA 5LIXX 1UASA 4NF7A 3WUGA 1SZFA 4KCTA 4S3DA 2XISA 3E0WA 4NZFA 3SGUA 3LSCA 1U33A 4CCZA 5PTDA 3KVKA 3BOLA 1IWPA 4WDUA 2JBMA 2Y63A 3RRAA 3ZVIA 1FVPA 1BFNA 2GVJA 3QKEA 2IW0A 3RDKA 3ZMRA 2V82A 4NZ4A 1NJJA 2OG9A 1ISVA 1F8IA 3UZYA 1WBHA 4DUXA 1Q13A 1IGWA 3IJQA 4NJGA 2CCRA 1IZJA 3VM5A 1GOQA 4DIAA 3C6CA 1KM0A 3M44A 3PAJA 4JR5A 1P43A 1FY6A 1KRAC 1QWGA 3I6TA 4C7FA 2ZC1A 5FF0A 2WB5A 3TWAA 1NVMA 5AKQA 5JIWA 4F0LA 4C5ZA 3DESA 3N2CA 3W7RA 1P0NA 5IFPA 4C6QA 2AGKA 3A21A 2EPHA 4ZQCA 1MW1A 4QM1A 1ZBVA 2X1RA 4NRSA 3TAKA 5F2IA 1YRRA 1MNZA 3M5XA 1HJXA 1NDVA 3FYOA 3K4DA 1JRCA 3BOFA 1GOIA 4OT7A 4Z2IA 2E3ZA 2ZZ1A 3CL7A 1F3TA 3MS8A 1J0IA 1TWWA 1IXPA 1K9DA 5CBIA 3NQEA 3CMJA 4NJKA 3O15A 2VOTA 3A9IA 3M7WA 5I3JA 1B57A 1UMYA 1K9EA 4X22A 3AICA 4YVXA 1H0IA 1HL9A 4C6KA 5HNNA 5E0CA 1VHCA 4NNCA 1U30A 2NVCA 4QDMA 2DJXA 3LBMA 1E4NA 1T99A 4LV4A 3VIGA 2GK1A 2HJPA 3KBMA 1RD5A 1YHTA 3GFYA 1SO4A 4MJZA 1NFGA 1X1ZA 1OJXA 3VKDA 2WZHA 4Z1CA 1YE6A 2ZKMX 2Y61A 3OPSA 4J2MA 1JZ4A 1XBYA 3CH0A 4P5UA 3QLDA 4F3HA 5DRCA 2FQIA 1GOWA 2X1SA 4PUMA 2EJ1A 2NLYA 1VCVA 4DJEA 1RJQA 5JQ9A 3W81A 1TJ1A 3ONBA 4GKLA 3CEPA 3UBPC 1DIKA 1O5KA 4GYPA 5CZ0A 2J78A 3OGSA 3LTYA 3O0KA 4FOKA 3VOCA 6A3HA 5DEZA 5HNRA 3VD4A 3CASA 2A5HA 4PCPA 2ZUNA 4MZ1A 4QAIA 3Q94A 2VI0A 3U5UA 4AAJA 1LDCA 3GHRA 1GW9A 1UH4A 4GI4A 1L0PA 2TSYA 3MP3A 4MFEA 4PMXA 3OA5A 1UKQA 1UWRA 2HBXA 5TIMA 1EX1A 4HMDA 4LRSA 1E55A 2WZEA 4PB3A 4KRZA 3W73A 3CHEA 2PCEA 3T05A 3DZ1A 4GNJA 1BGGA 4O15A 4OHQA 2WANA 3NQAA 3M5VA 4EACA 4IJBA 5KEZA 1H7PA 4DVOA 4LSBA 4NG3A 2PDIA 2FZNA 2HBVA 2WXDM 3DG7A 1SU5A 1SJBA 1Z3NA 4JAWA 3VDHA 4LBSA 4RNFA 5DCDA 3H2MA 1DQWA 3JUGA 1UW9A 3B8SA 2VTFA 2YBUA 3G1HA 2EG7A 1A5SA 3S5NA 5XIMA 3HPAA 1QOPA 3MB9A 2QLYA 1UR3M 3E5BA 5BNKA 2WC3A 2AMXA 1Q6EA 1EUNA 1H51A 3DYMA 4GHRA 5K9CA 1Q63A 1DBTA 3BARA 5I07A 2C14A 4K8HA 1LRQA 2J8FA 3M0LA 4NVTA 3CPGA 3WK0A 1JAKA 2PLKA 4E2VA 3AIVA 2VZUA 2L5HA 3PPHA 2ZUVA 5IM51 4P7LA 3UG5A 3VCNA 3LCLA 3NOYA 1EJXC 3M0MA 1OFPA 4O0KA 4LYPA 3AXXA 5HINA 3EBVA 2CLKA 4XZ9A 3FJNA 3SQLA 3HTWA 4GY1A 3W28A 3SAZA 3OGVA 1DKWA 3FKRA 3NZ1A 2P53A 4ZTYA 1TO3A 3WLOA 1OCJA 3P67A 3VKBA 3AZRA 2OJPA 2X7WA 1PJ9A 3QJAA 3TXVA 2PU1A 2POZA 3PZMA 4NZCA 2YW4A 1NDYA 4UQAA 1Q4WA 2VD9A 1OABA 2CPUA 5JBEA 1S2TA 1NOUA 3R7MA 4AD2A 1HJSA 1QCWA 2HSAA 4AZ5A 1FXPA 1POKA 3B8IA 3VNMA 1V3JA 1SFTA 1I8JA 3EDFA 3EA2A 3CU2A 4KRUA 3T0TA 3MV01 1KCXA 5D04C 4J9JA 1H7XA 3K30A 4EF8A 4X61A 4KT2A 4TR9A 8XIMA 3UGVA 1GVFA 3AJXA 3UZ5A 5DX7A 2GUUA 2VR4A 1XIMA 4MB3A 5FA5A 2HQAA 1G7UA 2DEPA 5HNUA 3PAOA 4E38A 3KBSA 3RX4A 3FGCA 1HZYA 2C7FA 1IZKA 1PKYA 3AJ7A 1AD1A 3O3RA 3UCQA 4EX4A 3ARUA 3BLOA 4P8WA 1TPUA 4XVEA 4YTSA 1WCGA 2J7GA 3M5ZA 1A3WA 3LPGA 1Q8JA 2GGHA 3MYPA 4MZYA 3PM6A 1XLGA 3MCMA 1BTCA 2HVNA 1JFHA 3ABQA 1ZQ5A 4FZIA 1NU5A 1A0DA 2YDRA 1DOSA 4GABA 3WL0A 3CHCA 3THQA 4N9DA 2NXIA 4E5TA 3VOJA 2Y62A 4ERGA 3D3FA 2YA0A 1CCWB 2J24A 5I09A 4Q22A 3L67A 1BF6A 4IIDA 2CYGA 5DQPA 3NVDA 1HX0A 3S4TA 1OHLA 4FIQA 3GDTA 2HXTA 3FYPA 4CQDA 3EDDA 2AGTA 4KMQA 1VBUA 3K8MA 3SZ8A 3COTA 4WCJA 4KEUA 3TC6A 2OMAA 4DJDC 3QZAA 4C91A 4YIWA 3GC2A 1OEPA 3GW3A 1U1UA 1X8CA 4FNUA 2ZX6A 3C0JA 1QPKA 1VFFA 3CZ8A 1FFQA 1A4MA 3R58A 4BQ4A 2D2JA 4IP5A 1QK0A 3T4CA 3TMLA 2YL6A 1Q6OA 1C29A 3W71A 3MCNA 5HNTA 4HNOA 4M3PA 1US0A 2A3AA 1VFTA 5FF3A 2VZVA 1XD0A 3HG5A 4N0RA 5CZJA 3SCTA 1MUCA 4LAKA 1JZ7A 3SUUA 4X0VA 4D6EA 4MNLA 3F4CA 1KFBA 5D37A 2QCEA 2BXVA 5AYYA 3SCOA 4Y7EA 1V02A 3NQ7A 2ACRA 3C2FA 2X1UA 4N6FA 4RE0A 3VE7A 3B05A 2DDXA 3ZFHA 4JICA 2XSAA 4ACZB 3ARZA 3AMLA 1WBJA 1TV8A 1BXCA 1UP0A 1EUAA 4Q3MA 5I02A 1GG0A 2PLJA 3RO6A 3S5ZA 1W17A 5A3HA 2PD5A 1J12A 2GSJA 2HROA 4P8UA 4P7RA 5I0DA 3F7JA 1E4IA 2BGNE 1S3TC 4AF0B 1HNYA 4PN2A 5ABGA 1O6IA 1OM0A 4CNSA 1HKMA 4I5RA 4Y9PA 2QXWA 3WJYA 1EWDA 3NO1A 3QXBA 3I65A 4QG6A 3LQLA 2QCMA 3DFPA 3O9NA 2QPSA 1OY0A 4WGHA 5AHMA 2YCKX 3OODA 4X2PA 3W7MA 2Y8UA 1ZBWA 5FESA 5A6AA 3W2MA 1QJWA 5BXSA 2PF8A 3S6DA 1TJPA 1YE4A 3MZNA 1Z42A 1A5KC 3HFTA 4PGLA 3L66A 2VEIA 3DX5A 1A5MC 1F3WA 4IX2A 2QV5A 2CXGA 1RAKA 4ROQA 3GDKA 4DBWA 2J7EA 1N7KA 3DC8A 3PZ9A 3WH5A 2NT0A 3MUY1 1UWSA 2AQWA 3LGDA 2VURA 3OTRA 2R1LA 2ABAA 3U4FA 1SO3A 4G7EA 2QJMA 2PDXA 1W9PA 2RDTA 3GRIA 1R2SA 4J3ZA 4AZCB 1LM1A 5GNYA 3QH2A 2OCZA 2YGYA 2VEMA 4HK7A 1QAPA 4AH7A 2PTDA 3RF9A 4KFPA 1IEIA 3FCPA 4S3CA 2GDQA 2QV4A 5C71A 1CXKA 1UWIA 2VFGA 1HJVA 4UTTC 3SADA 1UR1A 3DHUA 1BLIA 1L6WA 2D3LA 2BASA 3DECA 5KETA 4I5UA 4AMCA 1SJCA 3NPXA 4BI7A 4C6IA 1IEWA 1W1PA 3UNTA 1YPFA 1MRAA 2XVNA 1XYAA 4IXXA 3B0VC 4N9BA 3RO8A 2YYTA 4XISA 2FZ9A 5EGRA 3TKFA 1EBGA 2XIIA 6TAAA 2DUAA 2E9MA 2WMIA 5ABHA 1TIWA 3QVQA 2VX7A 1E6NA 3NXFA 2YXGA 4Z2JA 2R1NA 4N4PA 4BCEA 1OFAA 1OADA 3QTPA 3P8JA 1G4SA 1LRTA 1UJPA 3ZT6A 5FIPA 1DWHM 4ACYA 4OV4A 3WQ8A 3LCGA 1HJQA 4HHHA 2PDYA 3W7DA 1WQ5A 3B0YA 4LJ3A 7TAAA 3N4AA 4AD4A 3W1PA 1I2NA 3DHPA 4ZO6A 2QDDA 1TPB1 1JPIA 2WHKA 3GW0A 3VCCA 5CZTA 3U57A 3W37A 1EOMA 1OX4A 1KM6A 2PTZA 3CMGA 4AY1A 5AHLA 5D33A 4W5UA 3RCNA 2I9UA 3DG3A 3AAMA 1MQPA 2QF8A 4ZXLA 1VYPX 2XN2A 4IMGA 1KFLA 4M1BA 4E8GA 4ZQPA 5BWFA 2P8BA 5J5RA 4NHVA 3C52A 1BVWA 3WY1A 4KWSA 1EHNA 1CWYA 4LUIA 3P5ZA 1TIMA 1KQZA 2WWDA 3NDYA 1UD8A 3BL3A 3L4UA 4R85A 3D6NA 3WDIA 1V3KA 1W9BM 1KFKA 3POCA 4L4MA 3ME3A 2ZVRA 1VFUA 4M29A 3AUOA 2NXGA 1SGJA 2WZIA 3L23A 1H3GA 1Y65A 4C6DA 1ZUAX 2MUCA 3V1PA 4AEFA 1ME7A 1WKDA 2XH0A 2BLEA 1OFOA 3GIQA 1TRDA 4OUIA 5CPSA 2HV5A 3FV9A 3JR2A 3FVMA 5F4SA 3URNA 1XC4A 5CEWA 1UG6A 2VOMA 1XS2A 3ORWA 2W92A 2I5QA 2PDCA 5D9PA 4LEQA 1OYCA 2QCLA 4JGDA 1OFRA 2V5JA 4YLWA 1E3XA 1YIXA 2OT1A 1XUZA 1E9LA 3E2RA 3OOQA 4Z2GA 3PBVA 1SZRA 1AZ1A 1W9DM 4QLJA 4ZQRA 5CH9A 4YVVA 4JZ5A 1DE6A 1EQCA 1RV8A 3TJLA 1L2UA 1LBLA 3F2DA 1E9YB 3H70A 3WH7A 2C13A 1QHOA 5FJIA 4EPDC 2I9EA 4JFUA 4M24A 1TE1A 4YMZA 3LCHA 3TP4A 1KXVA 2WO5A 3TUUA 4HN4A 1V02E 4UR8A 4KESA 2G41A 4NILA 2VVNA 3J7HA 2GQAA 1E3ZA 2A21A 1KTBA 2OEMA 4J7RA 2YZ5A 3DKJA 2OOFA 4PCFA 2BY1A 5KMYA 3W2LA 4XQ6A 1QW7A 1GQKA 1Z41A 1F9CA 4KBXA 3T40A 3UWWA 1UWUA 3W27A 4IGMA 4AD5A 1FWEC 1MXSA 4JY8A 3KBNA 2WWCA 4M6VA 1OC7A 1FWFC 1TVLA 1NARA 3GFZA 3KFTA 3GH4A 4J3WA 1CLXA 4IFKB 4MYXA 4JQ1A 1I0BA 4Q8OA 2ZCGA 5BW6A 2ASHA 3OG3A 3IACA 4FX7A 3K4WA 3TW6A 3CYJA 3WX7A 1FOBA 2G8ZA 4IXHA 2BG5A 4H9VA <