3WKIA

Crystal structure of cellobiose 2-epimerase in complex with cellobiitol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
407
structure length
407
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Isomerase
total genus 162
structure length 407
sequence length 407
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkiA00
4TF4A 5CZLA 1FAEA 4L0GA 3ANJA 5M7IA 3VW5A 3WIQA 2CQSA 4AYPA 3QT3A 3GT5A 2YIKA 1NC5A 2VN7A 1DL2A 3QXQA 3PMMA 4EL8A 4CJ0A 4Q88A 1IA7A 2GZ6A 3GLYA 3P2CA 1KREA 2ZZRA 1L1YA 2Z07A 3W7TA 3TF4A 2FUZA 1V5DA 1UG9A 1WU4A 1KS8A 1WU6A 1GAIA 3QPFA 1WU5A 3RSYA 2FV0A 2AHFA 3ON6A 4ZG8A 1NXCA 4TXTA 3H2WA 3QWTA 4WU0A 3WUXA 3WKFA 3E73A 1FBOA 2FBAA 3WIWA 2EACA 3W5NA 1LF6A 2DRRA 3W7SA 1FMIA 4Z4JA 4AYRA 1FP3A 1FCEA 1JS4A 3ACSA 3RX8A 4WVBA 2JJBA 3EQAA 1H54A 2RI9A 1KFGA 1KSCA 1V7WA 3QSPA 4WVCA 1XWQA 3WKGA 3QT9A 3X17A 3WIRA 4Q2BA 5DGRA 3WKHA 1L2AA 3K11A 1IA6A 1FBWA 5E2JA 3S4BA 2DRSA 2RGKA 2EADA 1KWFA 1V5CA 2P0VA 2VN4A 4J5TA 3W7UA 4DODA 4CE7A 4KTRA 3QRYA 1DOGA 2JF4A 3QFZA 2DRQA 1RQ5A 2DROA 1VD5A 2NVPA 3W7XA 2XFGA 5M7YA 3W5MA 4ZH5A 1AYXA 1V7VA 2EABA 3T33A 1CLCA 3VXDA 3WC3A 1AGMA 3RENA 1H12A 2RI8A 3WKIA 3AFJA 1TF4A 3QFYA 5CD2A 5KKBA 1KKTA 3S4AA 2D8LA 4WVAA 2ZBLA 2OKXA 3ANIA 2EAEA 3E6UA 1ULVA 1G9JA 3S4CA 5GW7A 2JG0A 1CEMA 1V7XA 1GLMA 4AYQA 1GA2A 2D5JA 1KRFA 3D3IA 2QNOA 1G9GA 3H7LA 3QG0A 4DOEA 2B4FA 3S4DA 1G6IA 1H13A 2GH4A 2CQTA 3H3KA 2AHGA 3EZ8A 1XW2A 5CA3A 5DGQA 4FUSA 3ACTA 3RRSA 1G87A 1X9DA 3A3VA 4KTPA 4L6XA 4XUVA 3QDEA 3W7WA 1HCUA 2FV1A 2A8ZA 3QXFA 1LF9A 1FO3A 1UT9A 3RX5A 1F9OA 5GY3A 1GAHA 3RX7A 2F6DA 2AFAA 3CIHA 1IS9A 4Z4LA 5MEHA 1H14A 3ANKA 4JJJA 3GZKA 1WZZA 1FO2A 1K72A 4AYOA 4CJ1A 1F9DA 2WYNA 1KSDA 1XWTA
chains in the Genus database with same CATH superfamily
4TF4A 2Q1FA 3EU8A 3Q7AB 2ZISB 3E30B 1GXOA 3QXQA 5EASA 3PZ1B 4ZRQA 5FO9B 3DRAB 3GLYA 1LOHA 2ZZRA 5DHKA 2Z07A 4QT9A 1UG9A 1KS8A 3QPFA 4GTMB 4YCRA 3M00A 4ZG8A 4MMHA 2XQWA 3EUVB 3H2WA 3WUXA 2BB5A 2E24A 2B39A 4C1SA 3SAEA 4D4BA 3W7SA 1W6KA 4Z4JA 1FCEA 1FP3A 3ACSA 4FXGB 1N7PA 3EU5B 2RI9A 4WVCA 3Q75B 3N0GA 4GAXA 1L2AA 2WDAA 4Q2BA 1O79A 4OJZA 5E2JA 1H3CA 2RGKA 1KWFA 2VN4A 5IL8A 4KTRA 1DOGA 5C05A 1N4PB 1RQ5A 1N24A 1TN6B 2DROA 1NI1B 3NNBA 2ONGA 2WY7A 1HX9A 5M7YA 3VSMA 1AYXA 1V7VA 1CLCA 4ZH1A 1RWAA 5JMFA 1H12A 2RI8A 3DSSB 3AFJA 1KKTA 3S4AA 2D8LA 2OKXA 1ULVA 1G9JA 3S4CA 3M02A 3HXCB 4M76A 1GLMA 1HXGA 3NFVA 2QNOA 1G9GA 1F1SA 3H7LA 4D4DA 4DOEA 2B4FA 3SFXB 3S4DA 1H13A 1SA5B 1TNUB 3G4DA 2NOJA 4FUSA 1G87A 4KTPA 1GHQA 2FV1A 2A8ZA 3QXFA 1FO3A 1R76A 1UT9A 3RX5A 1GAHA 3RX7A 5MEHA 1N95B 3D5SA 3OXUA 4AYOA 1LXMA 3E73A 1SA4B 5CZLA 5IK9A 5M7IA 3ANJA 3WIQA 2CQSA 4AYPA 1TNZB 2YIKA 4EL8A 4OK2A 5ILZA 3P2CA 4YDOB 4FJQA 3W7TA 3TF4A 4EHMB 3P5RA 2WCOA 5GZKA 1GAIA 1HM2A 1WU5A 3OEDA 2AHFA 1NXCA 3HXDB 3E34B 3QWTA 3KLSA 3WKFA 4GTVB 3WIWA 2FBAA 1LF6A 3LZ9A 4AYRA 2I07B 1O6RA 1RWFA 1W6JA 1OJOA 1GXNA 2JJBA 3HXFB 4GTTB 3QSPA 1N4QB 1KSCA 1V7WA 4OZVA 3WKGA 5ILJA 3QT9A 3SFYB 4DI5A 3S4BA 4L9PB 1FT1B 2P0VA 1V5CA 1N7RA 3G6JB 1OJMA 1F9GA 3M7CA 4MBGB 1N9AB 1LD7B 4CE7A 3G4FA 3N0FA 2DRQA 1O6QA 3Q79B 3SDUA 3M7LA 5ILYA 2FUTA 3W7XA 4FNVA 1C82A 2EABA 2R2LB 3WC3A 1AGMA 1TF4A 5CD2A 5JMDA 1O1TB 3VSNA 2H6HB 4WVAA 1HV6A 1TN7B 4V1SA 2JG0A 1GSZA 1N1BA 4LNBB 2H6GB 4GTQB 2BB6A 1V7XA 3SDQA 2V8IA 2BRWA 1W3YA 1H36A 3QG0A 1KZPB 3E33B 2GH4A 2CQTA 1OJNA 2AHGA 5DHIA 4GTRB 3M73A 5CA3A 5IKHA 3RRSA 1X9DA 3A3VA 2J5CA 4L6XA 3DSTB 4LNVA 2V3NA 3W7WA 4ZRPA 3S9VA 5FOBB 1LF9A 1N94B 1N7QA 1N23A 1SQCA 1O1RB 1IS9A 4Z4LA 1TNBB 4V1RA 5ILHA 3M76A 4CJ1A 1C3DA 1JS4A 4ONTA 2V8JA 1S64B 1FAEA 4L0GA 3GT5A 1NC5A 1DL2A 4MMIA 1D8EB 1JCSB 2H6FB 4CJ0A 4Q88A 3Q78B 1V5DA 1RWCA 1WU4A 5IK0A 1WU6A 2BBCA 3ON6A 2H6IB 3PZ4B 1NL4B 4TXTA 2BRVX 1FT2B 2E22A 3M7EA 1FBOA 1HXAA 3W5NA 1N22A 2BRPA 3RX8A 5IM1A 1RWGA 1OJPA 3EQAA 1H54A 1KFGA 2V3PA 3X17A 1QBQB 1XWQA 5DGRA 2ONHA 3WKHA 5IKAA 3P5PA 3K11A 3K7XA 5IL3A 1IA6A 2WIIB 1FBWA 2DRSA 1J0NA 5ILKA 2EADA 5JPNB 3D5RA 1HZFA 4J5TA 3M71A 3SQCA 3QRYA 3DSXB 2JF4A 3QFZA 2GOXA 1HMUA 1VD5A 2NVPA 1J0MA 2IEJB 3W5MA 2F0YB 2ZIRB 3VXDA 3RENA 3M74A 3QFYA 5KKBA 1GXMA 4NEIA 1TNOB 1O5MB 3ANIA 2EAEA 3E6UA 1QSJA 3M72A 5ILIA 1N1ZA 4D4CA 3RJ3A 2BEDB 4GL3A 3SDRA 1LD8B 1KZOB 2G0DA 3CU7A 3SDTA 4AYQA 1KRFA 4BOJA 3M01A 1N20A 1N7NA 1CB8A 3E80A 3H3KA 1QQFA 3EZ8A 3ACTA 4E1YA 1N4RB 3M7BA 1X1HA 4GTSB 2WINB 5EAUA 3A0OA 1H35A 2XWJB 3E32B 1RWHA 3DSWB 4KKJA 2XWBB 2AFAA 3PYAA 1H14A 3ANKA 4JJJA 4FXKB 1KSDA 1XWTA 5FO8B 3PZ3B 3SDVA 3VW5A 1RW9A 3QT3A 1N4SB 2VN7A 1S63B 3PMMA 4LIXA 3C72B 4OZWA 1IA7A 2GZ6A 1DCEB 1KREA 1L1YA 3M77A 1D8DB 2FUQA 3Q7FB 2FUZA 1TN8B 3HXEB 2A73B 4OK4A 4RNQA 2WY8A 3RSYA 2FV0A 1X81B 4WU0A 4GTOB 4KKIA 5EATA 5AGDA 4D4AA 4F13A 3KQ4A 2EACA 2DRRA 1FMIA 1I8QA 1LTXB 4MU9A 3KSQB 1X1IA 4WVBA 3DPYB 3WIRA 3DSUB 2PMVA 1O1SB 1JCRB 1FPPB 5IK6A 3W7UA 4DODA 3HXBB 2V8KA 4D94A 4F10A 4BOKA 1EGUA 4YDEB 3E37B 3DSVB 2XFGA 1LXKA 4ZH5A 3T33A 5FO7B 1H3BA 1HMWA 3WKIA 1JCQB 2ZBLA 1H39A 3PZ2B 3M78A 5GW7A 1CEMA 1HXCA 4LNGB 4GTPB 2X03A 1TNYB 1GA2A 3KSLB 1N21A 2D5JA 3D3IA 3PYBA 1H37A 1G6IA 2PN5A 1QAZA 1XW2A 1MZCB 5DGQA 1HN0A 4XUVA 1O6HA 5ILDA 3QDEA 1HCUA 1HM3A 1UMPA 1H3AA 1F9OA 5JPMB 3E7JA 5GY3A 2G02A 3Q73B 3AFLA 1N7OA 2F6DA 3CIHA 3GZKA 1WZZA 1FO2A 1K72A 1X1JA 3M75A 1F9DA 2SQCA 2WYNA
chains in the Genus database with same CATH topology
4TF4A 3EU8A 3Q7AB 2ZISB 3E30B 1GXOA 3QXQA 3PZ1B 4ZRQA 5FO9B 3DRAB 3GLYA 2ZZRA 2Z07A 4QT9A 1UG9A 1KS8A 3QPFA 4GTMB 4YCRA 4ZG8A 2XQWA 3EUVB 3H2WA 3WUXA 2BB5A 2B39A 4C1SA 3SAEA 4D4BA 3W7SA 1W6KA 4Z4JA 1FCEA 1FP3A 3ACSA 4FXGB 3EU5B 2RI9A 4WVCA 3Q75B 1L2AA 4Q2BA 1O79A 5E2JA 1H3CA 2RGKA 1KWFA 2VN4A 4KTRA 1DOGA 1N4PB 1RQ5A 1TN6B 2DROA 1NI1B 2WY7A 5M7YA 1AYXA 1V7VA 1CLCA 4ZH1A 1H12A 2RI8A 3DSSB 3AFJA 1KKTA 3S4AA 2D8LA 2OKXA 1ULVA 1G9JA 3S4CA 3HXCB 4M76A 1GLMA 2QNOA 1G9GA 3H7LA 4D4DA 4DOEA 2B4FA 3SFXB 3S4DA 1H13A 1SA5B 1TNUB 2NOJA 4FUSA 1G87A 4KTPA 1GHQA 2FV1A 2A8ZA 3QXFA 1FO3A 1R76A 1UT9A 3RX5A 1GAHA 3RX7A 5MEHA 1N95B 3D5SA 3OXUA 4AYOA 3E73A 1SA4B 5CZLA 5M7IA 3ANJA 3WIQA 2CQSA 4AYPA 1TNZB 2YIKA 4EL8A 3P2CA 4YDOB 3W7TA 3TF4A 4EHMB 3P5RA 5GZKA 1GAIA 1WU5A 3OEDA 2AHFA 1NXCA 3HXDB 3E34B 3QWTA 3KLSA 3WKFA 4GTVB 3WIWA 2FBAA 1LF6A 4AYRA 2I07B 1O6RA 1W6JA 1GXNA 2JJBA 3HXFB 4GTTB 3QSPA 1N4QB 1KSCA 1V7WA 3WKGA 3QT9A 3SFYB 3S4BA 4L9PB 1FT1B 2P0VA 1V5CA 3G6JB 3M7CA 4MBGB 1N9AB 1LD7B 4CE7A 2DRQA 1O6QA 3Q79B 3SDUA 3M7LA 3W7XA 2EABA 2R2LB 3WC3A 1AGMA 1TF4A 5CD2A 1O1TB 2H6HB 4WVAA 1TN7B 4V1SA 2JG0A 1GSZA 4LNBB 2H6GB 4GTQB 2BB6A 1V7XA 3SDQA 2V8IA 1H36A 3QG0A 1KZPB 3E33B 2GH4A 2CQTA 2AHGA 4GTRB 3M73A 5CA3A 3RRSA 1X9DA 3A3VA 4L6XA 3DSTB 4LNVA 2V3NA 3W7WA 4ZRPA 3S9VA 5FOBB 1LF9A 1N94B 1SQCA 1O1RB 1IS9A 4Z4LA 1TNBB 4V1RA 3M76A 4CJ1A 1C3DA 1JS4A 4ONTA 2V8JA 1S64B 1FAEA 4L0GA 3GT5A 1NC5A 1DL2A 1D8EB 1JCSB 2H6FB 4CJ0A 4Q88A 3Q78B 1V5DA 1WU4A 1WU6A 2BBCA 3ON6A 2H6IB 3PZ4B 1NL4B 4TXTA 1FT2B 3M7EA 1FBOA 3W5NA 3RX8A 3EQAA 1H54A 1KFGA 2V3PA 3X17A 1QBQB 1XWQA 5DGRA 3WKHA 3P5PA 3K11A 3K7XA 1IA6A 2WIIB 1FBWA 2DRSA 2EADA 5JPNB 3D5RA 1HZFA 4J5TA 3M71A 3SQCA 3QRYA 3DSXB 2JF4A 3QFZA 2GOXA 1VD5A 2NVPA 2IEJB 3W5MA 2F0YB 2ZIRB 3VXDA 3RENA 3M74A 3QFYA 5KKBA 1GXMA 1TNOB 1O5MB 3ANIA 2EAEA 3E6UA 1QSJA 3M72A 4D4CA 3RJ3A 2BEDB 4GL3A 3SDRA 1LD8B 1KZOB 2G0DA 3CU7A 3SDTA 4AYQA 1KRFA 4BOJA 3H3KA 1QQFA 3EZ8A 3ACTA 1N4RB 3M7BA 4GTSB 2WINB 1H35A 2XWJB 3E32B 3DSWB 4KKJA 2XWBB 2AFAA 3PYAA 1H14A 3ANKA 4JJJA 4FXKB 1KSDA 1XWTA 5FO8B 3PZ3B 3SDVA 3VW5A 3QT3A 1N4SB 2VN7A 1S63B 3PMMA 4LIXA 3C72B 1IA7A 2GZ6A 1DCEB 1KREA 1L1YA 3M77A 1D8DB 3Q7FB 2FUZA 1TN8B 3HXEB 2A73B 2WY8A 3RSYA 2FV0A 1X81B 4WU0A 4GTOB 4KKIA 4D4AA 5AGDA 3KQ4A 2EACA 2DRRA 1FMIA 1LTXB 4MU9A 3KSQB 4WVBA 3DPYB 3WIRA 3DSUB 2PMVA 1O1SB 1JCRB 1FPPB 3W7UA 4DODA 3HXBB 2V8KA 4D94A 4BOKA 4YDEB 3E37B 3DSVB 2XFGA 4ZH5A 3T33A 5FO7B 1H3BA 3WKIA 1JCQB 2ZBLA 1H39A 3PZ2B 3M78A 5GW7A 1CEMA 4LNGB 4GTPB 1TNYB 1GA2A 3KSLB 2D5JA 3D3IA 3PYBA 1H37A 1G6IA 2PN5A 1XW2A 1MZCB 5DGQA 4XUVA 1O6HA 3QDEA 1HCUA 1UMPA 1H3AA 1F9OA 5JPMB 5GY3A 2G02A 3Q73B 2F6DA 3CIHA 3GZKA 1WZZA 1FO2A 1K72A 3M75A 1F9DA 2SQCA 2WYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TF4 A;  5CZL A;  1FAE A;  4L0G A;  3ANJ A;  5M7I A;  3VW5 A;  3WIQ A;  2CQS A;  4AYP A;  3QT3 A;  3GT5 A;  2YIK A;  1NC5 A;  2VN7 A;  1DL2 A;  3QXQ A;  3PMM A;  4EL8 A;  4CJ0 A;  4Q88 A;  1IA7 A;  2GZ6 A;  3GLY A;  3P2C A;  1KRE A;  2ZZR A;  1L1Y A;  2Z07 A;  3W7T A;  3TF4 A;  2FUZ A;  1V5D A;  1UG9 A;  1WU4 A;  1KS8 A;  1WU6 A;  1GAI A;  3QPF A;  1WU5 A;  3RSY A;  2FV0 A;  2AHF A;  3ON6 A;  4ZG8 A;  1NXC A;  4TXT A;  3H2W A;  3QWT A;  4WU0 A;  3WUX A;  3WKF A;  3E73 A;  1FBO A;  2FBA A;  3WIW A;  2EAC A;  3W5N A;  1LF6 A;  2DRR A;  3W7S A;  1FMI A;  4Z4J A;  4AYR A;  1FP3 A;  1FCE A;  1JS4 A;  3ACS A;  3RX8 A;  4WVB A;  2JJB A;  3EQA A;  1H54 A;  2RI9 A;  1KFG A;  1KSC A;  1V7W A;  3QSP A;  4WVC A;  1XWQ A;  3WKG A;  3QT9 A;  3X17 A;  3WIR A;  4Q2B A;  5DGR A;  3WKH A;  1L2A A;  3K11 A;  1IA6 A;  1FBW A;  5E2J A;  3S4B A;  2DRS A;  2RGK A;  2EAD A;  1KWF A;  1V5C A;  2P0V A;  2VN4 A;  4J5T A;  3W7U A;  4DOD A;  4CE7 A;  4KTR A;  3QRY A;  1DOG A;  2JF4 A;  3QFZ A;  2DRQ A;  1RQ5 A;  2DRO A;  1VD5 A;  2NVP A;  3W7X A;  2XFG A;  5M7Y A;  3W5M A;  4ZH5 A;  1AYX A;  1V7V A;  2EAB A;  3T33 A;  1CLC A;  3VXD A;  3WC3 A;  1AGM A;  3REN A;  1H12 A;  2RI8 A;  3WKI A;  3AFJ A;  1TF4 A;  3QFY A;  5CD2 A;  5KKB A;  1KKT A;  3S4A A;  2D8L A;  4WVA A;  2ZBL A;  2OKX A;  3ANI A;  2EAE A;  3E6U A;  1ULV A;  1G9J A;  3S4C A;  5GW7 A;  2JG0 A;  1CEM A;  1V7X A;  1GLM A;  4AYQ A;  1GA2 A;  2D5J A;  1KRF A;  3D3I A;  2QNO A;  1G9G A;  3H7L A;  3QG0 A;  4DOE A;  2B4F A;  3S4D A;  1G6I A;  1H13 A;  2GH4 A;  2CQT A;  3H3K A;  2AHG A;  3EZ8 A;  1XW2 A;  5CA3 A;  5DGQ A;  4FUS A;  3ACT A;  3RRS A;  1G87 A;  1X9D A;  3A3V A;  4KTP A;  4L6X A;  4XUV A;  3QDE A;  3W7W A;  1HCU A;  2FV1 A;  2A8Z A;  3QXF A;  1LF9 A;  1FO3 A;  1UT9 A;  3RX5 A;  1F9O A;  5GY3 A;  1GAH A;  3RX7 A;  2F6D A;  2AFA A;  3CIH A;  1IS9 A;  4Z4L A;  5MEH A;  1H14 A;  3ANK A;  4JJJ A;  3GZK A;  1WZZ A;  1FO2 A;  1K72 A;  4AYO A;  4CJ1 A;  1F9D A;  2WYN A;  1KSD A;  1XWT A; 
#chains in the Genus database with same CATH topology
 4TF4 A;  2Q1F A;  3EU8 A;  3Q7A B;  2ZIS B;  3E30 B;  1GXO A;  3QXQ A;  5EAS A;  3PZ1 B;  4ZRQ A;  5FO9 B;  3DRA B;  3GLY A;  1LOH A;  2ZZR A;  5DHK A;  2Z07 A;  4QT9 A;  1UG9 A;  1KS8 A;  3QPF A;  4GTM B;  4YCR A;  3M00 A;  4ZG8 A;  4MMH A;  2XQW A;  3EUV B;  3H2W A;  3WUX A;  2BB5 A;  2E24 A;  2B39 A;  4C1S A;  3SAE A;  4D4B A;  3W7S A;  1W6K A;  4Z4J A;  1FCE A;  1FP3 A;  3ACS A;  4FXG B;  1N7P A;  3EU5 B;  2RI9 A;  4WVC A;  3Q75 B;  3N0G A;  4GAX A;  1L2A A;  2WDA A;  4Q2B A;  1O79 A;  4OJZ A;  5E2J A;  1H3C A;  2RGK A;  1KWF A;  2VN4 A;  5IL8 A;  4KTR A;  1DOG A;  5C05 A;  1N4P B;  1RQ5 A;  1N24 A;  1TN6 B;  2DRO A;  1NI1 B;  3NNB A;  2ONG A;  2WY7 A;  1HX9 A;  5M7Y A;  3VSM A;  1AYX A;  1V7V A;  1CLC A;  4ZH1 A;  1RWA A;  5JMF A;  1H12 A;  2RI8 A;  3DSS B;  3AFJ A;  1KKT A;  3S4A A;  2D8L A;  2OKX A;  1ULV A;  1G9J A;  3S4C A;  3M02 A;  3HXC B;  4M76 A;  1GLM A;  1HXG A;  3NFV A;  2QNO A;  1G9G A;  1F1S A;  3H7L A;  4D4D A;  4DOE A;  2B4F A;  3SFX B;  3S4D A;  1H13 A;  1SA5 B;  1TNU B;  3G4D A;  2NOJ A;  4FUS A;  1G87 A;  4KTP A;  1GHQ A;  2FV1 A;  2A8Z A;  3QXF A;  1FO3 A;  1R76 A;  1UT9 A;  3RX5 A;  1GAH A;  3RX7 A;  5MEH A;  1N95 B;  3D5S A;  3OXU A;  4AYO A;  1LXM A;  3E73 A;  1SA4 B;  5CZL A;  5IK9 A;  5M7I A;  3ANJ A;  3WIQ A;  2CQS A;  4AYP A;  1TNZ B;  2YIK A;  4EL8 A;  4OK2 A;  5ILZ A;  3P2C A;  4YDO B;  4FJQ A;  3W7T A;  3TF4 A;  4EHM B;  3P5R A;  2WCO A;  5GZK A;  1GAI A;  1HM2 A;  1WU5 A;  3OED A;  2AHF A;  1NXC A;  3HXD B;  3E34 B;  3QWT A;  3KLS A;  3WKF A;  4GTV B;  3WIW A;  2FBA A;  1LF6 A;  3LZ9 A;  4AYR A;  2I07 B;  1O6R A;  1RWF A;  1W6J A;  1OJO A;  1GXN A;  2JJB A;  3HXF B;  4GTT B;  3QSP A;  1N4Q B;  1KSC A;  1V7W A;  4OZV A;  3WKG A;  5ILJ A;  3QT9 A;  3SFY B;  4DI5 A;  3S4B A;  4L9P B;  1FT1 B;  2P0V A;  1V5C A;  1N7R A;  3G6J B;  1OJM A;  1F9G A;  3M7C A;  4MBG B;  1N9A B;  1LD7 B;  4CE7 A;  3G4F A;  3N0F A;  2DRQ A;  1O6Q A;  3Q79 B;  3SDU A;  3M7L A;  5ILY A;  2FUT A;  3W7X A;  4FNV A;  1C82 A;  2EAB A;  2R2L B;  3WC3 A;  1AGM A;  1TF4 A;  5CD2 A;  5JMD A;  1O1T B;  3VSN A;  2H6H B;  4WVA A;  1HV6 A;  1TN7 B;  4V1S A;  2JG0 A;  1GSZ A;  1N1B A;  4LNB B;  2H6G B;  4GTQ B;  2BB6 A;  1V7X A;  3SDQ A;  2V8I A;  2BRW A;  1W3Y A;  1H36 A;  3QG0 A;  1KZP B;  3E33 B;  2GH4 A;  2CQT A;  1OJN A;  2AHG A;  5DHI A;  4GTR B;  3M73 A;  5CA3 A;  5IKH A;  3RRS A;  1X9D A;  3A3V A;  2J5C A;  4L6X A;  3DST B;  4LNV A;  2V3N A;  3W7W A;  4ZRP A;  3S9V A;  5FOB B;  1LF9 A;  1N94 B;  1N7Q A;  1N23 A;  1SQC A;  1O1R B;  1IS9 A;  4Z4L A;  1TNB B;  4V1R A;  5ILH A;  3M76 A;  4CJ1 A;  1C3D A;  1JS4 A;  4ONT A;  2V8J A;  1S64 B;  1FAE A;  4L0G A;  3GT5 A;  1NC5 A;  1DL2 A;  4MMI A;  1D8E B;  1JCS B;  2H6F B;  4CJ0 A;  4Q88 A;  3Q78 B;  1V5D A;  1RWC A;  1WU4 A;  5IK0 A;  1WU6 A;  2BBC A;  3ON6 A;  2H6I B;  3PZ4 B;  1NL4 B;  4TXT A;  2BRV X;  1FT2 B;  2E22 A;  3M7E A;  1FBO A;  1HXA A;  3W5N A;  1N22 A;  2BRP A;  3RX8 A;  5IM1 A;  1RWG A;  1OJP A;  3EQA A;  1H54 A;  1KFG A;  2V3P A;  3X17 A;  1QBQ B;  1XWQ A;  5DGR A;  2ONH A;  3WKH A;  5IKA A;  3P5P A;  3K11 A;  3K7X A;  5IL3 A;  1IA6 A;  2WII B;  1FBW A;  2DRS A;  1J0N A;  5ILK A;  2EAD A;  5JPN B;  3D5R A;  1HZF A;  4J5T A;  3M71 A;  3SQC A;  3QRY A;  3DSX B;  2JF4 A;  3QFZ A;  2GOX A;  1HMU A;  1VD5 A;  2NVP A;  1J0M A;  2IEJ B;  3W5M A;  2F0Y B;  2ZIR B;  3VXD A;  3REN A;  3M74 A;  3QFY A;  5KKB A;  1GXM A;  4NEI A;  1TNO B;  1O5M B;  3ANI A;  2EAE A;  3E6U A;  1QSJ A;  3M72 A;  5ILI A;  1N1Z A;  4D4C A;  3RJ3 A;  2BED B;  4GL3 A;  3SDR A;  1LD8 B;  1KZO B;  2G0D A;  3CU7 A;  3SDT A;  4AYQ A;  1KRF A;  4BOJ A;  3M01 A;  1N20 A;  1N7N A;  1CB8 A;  3E80 A;  3H3K A;  1QQF A;  3EZ8 A;  3ACT A;  4E1Y A;  1N4R B;  3M7B A;  1X1H A;  4GTS B;  2WIN B;  5EAU A;  3A0O A;  1H35 A;  2XWJ B;  3E32 B;  1RWH A;  3DSW B;  4KKJ A;  2XWB B;  2AFA A;  3PYA A;  1H14 A;  3ANK A;  4JJJ A;  4FXK B;  1KSD A;  1XWT A;  5FO8 B;  3PZ3 B;  3SDV A;  3VW5 A;  1RW9 A;  3QT3 A;  1N4S B;  2VN7 A;  1S63 B;  3PMM A;  4LIX A;  3C72 B;  4OZW A;  1IA7 A;  2GZ6 A;  1DCE B;  1KRE A;  1L1Y A;  3M77 A;  1D8D B;  2FUQ A;  3Q7F B;  2FUZ A;  1TN8 B;  3HXE B;  2A73 B;  4OK4 A;  4RNQ A;  2WY8 A;  3RSY A;  2FV0 A;  1X81 B;  4WU0 A;  4GTO B;  4KKI A;  5EAT A;  5AGD A;  4D4A A;  4F13 A;  3KQ4 A;  2EAC A;  2DRR A;  1FMI A;  1I8Q A;  1LTX B;  4MU9 A;  3KSQ B;  1X1I A;  4WVB A;  3DPY B;  3WIR A;  3DSU B;  2PMV A;  1O1S B;  1JCR B;  1FPP B;  5IK6 A;  3W7U A;  4DOD A;  3HXB B;  2V8K A;  4D94 A;  4F10 A;  4BOK A;  1EGU A;  4YDE B;  3E37 B;  3DSV B;  2XFG A;  1LXK A;  4ZH5 A;  3T33 A;  5FO7 B;  1H3B A;  1HMW A;  3WKI A;  1JCQ B;  2ZBL A;  1H39 A;  3PZ2 B;  3M78 A;  5GW7 A;  1CEM A;  1HXC A;  4LNG B;  4GTP B;  2X03 A;  1TNY B;  1GA2 A;  3KSL B;  1N21 A;  2D5J A;  3D3I A;  3PYB A;  1H37 A;  1G6I A;  2PN5 A;  1QAZ A;  1XW2 A;  1MZC B;  5DGQ A;  1HN0 A;  4XUV A;  1O6H A;  5ILD A;  3QDE A;  1HCU A;  1HM3 A;  1UMP A;  1H3A A;  1F9O A;  5JPM B;  3E7J A;  5GY3 A;  2G02 A;  3Q73 B;  3AFL A;  1N7O A;  2F6D A;  3CIH A;  3GZK A;  1WZZ A;  1FO2 A;  1K72 A;  1X1J A;  3M75 A;  1F9D A;  2SQC A;  2WYN A; 
#chains in the Genus database with same CATH homology
 4TF4 A;  3EU8 A;  3Q7A B;  2ZIS B;  3E30 B;  1GXO A;  3QXQ A;  3PZ1 B;  4ZRQ A;  5FO9 B;  3DRA B;  3GLY A;  2ZZR A;  2Z07 A;  4QT9 A;  1UG9 A;  1KS8 A;  3QPF A;  4GTM B;  4YCR A;  4ZG8 A;  2XQW A;  3EUV B;  3H2W A;  3WUX A;  2BB5 A;  2B39 A;  4C1S A;  3SAE A;  4D4B A;  3W7S A;  1W6K A;  4Z4J A;  1FCE A;  1FP3 A;  3ACS A;  4FXG B;  3EU5 B;  2RI9 A;  4WVC A;  3Q75 B;  1L2A A;  4Q2B A;  1O79 A;  5E2J A;  1H3C A;  2RGK A;  1KWF A;  2VN4 A;  4KTR A;  1DOG A;  1N4P B;  1RQ5 A;  1TN6 B;  2DRO A;  1NI1 B;  2WY7 A;  5M7Y A;  1AYX A;  1V7V A;  1CLC A;  4ZH1 A;  1H12 A;  2RI8 A;  3DSS B;  3AFJ A;  1KKT A;  3S4A A;  2D8L A;  2OKX A;  1ULV A;  1G9J A;  3S4C A;  3HXC B;  4M76 A;  1GLM A;  2QNO A;  1G9G A;  3H7L A;  4D4D A;  4DOE A;  2B4F A;  3SFX B;  3S4D A;  1H13 A;  1SA5 B;  1TNU B;  2NOJ A;  4FUS A;  1G87 A;  4KTP A;  1GHQ A;  2FV1 A;  2A8Z A;  3QXF A;  1FO3 A;  1R76 A;  1UT9 A;  3RX5 A;  1GAH A;  3RX7 A;  5MEH A;  1N95 B;  3D5S A;  3OXU A;  4AYO A;  3E73 A;  1SA4 B;  5CZL A;  5M7I A;  3ANJ A;  3WIQ A;  2CQS A;  4AYP A;  1TNZ B;  2YIK A;  4EL8 A;  3P2C A;  4YDO B;  3W7T A;  3TF4 A;  4EHM B;  3P5R A;  5GZK A;  1GAI A;  1WU5 A;  3OED A;  2AHF A;  1NXC A;  3HXD B;  3E34 B;  3QWT A;  3KLS A;  3WKF A;  4GTV B;  3WIW A;  2FBA A;  1LF6 A;  4AYR A;  2I07 B;  1O6R A;  1W6J A;  1GXN A;  2JJB A;  3HXF B;  4GTT B;  3QSP A;  1N4Q B;  1KSC A;  1V7W A;  3WKG A;  3QT9 A;  3SFY B;  3S4B A;  4L9P B;  1FT1 B;  2P0V A;  1V5C A;  3G6J B;  3M7C A;  4MBG B;  1N9A B;  1LD7 B;  4CE7 A;  2DRQ A;  1O6Q A;  3Q79 B;  3SDU A;  3M7L A;  3W7X A;  2EAB A;  2R2L B;  3WC3 A;  1AGM A;  1TF4 A;  5CD2 A;  1O1T B;  2H6H B;  4WVA A;  1TN7 B;  4V1S A;  2JG0 A;  1GSZ A;  4LNB B;  2H6G B;  4GTQ B;  2BB6 A;  1V7X A;  3SDQ A;  2V8I A;  1H36 A;  3QG0 A;  1KZP B;  3E33 B;  2GH4 A;  2CQT A;  2AHG A;  4GTR B;  3M73 A;  5CA3 A;  3RRS A;  1X9D A;  3A3V A;  4L6X A;  3DST B;  4LNV A;  2V3N A;  3W7W A;  4ZRP A;  3S9V A;  5FOB B;  1LF9 A;  1N94 B;  1SQC A;  1O1R B;  1IS9 A;  4Z4L A;  1TNB B;  4V1R A;  3M76 A;  4CJ1 A;  1C3D A;  1JS4 A;  4ONT A;  2V8J A;  1S64 B;  1FAE A;  4L0G A;  3GT5 A;  1NC5 A;  1DL2 A;  1D8E B;  1JCS B;  2H6F B;  4CJ0 A;  4Q88 A;  3Q78 B;  1V5D A;  1WU4 A;  1WU6 A;  2BBC A;  3ON6 A;  2H6I B;  3PZ4 B;  1NL4 B;  4TXT A;  1FT2 B;  3M7E A;  1FBO A;  3W5N A;  3RX8 A;  3EQA A;  1H54 A;  1KFG A;  2V3P A;  3X17 A;  1QBQ B;  1XWQ A;  5DGR A;  3WKH A;  3P5P A;  3K11 A;  3K7X A;  1IA6 A;  2WII B;  1FBW A;  2DRS A;  2EAD A;  5JPN B;  3D5R A;  1HZF A;  4J5T A;  3M71 A;  3SQC A;  3QRY A;  3DSX B;  2JF4 A;  3QFZ A;  2GOX A;  1VD5 A;  2NVP A;  2IEJ B;  3W5M A;  2F0Y B;  2ZIR B;  3VXD A;  3REN A;  3M74 A;  3QFY A;  5KKB A;  1GXM A;  1TNO B;  1O5M B;  3ANI A;  2EAE A;  3E6U A;  1QSJ A;  3M72 A;  4D4C A;  3RJ3 A;  2BED B;  4GL3 A;  3SDR A;  1LD8 B;  1KZO B;  2G0D A;  3CU7 A;  3SDT A;  4AYQ A;  1KRF A;  4BOJ A;  3H3K A;  1QQF A;  3EZ8 A;  3ACT A;  1N4R B;  3M7B A;  4GTS B;  2WIN B;  1H35 A;  2XWJ B;  3E32 B;  3DSW B;  4KKJ A;  2XWB B;  2AFA A;  3PYA A;  1H14 A;  3ANK A;  4JJJ A;  4FXK B;  1KSD A;  1XWT A;  5FO8 B;  3PZ3 B;  3SDV A;  3VW5 A;  3QT3 A;  1N4S B;  2VN7 A;  1S63 B;  3PMM A;  4LIX A;  3C72 B;  1IA7 A;  2GZ6 A;  1DCE B;  1KRE A;  1L1Y A;  3M77 A;  1D8D B;  3Q7F B;  2FUZ A;  1TN8 B;  3HXE B;  2A73 B;  2WY8 A;  3RSY A;  2FV0 A;  1X81 B;  4WU0 A;  4GTO B;  4KKI A;  4D4A A;  5AGD A;  3KQ4 A;  2EAC A;  2DRR A;  1FMI A;  1LTX B;  4MU9 A;  3KSQ B;  4WVB A;  3DPY B;  3WIR A;  3DSU B;  2PMV A;  1O1S B;  1JCR B;  1FPP B;  3W7U A;  4DOD A;  3HXB B;  2V8K A;  4D94 A;  4BOK A;  4YDE B;  3E37 B;  3DSV B;  2XFG A;  4ZH5 A;  3T33 A;  5FO7 B;  1H3B A;  3WKI A;  1JCQ B;  2ZBL A;  1H39 A;  3PZ2 B;  3M78 A;  5GW7 A;  1CEM A;  4LNG B;  4GTP B;  1TNY B;  1GA2 A;  3KSL B;  2D5J A;  3D3I A;  3PYB A;  1H37 A;  1G6I A;  2PN5 A;  1XW2 A;  1MZC B;  5DGQ A;  4XUV A;  1O6H A;  3QDE A;  1HCU A;  1UMP A;  1H3A A;  1F9O A;  5JPM B;  5GY3 A;  2G02 A;  3Q73 B;  2F6D A;  3CIH A;  3GZK A;  1WZZ A;  1FO2 A;  1K72 A;  3M75 A;  1F9D A;  2SQC A;  2WYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...