3WKJB

The nucleosome containing human tsh2b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjB00
5AV5C 1M19C 3B0DB 2RVQC 2F8NA 5B31D 4WU8D 2F8NB 4XZQA 5B24D 5AV5A 2BYMA 4XZQB 3UTAC 3WTPB 5AV5B 5AV8C 3MGQD 3AV1C 3W96D 1ULYA 1TZYD 3O62A 3W99D 5B0ZD 4J8WA 3O62B 3AZIA 5AV8A 4CAYA 4J8WB 1EQZC 3AZKC 3AZIB 4CAYB 3WKJC 5CP6D 1F66A 4J8XD 4WU8C 1F66B 5B33D 1EQZA 3AZKA 3MNND 5B2JD 1EQZB 5B24C 3X1UD 3AZKB 5B31A 4WU8A 5B31B 4WU8B 4XUJD 3MGQC 5B24A 3WAAB 1B6WA 5AVCC 1TZYC 2IO5B 5B0ZC 1P3MC 5B24B 3MGRD 1M18D 3MGQA 3W96A 1N1JA 5KDMA 5CP6C 3MGQB 5B0ZA 1P3KC 3W99A 1N1JB 3B0CT 3W96B 5KDMB 4R8PD 5B0ZB 3W99B 5B33C 3LZ0D 3MNNC 4H9SC 3X1UC 4J8XA 3KSYA 5B33A 4J8XB 1S32D 3MNNA 4XUJC 4H9SA 5B2JA 5B33B 1ID3C 3X1UA 2BYKB 3MNNB 5B2JB 4G92B 1M18C 5AV9C 1M1AD 4XUJA 3MGRA 1ZLAD 1M18A 5JA4A 4KUDD 5BNXA 3MGRB 3LZ0C 1M18B 5JA4B 5BNXB 4R8PA 3REIB 5B32C 4J8UD 1P3AD 3LZ0A 4R8PB 3LZ0B 1S32A 3AV2D 1M1AC 3TU4D 1H3OA 3RELD 1S32B 4KHAA 3VH5W 5BS7A 3C1CC 1H3OB 4KHAB 1ZLAC 1WWIA 1KX5D 4KUDC 4NFTA 1KU5A 4Z66D 5DNNC 4H9OA 1ZLAA 4ZUXD 4KUDA 5F99B 4J8UC 1P3AC 1ZLAB 1P3PD 3VH6A 3X1VD 3A6ND 2NZDD 3MVDD 4J8UA 1P3AA 2HIOA 1P3FC 3AV2C 5B1LB 4M6BA 5GXQD 2HIOB 1P3AB 4EO5C 5AV6C 5GT0D 3UTBC 4H9PA 1M19D 3KWQD 4WU9D 1BH8A 4H9PB 1B67A 3AV2A 3TU4A 1P3GA 3RELA 5B2IA 4Z66C 5B32G 3TU4B 1P3GB 4EO5B 5B2IB 3RELB 5CPJD 4ZUXC 5GT3C 1KX5A 4KGCD 5FUGA 4HGAC 1KX3D 1P3PC 3AV1D 1KX5B 4Z66A 4WV4B 5FUGB 3A6NC 3MGPD 2NZDC 4Z66B 4ZUXA 2HUEC 4ZUXB 1P3PA 4YS3B 5GXQC 3KXBD 3KUYD 2PYOA 2LY8A 3X1VA 5GT0C 2CV5D 3WKJD 2NZDA 2PYOB 3X1VB 1BH8B 3MVDA 3KWQC 5DNMD 5BNVA 4WU9C 2NZDB 3MVDB 5BNVB 5GT0A 1P3LC 1M19A 5GSUD 3LZ1D 3KWQA 4WU9A 3MGSD 5CPJC 2BYMB 4KGCC 1M19B 4WU9B 3W97C 4G91C 1KX3C 5AVCD 3MGPC 3X1TD 3UTAA 4E45A 1P3MD 1KX4D 5CHLB 3UTAB 3REKD 1KX3A 3AV1A 3KXBC 3KUYC 5AV8B 4YM6D 4G91B 3MGPA 2CV5C 3AV1B 1P3KD 5DNMC 3AYWD 3KUYA 3AFAC 2CV5A 3WKJA 3KUYB 2F8NH 1U35C 5GSUC 3LZ1C 2CV5B 5DNMA 3MGSC 3WKJB 3AZHC 1ID3D 3NQJA 3X1TC 5GSUA 1KX4C 3NQJB 3MGSA 3R45A 3REKC 5AV9D 3R45B 5AVCA 1TZYA 4YM6C 3X1TA 1P3MA 5AVCB 1TZYB 3X1TB 1P3MB 3V9RA 5AVBC 3AYWC 3WTPE 4H9NA 4YM6A 3V9RB 4NE5A 5CP6A 3UT9D 1P3KA 4H9NB 4YM6B 5CP6B 1P3KB 3NQUA 1P3IC 5B32D 4Z5TD 3AYWA 3NQUB 3AYWB 5G49A 1R4VA 3X1UB 5G49B 3VH5T 3C1BC 1ID3A 4WNNA 4XUJB 4QLCD 1ID3B 3C1CD 2FJ7D 4WNNB 3LJAC 4Z2MH 5AV9A 4JJND 2F8NK 1HQ3D 1AOIC 3VH6W 5AV9B 1WWSA 3UT9C 3AZGC 3AZFD 5DNND 3AZJD 5B1MD 4Z5TC 3B6GC 1P34D 3W98D 5AY8D 5B32A 4Z5TA 1P3FD 5B32B 4Z5TB 2YFWA 5AV6D 3B6FD 4QLCC 3UTBD 2FJ7C 2YFWB 5JRGD 1M1AA 4JJNC 1HQ3C 4UUZA 1M1AB 4E44A 4QLCA 2FJ7A 3C1CA 3AZFC 4UUZB 3AZJC 5B1MC 4QLCB 4Z2MG 3C1CB 5GT3D 4H9OB 1A7WA 1HQ3A 4KUDB 1P34C 5DNNA 3AZJA 5B1MA 3W98C 5AY8C 5DNNB 5B40C 3AZJB 3WA9D 4J8UB 1P34A 4H9RA 3B6FC 3X1SD 3W98A 5AY8A 1P34B 4H9RB 1BH9A 5JRGC 1P3FA 3W98B 2L5AA 1BH9B 1P3FB 5AV6A 3AV2B 3B6FA 3UTBA 1P3LD 5AV6B 4NE3A 5JRGA 3B6FB 5CPIC 3UTBB 5C3IC 3W97D 4X23D 1JFIA 5GT3A 5E5AC 1JFIB 3WA9C 2YFVA 5GT3B 5C3IB 2YFVB 3WTPD 4HGAB 3A6NA 4J8VD 1P3PB 3X1SC 3AN2D 1TAFA 4CSRA 3A6NB 3WA9A 2HUEB 1TAFB 4CSRB 5GXQA 3AFAD 4H9QA 5GXQB 3X1SA 4DRBA 3O62D 2AROD 1U35D 4NE6A 5GT0B 4H9QB 3X1SB 3AZHD 3KWQB 5BT1D 1HTAA 3B0DC 4X23C 3AZND 1P3LA 5CPJA 4KGCA 1P3LB 5CPJB 3W97A 4KGCB 4X23A 3WTPC 4J8VC 1KX3B 3W97B 3AN2C 4X23B 3MGPB 5AVBD 3WAAD 3KXBA 3WTPA 4J8VA 3KXBB 3AN2A 3O62C 2AROC 4J8VB 1P3ID 4J8WC 3AN2B 1P3OD 3AZIC 1BFMA 5DNMB 3AFAA 5BT1C 3AFAB 2AROA 3AZNC 1U35A 3LZ1A 4WZSB 1F66C 1Q9CA 3AZHA 2AROB 1U35B 5GSUB 3LZ1B 3MGSB 3C1BD 3AZHB 4LD9D 1P3BD 3AZNA 1KX4A 5B0YD 3AZNB 3VH6T 5B31C 3LJAD 3REKA 1KX4B 3WAAC 3REKB 2IO5C 1AOID 3REHD 3AZGD 3AZMD 5AVBA 1P3OC 3B6GD 3WAAA 3W96C 5AVBB 2F8NG 3W99C 1P3IA 1P3OA 1P3IB 1P3OB 3AZLD 4DRAA 1P3BC 4LD9C 3REID 5B0YC 4J8XC 3C1BA 3REJD 2CWEA 4LD9A 5B2JC 1P3BA 3REHC 3C1BB 3AZMC 1F1EA 4G92C 5CPKD 5B0YA 2NQBD 1P3BB 4LD9B 3LJAA 5B0YB 2BYKA 3LJAB 1AOIA 3REHA 3UT9A 3AZGA 3AZMA 3B0BA 1AOIB 3REHB 3UT9B 3AZGB 3AZMB 3MGRC 5B40D 3B6GA 3B6GB 3AZLC 5B31G 3LELD 3REIC 5F99D 4R8PC 3B0CW 3REJC 3AZLA 3REIA 5CPKC 3AZLB 2NQBC 5CPID 2FJ7B 5B1LD 2HIOD 4JJNA 3REJA 1S32C 4JJNB 3REJB 1HQ3B 3AZFA 5CPKA 2NQBA 5BS7C 3AZFB 5CPKB 5E5AD 2NQBB 5B1MB 2JSSA 1P3GD 5B2ID 3LELC 4ZBJC 5F99C 5B40A 5AY8B 5B40B 4AWLC 3LELA 5F99A 3LELB 4ZBJB 5B1LC 4YS3D 2HIOC 3AZED 5JRGB 2PYOD 5BO0A 4AWLB 5CPIA 5B1LA 5BO0B 2F8ND 5CPIB 3TU4C 1P3GC 3RELC 5B2IC 4XZQD 5AV5D 2RVQD 5E5AA 1KX5C 5E5AB 3WA9B 3UTAD 3VH5A 4J8WD 4YS3C 3AZEC 3AZID 5AV8D 2PYOC 3X1VC 1F66D 3MVDC 4YS3A 3AZEA 1EQZD 3AZKD 3AZEB 4XZQC
chains in the Genus database with same CATH superfamily
5AV5C 1M19C 3B0DB 2RVQC 2F8NA 5B31D 4WU8D 2G5IC 2F8NB 4XZQA 5B24D 5AV5A 2BYMA 4XZQB 3UTAC 3WTPB 5AV5B 5AV8C 3MGQD 3AV1C 3W96D 1ULYA 1TZYD 3O62A 3W99D 5B0ZD 4J8WA 3O62B 3AZIA 5AV8A 4CAYA 4J8WB 1EQZC 3AZKC 3AZIB 4CAYB 3WKJC 5CP6D 1F66A 4J8XD 3EG5B 4WU8C 1F66B 5B33D 1EQZA 3AZKA 3MNND 5B2JD 1W2EA 1EQZB 5B24C 3X1UD 2W8SA 3AZKB 5B31A 4WU8A 5B31B 4WU8B 4XUJD 3MGQC 5B24A 3WAAB 1B6WA 5AVCC 1TZYC 2IO5B 5B0ZC 1P3MC 5B24B 3MGRD 1M18D 3MGQA 3W96A 1N1JA 5KDMA 5CP6C 3MGQB 5B0ZA 1P3KC 3W99A 1N1JB 3B0CT 3W96B 5KDMB 4R8PD 5B0ZB 3W99B 5B33C 3LZ0D 3MNNC 4H9SC 3X1UC 4UPKA 2G5HC 2Y2HA 4J8XA 2XD1A 2Y2MA 3KSYA 5B33A 4J8XB 1S32D 3MNNA 4XUJC 4H9SA 5B2JA 5B33B 1ID3C 3X1UA 2BYKB 3MNNB 5B2JB 4G92B 1M18C 5AV9C 1M1AD 4XUJA 3MGRA 1ZLAD 1M18A 5JA4A 4KUDD 5BNXA 3MGRB 3LZ0C 1M18B 5JA4B 5BNXB 4R8PA 3REIB 5B32C 4J8UD 1P3AD 3LZ0A 4R8PB 3LZ0B 1S32A 3AV2D 1M1AC 3TU4D 1H3OA 3RELD 1S32B 4KHAA 3VH5W 5BS7A 3C1CC 1H3OB 4KHAB 1ZLAC 1WWIA 2DQNC 1KX5D 4NFTA 4KUDC 1KU5A 3H0LC 4Z66D 5DNNC 4H9OA 1ZLAA 4ZUXD 4KUDA 5F99B 4J8UC 1P3AC 1ZLAB 1P3PD 3VH6A 3X1VD 3A6ND 3KFUG 2NZDD 2F2AC 3MVDD 4J8UA 1P3AA 2HIOA 1P3FC 2JE5A 2VQRA 3AV2C 5B1LB 4M6BA 5GXQD 2HIOB 1P3AB 4EO5C 5AV6C 5GT0D 3UTBC 4H9PA 1M19D 3KWQD 4WU9D 1BH8A 4H9PB 1B67A 3AV2A 3TU4A 1P3GA 3RELA 5B2IA 4Z66C 1PZRA 5B32G 3TU4B 1P3GB 4EO5B 5B2IB 3RELB 5CPJD 4ZUXC 5GT3C 1KX5A 4KGCD 5FUGA 4HGAC 1KX3D 1P3PC 3AV1D 1KX5B 4Z66A 4WV4B 5FUGB 3A6NC 3MGPD 2NZDC 4Z66B 4ZUXA 2HUEC 4ZUXB 1P3PA 4YS3B 5GXQC 3KXBD 3KUYD 2PYOA 2LY8A 3X1VA 5GT0C 2CV5D 3WKJD 2NZDA 2PYOB 3X1VB 1BH8B 3MVDA 3KWQC 5DNMD 5BNVA 4WU9C 2NZDB 3MVDB 5BNVB 5GT0A 1P3LC 1M19A 5GSUD 3LZ1D 3KWQA 4WU9A 3MGSD 5CPJC 2BYMB 4KGCC 1M19B 4WU9B 3W97C 4G91C 1KX3C 5AVCD 3MGPC 2ZY4A 3X1TD 3UTAA 4E45A 1P3MD 1KX4D 5CHLB 3UTAB 3REKD 1KX3A 3AV1A 3KXBC 3KUYC 5AV8B 4YM6D 4G91B 3MGPA 2CV5C 3AV1B 1P3KD 2ZY3A 5DNMC 3AYWD 3KUYA 3AFAC 2Y2JA 2CV5A 3WKJA 3KUYB 2F8NH 1U35C 5GSUC 3LZ1C 2CV5B 5DNMA 3MGSC 3WKJB 3AZHC 2Y2NA 1ID3D 3NQJA 3X1TC 5GSUA 1KX4C 3NQJB 3MGSA 3R45A 3REKC 5AV9D 3R45B 5AVCA 1TZYA 4YM6C 3X1TA 1P3MA 5AVCB 1TZYB 3X1TB 1P3MB 3V9RA 5AVBC 3AYWC 3WTPE 2Y2IA 4H9NA 4YM6A 3V9RB 4NE5A 5CP6A 3UT9D 1P3KA 4H9NB 4YM6B 5CP6B 1P3KB 3NQUA 1P3IC 5B32D 4Z5TD 3AYWA 3NQUB 3AYWB 5G49A 1R4VA 3X1UB 5G49B 3VH5T 3C1BC 1ID3A 4WNNA 4XUJB 4QLCD 1ID3B 3C1CD 2FJ7D 4WNNB 3LJAC 4Z2MH 5AV9A 4JJND 2F8NK 1HQ3D 1AOIC 3VH6W 5AV9B 1WWSA 3UT9C 3AZGC 3AZFD 5DNND 3AZJD 5B1MD 4Z5TC 3B6GC 4WJ3C 1P34D 3H0MC 3W98D 5AY8D 5B32A 4Z5TA 1P3FD 3P5JB 5B32B 4Z5TB 2YFWA 5AV6D 3B6FD 4QLCC 3UTBD 2FJ7C 2YFWB 5JRGD 1M1AA 4JJNC 1HQ3C 4UUZA 1M1AB 4E44A 4QLCA 2FJ7A 3C1CA 3AZFC 4UUZB 3AZJC 5B1MC 4QLCB 4Z2MG 3C1CB 5GT3D 2RIQA 4H9OB 1A7WA 1HQ3A 2UWXA 4KUDB 1P34C 5DNNA 3AZJA 5B1MA 3W98C 5AY8C 5DNNB 5B40C 3AZJB 3WA9D 4J8UB 4DQYB 1P34A 4H9RA 3B6FC 3X1SD 3W98A 5AY8A 1P34B 4H9RB 1BH9A 5JRGC 1P3FA 3W98B 2L5AA 1BH9B 1P3FB 5AV6A 3AV2B 3B6FA 3UTBA 1P3LD 5AV6B 4NE3A 5JRGA 3B6FB 5CPIC 3UTBB 5C3IC 3W97D 4X23D 1JFIA 5GT3A 5E5AC 1JFIB 3WA9C 2YFVA 3AL0C 5GT3B 5C3IB 2YFVB 3WTPD 4HGAB 3A6NA 4J8VD 1P3PB 3X1SC 3AN2D 1TAFA 4CSRA 3A6NB 3WA9A 2HUEB 1TAFB 4CSRB 5GXQA 3AFAD 4H9QA 5GXQB 3X1SA 4DRBA 3O62D 2AROD 1U35D 4NE6A 5GT0B 4H9QB 3X1SB 3AZHD 3KWQB 5BT1D 1HTAA 3B0DC 4X23C 3AZND 1P3LA 1Z2CB 5CPJA 4KGCA 1P3LB 5CPJB 3W97A 4KGCB 4X23A 3WTPC 4J8VC 1KX3B 3W97B 3AN2C 4X23B 3MGPB 5AVBD 3WAAD 2Y2LA 3KXBA 3WTPA 4J8VA 3KXBB 3AN2A 3O62C 2AROC 2JCHA 4J8VB 1P3ID 2Y2PA 4J8WC 3AN2B 1P3OD 3AZIC 1BFMA 5DNMB 3AFAA 5BT1C 3AFAB 2AROA 3AZNC 1U35A 2Y2OA 4WZSB 3LZ1A 1Q9CA 1F66C 3AZHA 2AROB 1U35B 5GSUB 3LZ1B 3MGSB 2Y2GA 3C1BD 3AZHB 3A1IA 4LD9D 1P3BD 3AZNA 1KX4A 5B0YD 3FDDA 3AZNB 3EPLA 3VH6T 5B31C 3LJAD 3REKA 1KX4B 3WAAC 2ZM5A 3REKB 2IO5C 1AOID 3REHD 3AZGD 3AZMD 3EPJA 5AVBA 1P3OC 3B6GD 3WAAA 3W96C 5AVBB 2F8NG 3W99C 1P3IA 1P3OA 1P3IB 1P3OB 3AZLD 4DRAA 1P3BC 4LD9C 3REID 5B0YC 4J8XC 2DF4C 3F6TA 3C1BA 3REJD 2CWEA 2Y2KA 4LD9A 5B2JC 1P3BA 3REHC 3C1BB 3AZMC 1F1EA 4G92C 5CPKD 5B0YA 2NQBD 1P3BB 4LD9B 1T3UA 3LJAA 5B0YB 2ZY2A 2BYKA 3LJAB 1AOIA 3REHA 3UT9A 3AZGA 3AZMA 3B0BA 1AOIB 2ZY5A 3REHB 3UT9B 3AZGB 3AZMB 3MGRC 5B40D 3B6GA 3B6GB 3AZLC 3EPKA 5B31G 3LELD 3REIC 5F99D 4R8PC 3B0CW 3REJC 3AZLA 3IP4C 3REIA 5CPKC 3AZLB 2NQBC 5CPID 2FJ7B 5B1LD 2HIOD 4JJNA 3REJA 1S32C 4JJNB 3REJB 1HQ3B 3AZFA 5CPKA 2NQBA 5BS7C 3AZFB 5CPKB 5E5AD 2NQBB 5B1MB 2JSSA 1P3GD 5B2ID 3LELC 4ZBJC 5F99C 5B40A 2Y2QA 2XD5A 5AY8B 5B40B 4AWLC 3LELA 5F99A 3LELB 4ZBJB 5B1LC 4YS3D 2HIOC 3AZED 5JRGB 2PYOD 5BO0A 4AWLB 3EPHA 5CPIA 5B1LA 5BO0B 2F8ND 5CPIB 3A1KA 3TU4C 3RELC 5B2IC 4XZQD 1P3GC 2BG1A 5AV5D 2RVQD 5E5AA 1KX5C 5E5AB 3WA9B 3UTAD 3VH5A 2J8PA 4J8WD 4YS3C 3AZEC 3AZID 5AV8D 2PYOC 3X1VC 1F66D 3MVDC 4YS3A 2FFFB 3AZEA 3H0RC 1EQZD 3AZKD 3AZEB 4XZQC
chains in the Genus database with same CATH topology
5AV5C 1M19C 3B0DB 2RVQC 2F8NA 5B31D 4WU8D 2G5IC 2F8NB 4XZQA 5B24D 5AV5A 2BYMA 4XZQB 3UTAC 3WTPB 5AV5B 5AV8C 3MGQD 3AV1C 3W96D 1ULYA 1TZYD 3O62A 3W99D 5B0ZD 4J8WA 3O62B 3AZIA 5AV8A 4CAYA 4J8WB 1EQZC 3AZKC 3AZIB 4CAYB 3WKJC 5CP6D 1F66A 4J8XD 3EG5B 4WU8C 1F66B 5B33D 1EQZA 3AZKA 3MNND 5B2JD 1W2EA 1EQZB 5B24C 3X1UD 2W8SA 3AZKB 5B31A 4WU8A 5B31B 4WU8B 4XUJD 3MGQC 5B24A 3WAAB 1B6WA 5AVCC 1TZYC 2IO5B 5B0ZC 1P3MC 5B24B 3MGRD 1M18D 3MGQA 3W96A 1N1JA 5KDMA 5CP6C 3MGQB 5B0ZA 1P3KC 3W99A 1N1JB 3B0CT 3W96B 5KDMB 4R8PD 5B0ZB 3W99B 5B33C 3LZ0D 3MNNC 4H9SC 3X1UC 4UPKA 2G5HC 2Y2HA 4J8XA 2XD1A 2Y2MA 3KSYA 5B33A 4J8XB 1S32D 3MNNA 4XUJC 4H9SA 5B2JA 5B33B 1ID3C 3X1UA 2BYKB 3MNNB 5B2JB 4G92B 1M18C 5AV9C 1M1AD 4XUJA 3MGRA 1ZLAD 1M18A 5JA4A 4KUDD 5BNXA 3MGRB 3LZ0C 1M18B 5JA4B 5BNXB 4R8PA 3REIB 5B32C 4J8UD 1P3AD 3LZ0A 4R8PB 3LZ0B 1S32A 3AV2D 1M1AC 3TU4D 1H3OA 3RELD 1S32B 4KHAA 3VH5W 5BS7A 3C1CC 1H3OB 4KHAB 1ZLAC 1WWIA 2DQNC 1KX5D 4NFTA 4KUDC 1KU5A 3H0LC 4Z66D 5DNNC 4H9OA 1ZLAA 4ZUXD 4KUDA 5F99B 4J8UC 1P3AC 1ZLAB 1P3PD 3VH6A 3X1VD 3A6ND 3KFUG 2NZDD 2F2AC 3MVDD 4J8UA 1P3AA 2HIOA 1P3FC 2JE5A 2VQRA 3AV2C 5B1LB 4M6BA 5GXQD 2HIOB 1P3AB 4EO5C 5AV6C 5GT0D 3UTBC 4H9PA 1M19D 3KWQD 4WU9D 1BH8A 4H9PB 1B67A 3AV2A 3TU4A 1P3GA 3RELA 5B2IA 4Z66C 1PZRA 5B32G 3TU4B 1P3GB 4EO5B 5B2IB 3RELB 5CPJD 4ZUXC 5GT3C 1KX5A 4KGCD 5FUGA 4HGAC 1KX3D 1P3PC 3AV1D 1KX5B 4Z66A 4WV4B 5FUGB 3A6NC 3MGPD 2NZDC 4Z66B 4ZUXA 2HUEC 4ZUXB 1P3PA 4YS3B 5GXQC 3KXBD 3KUYD 2PYOA 2LY8A 3X1VA 5GT0C 2CV5D 3WKJD 2NZDA 2PYOB 3X1VB 1BH8B 3MVDA 3KWQC 5DNMD 5BNVA 4WU9C 2NZDB 3MVDB 5BNVB 5GT0A 1P3LC 1M19A 5GSUD 3LZ1D 3KWQA 4WU9A 3MGSD 5CPJC 2BYMB 4KGCC 1M19B 4WU9B 3W97C 4G91C 1KX3C 5AVCD 3MGPC 2ZY4A 3X1TD 3UTAA 4E45A 1P3MD 1KX4D 5CHLB 3UTAB 3REKD 1KX3A 3AV1A 3KXBC 3KUYC 5AV8B 4YM6D 4G91B 3MGPA 2CV5C 3AV1B 1P3KD 2ZY3A 5DNMC 3AYWD 3KUYA 3AFAC 2Y2JA 2CV5A 3WKJA 3KUYB 2F8NH 1U35C 5GSUC 3LZ1C 2CV5B 5DNMA 3MGSC 3WKJB 3AZHC 2Y2NA 1ID3D 3NQJA 3X1TC 5GSUA 1KX4C 3NQJB 3MGSA 3R45A 3REKC 5AV9D 3R45B 5AVCA 1TZYA 4YM6C 3X1TA 1P3MA 5AVCB 1TZYB 3X1TB 1P3MB 3V9RA 5AVBC 3AYWC 3WTPE 2Y2IA 4H9NA 4YM6A 3V9RB 4NE5A 5CP6A 3UT9D 1P3KA 4H9NB 4YM6B 5CP6B 1P3KB 3NQUA 1P3IC 5B32D 4Z5TD 3AYWA 3NQUB 3AYWB 5G49A 1R4VA 3X1UB 5G49B 3VH5T 3C1BC 1ID3A 4WNNA 4XUJB 4QLCD 1ID3B 3C1CD 2FJ7D 4WNNB 3LJAC 4Z2MH 5AV9A 4JJND 2F8NK 1HQ3D 1AOIC 3VH6W 5AV9B 1WWSA 3UT9C 3AZGC 3AZFD 5DNND 3AZJD 5B1MD 4Z5TC 3B6GC 4WJ3C 1P34D 3H0MC 3W98D 5AY8D 5B32A 4Z5TA 1P3FD 3P5JB 5B32B 4Z5TB 2YFWA 5AV6D 3B6FD 4QLCC 3UTBD 2FJ7C 2YFWB 5JRGD 1M1AA 4JJNC 1HQ3C 4UUZA 1M1AB 4E44A 4QLCA 2FJ7A 3C1CA 3AZFC 4UUZB 3AZJC 5B1MC 4QLCB 4Z2MG 3C1CB 5GT3D 2RIQA 4H9OB 1A7WA 1HQ3A 2UWXA 4KUDB 1P34C 5DNNA 3AZJA 5B1MA 3W98C 5AY8C 5DNNB 5B40C 3AZJB 3WA9D 4J8UB 4DQYB 1P34A 4H9RA 3B6FC 3X1SD 3W98A 5AY8A 1P34B 4H9RB 1BH9A 5JRGC 1P3FA 3W98B 2L5AA 1BH9B 1P3FB 5AV6A 3AV2B 3B6FA 3UTBA 1P3LD 5AV6B 4NE3A 5JRGA 3B6FB 5CPIC 3UTBB 5C3IC 3W97D 4X23D 1JFIA 5GT3A 5E5AC 1JFIB 3WA9C 2YFVA 3AL0C 5GT3B 5C3IB 2YFVB 3WTPD 4HGAB 3A6NA 4J8VD 1P3PB 3X1SC 3AN2D 1TAFA 4CSRA 3A6NB 3WA9A 2HUEB 1TAFB 4CSRB 5GXQA 3AFAD 4H9QA 5GXQB 3X1SA 4DRBA 3O62D 2AROD 1U35D 4NE6A 5GT0B 4H9QB 3X1SB 3AZHD 3KWQB 5BT1D 1HTAA 3B0DC 4X23C 3AZND 1P3LA 1Z2CB 5CPJA 4KGCA 1P3LB 5CPJB 3W97A 4KGCB 4X23A 3WTPC 4J8VC 1KX3B 3W97B 3AN2C 4X23B 3MGPB 5AVBD 3WAAD 2Y2LA 3KXBA 3WTPA 4J8VA 3KXBB 3AN2A 3O62C 2AROC 2JCHA 4J8VB 1P3ID 2Y2PA 4J8WC 3AN2B 1P3OD 3AZIC 1BFMA 5DNMB 3AFAA 5BT1C 3AFAB 2AROA 3AZNC 1U35A 2Y2OA 4WZSB 3LZ1A 1Q9CA 1F66C 3AZHA 2AROB 1U35B 5GSUB 3LZ1B 3MGSB 2Y2GA 3C1BD 3AZHB 3A1IA 4LD9D 1P3BD 3AZNA 1KX4A 5B0YD 3FDDA 3AZNB 3EPLA 3VH6T 5B31C 3LJAD 3REKA 1KX4B 3WAAC 2ZM5A 3REKB 2IO5C 1AOID 3REHD 3AZGD 3AZMD 3EPJA 5AVBA 1P3OC 3B6GD 3WAAA 3W96C 5AVBB 2F8NG 3W99C 1P3IA 1P3OA 1P3IB 1P3OB 3AZLD 4DRAA 1P3BC 4LD9C 3REID 5B0YC 4J8XC 2DF4C 3F6TA 3C1BA 3REJD 2CWEA 2Y2KA 4LD9A 5B2JC 1P3BA 3REHC 3C1BB 3AZMC 1F1EA 4G92C 5CPKD 5B0YA 2NQBD 1P3BB 4LD9B 1T3UA 3LJAA 5B0YB 2ZY2A 2BYKA 3LJAB 1AOIA 3REHA 3UT9A 3AZGA 3AZMA 3B0BA 1AOIB 2ZY5A 3REHB 3UT9B 3AZGB 3AZMB 3MGRC 5B40D 3B6GA 3B6GB 3AZLC 3EPKA 5B31G 3LELD 3REIC 5F99D 4R8PC 3B0CW 3REJC 3AZLA 3IP4C 3REIA 5CPKC 3AZLB 2NQBC 5CPID 2FJ7B 5B1LD 2HIOD 4JJNA 3REJA 1S32C 4JJNB 3REJB 1HQ3B 3AZFA 5CPKA 2NQBA 5BS7C 3AZFB 5CPKB 5E5AD 2NQBB 5B1MB 2JSSA 1P3GD 5B2ID 3LELC 4ZBJC 5F99C 5B40A 2Y2QA 2XD5A 5AY8B 5B40B 4AWLC 3LELA 5F99A 3LELB 4ZBJB 5B1LC 4YS3D 2HIOC 3AZED 5JRGB 2PYOD 5BO0A 4AWLB 3EPHA 5CPIA 5B1LA 5BO0B 2F8ND 5CPIB 3A1KA 3TU4C 3RELC 5B2IC 4XZQD 1P3GC 2BG1A 5AV5D 2RVQD 5E5AA 1KX5C 5E5AB 3WA9B 3UTAD 3VH5A 2J8PA 4J8WD 4YS3C 3AZEC 3AZID 5AV8D 2PYOC 3X1VC 1F66D 3MVDC 4YS3A 2FFFB 3AZEA 3H0RC 1EQZD 3AZKD 3AZEB 4XZQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 C;  1M19 C;  3B0D B;  2RVQ C;  2F8N A;  5B31 D;  4WU8 D;  2F8N B;  4XZQ A;  5B24 D;  5AV5 A;  2BYM A;  4XZQ B;  3UTA C;  3WTP B;  5AV5 B;  5AV8 C;  3MGQ D;  3AV1 C;  3W96 D;  1ULY A;  1TZY D;  3O62 A;  3W99 D;  5B0Z D;  4J8W A;  3O62 B;  3AZI A;  5AV8 A;  4CAY A;  4J8W B;  1EQZ C;  3AZK C;  3AZI B;  4CAY B;  3WKJ C;  5CP6 D;  1F66 A;  4J8X D;  4WU8 C;  1F66 B;  5B33 D;  1EQZ A;  3AZK A;  3MNN D;  5B2J D;  1EQZ B;  5B24 C;  3X1U D;  3AZK B;  5B31 A;  4WU8 A;  5B31 B;  4WU8 B;  4XUJ D;  3MGQ C;  5B24 A;  3WAA B;  1B6W A;  5AVC C;  1TZY C;  2IO5 B;  5B0Z C;  1P3M C;  5B24 B;  3MGR D;  1M18 D;  3MGQ A;  3W96 A;  1N1J A;  5KDM A;  5CP6 C;  3MGQ B;  5B0Z A;  1P3K C;  3W99 A;  1N1J B;  3B0C T;  3W96 B;  5KDM B;  4R8P D;  5B0Z B;  3W99 B;  5B33 C;  3LZ0 D;  3MNN C;  4H9S C;  3X1U C;  4J8X A;  3KSY A;  5B33 A;  4J8X B;  1S32 D;  3MNN A;  4XUJ C;  4H9S A;  5B2J A;  5B33 B;  1ID3 C;  3X1U A;  2BYK B;  3MNN B;  5B2J B;  4G92 B;  1M18 C;  5AV9 C;  1M1A D;  4XUJ A;  3MGR A;  1ZLA D;  1M18 A;  5JA4 A;  4KUD D;  5BNX A;  3MGR B;  3LZ0 C;  1M18 B;  5JA4 B;  5BNX B;  4R8P A;  3REI B;  5B32 C;  4J8U D;  1P3A D;  3LZ0 A;  4R8P B;  3LZ0 B;  1S32 A;  3AV2 D;  1M1A C;  3TU4 D;  1H3O A;  3REL D;  1S32 B;  4KHA A;  3VH5 W;  5BS7 A;  3C1C C;  1H3O B;  4KHA B;  1ZLA C;  1WWI A;  1KX5 D;  4KUD C;  4NFT A;  1KU5 A;  4Z66 D;  5DNN C;  4H9O A;  1ZLA A;  4ZUX D;  4KUD A;  5F99 B;  4J8U C;  1P3A C;  1ZLA B;  1P3P D;  3VH6 A;  3X1V D;  3A6N D;  2NZD D;  3MVD D;  4J8U A;  1P3A A;  2HIO A;  1P3F C;  3AV2 C;  5B1L B;  4M6B A;  5GXQ D;  2HIO B;  1P3A B;  4EO5 C;  5AV6 C;  5GT0 D;  3UTB C;  4H9P A;  1M19 D;  3KWQ D;  4WU9 D;  1BH8 A;  4H9P B;  1B67 A;  3AV2 A;  3TU4 A;  1P3G A;  3REL A;  5B2I A;  4Z66 C;  5B32 G;  3TU4 B;  1P3G B;  4EO5 B;  5B2I B;  3REL B;  5CPJ D;  4ZUX C;  5GT3 C;  1KX5 A;  4KGC D;  5FUG A;  4HGA C;  1KX3 D;  1P3P C;  3AV1 D;  1KX5 B;  4Z66 A;  4WV4 B;  5FUG B;  3A6N C;  3MGP D;  2NZD C;  4Z66 B;  4ZUX A;  2HUE C;  4ZUX B;  1P3P A;  4YS3 B;  5GXQ C;  3KXB D;  3KUY D;  2PYO A;  2LY8 A;  3X1V A;  5GT0 C;  2CV5 D;  3WKJ D;  2NZD A;  2PYO B;  3X1V B;  1BH8 B;  3MVD A;  3KWQ C;  5DNM D;  5BNV A;  4WU9 C;  2NZD B;  3MVD B;  5BNV B;  5GT0 A;  1P3L C;  1M19 A;  5GSU D;  3LZ1 D;  3KWQ A;  4WU9 A;  3MGS D;  5CPJ C;  2BYM B;  4KGC C;  1M19 B;  4WU9 B;  3W97 C;  4G91 C;  1KX3 C;  5AVC D;  3MGP C;  3X1T D;  3UTA A;  4E45 A;  1P3M D;  1KX4 D;  5CHL B;  3UTA B;  3REK D;  1KX3 A;  3AV1 A;  3KXB C;  3KUY C;  5AV8 B;  4YM6 D;  4G91 B;  3MGP A;  2CV5 C;  3AV1 B;  1P3K D;  5DNM C;  3AYW D;  3KUY A;  3AFA C;  2CV5 A;  3WKJ A;  3KUY B;  2F8N H;  1U35 C;  5GSU C;  3LZ1 C;  2CV5 B;  5DNM A;  3MGS C;  3WKJ B;  3AZH C;  1ID3 D;  3NQJ A;  3X1T C;  5GSU A;  1KX4 C;  3NQJ B;  3MGS A;  3R45 A;  3REK C;  5AV9 D;  3R45 B;  5AVC A;  1TZY A;  4YM6 C;  3X1T A;  1P3M A;  5AVC B;  1TZY B;  3X1T B;  1P3M B;  3V9R A;  5AVB C;  3AYW C;  3WTP E;  4H9N A;  4YM6 A;  3V9R B;  4NE5 A;  5CP6 A;  3UT9 D;  1P3K A;  4H9N B;  4YM6 B;  5CP6 B;  1P3K B;  3NQU A;  1P3I C;  5B32 D;  4Z5T D;  3AYW A;  3NQU B;  3AYW B;  5G49 A;  1R4V A;  3X1U B;  5G49 B;  3VH5 T;  3C1B C;  1ID3 A;  4WNN A;  4XUJ B;  4QLC D;  1ID3 B;  3C1C D;  2FJ7 D;  4WNN B;  3LJA C;  4Z2M H;  5AV9 A;  4JJN D;  2F8N K;  1HQ3 D;  1AOI C;  3VH6 W;  5AV9 B;  1WWS A;  3UT9 C;  3AZG C;  3AZF D;  5DNN D;  3AZJ D;  5B1M D;  4Z5T C;  3B6G C;  1P34 D;  3W98 D;  5AY8 D;  5B32 A;  4Z5T A;  1P3F D;  5B32 B;  4Z5T B;  2YFW A;  5AV6 D;  3B6F D;  4QLC C;  3UTB D;  2FJ7 C;  2YFW B;  5JRG D;  1M1A A;  4JJN C;  1HQ3 C;  4UUZ A;  1M1A B;  4E44 A;  4QLC A;  2FJ7 A;  3C1C A;  3AZF C;  4UUZ B;  3AZJ C;  5B1M C;  4QLC B;  4Z2M G;  3C1C B;  5GT3 D;  4H9O B;  1A7W A;  1HQ3 A;  4KUD B;  1P34 C;  5DNN A;  3AZJ A;  5B1M A;  3W98 C;  5AY8 C;  5DNN B;  5B40 C;  3AZJ B;  3WA9 D;  4J8U B;  1P34 A;  4H9R A;  3B6F C;  3X1S D;  3W98 A;  5AY8 A;  1P34 B;  4H9R B;  1BH9 A;  5JRG C;  1P3F A;  3W98 B;  2L5A A;  1BH9 B;  1P3F B;  5AV6 A;  3AV2 B;  3B6F A;  3UTB A;  1P3L D;  5AV6 B;  4NE3 A;  5JRG A;  3B6F B;  5CPI C;  3UTB B;  5C3I C;  3W97 D;  4X23 D;  1JFI A;  5GT3 A;  5E5A C;  1JFI B;  3WA9 C;  2YFV A;  5GT3 B;  5C3I B;  2YFV B;  3WTP D;  4HGA B;  3A6N A;  4J8V D;  1P3P B;  3X1S C;  3AN2 D;  1TAF A;  4CSR A;  3A6N B;  3WA9 A;  2HUE B;  1TAF B;  4CSR B;  5GXQ A;  3AFA D;  4H9Q A;  5GXQ B;  3X1S A;  4DRB A;  3O62 D;  2ARO D;  1U35 D;  4NE6 A;  5GT0 B;  4H9Q B;  3X1S B;  3AZH D;  3KWQ B;  5BT1 D;  1HTA A;  3B0D C;  4X23 C;  3AZN D;  1P3L A;  5CPJ A;  4KGC A;  1P3L B;  5CPJ B;  3W97 A;  4KGC B;  4X23 A;  3WTP C;  4J8V C;  1KX3 B;  3W97 B;  3AN2 C;  4X23 B;  3MGP B;  5AVB D;  3WAA D;  3KXB A;  3WTP A;  4J8V A;  3KXB B;  3AN2 A;  3O62 C;  2ARO C;  4J8V B;  1P3I D;  4J8W C;  3AN2 B;  1P3O D;  3AZI C;  1BFM A;  5DNM B;  3AFA A;  5BT1 C;  3AFA B;  2ARO A;  3AZN C;  1U35 A;  3LZ1 A;  4WZS B;  1F66 C;  1Q9C A;  3AZH A;  2ARO B;  1U35 B;  5GSU B;  3LZ1 B;  3MGS B;  3C1B D;  3AZH B;  4LD9 D;  1P3B D;  3AZN A;  1KX4 A;  5B0Y D;  3AZN B;  3VH6 T;  5B31 C;  3LJA D;  3REK A;  1KX4 B;  3WAA C;  3REK B;  2IO5 C;  1AOI D;  3REH D;  3AZG D;  3AZM D;  5AVB A;  1P3O C;  3B6G D;  3WAA A;  3W96 C;  5AVB B;  2F8N G;  3W99 C;  1P3I A;  1P3O A;  1P3I B;  1P3O B;  3AZL D;  4DRA A;  1P3B C;  4LD9 C;  3REI D;  5B0Y C;  4J8X C;  3C1B A;  3REJ D;  2CWE A;  4LD9 A;  5B2J C;  1P3B A;  3REH C;  3C1B B;  3AZM C;  1F1E A;  4G92 C;  5CPK D;  5B0Y A;  2NQB D;  1P3B B;  4LD9 B;  3LJA A;  5B0Y B;  2BYK A;  3LJA B;  1AOI A;  3REH A;  3UT9 A;  3AZG A;  3AZM A;  3B0B A;  1AOI B;  3REH B;  3UT9 B;  3AZG B;  3AZM B;  3MGR C;  5B40 D;  3B6G A;  3B6G B;  3AZL C;  5B31 G;  3LEL D;  3REI C;  5F99 D;  4R8P C;  3B0C W;  3REJ C;  3AZL A;  3REI A;  5CPK C;  3AZL B;  2NQB C;  5CPI D;  2FJ7 B;  5B1L D;  2HIO D;  4JJN A;  3REJ A;  1S32 C;  4JJN B;  3REJ B;  1HQ3 B;  3AZF A;  5CPK A;  2NQB A;  5BS7 C;  3AZF B;  5CPK B;  5E5A D;  2NQB B;  5B1M B;  2JSS A;  1P3G D;  5B2I D;  3LEL C;  4ZBJ C;  5F99 C;  5B40 A;  5AY8 B;  5B40 B;  4AWL C;  3LEL A;  5F99 A;  3LEL B;  4ZBJ B;  5B1L C;  4YS3 D;  2HIO C;  3AZE D;  5JRG B;  2PYO D;  5BO0 A;  4AWL B;  5CPI A;  5B1L A;  5BO0 B;  2F8N D;  5CPI B;  3TU4 C;  1P3G C;  3REL C;  5B2I C;  4XZQ D;  5AV5 D;  2RVQ D;  5E5A A;  1KX5 C;  5E5A B;  3WA9 B;  3UTA D;  3VH5 A;  4J8W D;  4YS3 C;  3AZE C;  3AZI D;  5AV8 D;  2PYO C;  3X1V C;  1F66 D;  3MVD C;  4YS3 A;  3AZE A;  1EQZ D;  3AZK D;  3AZE B;  4XZQ C; 
#chains in the Genus database with same CATH topology
 5AV5 C;  1M19 C;  3B0D B;  2RVQ C;  2F8N A;  5B31 D;  4WU8 D;  2G5I C;  2F8N B;  4XZQ A;  5B24 D;  5AV5 A;  2BYM A;  4XZQ B;  3UTA C;  3WTP B;  5AV5 B;  5AV8 C;  3MGQ D;  3AV1 C;  3W96 D;  1ULY A;  1TZY D;  3O62 A;  3W99 D;  5B0Z D;  4J8W A;  3O62 B;  3AZI A;  5AV8 A;  4CAY A;  4J8W B;  1EQZ C;  3AZK C;  3AZI B;  4CAY B;  3WKJ C;  5CP6 D;  1F66 A;  4J8X D;  3EG5 B;  4WU8 C;  1F66 B;  5B33 D;  1EQZ A;  3AZK A;  3MNN D;  5B2J D;  1W2E A;  1EQZ B;  5B24 C;  3X1U D;  2W8S A;  3AZK B;  5B31 A;  4WU8 A;  5B31 B;  4WU8 B;  4XUJ D;  3MGQ C;  5B24 A;  3WAA B;  1B6W A;  5AVC C;  1TZY C;  2IO5 B;  5B0Z C;  1P3M C;  5B24 B;  3MGR D;  1M18 D;  3MGQ A;  3W96 A;  1N1J A;  5KDM A;  5CP6 C;  3MGQ B;  5B0Z A;  1P3K C;  3W99 A;  1N1J B;  3B0C T;  3W96 B;  5KDM B;  4R8P D;  5B0Z B;  3W99 B;  5B33 C;  3LZ0 D;  3MNN C;  4H9S C;  3X1U C;  4UPK A;  2G5H C;  2Y2H A;  4J8X A;  2XD1 A;  2Y2M A;  3KSY A;  5B33 A;  4J8X B;  1S32 D;  3MNN A;  4XUJ C;  4H9S A;  5B2J A;  5B33 B;  1ID3 C;  3X1U A;  2BYK B;  3MNN B;  5B2J B;  4G92 B;  1M18 C;  5AV9 C;  1M1A D;  4XUJ A;  3MGR A;  1ZLA D;  1M18 A;  5JA4 A;  4KUD D;  5BNX A;  3MGR B;  3LZ0 C;  1M18 B;  5JA4 B;  5BNX B;  4R8P A;  3REI B;  5B32 C;  4J8U D;  1P3A D;  3LZ0 A;  4R8P B;  3LZ0 B;  1S32 A;  3AV2 D;  1M1A C;  3TU4 D;  1H3O A;  3REL D;  1S32 B;  4KHA A;  3VH5 W;  5BS7 A;  3C1C C;  1H3O B;  4KHA B;  1ZLA C;  1WWI A;  2DQN C;  1KX5 D;  4NFT A;  4KUD C;  1KU5 A;  3H0L C;  4Z66 D;  5DNN C;  4H9O A;  1ZLA A;  4ZUX D;  4KUD A;  5F99 B;  4J8U C;  1P3A C;  1ZLA B;  1P3P D;  3VH6 A;  3X1V D;  3A6N D;  3KFU G;  2NZD D;  2F2A C;  3MVD D;  4J8U A;  1P3A A;  2HIO A;  1P3F C;  2JE5 A;  2VQR A;  3AV2 C;  5B1L B;  4M6B A;  5GXQ D;  2HIO B;  1P3A B;  4EO5 C;  5AV6 C;  5GT0 D;  3UTB C;  4H9P A;  1M19 D;  3KWQ D;  4WU9 D;  1BH8 A;  4H9P B;  1B67 A;  3AV2 A;  3TU4 A;  1P3G A;  3REL A;  5B2I A;  4Z66 C;  1PZR A;  5B32 G;  3TU4 B;  1P3G B;  4EO5 B;  5B2I B;  3REL B;  5CPJ D;  4ZUX C;  5GT3 C;  1KX5 A;  4KGC D;  5FUG A;  4HGA C;  1KX3 D;  1P3P C;  3AV1 D;  1KX5 B;  4Z66 A;  4WV4 B;  5FUG B;  3A6N C;  3MGP D;  2NZD C;  4Z66 B;  4ZUX A;  2HUE C;  4ZUX B;  1P3P A;  4YS3 B;  5GXQ C;  3KXB D;  3KUY D;  2PYO A;  2LY8 A;  3X1V A;  5GT0 C;  2CV5 D;  3WKJ D;  2NZD A;  2PYO B;  3X1V B;  1BH8 B;  3MVD A;  3KWQ C;  5DNM D;  5BNV A;  4WU9 C;  2NZD B;  3MVD B;  5BNV B;  5GT0 A;  1P3L C;  1M19 A;  5GSU D;  3LZ1 D;  3KWQ A;  4WU9 A;  3MGS D;  5CPJ C;  2BYM B;  4KGC C;  1M19 B;  4WU9 B;  3W97 C;  4G91 C;  1KX3 C;  5AVC D;  3MGP C;  2ZY4 A;  3X1T D;  3UTA A;  4E45 A;  1P3M D;  1KX4 D;  5CHL B;  3UTA B;  3REK D;  1KX3 A;  3AV1 A;  3KXB C;  3KUY C;  5AV8 B;  4YM6 D;  4G91 B;  3MGP A;  2CV5 C;  3AV1 B;  1P3K D;  2ZY3 A;  5DNM C;  3AYW D;  3KUY A;  3AFA C;  2Y2J A;  2CV5 A;  3WKJ A;  3KUY B;  2F8N H;  1U35 C;  5GSU C;  3LZ1 C;  2CV5 B;  5DNM A;  3MGS C;  3WKJ B;  3AZH C;  2Y2N A;  1ID3 D;  3NQJ A;  3X1T C;  5GSU A;  1KX4 C;  3NQJ B;  3MGS A;  3R45 A;  3REK C;  5AV9 D;  3R45 B;  5AVC A;  1TZY A;  4YM6 C;  3X1T A;  1P3M A;  5AVC B;  1TZY B;  3X1T B;  1P3M B;  3V9R A;  5AVB C;  3AYW C;  3WTP E;  2Y2I A;  4H9N A;  4YM6 A;  3V9R B;  4NE5 A;  5CP6 A;  3UT9 D;  1P3K A;  4H9N B;  4YM6 B;  5CP6 B;  1P3K B;  3NQU A;  1P3I C;  5B32 D;  4Z5T D;  3AYW A;  3NQU B;  3AYW B;  5G49 A;  1R4V A;  3X1U B;  5G49 B;  3VH5 T;  3C1B C;  1ID3 A;  4WNN A;  4XUJ B;  4QLC D;  1ID3 B;  3C1C D;  2FJ7 D;  4WNN B;  3LJA C;  4Z2M H;  5AV9 A;  4JJN D;  2F8N K;  1HQ3 D;  1AOI C;  3VH6 W;  5AV9 B;  1WWS A;  3UT9 C;  3AZG C;  3AZF D;  5DNN D;  3AZJ D;  5B1M D;  4Z5T C;  3B6G C;  4WJ3 C;  1P34 D;  3H0M C;  3W98 D;  5AY8 D;  5B32 A;  4Z5T A;  1P3F D;  3P5J B;  5B32 B;  4Z5T B;  2YFW A;  5AV6 D;  3B6F D;  4QLC C;  3UTB D;  2FJ7 C;  2YFW B;  5JRG D;  1M1A A;  4JJN C;  1HQ3 C;  4UUZ A;  1M1A B;  4E44 A;  4QLC A;  2FJ7 A;  3C1C A;  3AZF C;  4UUZ B;  3AZJ C;  5B1M C;  4QLC B;  4Z2M G;  3C1C B;  5GT3 D;  2RIQ A;  4H9O B;  1A7W A;  1HQ3 A;  2UWX A;  4KUD B;  1P34 C;  5DNN A;  3AZJ A;  5B1M A;  3W98 C;  5AY8 C;  5DNN B;  5B40 C;  3AZJ B;  3WA9 D;  4J8U B;  4DQY B;  1P34 A;  4H9R A;  3B6F C;  3X1S D;  3W98 A;  5AY8 A;  1P34 B;  4H9R B;  1BH9 A;  5JRG C;  1P3F A;  3W98 B;  2L5A A;  1BH9 B;  1P3F B;  5AV6 A;  3AV2 B;  3B6F A;  3UTB A;  1P3L D;  5AV6 B;  4NE3 A;  5JRG A;  3B6F B;  5CPI C;  3UTB B;  5C3I C;  3W97 D;  4X23 D;  1JFI A;  5GT3 A;  5E5A C;  1JFI B;  3WA9 C;  2YFV A;  3AL0 C;  5GT3 B;  5C3I B;  2YFV B;  3WTP D;  4HGA B;  3A6N A;  4J8V D;  1P3P B;  3X1S C;  3AN2 D;  1TAF A;  4CSR A;  3A6N B;  3WA9 A;  2HUE B;  1TAF B;  4CSR B;  5GXQ A;  3AFA D;  4H9Q A;  5GXQ B;  3X1S A;  4DRB A;  3O62 D;  2ARO D;  1U35 D;  4NE6 A;  5GT0 B;  4H9Q B;  3X1S B;  3AZH D;  3KWQ B;  5BT1 D;  1HTA A;  3B0D C;  4X23 C;  3AZN D;  1P3L A;  1Z2C B;  5CPJ A;  4KGC A;  1P3L B;  5CPJ B;  3W97 A;  4KGC B;  4X23 A;  3WTP C;  4J8V C;  1KX3 B;  3W97 B;  3AN2 C;  4X23 B;  3MGP B;  5AVB D;  3WAA D;  2Y2L A;  3KXB A;  3WTP A;  4J8V A;  3KXB B;  3AN2 A;  3O62 C;  2ARO C;  2JCH A;  4J8V B;  1P3I D;  2Y2P A;  4J8W C;  3AN2 B;  1P3O D;  3AZI C;  1BFM A;  5DNM B;  3AFA A;  5BT1 C;  3AFA B;  2ARO A;  3AZN C;  1U35 A;  2Y2O A;  4WZS B;  3LZ1 A;  1Q9C A;  1F66 C;  3AZH A;  2ARO B;  1U35 B;  5GSU B;  3LZ1 B;  3MGS B;  2Y2G A;  3C1B D;  3AZH B;  3A1I A;  4LD9 D;  1P3B D;  3AZN A;  1KX4 A;  5B0Y D;  3FDD A;  3AZN B;  3EPL A;  3VH6 T;  5B31 C;  3LJA D;  3REK A;  1KX4 B;  3WAA C;  2ZM5 A;  3REK B;  2IO5 C;  1AOI D;  3REH D;  3AZG D;  3AZM D;  3EPJ A;  5AVB A;  1P3O C;  3B6G D;  3WAA A;  3W96 C;  5AVB B;  2F8N G;  3W99 C;  1P3I A;  1P3O A;  1P3I B;  1P3O B;  3AZL D;  4DRA A;  1P3B C;  4LD9 C;  3REI D;  5B0Y C;  4J8X C;  2DF4 C;  3F6T A;  3C1B A;  3REJ D;  2CWE A;  2Y2K A;  4LD9 A;  5B2J C;  1P3B A;  3REH C;  3C1B B;  3AZM C;  1F1E A;  4G92 C;  5CPK D;  5B0Y A;  2NQB D;  1P3B B;  4LD9 B;  1T3U A;  3LJA A;  5B0Y B;  2ZY2 A;  2BYK A;  3LJA B;  1AOI A;  3REH A;  3UT9 A;  3AZG A;  3AZM A;  3B0B A;  1AOI B;  2ZY5 A;  3REH B;  3UT9 B;  3AZG B;  3AZM B;  3MGR C;  5B40 D;  3B6G A;  3B6G B;  3AZL C;  3EPK A;  5B31 G;  3LEL D;  3REI C;  5F99 D;  4R8P C;  3B0C W;  3REJ C;  3AZL A;  3IP4 C;  3REI A;  5CPK C;  3AZL B;  2NQB C;  5CPI D;  2FJ7 B;  5B1L D;  2HIO D;  4JJN A;  3REJ A;  1S32 C;  4JJN B;  3REJ B;  1HQ3 B;  3AZF A;  5CPK A;  2NQB A;  5BS7 C;  3AZF B;  5CPK B;  5E5A D;  2NQB B;  5B1M B;  2JSS A;  1P3G D;  5B2I D;  3LEL C;  4ZBJ C;  5F99 C;  5B40 A;  2Y2Q A;  2XD5 A;  5AY8 B;  5B40 B;  4AWL C;  3LEL A;  5F99 A;  3LEL B;  4ZBJ B;  5B1L C;  4YS3 D;  2HIO C;  3AZE D;  5JRG B;  2PYO D;  5BO0 A;  4AWL B;  3EPH A;  5CPI A;  5B1L A;  5BO0 B;  2F8N D;  5CPI B;  3A1K A;  3TU4 C;  3REL C;  5B2I C;  4XZQ D;  1P3G C;  2BG1 A;  5AV5 D;  2RVQ D;  5E5A A;  1KX5 C;  5E5A B;  3WA9 B;  3UTA D;  3VH5 A;  2J8P A;  4J8W D;  4YS3 C;  3AZE C;  3AZI D;  5AV8 D;  2PYO C;  3X1V C;  1F66 D;  3MVD C;  4YS3 A;  2FFF B;  3AZE A;  3H0R C;  1EQZ D;  3AZK D;  3AZE B;  4XZQ C; 
#chains in the Genus database with same CATH homology
 5AV5 C;  1M19 C;  3B0D B;  2RVQ C;  2F8N A;  5B31 D;  4WU8 D;  2G5I C;  2F8N B;  4XZQ A;  5B24 D;  5AV5 A;  2BYM A;  4XZQ B;  3UTA C;  3WTP B;  5AV5 B;  5AV8 C;  3MGQ D;  3AV1 C;  3W96 D;  1ULY A;  1TZY D;  3O62 A;  3W99 D;  5B0Z D;  4J8W A;  3O62 B;  3AZI A;  5AV8 A;  4CAY A;  4J8W B;  1EQZ C;  3AZK C;  3AZI B;  4CAY B;  3WKJ C;  5CP6 D;  1F66 A;  4J8X D;  3EG5 B;  4WU8 C;  1F66 B;  5B33 D;  1EQZ A;  3AZK A;  3MNN D;  5B2J D;  1W2E A;  1EQZ B;  5B24 C;  3X1U D;  2W8S A;  3AZK B;  5B31 A;  4WU8 A;  5B31 B;  4WU8 B;  4XUJ D;  3MGQ C;  5B24 A;  3WAA B;  1B6W A;  5AVC C;  1TZY C;  2IO5 B;  5B0Z C;  1P3M C;  5B24 B;  3MGR D;  1M18 D;  3MGQ A;  3W96 A;  1N1J A;  5KDM A;  5CP6 C;  3MGQ B;  5B0Z A;  1P3K C;  3W99 A;  1N1J B;  3B0C T;  3W96 B;  5KDM B;  4R8P D;  5B0Z B;  3W99 B;  5B33 C;  3LZ0 D;  3MNN C;  4H9S C;  3X1U C;  4UPK A;  2G5H C;  2Y2H A;  4J8X A;  2XD1 A;  2Y2M A;  3KSY A;  5B33 A;  4J8X B;  1S32 D;  3MNN A;  4XUJ C;  4H9S A;  5B2J A;  5B33 B;  1ID3 C;  3X1U A;  2BYK B;  3MNN B;  5B2J B;  4G92 B;  1M18 C;  5AV9 C;  1M1A D;  4XUJ A;  3MGR A;  1ZLA D;  1M18 A;  5JA4 A;  4KUD D;  5BNX A;  3MGR B;  3LZ0 C;  1M18 B;  5JA4 B;  5BNX B;  4R8P A;  3REI B;  5B32 C;  4J8U D;  1P3A D;  3LZ0 A;  4R8P B;  3LZ0 B;  1S32 A;  3AV2 D;  1M1A C;  3TU4 D;  1H3O A;  3REL D;  1S32 B;  4KHA A;  3VH5 W;  5BS7 A;  3C1C C;  1H3O B;  4KHA B;  1ZLA C;  1WWI A;  2DQN C;  1KX5 D;  4NFT A;  4KUD C;  1KU5 A;  3H0L C;  4Z66 D;  5DNN C;  4H9O A;  1ZLA A;  4ZUX D;  4KUD A;  5F99 B;  4J8U C;  1P3A C;  1ZLA B;  1P3P D;  3VH6 A;  3X1V D;  3A6N D;  3KFU G;  2NZD D;  2F2A C;  3MVD D;  4J8U A;  1P3A A;  2HIO A;  1P3F C;  2JE5 A;  2VQR A;  3AV2 C;  5B1L B;  4M6B A;  5GXQ D;  2HIO B;  1P3A B;  4EO5 C;  5AV6 C;  5GT0 D;  3UTB C;  4H9P A;  1M19 D;  3KWQ D;  4WU9 D;  1BH8 A;  4H9P B;  1B67 A;  3AV2 A;  3TU4 A;  1P3G A;  3REL A;  5B2I A;  4Z66 C;  1PZR A;  5B32 G;  3TU4 B;  1P3G B;  4EO5 B;  5B2I B;  3REL B;  5CPJ D;  4ZUX C;  5GT3 C;  1KX5 A;  4KGC D;  5FUG A;  4HGA C;  1KX3 D;  1P3P C;  3AV1 D;  1KX5 B;  4Z66 A;  4WV4 B;  5FUG B;  3A6N C;  3MGP D;  2NZD C;  4Z66 B;  4ZUX A;  2HUE C;  4ZUX B;  1P3P A;  4YS3 B;  5GXQ C;  3KXB D;  3KUY D;  2PYO A;  2LY8 A;  3X1V A;  5GT0 C;  2CV5 D;  3WKJ D;  2NZD A;  2PYO B;  3X1V B;  1BH8 B;  3MVD A;  3KWQ C;  5DNM D;  5BNV A;  4WU9 C;  2NZD B;  3MVD B;  5BNV B;  5GT0 A;  1P3L C;  1M19 A;  5GSU D;  3LZ1 D;  3KWQ A;  4WU9 A;  3MGS D;  5CPJ C;  2BYM B;  4KGC C;  1M19 B;  4WU9 B;  3W97 C;  4G91 C;  1KX3 C;  5AVC D;  3MGP C;  2ZY4 A;  3X1T D;  3UTA A;  4E45 A;  1P3M D;  1KX4 D;  5CHL B;  3UTA B;  3REK D;  1KX3 A;  3AV1 A;  3KXB C;  3KUY C;  5AV8 B;  4YM6 D;  4G91 B;  3MGP A;  2CV5 C;  3AV1 B;  1P3K D;  2ZY3 A;  5DNM C;  3AYW D;  3KUY A;  3AFA C;  2Y2J A;  2CV5 A;  3WKJ A;  3KUY B;  2F8N H;  1U35 C;  5GSU C;  3LZ1 C;  2CV5 B;  5DNM A;  3MGS C;  3WKJ B;  3AZH C;  2Y2N A;  1ID3 D;  3NQJ A;  3X1T C;  5GSU A;  1KX4 C;  3NQJ B;  3MGS A;  3R45 A;  3REK C;  5AV9 D;  3R45 B;  5AVC A;  1TZY A;  4YM6 C;  3X1T A;  1P3M A;  5AVC B;  1TZY B;  3X1T B;  1P3M B;  3V9R A;  5AVB C;  3AYW C;  3WTP E;  2Y2I A;  4H9N A;  4YM6 A;  3V9R B;  4NE5 A;  5CP6 A;  3UT9 D;  1P3K A;  4H9N B;  4YM6 B;  5CP6 B;  1P3K B;  3NQU A;  1P3I C;  5B32 D;  4Z5T D;  3AYW A;  3NQU B;  3AYW B;  5G49 A;  1R4V A;  3X1U B;  5G49 B;  3VH5 T;  3C1B C;  1ID3 A;  4WNN A;  4XUJ B;  4QLC D;  1ID3 B;  3C1C D;  2FJ7 D;  4WNN B;  3LJA C;  4Z2M H;  5AV9 A;  4JJN D;  2F8N K;  1HQ3 D;  1AOI C;  3VH6 W;  5AV9 B;  1WWS A;  3UT9 C;  3AZG C;  3AZF D;  5DNN D;  3AZJ D;  5B1M D;  4Z5T C;  3B6G C;  4WJ3 C;  1P34 D;  3H0M C;  3W98 D;  5AY8 D;  5B32 A;  4Z5T A;  1P3F D;  3P5J B;  5B32 B;  4Z5T B;  2YFW A;  5AV6 D;  3B6F D;  4QLC C;  3UTB D;  2FJ7 C;  2YFW B;  5JRG D;  1M1A A;  4JJN C;  1HQ3 C;  4UUZ A;  1M1A B;  4E44 A;  4QLC A;  2FJ7 A;  3C1C A;  3AZF C;  4UUZ B;  3AZJ C;  5B1M C;  4QLC B;  4Z2M G;  3C1C B;  5GT3 D;  2RIQ A;  4H9O B;  1A7W A;  1HQ3 A;  2UWX A;  4KUD B;  1P34 C;  5DNN A;  3AZJ A;  5B1M A;  3W98 C;  5AY8 C;  5DNN B;  5B40 C;  3AZJ B;  3WA9 D;  4J8U B;  4DQY B;  1P34 A;  4H9R A;  3B6F C;  3X1S D;  3W98 A;  5AY8 A;  1P34 B;  4H9R B;  1BH9 A;  5JRG C;  1P3F A;  3W98 B;  2L5A A;  1BH9 B;  1P3F B;  5AV6 A;  3AV2 B;  3B6F A;  3UTB A;  1P3L D;  5AV6 B;  4NE3 A;  5JRG A;  3B6F B;  5CPI C;  3UTB B;  5C3I C;  3W97 D;  4X23 D;  1JFI A;  5GT3 A;  5E5A C;  1JFI B;  3WA9 C;  2YFV A;  3AL0 C;  5GT3 B;  5C3I B;  2YFV B;  3WTP D;  4HGA B;  3A6N A;  4J8V D;  1P3P B;  3X1S C;  3AN2 D;  1TAF A;  4CSR A;  3A6N B;  3WA9 A;  2HUE B;  1TAF B;  4CSR B;  5GXQ A;  3AFA D;  4H9Q A;  5GXQ B;  3X1S A;  4DRB A;  3O62 D;  2ARO D;  1U35 D;  4NE6 A;  5GT0 B;  4H9Q B;  3X1S B;  3AZH D;  3KWQ B;  5BT1 D;  1HTA A;  3B0D C;  4X23 C;  3AZN D;  1P3L A;  1Z2C B;  5CPJ A;  4KGC A;  1P3L B;  5CPJ B;  3W97 A;  4KGC B;  4X23 A;  3WTP C;  4J8V C;  1KX3 B;  3W97 B;  3AN2 C;  4X23 B;  3MGP B;  5AVB D;  3WAA D;  2Y2L A;  3KXB A;  3WTP A;  4J8V A;  3KXB B;  3AN2 A;  3O62 C;  2ARO C;  2JCH A;  4J8V B;  1P3I D;  2Y2P A;  4J8W C;  3AN2 B;  1P3O D;  3AZI C;  1BFM A;  5DNM B;  3AFA A;  5BT1 C;  3AFA B;  2ARO A;  3AZN C;  1U35 A;  2Y2O A;  4WZS B;  3LZ1 A;  1Q9C A;  1F66 C;  3AZH A;  2ARO B;  1U35 B;  5GSU B;  3LZ1 B;  3MGS B;  2Y2G A;  3C1B D;  3AZH B;  3A1I A;  4LD9 D;  1P3B D;  3AZN A;  1KX4 A;  5B0Y D;  3FDD A;  3AZN B;  3EPL A;  3VH6 T;  5B31 C;  3LJA D;  3REK A;  1KX4 B;  3WAA C;  2ZM5 A;  3REK B;  2IO5 C;  1AOI D;  3REH D;  3AZG D;  3AZM D;  3EPJ A;  5AVB A;  1P3O C;  3B6G D;  3WAA A;  3W96 C;  5AVB B;  2F8N G;  3W99 C;  1P3I A;  1P3O A;  1P3I B;  1P3O B;  3AZL D;  4DRA A;  1P3B C;  4LD9 C;  3REI D;  5B0Y C;  4J8X C;  2DF4 C;  3F6T A;  3C1B A;  3REJ D;  2CWE A;  2Y2K A;  4LD9 A;  5B2J C;  1P3B A;  3REH C;  3C1B B;  3AZM C;  1F1E A;  4G92 C;  5CPK D;  5B0Y A;  2NQB D;  1P3B B;  4LD9 B;  1T3U A;  3LJA A;  5B0Y B;  2ZY2 A;  2BYK A;  3LJA B;  1AOI A;  3REH A;  3UT9 A;  3AZG A;  3AZM A;  3B0B A;  1AOI B;  2ZY5 A;  3REH B;  3UT9 B;  3AZG B;  3AZM B;  3MGR C;  5B40 D;  3B6G A;  3B6G B;  3AZL C;  3EPK A;  5B31 G;  3LEL D;  3REI C;  5F99 D;  4R8P C;  3B0C W;  3REJ C;  3AZL A;  3IP4 C;  3REI A;  5CPK C;  3AZL B;  2NQB C;  5CPI D;  2FJ7 B;  5B1L D;  2HIO D;  4JJN A;  3REJ A;  1S32 C;  4JJN B;  3REJ B;  1HQ3 B;  3AZF A;  5CPK A;  2NQB A;  5BS7 C;  3AZF B;  5CPK B;  5E5A D;  2NQB B;  5B1M B;  2JSS A;  1P3G D;  5B2I D;  3LEL C;  4ZBJ C;  5F99 C;  5B40 A;  2Y2Q A;  2XD5 A;  5AY8 B;  5B40 B;  4AWL C;  3LEL A;  5F99 A;  3LEL B;  4ZBJ B;  5B1L C;  4YS3 D;  2HIO C;  3AZE D;  5JRG B;  2PYO D;  5BO0 A;  4AWL B;  3EPH A;  5CPI A;  5B1L A;  5BO0 B;  2F8N D;  5CPI B;  3A1K A;  3TU4 C;  3REL C;  5B2I C;  4XZQ D;  1P3G C;  2BG1 A;  5AV5 D;  2RVQ D;  5E5A A;  1KX5 C;  5E5A B;  3WA9 B;  3UTA D;  3VH5 A;  2J8P A;  4J8W D;  4YS3 C;  3AZE C;  3AZI D;  5AV8 D;  2PYO C;  3X1V C;  1F66 D;  3MVD C;  4YS3 A;  2FFF B;  3AZE A;  3H0R C;  1EQZ D;  3AZK D;  3AZE B;  4XZQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...