3WKIA

Crystal structure of cellobiose 2-epimerase in complex with cellobiitol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
407
structure length
407
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Isomerase
total genus 162
structure length 407
sequence length 407
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkiA00
4WVAA 4DOEA 1FO2A 2JJBA 3WC3A 1IS9A 1NC5A 2RI9A 3ACTA 3W7SA 5E2JA 3P2CA 1IA7A 1TF4A 2DRSA 1UT9A 3RRSA 3VXDA 3QDEA 2D8LA 5MEHA 1X9DA 4WU0A 3W5MA 3S4AA 3QT9A 3CIHA 1FMIA 1KRFA 1H12A 4WVBA 1L2AA 1UG9A 2WYNA 4CE7A 1CEMA 3RENA 1AYXA 4TF4A 3WKIA 1CLCA 2RGKA 4ZG8A 3H7LA 4CJ0A 2DRQA 2AHGA 1GAHA 2EADA 1WU6A 1V5CA 4KTPA 5KKBA 1WU4A 3ANKA 3WKGA 2RI8A 3QSPA 1DOGA 3QXFA 3QWTA 4FUSA 4AYRA 2F6DA 1DL2A 5DGRA 1KWFA 1NXCA 2A8ZA 3WKHA 3H3KA 1JS4A 1KSDA 3QRYA 2GZ6A 1KS8A 1V7WA 3S4DA 1V7VA 1F9OA 2FUZA 2P0VA 2D5JA 1V7XA 3E73A 3W7XA 1G9JA 2EABA 2CQSA 3WIQA 5CZLA 3GLYA 2XFGA 2CQTA 3RX8A 2DRRA 1H13A 3RX5A 2JF4A 1LF9A 1ULVA 3W7TA 4KTRA 2ZZRA 5CA3A 5M7IA 3W7UA 1G9GA 3GT5A 3VW5A 1FO3A 2VN4A 1G87A 3T33A 4XUVA 3QG0A 2JG0A 4L6XA 5GY3A 1FBWA 3TF4A 3WIWA 3WIRA 1FAEA 1GLMA 2NVPA 2FV1A 5CD2A 1V5DA 4TXTA 2ZBLA 3RX7A 2AHFA 2DROA 4Q2BA 3X17A 3ON6A 1KSCA 5GW7A 1KREA 3ACSA 2AFAA 2OKXA 4DODA 1F9DA 4WVCA 3WKFA 4Z4LA 1WZZA 5DGQA 2QNOA 4AYQA 4AYPA 3S4BA 3S4CA 1VD5A 3ANJA 2EAEA 3ANIA 4CJ1A 1GAIA 3RSYA 2FV0A 3K11A 1KFGA 1L1YA 1XWTA 1IA6A 2VN7A 3AFJA 4EL8A 3W7WA 4JJJA 3D3IA 3EQAA 4ZH5A 4AYOA 3QFZA 3A3VA 3PMMA 1WU5A 1FBOA 3GZKA 4J5TA 1HCUA 1KKTA 3EZ8A 4L0GA 4Q88A 1LF6A 2FBAA 2EACA 3WUXA 1K72A 5M7YA 2GH4A 1AGMA 3QPFA 1RQ5A 1G6IA 1FP3A 3H2WA 1H14A 3E6UA 3W5NA 1FCEA 1XWQA 4Z4JA 2YIKA 1GA2A 3QT3A 2Z07A 3QXQA 3QFYA 1XW2A 2B4FA 1H54A
chains in the Genus database with same CATH superfamily
4WVAA 4DOEA 1FO2A 1W6KA 1IS9A 4GL3A 3W7SA 3SDUA 5E2JA 1N23A 1N24A 1TF4A 1SA5B 3KSQB 4MU9A 5FO9B 2NOJA 5IK9A 1D8EB 1HMUA 1HM3A 1H12A 4WVBA 1L2AA 5EASA 2BRPA 4CE7A 5IK0A 1AYXA 4TF4A 3WKIA 3NNBA 3E33B 1RWCA 5ILDA 1N9AB 1V5CA 1N22A 3WKGA 3HXBB 3CU7A 1DOGA 1H35A 1F9GA 1CB8A 3M76A 1FT2B 3C72B 2WCOA 4MMIA 2A8ZA 1JS4A 1KSDA 1R76A 2GZ6A 2XQWA 2P0VA 1V7XA 4GTOB 1OJNA 1LTXB 2EABA 1LXMA 2CQSA 5CZLA 2DRRA 2J5CA 2JF4A 1LF9A 1H37A 4KTRA 1N4RB 2B39A 4L9PB 4OJZA 3Q75B 3KLSA 1O1TB 1HM2A 5GY3A 1FBWA 5IL3A 5C05A 2BB5A 1FAEA 1N7OA 4OZVA 1GLMA 1O1SB 4YDEB 1LD7B 3RX7A 2DROA 1KSCA 2ZISB 5GW7A 1KREA 4D4DA 4DODA 1LOHA 1VD5A 4V1RA 1N7PA 2EAEA 1NL4B 3SFYB 3RSYA 1L1YA 1XWTA 3W7WA 1LD8B 3QFZA 3GZKA 1HCUA 1X1JA 4M76A 4RNQA 4NEIA 4L0GA 4Q88A 5JMFA 2ZIRB 1TNUB 3SDVA 2H6GB 3E37B 5JPMB 3M00A 3QPFA 1G6IA 3M7CA 5IKHA 3H2WA 3M7LA 3RJ3A 2A73B 1JCSB 3W5NA 1S63B 1XWQA 2FUTA 4GTMB 2YIKA 3QT3A 1H39A 1XW2A 5FO8B 2JJBA 3EU8A 4KKJA 4FJQA 4GTQB 2BRVX 1HZFA 3P2CA 1IA7A 2DRSA 1UT9A 3RRSA 2ONGA 2D8LA 5MEHA 3S4AA 2WINB 3QT9A 1HXAA 1FMIA 3N0GA 1I8QA 3OEDA 2WYNA 1JCRB 1CEMA 3RENA 3DSTB 4ZG8A 1RW9A 3DSVB 1JCQB 1TNBB 5KKBA 3DSUB 3PZ2B 3SDQA 1EGUA 1FT1B 1N4PB 3G4DA 3QWTA 1N20A 4FUSA 1N7RA 4AYRA 1N94B 3G4FA 1KWFA 1N4SB 3WKHA 3H3KA 3QRYA 4GTPB 3M78A 1V7VA 1QBQB 1SQCA 1N1BA 3DSWB 4KKIA 1D8DB 3SFXB 3GLYA 4GTSB 2XFGA 3RX8A 2Q1FA 4EHMB 4D4AA 1ULVA 2ZZRA 4OK2A 3E30B 1HXGA 3W7UA 2BBCA 4YCRA 3VW5A 4FNVA 3OXUA 3QG0A 4XUVA 4L6XA 5ILHA 4QT9A 4MBGB 1QAZA 4F13A 4OK4A 2NVPA 3EU5B 4TXTA 2I07B 1QQFA 2AHFA 3ACSA 3DSSB 1RWHA 2V8KA 1C3DA 3PZ1B 5ILIA 3S4BA 1TN6B 1NI1B 3ANIA 3M71A 2FV0A 3P5RA 5DHIA 1KFGA 3AFJA 1C82A 1IA6A 4JJJA 4BOJA 3EQAA 4AYOA 1W6JA 1N21A 3Q78B 3VSMA 3A3VA 1WU5A 4GTRB 4F10A 1SA4B 1H3AA 3EZ8A 5IM1A 5ILZA 4ZRQA 2F0YB 3WUXA 5M7YA 3D5RA 1AGMA 1RQ5A 3SDRA 2V8JA 3HXCB 1H14A 2FUQA 4Z4JA 2X03A 5ILKA 2V8IA 2V3NA 3QFYA 2B4FA 2GOXA 3WC3A 1NC5A 1OJMA 2WDAA 1O79A 3DSXB 3W5MA 1KRFA 5FOBB 4E1YA 1FPPB 4MMHA 1X81B 3PYBA 3KSLB 1OJPA 4CJ0A 5JMDA 1GAHA 1S64B 1WU6A 5EATA 1WU4A 3ANKA 2RI8A 3QSPA 4LNVA 2F6DA 1DL2A 1NXCA 3M74A 1V7WA 1F9OA 2V3PA 2FUZA 3PYAA 2CQTA 4D94A 3RX5A 3W7TA 4V1SA 2H6FB 3HXDB 5GZKA 5M7IA 3D5SA 1W3YA 3N0FA 1FO3A 1O6RA 2VN4A 2BEDB 1O5MB 1F1SA 2JG0A 3TF4A 3WIRA 2BRWA 5ILYA 2FV1A 4LIXA 1GSZA 4FXGB 2ZBLA 3KQ4A 5IKAA 3ON6A 3AFLA 2AFAA 2OKXA 1F9DA 4Z4LA 1WZZA 4OZWA 1N7NA 4AYQA 4AYPA 2BB6A 3S4CA 1UMPA 4CJ1A 1GAIA 3M73A 3K11A 3E34B 2G02A 4EL8A 1TNOB 1O1RB 1RWGA 1HMWA 4J5TA 3E7JA 1KKTA 3S9VA 3DPYB 1LF6A 1TNZB 2FBAA 1N95B 3DRAB 1K72A 4LNBB 1GXMA 3NFVA 2GH4A 1N4QB 3Q79B 4ZRPA 1FP3A 5FO7B 1FCEA 4FXKB 3HXEB 4GAXA 3SDTA 2PN5A 3P5PA 3SQCA 2E22A 1GA2A 3Q73B 2Z07A 5DGQA 2XWBB 3M7BA 1H54A 2XWJB 3M77A 2RI9A 3ACTA 2WY7A 1HV6A 2WIIB 3Q7AB 3VXDA 3QDEA 1X9DA 4WU0A 3CIHA 1UG9A 3E80A 1HN0A 1CLCA 3G6JB 2RGKA 4GTVB 1N1ZA 3H7LA 2DRQA 2AHGA 2EADA 4KTPA 5ILJA 5IK6A 1QSJA 1GXNA 2IEJB 4BOKA 3QXFA 3M01A 1GHQA 1J0MA 5DGRA 3EUVB 1KS8A 3S4DA 3PZ3B 3M75A 2PMVA 2D5JA 3Q7FB 1MZCB 3E73A 3W7XA 1G9JA 3WIQA 1OJOA 2G0DA 1J0NA 4ONTA 1RWAA 1X1IA 1H13A 4C1SA 5EAUA 2H6HB 5CA3A 1O6QA 2H6IB 3M7EA 4D4BA 1G9GA 3LZ9A 3GT5A 3PZ4B 1G87A 3T33A 1O6HA 1N7QA 2R2LB 3WIWA 5JPNB 1LXKA 5CD2A 1V5DA 2SQCA 4Q2BA 1RWFA 3X17A 3K7XA 1GXOA 3E32B 4WVCA 3WKFA 2QNOA 5DHKA 1DCEB 3SAEA 3M72A 3ANJA 4GTTB 4LNGB 2VN7A 1H36A 4YDOB 2E24A 3D3IA 5AGDA 4ZH5A 4ZH1A 2ONHA 4DI5A 1TNYB 3HXFB 3PMMA 1FBOA 5IL8A 1H3CA 1HXCA 1TN8B 3M02A 2EACA 1KZPB 1X1HA 1KZOB 3A0OA 1HX9A 3E6UA 2WY8A 1H3BA 4D4CA 3QXQA 3VSNA 1TN7B
chains in the Genus database with same CATH topology
4WVAA 4DOEA 1FO2A 1W6KA 1IS9A 4GL3A 3W7SA 3SDUA 5E2JA 1TF4A 1SA5B 3KSQB 4MU9A 5FO9B 2NOJA 1D8EB 1H12A 4WVBA 1L2AA 4CE7A 1AYXA 4TF4A 3WKIA 3E33B 1N9AB 1V5CA 3WKGA 3HXBB 3CU7A 1DOGA 1H35A 3M76A 1FT2B 3C72B 2A8ZA 1JS4A 1KSDA 1R76A 2GZ6A 2XQWA 2P0VA 1V7XA 4GTOB 1LTXB 2EABA 2CQSA 5CZLA 2DRRA 2JF4A 1LF9A 1H37A 4KTRA 1N4RB 2B39A 4L9PB 3Q75B 3KLSA 1O1TB 5GY3A 1FBWA 2BB5A 1FAEA 1GLMA 1O1SB 4YDEB 1LD7B 3RX7A 2DROA 1KSCA 2ZISB 5GW7A 1KREA 4D4DA 4DODA 1VD5A 4V1RA 2EAEA 1NL4B 3SFYB 3RSYA 1L1YA 1XWTA 3W7WA 1LD8B 3QFZA 3GZKA 1HCUA 4M76A 4L0GA 4Q88A 2ZIRB 1TNUB 3SDVA 2H6GB 3E37B 5JPMB 3QPFA 1G6IA 3M7CA 3H2WA 3M7LA 3RJ3A 2A73B 1JCSB 3W5NA 1S63B 1XWQA 4GTMB 2YIKA 3QT3A 1H39A 1XW2A 5FO8B 2JJBA 3EU8A 4KKJA 4GTQB 1HZFA 3P2CA 1IA7A 2DRSA 1UT9A 3RRSA 2D8LA 5MEHA 3S4AA 2WINB 3QT9A 1FMIA 3OEDA 2WYNA 1JCRB 1CEMA 3RENA 3DSTB 4ZG8A 3DSVB 1JCQB 1TNBB 5KKBA 3DSUB 3PZ2B 3SDQA 1FT1B 1N4PB 3QWTA 4FUSA 4AYRA 1N94B 3WKHA 1KWFA 1N4SB 3H3KA 3QRYA 4GTPB 3M78A 1V7VA 1QBQB 1SQCA 3DSWB 4KKIA 1D8DB 3SFXB 3GLYA 4GTSB 2XFGA 3RX8A 4EHMB 4D4AA 1ULVA 2ZZRA 3E30B 3W7UA 2BBCA 4YCRA 3VW5A 3OXUA 3QG0A 4XUVA 4L6XA 4QT9A 4MBGB 2NVPA 3EU5B 4TXTA 2I07B 1QQFA 2AHFA 3ACSA 3DSSB 2V8KA 1C3DA 3PZ1B 3S4BA 1TN6B 1NI1B 3ANIA 3M71A 2FV0A 3P5RA 1KFGA 3AFJA 1IA6A 4JJJA 4BOJA 3EQAA 4AYOA 1W6JA 3Q78B 3A3VA 1WU5A 4GTRB 1SA4B 1H3AA 3EZ8A 4ZRQA 2F0YB 3WUXA 5M7YA 3D5RA 1AGMA 1RQ5A 3SDRA 2V8JA 3HXCB 1H14A 4Z4JA 2V8IA 2V3NA 3QFYA 2B4FA 2GOXA 3WC3A 1NC5A 1O79A 3DSXB 3W5MA 1KRFA 5FOBB 1FPPB 1X81B 3PYBA 3KSLB 4CJ0A 1GAHA 1S64B 1WU6A 1WU4A 3ANKA 2RI8A 3QSPA 4LNVA 2F6DA 1DL2A 1NXCA 3M74A 1V7WA 1F9OA 2V3PA 2FUZA 3PYAA 2CQTA 4D94A 3RX5A 3W7TA 4V1SA 2H6FB 3HXDB 5GZKA 5M7IA 3D5SA 1FO3A 1O6RA 2VN4A 2BEDB 1O5MB 2JG0A 3TF4A 3WIRA 2FV1A 4LIXA 1GSZA 4FXGB 2ZBLA 3KQ4A 3ON6A 2AFAA 2OKXA 1F9DA 4Z4LA 1WZZA 4AYQA 4AYPA 2BB6A 3S4CA 1UMPA 4CJ1A 1GAIA 3M73A 3K11A 3E34B 2G02A 4EL8A 1TNOB 1O1RB 4J5TA 1KKTA 3S9VA 3DPYB 1LF6A 1TNZB 2FBAA 1N95B 3DRAB 1K72A 4LNBB 1GXMA 2GH4A 1N4QB 3Q79B 4ZRPA 1FP3A 5FO7B 1FCEA 4FXKB 3HXEB 3SDTA 2PN5A 3P5PA 3SQCA 1GA2A 3Q73B 2Z07A 5DGQA 2XWBB 3M7BA 1H54A 2XWJB 3M77A 2RI9A 3ACTA 2WY7A 2WIIB 3Q7AB 3VXDA 3QDEA 1X9DA 4WU0A 3CIHA 1UG9A 1CLCA 3G6JB 2RGKA 4GTVB 3H7LA 2DRQA 2AHGA 2EADA 4KTPA 4BOKA 1QSJA 1GXNA 2IEJB 3QXFA 1GHQA 5DGRA 3EUVB 1KS8A 3S4DA 3PZ3B 3M75A 2PMVA 2D5JA 3Q7FB 1MZCB 3E73A 3W7XA 1G9JA 3WIQA 2G0DA 4ONTA 1H13A 4C1SA 2H6HB 5CA3A 1O6QA 2H6IB 3M7EA 4D4BA 1G9GA 3GT5A 3PZ4B 1G87A 3T33A 1O6HA 2R2LB 3WIWA 5JPNB 5CD2A 1V5DA 2SQCA 4Q2BA 3X17A 3K7XA 1GXOA 3E32B 4WVCA 3WKFA 2QNOA 1DCEB 3SAEA 3M72A 3ANJA 4GTTB 4LNGB 2VN7A 1H36A 4YDOB 3D3IA 5AGDA 4ZH5A 4ZH1A 1TNYB 3HXFB 3PMMA 1FBOA 1H3CA 1TN8B 2EACA 1KZPB 1KZOB 3E6UA 2WY8A 1H3BA 4D4CA 3QXQA 1TN7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WVA A;  4DOE A;  1FO2 A;  2JJB A;  3WC3 A;  1IS9 A;  1NC5 A;  2RI9 A;  3ACT A;  3W7S A;  5E2J A;  3P2C A;  1IA7 A;  1TF4 A;  2DRS A;  1UT9 A;  3RRS A;  3VXD A;  3QDE A;  2D8L A;  5MEH A;  1X9D A;  4WU0 A;  3W5M A;  3S4A A;  3QT9 A;  3CIH A;  1FMI A;  1KRF A;  1H12 A;  4WVB A;  1L2A A;  1UG9 A;  2WYN A;  4CE7 A;  1CEM A;  3REN A;  1AYX A;  4TF4 A;  3WKI A;  1CLC A;  2RGK A;  4ZG8 A;  3H7L A;  4CJ0 A;  2DRQ A;  2AHG A;  1GAH A;  2EAD A;  1WU6 A;  1V5C A;  4KTP A;  5KKB A;  1WU4 A;  3ANK A;  3WKG A;  2RI8 A;  3QSP A;  1DOG A;  3QXF A;  3QWT A;  4FUS A;  4AYR A;  2F6D A;  1DL2 A;  5DGR A;  1KWF A;  1NXC A;  2A8Z A;  3WKH A;  3H3K A;  1JS4 A;  1KSD A;  3QRY A;  2GZ6 A;  1KS8 A;  1V7W A;  3S4D A;  1V7V A;  1F9O A;  2FUZ A;  2P0V A;  2D5J A;  1V7X A;  3E73 A;  3W7X A;  1G9J A;  2EAB A;  2CQS A;  3WIQ A;  5CZL A;  3GLY A;  2XFG A;  2CQT A;  3RX8 A;  2DRR A;  1H13 A;  3RX5 A;  2JF4 A;  1LF9 A;  1ULV A;  3W7T A;  4KTR A;  2ZZR A;  5CA3 A;  5M7I A;  3W7U A;  1G9G A;  3GT5 A;  3VW5 A;  1FO3 A;  2VN4 A;  1G87 A;  3T33 A;  4XUV A;  3QG0 A;  2JG0 A;  4L6X A;  5GY3 A;  1FBW A;  3TF4 A;  3WIW A;  3WIR A;  1FAE A;  1GLM A;  2NVP A;  2FV1 A;  5CD2 A;  1V5D A;  4TXT A;  2ZBL A;  3RX7 A;  2AHF A;  2DRO A;  4Q2B A;  3X17 A;  3ON6 A;  1KSC A;  5GW7 A;  1KRE A;  3ACS A;  2AFA A;  2OKX A;  4DOD A;  1F9D A;  4WVC A;  3WKF A;  4Z4L A;  1WZZ A;  5DGQ A;  2QNO A;  4AYQ A;  4AYP A;  3S4B A;  3S4C A;  1VD5 A;  3ANJ A;  2EAE A;  3ANI A;  4CJ1 A;  1GAI A;  3RSY A;  2FV0 A;  3K11 A;  1KFG A;  1L1Y A;  1XWT A;  1IA6 A;  2VN7 A;  3AFJ A;  4EL8 A;  3W7W A;  4JJJ A;  3D3I A;  3EQA A;  4ZH5 A;  4AYO A;  3QFZ A;  3A3V A;  3PMM A;  1WU5 A;  1FBO A;  3GZK A;  4J5T A;  1HCU A;  1KKT A;  3EZ8 A;  4L0G A;  4Q88 A;  1LF6 A;  2FBA A;  2EAC A;  3WUX A;  1K72 A;  5M7Y A;  2GH4 A;  1AGM A;  3QPF A;  1RQ5 A;  1G6I A;  1FP3 A;  3H2W A;  1H14 A;  3E6U A;  3W5N A;  1FCE A;  1XWQ A;  4Z4J A;  2YIK A;  1GA2 A;  3QT3 A;  2Z07 A;  3QXQ A;  3QFY A;  1XW2 A;  2B4F A;  1H54 A; 
#chains in the Genus database with same CATH topology
 4WVA A;  4DOE A;  1FO2 A;  1W6K A;  1IS9 A;  4GL3 A;  3W7S A;  3SDU A;  5E2J A;  1N23 A;  1N24 A;  1TF4 A;  1SA5 B;  3KSQ B;  4MU9 A;  5FO9 B;  2NOJ A;  5IK9 A;  1D8E B;  1HMU A;  1HM3 A;  1H12 A;  4WVB A;  1L2A A;  5EAS A;  2BRP A;  4CE7 A;  5IK0 A;  1AYX A;  4TF4 A;  3WKI A;  3NNB A;  3E33 B;  1RWC A;  5ILD A;  1N9A B;  1V5C A;  1N22 A;  3WKG A;  3HXB B;  3CU7 A;  1DOG A;  1H35 A;  1F9G A;  1CB8 A;  3M76 A;  1FT2 B;  3C72 B;  2WCO A;  4MMI A;  2A8Z A;  1JS4 A;  1KSD A;  1R76 A;  2GZ6 A;  2XQW A;  2P0V A;  1V7X A;  4GTO B;  1OJN A;  1LTX B;  2EAB A;  1LXM A;  2CQS A;  5CZL A;  2DRR A;  2J5C A;  2JF4 A;  1LF9 A;  1H37 A;  4KTR A;  1N4R B;  2B39 A;  4L9P B;  4OJZ A;  3Q75 B;  3KLS A;  1O1T B;  1HM2 A;  5GY3 A;  1FBW A;  5IL3 A;  5C05 A;  2BB5 A;  1FAE A;  1N7O A;  4OZV A;  1GLM A;  1O1S B;  4YDE B;  1LD7 B;  3RX7 A;  2DRO A;  1KSC A;  2ZIS B;  5GW7 A;  1KRE A;  4D4D A;  4DOD A;  1LOH A;  1VD5 A;  4V1R A;  1N7P A;  2EAE A;  1NL4 B;  3SFY B;  3RSY A;  1L1Y A;  1XWT A;  3W7W A;  1LD8 B;  3QFZ A;  3GZK A;  1HCU A;  1X1J A;  4M76 A;  4RNQ A;  4NEI A;  4L0G A;  4Q88 A;  5JMF A;  2ZIR B;  1TNU B;  3SDV A;  2H6G B;  3E37 B;  5JPM B;  3M00 A;  3QPF A;  1G6I A;  3M7C A;  5IKH A;  3H2W A;  3M7L A;  3RJ3 A;  2A73 B;  1JCS B;  3W5N A;  1S63 B;  1XWQ A;  2FUT A;  4GTM B;  2YIK A;  3QT3 A;  1H39 A;  1XW2 A;  5FO8 B;  2JJB A;  3EU8 A;  4KKJ A;  4FJQ A;  4GTQ B;  2BRV X;  1HZF A;  3P2C A;  1IA7 A;  2DRS A;  1UT9 A;  3RRS A;  2ONG A;  2D8L A;  5MEH A;  3S4A A;  2WIN B;  3QT9 A;  1HXA A;  1FMI A;  3N0G A;  1I8Q A;  3OED A;  2WYN A;  1JCR B;  1CEM A;  3REN A;  3DST B;  4ZG8 A;  1RW9 A;  3DSV B;  1JCQ B;  1TNB B;  5KKB A;  3DSU B;  3PZ2 B;  3SDQ A;  1EGU A;  1FT1 B;  1N4P B;  3G4D A;  3QWT A;  1N20 A;  4FUS A;  1N7R A;  4AYR A;  1N94 B;  3G4F A;  1KWF A;  1N4S B;  3WKH A;  3H3K A;  3QRY A;  4GTP B;  3M78 A;  1V7V A;  1QBQ B;  1SQC A;  1N1B A;  3DSW B;  4KKI A;  1D8D B;  3SFX B;  3GLY A;  4GTS B;  2XFG A;  3RX8 A;  2Q1F A;  4EHM B;  4D4A A;  1ULV A;  2ZZR A;  4OK2 A;  3E30 B;  1HXG A;  3W7U A;  2BBC A;  4YCR A;  3VW5 A;  4FNV A;  3OXU A;  3QG0 A;  4XUV A;  4L6X A;  5ILH A;  4QT9 A;  4MBG B;  1QAZ A;  4F13 A;  4OK4 A;  2NVP A;  3EU5 B;  4TXT A;  2I07 B;  1QQF A;  2AHF A;  3ACS A;  3DSS B;  1RWH A;  2V8K A;  1C3D A;  3PZ1 B;  5ILI A;  3S4B A;  1TN6 B;  1NI1 B;  3ANI A;  3M71 A;  2FV0 A;  3P5R A;  5DHI A;  1KFG A;  3AFJ A;  1C82 A;  1IA6 A;  4JJJ A;  4BOJ A;  3EQA A;  4AYO A;  1W6J A;  1N21 A;  3Q78 B;  3VSM A;  3A3V A;  1WU5 A;  4GTR B;  4F10 A;  1SA4 B;  1H3A A;  3EZ8 A;  5IM1 A;  5ILZ A;  4ZRQ A;  2F0Y B;  3WUX A;  5M7Y A;  3D5R A;  1AGM A;  1RQ5 A;  3SDR A;  2V8J A;  3HXC B;  1H14 A;  2FUQ A;  4Z4J A;  2X03 A;  5ILK A;  2V8I A;  2V3N A;  3QFY A;  2B4F A;  2GOX A;  3WC3 A;  1NC5 A;  1OJM A;  2WDA A;  1O79 A;  3DSX B;  3W5M A;  1KRF A;  5FOB B;  4E1Y A;  1FPP B;  4MMH A;  1X81 B;  3PYB A;  3KSL B;  1OJP A;  4CJ0 A;  5JMD A;  1GAH A;  1S64 B;  1WU6 A;  5EAT A;  1WU4 A;  3ANK A;  2RI8 A;  3QSP A;  4LNV A;  2F6D A;  1DL2 A;  1NXC A;  3M74 A;  1V7W A;  1F9O A;  2V3P A;  2FUZ A;  3PYA A;  2CQT A;  4D94 A;  3RX5 A;  3W7T A;  4V1S A;  2H6F B;  3HXD B;  5GZK A;  5M7I A;  3D5S A;  1W3Y A;  3N0F A;  1FO3 A;  1O6R A;  2VN4 A;  2BED B;  1O5M B;  1F1S A;  2JG0 A;  3TF4 A;  3WIR A;  2BRW A;  5ILY A;  2FV1 A;  4LIX A;  1GSZ A;  4FXG B;  2ZBL A;  3KQ4 A;  5IKA A;  3ON6 A;  3AFL A;  2AFA A;  2OKX A;  1F9D A;  4Z4L A;  1WZZ A;  4OZW A;  1N7N A;  4AYQ A;  4AYP A;  2BB6 A;  3S4C A;  1UMP A;  4CJ1 A;  1GAI A;  3M73 A;  3K11 A;  3E34 B;  2G02 A;  4EL8 A;  1TNO B;  1O1R B;  1RWG A;  1HMW A;  4J5T A;  3E7J A;  1KKT A;  3S9V A;  3DPY B;  1LF6 A;  1TNZ B;  2FBA A;  1N95 B;  3DRA B;  1K72 A;  4LNB B;  1GXM A;  3NFV A;  2GH4 A;  1N4Q B;  3Q79 B;  4ZRP A;  1FP3 A;  5FO7 B;  1FCE A;  4FXK B;  3HXE B;  4GAX A;  3SDT A;  2PN5 A;  3P5P A;  3SQC A;  2E22 A;  1GA2 A;  3Q73 B;  2Z07 A;  5DGQ A;  2XWB B;  3M7B A;  1H54 A;  2XWJ B;  3M77 A;  2RI9 A;  3ACT A;  2WY7 A;  1HV6 A;  2WII B;  3Q7A B;  3VXD A;  3QDE A;  1X9D A;  4WU0 A;  3CIH A;  1UG9 A;  3E80 A;  1HN0 A;  1CLC A;  3G6J B;  2RGK A;  4GTV B;  1N1Z A;  3H7L A;  2DRQ A;  2AHG A;  2EAD A;  4KTP A;  5ILJ A;  5IK6 A;  1QSJ A;  1GXN A;  2IEJ B;  4BOK A;  3QXF A;  3M01 A;  1GHQ A;  1J0M A;  5DGR A;  3EUV B;  1KS8 A;  3S4D A;  3PZ3 B;  3M75 A;  2PMV A;  2D5J A;  3Q7F B;  1MZC B;  3E73 A;  3W7X A;  1G9J A;  3WIQ A;  1OJO A;  2G0D A;  1J0N A;  4ONT A;  1RWA A;  1X1I A;  1H13 A;  4C1S A;  5EAU A;  2H6H B;  5CA3 A;  1O6Q A;  2H6I B;  3M7E A;  4D4B A;  1G9G A;  3LZ9 A;  3GT5 A;  3PZ4 B;  1G87 A;  3T33 A;  1O6H A;  1N7Q A;  2R2L B;  3WIW A;  5JPN B;  1LXK A;  5CD2 A;  1V5D A;  2SQC A;  4Q2B A;  1RWF A;  3X17 A;  3K7X A;  1GXO A;  3E32 B;  4WVC A;  3WKF A;  2QNO A;  5DHK A;  1DCE B;  3SAE A;  3M72 A;  3ANJ A;  4GTT B;  4LNG B;  2VN7 A;  1H36 A;  4YDO B;  2E24 A;  3D3I A;  5AGD A;  4ZH5 A;  4ZH1 A;  2ONH A;  4DI5 A;  1TNY B;  3HXF B;  3PMM A;  1FBO A;  5IL8 A;  1H3C A;  1HXC A;  1TN8 B;  3M02 A;  2EAC A;  1KZP B;  1X1H A;  1KZO B;  3A0O A;  1HX9 A;  3E6U A;  2WY8 A;  1H3B A;  4D4C A;  3QXQ A;  3VSN A;  1TN7 B; 
#chains in the Genus database with same CATH homology
 4WVA A;  4DOE A;  1FO2 A;  1W6K A;  1IS9 A;  4GL3 A;  3W7S A;  3SDU A;  5E2J A;  1TF4 A;  1SA5 B;  3KSQ B;  4MU9 A;  5FO9 B;  2NOJ A;  1D8E B;  1H12 A;  4WVB A;  1L2A A;  4CE7 A;  1AYX A;  4TF4 A;  3WKI A;  3E33 B;  1N9A B;  1V5C A;  3WKG A;  3HXB B;  3CU7 A;  1DOG A;  1H35 A;  3M76 A;  1FT2 B;  3C72 B;  2A8Z A;  1JS4 A;  1KSD A;  1R76 A;  2GZ6 A;  2XQW A;  2P0V A;  1V7X A;  4GTO B;  1LTX B;  2EAB A;  2CQS A;  5CZL A;  2DRR A;  2JF4 A;  1LF9 A;  1H37 A;  4KTR A;  1N4R B;  2B39 A;  4L9P B;  3Q75 B;  3KLS A;  1O1T B;  5GY3 A;  1FBW A;  2BB5 A;  1FAE A;  1GLM A;  1O1S B;  4YDE B;  1LD7 B;  3RX7 A;  2DRO A;  1KSC A;  2ZIS B;  5GW7 A;  1KRE A;  4D4D A;  4DOD A;  1VD5 A;  4V1R A;  2EAE A;  1NL4 B;  3SFY B;  3RSY A;  1L1Y A;  1XWT A;  3W7W A;  1LD8 B;  3QFZ A;  3GZK A;  1HCU A;  4M76 A;  4L0G A;  4Q88 A;  2ZIR B;  1TNU B;  3SDV A;  2H6G B;  3E37 B;  5JPM B;  3QPF A;  1G6I A;  3M7C A;  3H2W A;  3M7L A;  3RJ3 A;  2A73 B;  1JCS B;  3W5N A;  1S63 B;  1XWQ A;  4GTM B;  2YIK A;  3QT3 A;  1H39 A;  1XW2 A;  5FO8 B;  2JJB A;  3EU8 A;  4KKJ A;  4GTQ B;  1HZF A;  3P2C A;  1IA7 A;  2DRS A;  1UT9 A;  3RRS A;  2D8L A;  5MEH A;  3S4A A;  2WIN B;  3QT9 A;  1FMI A;  3OED A;  2WYN A;  1JCR B;  1CEM A;  3REN A;  3DST B;  4ZG8 A;  3DSV B;  1JCQ B;  1TNB B;  5KKB A;  3DSU B;  3PZ2 B;  3SDQ A;  1FT1 B;  1N4P B;  3QWT A;  4FUS A;  4AYR A;  1N94 B;  3WKH A;  1KWF A;  1N4S B;  3H3K A;  3QRY A;  4GTP B;  3M78 A;  1V7V A;  1QBQ B;  1SQC A;  3DSW B;  4KKI A;  1D8D B;  3SFX B;  3GLY A;  4GTS B;  2XFG A;  3RX8 A;  4EHM B;  4D4A A;  1ULV A;  2ZZR A;  3E30 B;  3W7U A;  2BBC A;  4YCR A;  3VW5 A;  3OXU A;  3QG0 A;  4XUV A;  4L6X A;  4QT9 A;  4MBG B;  2NVP A;  3EU5 B;  4TXT A;  2I07 B;  1QQF A;  2AHF A;  3ACS A;  3DSS B;  2V8K A;  1C3D A;  3PZ1 B;  3S4B A;  1TN6 B;  1NI1 B;  3ANI A;  3M71 A;  2FV0 A;  3P5R A;  1KFG A;  3AFJ A;  1IA6 A;  4JJJ A;  4BOJ A;  3EQA A;  4AYO A;  1W6J A;  3Q78 B;  3A3V A;  1WU5 A;  4GTR B;  1SA4 B;  1H3A A;  3EZ8 A;  4ZRQ A;  2F0Y B;  3WUX A;  5M7Y A;  3D5R A;  1AGM A;  1RQ5 A;  3SDR A;  2V8J A;  3HXC B;  1H14 A;  4Z4J A;  2V8I A;  2V3N A;  3QFY A;  2B4F A;  2GOX A;  3WC3 A;  1NC5 A;  1O79 A;  3DSX B;  3W5M A;  1KRF A;  5FOB B;  1FPP B;  1X81 B;  3PYB A;  3KSL B;  4CJ0 A;  1GAH A;  1S64 B;  1WU6 A;  1WU4 A;  3ANK A;  2RI8 A;  3QSP A;  4LNV A;  2F6D A;  1DL2 A;  1NXC A;  3M74 A;  1V7W A;  1F9O A;  2V3P A;  2FUZ A;  3PYA A;  2CQT A;  4D94 A;  3RX5 A;  3W7T A;  4V1S A;  2H6F B;  3HXD B;  5GZK A;  5M7I A;  3D5S A;  1FO3 A;  1O6R A;  2VN4 A;  2BED B;  1O5M B;  2JG0 A;  3TF4 A;  3WIR A;  2FV1 A;  4LIX A;  1GSZ A;  4FXG B;  2ZBL A;  3KQ4 A;  3ON6 A;  2AFA A;  2OKX A;  1F9D A;  4Z4L A;  1WZZ A;  4AYQ A;  4AYP A;  2BB6 A;  3S4C A;  1UMP A;  4CJ1 A;  1GAI A;  3M73 A;  3K11 A;  3E34 B;  2G02 A;  4EL8 A;  1TNO B;  1O1R B;  4J5T A;  1KKT A;  3S9V A;  3DPY B;  1LF6 A;  1TNZ B;  2FBA A;  1N95 B;  3DRA B;  1K72 A;  4LNB B;  1GXM A;  2GH4 A;  1N4Q B;  3Q79 B;  4ZRP A;  1FP3 A;  5FO7 B;  1FCE A;  4FXK B;  3HXE B;  3SDT A;  2PN5 A;  3P5P A;  3SQC A;  1GA2 A;  3Q73 B;  2Z07 A;  5DGQ A;  2XWB B;  3M7B A;  1H54 A;  2XWJ B;  3M77 A;  2RI9 A;  3ACT A;  2WY7 A;  2WII B;  3Q7A B;  3VXD A;  3QDE A;  1X9D A;  4WU0 A;  3CIH A;  1UG9 A;  1CLC A;  3G6J B;  2RGK A;  4GTV B;  3H7L A;  2DRQ A;  2AHG A;  2EAD A;  4KTP A;  4BOK A;  1QSJ A;  1GXN A;  2IEJ B;  3QXF A;  1GHQ A;  5DGR A;  3EUV B;  1KS8 A;  3S4D A;  3PZ3 B;  3M75 A;  2PMV A;  2D5J A;  3Q7F B;  1MZC B;  3E73 A;  3W7X A;  1G9J A;  3WIQ A;  2G0D A;  4ONT A;  1H13 A;  4C1S A;  2H6H B;  5CA3 A;  1O6Q A;  2H6I B;  3M7E A;  4D4B A;  1G9G A;  3GT5 A;  3PZ4 B;  1G87 A;  3T33 A;  1O6H A;  2R2L B;  3WIW A;  5JPN B;  5CD2 A;  1V5D A;  2SQC A;  4Q2B A;  3X17 A;  3K7X A;  1GXO A;  3E32 B;  4WVC A;  3WKF A;  2QNO A;  1DCE B;  3SAE A;  3M72 A;  3ANJ A;  4GTT B;  4LNG B;  2VN7 A;  1H36 A;  4YDO B;  3D3I A;  5AGD A;  4ZH5 A;  4ZH1 A;  1TNY B;  3HXF B;  3PMM A;  1FBO A;  1H3C A;  1TN8 B;  2EAC A;  1KZP B;  1KZO B;  3E6U A;  2WY8 A;  1H3B A;  4D4C A;  3QXQ A;  1TN7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...