3WLFA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with (r)-1-phenyl-1,2-ethanediol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 97
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wlfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wlfA01
3W1VA 3JQAA 3UCFA 5B4TA 1R37A 3DOOA 4LCEA 5KJ6A 2YV3A 4PLFA 3MOGA 2R00A 4F6LA 4EEZA 4ONEA 3SJUA 4BO8A 2H9IA 3K92A 1MG5A 1Y5MA 1U5AA 2IEDA 1H6BA 2C7GA 4NH4A 1LC3A 2NVBA 4R1TA 1GUYA 3F6YA 4OJNA 3I9LA 1P1IA 4BO4A 4UVDA 5THKA 3KBOA 3U4CA 1XQ6A 4GLLA 5EMHA 3BTSA 4XWYA 1YJQA 4JQCA 2VYNA 2GSDA 1K6XA 1WDLA 2VZ8A 3RFVA 4CM3A 5CAEA 4UULA 5ADHA 4PG7A 1YDWA 4FPXA 4E5MA 2AQKA 4J2HA 2P9GA 4FCCA 1I0ZA 1WVGA 3DZJA 5ENVA 3ETDA 2JAPA 1R4MB 2I9PA 3GY0A 4IDEA 4NBVA 4QX6A 4WCFA 4AJJA 5C7IO 5HS4A 3EMKA 1Z75A 3C1AA 3DBHB 1RM0A 2VYVA 5F5NA 1B15A 3PZBA 1Y8RB 3B1FA 3A14A 3CUKA 3WBBA 2ZYDA 2VHXA 1ADFA 1Q0QA 4NHEA 1ISHA 3JYPA 2VTDA 2B4QA 4CLEA 3GRPA 2C2YA 4DQVA 2CSUA 2OMEA 2NVWA 1FDVA 1JAXA 4AJ2A 3TZHA 3SLGA 4R41A 4GKVA 1L7DA 2I99A 3A4VA 3EVNA 3PDUA 1PJSA 5BNTA 1HDYA 3WGGA 5BSFA 3PYMA 1Z73A 3I4FA 2YQ4A 3KRTA 5JAQA 5JAMA 5JCJA 3OA0A 1MGOA 1HWYA 1VI2A 3IKVA 2VHVA 5TSDA 2A92A 3ON5A 4BO0A 2B0JA 1E77A 1P77A 2FPGA 4BVAA 3FF4A 4DPLA 1NASA 4JJFA 3NGLA 3QJ5A 2CMDA 2Z1MA 1YL6A 2B35A 5A3JA 1GZ6A 1QV7A 2X23A 4O5OA 4BNKA 4E5KA 4BNYA 1JN0A 1F8GA 1F12A 1WW8A 1LDYA 3IC5A 2O7SA 3ORFA 5JDIA 1GR0A 1LX6A 4R16A 5L51A 4PCVA 1BHSA 5GZ6A 1YOVA 4K6FA 3RKRA 3KETA 3G1TA 3LSYA 5ICMA 5IJZA 3WOHA 3VPXA 3FNEA 3PLRA 1A9ZA 1QSGA 1C0IA 1HDGO 1R4NA 3RQSA 4FFLA 3SJ7A 1DB3A 4P8RA 4E30A 3UCEA 1ZCJA 3TOXA 3MJSA 2DTEA 1E7RA 4NK4A 1PJLA 4MIYA 3NEPX 3JQ8A 4D3FA 1E5QA 2V7PA 2VN8A 3F5QA 2E4AA 2PNFA 4YEDA 2BI8A 5DBIA 1ZH8A 2EIHA 1I3KA 2V6BA 1U3VA 2W98A 3C7DB 3DHEA 4XQCA 2VRBA 5EESA 2X22A 2Q4EA 4WGGA 3RSHA 3TF5A 2GDZA 4E2WA 3E9MA 3R1IA 4WCDA 5KIAA 5IG2A 3STHA 4KQWA 3ZWYA 2D5CA 2H5LA 4CM9D 3DB2A 4G2NA 4OOFA 3U9LA 4CQMA 4DLAA 3H3JA 3V1UA 4BGUA 1BXGB 5A4DA 4CM4B 1T2FA 2CNBA 3WJ7A 3OMLA 2IZZA 2XXBA 2IYPA 3GNSA 4W82A 4DLBA 3TL3A 5JO9A 2PH3A 2DFVA 1VM6A 2EKPA 2FR8A 4IQGA 4BNLA 3D5TA 3NJ8A 3WQQA 4BQRA 2DTXA 2ILTA 2Q1SA 1ZSNA 2GZ1A 2GRAA 3QWAA 5TX7A 3P2OA 1O94A 4XGKA 1GQQA 5CDUA 4BB5A 4D46A 2P9EA 1T26A 2FZWA 1U8FO 3Q9NA 3WDSA 2Y05A 3ZNNA 3NT4A 1E3EA 2FN7A 3JQCA 2JHFA 1LRLA 5G4LA 2GF2A 3V1YA 4BNHA 1V3UA 3GDFA 3VPGA 3CZRA 1N1EA 1KVSA 2FRDA 9LDTA 5GZ1A 3D1LA 1TT5A 1YQDA 3HN2A 1ID1A 1U3WA 3LLSA 1P0CA 3M6IA 3MEQA 1WZEA 4GLOA 4PLHA 2IE0A 4CM1A 5JAIA 2DAPA 3CMMA 3ZN2A 1DOHA 4QT0A 1LUAA 2E48A 4OXYA 4I9HA 5CEFA 4RZHA 3WX0A 3ZV6A 1WNTA 5I7VA 2QZZA 3MOIA 3EDMA 3OJEA 1X7GA 1GZ4A 1BVUA 3TZCA 3BHMA 3NDIA 4D3DA 3SXPA 4TRMA 3IUPA 3H9QA 4TKMA 1MLDA 3HUDA 2OBYA 2VHZA 5KOIA 3ZDFA 2BH9A 1LSUA 3RAJA 4RVFA 1NP3A 4BGVA 4F45A 1PS8A 3Q1LA 5JE8A 2GN8A 4E2YA 1V3VA 1A71A 4FJ0A 4LCJA 3AWDA 2HU2A 4XD2A 3RFXA 2NTNA 3JYQA 5L3ZA 3ZW8A 1QG6A 3QV1A 2ZCUA 2AA3A 1NPTO 4G5HA 4O0LA 4BO6A 4ZHSA 2YDYA 4DL9A 4Q3AA 2BGLA 1QP8A 4IDBA 1FF9A 1PJCA 4BO5A 5KJCA 3A28A 4DBZA 1I2BA 1ZIDA 1GV0A 1AXEA 1T1SA 1Z7BA 2WEKA 3N58A 3Q2KA 4N54A 4ALJA 1U3UA 4QEDA 5DOVA 5JDCC 4AG3A 4RVDA 5HTOA 1LEHA 3U4IA 2QG4A 1C1XB 2GN9A 1GUFA 2IXAA 3IS3A 5U1PA 3DBHA 3QWIA 5TJ9A 4BMNA 1NFRA 4E6PA 3JCZA 3H6KA 4W99A 3O03A 3NTOA 5GY7A 1V0JA 4E4YA 2HDHA 4QECA 1SC6A 5JO0A 1RM5A 2AG5A 2TMDA 3CE6A 3G0OA 4QSMA 4A2CA 2D59A 3K8ZA 3L6EA 2LDXA 1PU2A 4GX1A 1KEWA 2GZ2A 3RJ9A 1JVBA 1DFGA 3GZ4A 5FFFA 3LLVA 2FY8A 3DBRB 4E31A 2A35A 2O7QA 3DZIA 3TN7A 1OBFO 4BNXA 2Y1GA 3ADOA 1F06A 1NQAO 3AY7A 2GPTA 1YXMA 2AMFA 3ICCA 4IUYA 3QLJA 3OEWA 4L4SA 4J9VA 5LCXA 4JP3A 2C29D 3CIFA 5H81A 3F3SA 5TT0A 1CF2O 3V2HA 1RM4A 5FI5A 3ZNOA 4PLZA 3IOYA 5CHEA 4IIUA 3E6AA 4EBFA 2JCYA 1K89A 1QXSA 2OFPA 3GMSA 4DC1A 5F1KA 1DXYA 1GCOA 4OMUA 3AFNA 4AJPA 2Y93A 4RJTA 2ZKLA 2BELA 5JCJD 1Y1PA 4GPD1 5K6AC 3OM9A 4A0SA 5DF1A 1NR7A 3MJCA 3NJ4A 4IDDA 4Q3CA 3TJRA 3WYEA 4OXKA 3LQFA 3PGXA 1PGNA 2FPIA 1NTOA 3DR3A 4NDNE 4RDIA 2I76A 4HBGA 1ONPA 3OHSX 4ND3A 1XG5A 1DC3A 2DT5A 1AN9A 2WTBA 5CDSA 4HFRA 3T7EA 1LSJA 3UH1A 2NTVA 4CUJA 2O4CA 3L0DA 4JBGA 1NVTA 4R68A 1YBVA 3KLMX 1KOLA 3WQSB 3WNQA 4EUEA 4WEOA 1K2WA 5IDXA 4Q3BA 4ZGWA 4HV4A 2A94A 4EGFA 3EHEA 5L53A 3K6JA 4X54A 3WNVA 1LLDA 1EE2A 2RHRA 5A5FA 3UN1A 3LT0A 4XYEA 1Z82A 4AFNA 3LF2A 4CJXA 1TXGA 3KYCB 2O2YA 4DIBA 2RAFA 3JD4A 5I9NA 4KDEA 1P74A 3ONFA 3VVBA 3NX4A 1DSSG 4GBJA 3GN2A 3IIEA 3IDSA 5KNLA 4DQUA 4J4HA 3I23A 1Y5RA 2Y1CA 5CG2A 4UUMA 1QLHA 1BVRA 3C85A 4MKXA 4HY3A 3RUEA 4AJKA 1C14A 1Z7EA 2PR2A 3MWDB 4MOWA 4PLTA 1GYQA 4R1NA 5DCUA 4PLCA 3VOSA 3ZNQA 4XYLA 1A4UA 1IOLA 1JKIA 1HYHA 4N5LA 3NGXA 3BHIA 3VH1A 4IMRA 3PWSA 3DBLB 2BFOA 4LMRA 4EJ6A 2E37A 1LRJA 3WQRA 1AGNA 3ZV4A 3CEAA 2EXXA 1QYVA 4B8ZA 1CEQA 1J6UA 1A9YA 1C0LA 3A1NA 3VH3A 1TI7A 1X1TA 1W6UA 4ALNA 5DBFA 9LDBA 4CUKA 3VZSA 1JKJA 3RC1A 5TRTA 3GFBA 4H7PA 4FSHA 4CODB 3DEYX 4WNIA 1E6EA 4WEQA 1XCBA 4ZVVA 1RM3A 5EN4A 4XCVA 2BHLA 3R6DA 3HSKA 3ROKA 5T6BA 3NRCA 4Z0TA 2I6TA 1B16A 3KOUA 5HS6A 1H2HA 4DYVA 3PJDA 3RBXA 1E3WB 1O5IA 5T64A 4XRRA 3WGIA 3RC7A 4ESOA 5B1YA 3CSDA 4HNGA 3WFJA 4D45A 2EKQA 3GG2A 1RYDA 1VJ1A 4CUZA 4AJHA 1E1MA 3WIDA 1BDBA 3WGZA 2VQ3A 4DBVO 1DRWA 4L4XA 3OFSA 4WCFB 1ULUA 4MINA 5KJ1A 1NPYA 2JCXA 3JSAA 2QHXA 5JBIA 1Y9AA 3ABIA 3ST7A 1UXHA 3GFGA 5AXDA 5C37A 3K9QO 4GI2A 5IXSA 1TB4A 4U6QA 2QIOA 1IHXA 4YQYA 3LK7A 5TT1A 4NPCA 1QYCA 4XKJA 3ROMA 4E3ZA 2B5WA 3TSCA 2SCUA 1LNQA 2V6GA 4AJOA 5IZ4A 4KZPA 3G79A 3U5TA 3ICPA 4DTIA 1BXZA 4IXWA 4L8VA 1WMAA 4YYZA 4BNJA 1CQJA 4CMKA 4UAGA 5ILOA 1HEUA 1SPXA 1KVTA 4JN6B 4FQ8A 4IDAA 1M6HA 2ZB7A 4IXTA 4H3VA 1TT7A 4YACA 2I67A 3H9UA 5EINA 2D0IA 1D7OA 2HJSA 2EP7A 1OC4A 3QE3A 1YB4A 4W9NA 4U5QA 3TPCA 4JJGA 3QVOA 2IZ0A 5KVCA 5AXCA 1R6DA 3C7CB 2YHUA 4OQZA 1O6ZA 2YV1A 3WFIA 2PZLA 1E92A 4J1TA 3IUSA 4CLXA 2RH8A 2HK9A 1P9LA 3ZHZA 4UUOA 3OP4A 3UHAA 4E2XA 3FBGA 1NWCA 2IRWA 4I5EA 1HZZA 1LSOA 3DL2A 2VT3A 2YUTA 2G82A 3L4BC 1NAHA 3B20A 1AUPA 3I6QA 4WLOA 1PR9A 3QW2A 5L7WA 2RHCA 1IE3A 1M2WA 1LDGA 3D7LA 1ZJYA 3EYWA 3ENKA 1PJ3A 3DZKA 2W2KB 2I65A 3W4IA 2HRZA 4CLRA 5G0WA 3WIEA 4QO8A 4BNIA 3LU1A 4YT2A 1K6JA 2CY0A 4CMJA 1R4NB 1PQWA 4YAKA 4M1QA 4DREA 3WWYA 3RUCA 1VJ0A 1HDOA 5L45A 4YAIA 4FFOA 1GTMA 3JQ8B 2EW8A 4PG4A 1EVZA 5A9SB 4ITUA 4CM9A 1YL7A 1IB6A 4Z6KA 1N9GB 2PZKA 1T2DA 4QO7A 4XDZA 4RF5A 4YA6A 2NADA 5DNAA 5AYVA 4CMCA 1GQ2A 3NTQA 1J49A 3D3WA 4G81A 1AE1A 3ANMA 2BD0A 4KWHA 2OP0A 2FSVA 2PGLA 1WXDA 1FXSA 4M54A 1ORRA 3MJEA 4L74A 1XSEA 1QORA 2AEFA 3DC2A 3TFOA 4CV3A 4B8WA 4FFPA 4Y9DA 4YR9A 1GV1A 4GAEA 1NAIA 2EKLA 1MP0A 1UXGA 3Q0EA 3QA9A 5TC4A 3PYLA 5KKCA 2D2IA 4UREA 4M55A 4KQXA 1KVRA 5KKAA 1N92A 1U4OA 1VPDA 1P1KA 2VOJA 3VDQA 4H16A 1X7DA 2AQHA 2GYYA 1YQXA 3HFGA 4J1SA 4II3A 3JV7A 3K2EA 3GF4A 1R66A 3RCBA 4I5DA 2Q1WA 3QVSA 4W7IA 4AJLA 3OJLA 4D7AA 4LVCA 1P3DA 3PIDA 1HE5A 4MP8A 4F6CA 4YT5A 1KBZA 2NACA 5G4KA 3WGOA 4BKRA 3W4KA 3DWFA 4XYBA 3ETGA 3I83A 3KYCA 4BGEA 4I9NA 3D4PA 3JQFC 4ALIA 5ER6A 3FRJA 5ITWA 4ZD6A 3GK3A 4CM8A 4GMFA 4XJTA 2Q45A 5H83A 1B7GO 3RUFA 4DPMA 2P5YA 1EZ4A 3BMOA 1DIAA 5T8KC 3F9IA 4J2OA 4QXMA 3RWBA 3PEFA 4FIZA 5T5QA 2EP5A 3JYLA 4FC6A 2XF8A 4R1UA 4ALLA 2OUIA 4JBHA 3H9EO 3RUIA 4XA8A 2X9VA 2CUKA 3GLQA 2X1HA 4Z3DA 1OZAA 1BW9B 4E5NA 4KUHA 2NU9A 2P4QA 1H0KA 2QYSA 2R6JA 1ONOA 4R54A 4MKZA 2UV8A 1JWAB 3GNQA 2ZB4A 3LZ6A 1GQYA 3JD0A 4CR8A 3L6OO 1ARZA 1RKXA 4L73A 2PLAA 3K96A 3KYDA 2AXQA 1F0YA 5DOZA 2C20A 2GNAA 5JXWA 3N74A 1OMOA 1PJ2A 1U7TA 1NQ5A 2YFHA 1KS9A 2DC1A 4P38A 1C3VA 4XR4A 3DDNA 3DO5A 5A05A 4J9UE 3MTJA 3OECA 4CMBA 2UDPA 1RWBA 4WOKA 1VSVA 1UP4A 1GADO 4MDHA 3WSWA 4BNUA 3DFUA 4TZTA 1E3WA 3FPLA 4IPTA 3P2YA 3UGKA 4OOEA 2HMWA 3LT2A 2HMUA 5KTKA 1HRDA 4IDGA 5IZCA 1SEVA 3S2FA 2RH4A 3TFQA 4AJNA 1KVUA 1WMBA 4CM5A 3G3EA 3BTVA 4WKGA 5BT9A 3RC9A 4AVYA 2AE1A 3AK4A 2RBEA 3SC4A 2DM6A 1XEAA 3ITKA 3PJGA 3VH2A 5A3VA 4XEHA 1U28A 3VTFA 1XR3A 1HDRA 2R00C 1O9BA 2JAHA 4WE3A 4WK6A 1E6UA 4M89A 5AQ1A 3RJ5A 1P45A 3V5NA 2IXBA 3INRA 3ETEA 4HFMA 3V2GA 3GZNA 4BKQA 3MWEB 4PG5A 4BUCA 3KUXA 4DGSA 2Q3EA 4J6FA 4J7CA 3QWFA 2XXJA 5L7YA 1E3JA 1EK5A 2BGMA 1CRWG 4U6SA 4LRTB 5DZSA 2B5VA 5JMWA 5CEJA 4EDFA 4OHUA 3W8DA 3S2IA 4ILKA 1UDAA 4RPLA 4Y6PA 5JS6A 3C1OA 1ADCA 1PQUA 3A9WA 1W73A 1SB9A 4FGSA 4QFCA 1W8DA 3PFWO 1SO8A 4YAEA 3R0IA 2O3UA 1I5RA 3FBTA 4M49A 4WCFC 4IZHA 2XPCA 3NV9A 1NBOA 3AU9A 5B4VA 4CLOA 4RPJA 5TNXA 3UW3A 4C4OA 1I36A 1I30A 2EJVA 4JJIA 5BNIA 2YV2A 3ZNPA 2NNLD 4XIJA 4PRKA 1JLLA 1JTVA 2OHXA 1T4BA 3RKUA 2W2KA 1N7HA 1N2SA 1UZMA 3ZU2A 1BXKA 3AFMA 1OAAA 3CXRA 4YAJA 1ZEMA 3FWZA 3NT2A 4YRDA 5JY1A 2CF5A 4XYGA 4CMIB 4B4UA 3UOGA 5CDGA 4BNTA 1AXGA 1J5PA 4RGBA 2WE7A 5G0UA 3PWZA 3MJ4A 1DJQA 5A9SA 5I8ZA 2R2GA 3RUHA 2Q46A 3H3FA 4MKRA 1Q2XA 1EVIA 3FR7A 1N9GA 3IP1A 5COQA 2J6IA 1SZJG 3SLKA 3ZWAA 5A5EA 3ZH2A 1Q7GA 5HA5A 4NFYA 3DQPA 2HUNA 2ZJ1A 1PR3A 4XQ9A 2WYUA 4A26A 1C0PA 4MVJG 3JQ7A 1KIFA 4WOJA 1LDMA 3RBZA 1X14A 1GPDG 1HE2A 1YQGA 4GWGA 4XX0A 1DFIA 1X15A 1T2CA 3O9ZA 1ZK2A 1ZNQO 1A72A 4MVJI 1KY5A 4DWVA 4CMGA 4ZJUA 4Q3EA 2G17A 1SB8A 5G0TA 5JDIC 3N7UA 3C7AA 3RVDA 4BO3A 1DBVO 4BKOA 1I33A 4BNWA 4RF3A 2E6UX 3DHNA 2PKQO 3KEOA 2NV6A 1FK8A 2AHRA 4BB6A 3VAZA 3I6IA 1LRKA 1ZFNA 3OQ1A 4TVBA 4B79A 1E7MA 4J4TA 4WLVA 4O1MA 1JWBB 4IJUA 5DT9A 1B26A 4FW8A 2OL4A 4CM7A 3OIGA 1GAEO 3OH8A 3P5SA 3WGHA 5JAZA 2TMGA 1Y8QB 1EBUA 2VHYA 2X6TA 5FWNA 3NDJA 4IS3A 3PJFA 4L75A 4MVJM 2FR1A 5IXYA 3V8BA 3PQDA 2Y0CA 1P31A 5COAA 4UEJA 4YAGA 3F1KA 4N5NA 4IY1A 2QW8A 3K30A 4HADA 4D79A 4J43A 3D3EA 4D3SA 3GHYA 7ADHA 3MCVA 2C59A 3T4EA 2NLOA 1BW9A 4K26A 1EEHA 1HT0A 3RI3A 4BMSA 3MJVA 4GVLA 1VSUA 3O26A 3ZV5A 3VH4A 3OSUA 1KEUA 4GL4A 1PL7A 4XGIA 3X2EA 2X0NA 2BF7A 2ZTVA 3WMXA 3WYBA 2B83A 1BMDA 1PZHA 2AW5A 2PTGA 3AUSA 1H6AA 2HKIA 3LDHA 4OKIA 5FI3A 2WD8A 2YYYA 3E82A 3U4HA 3GGOA 4L0QA 3RASA 4YRBA 4YBZA 5C7OO 5IDQA 3M2PA 3AI2A 4R01A 1FDUA 5EJ2A 1LSSA 2PA3A 4PLWA 3MJTA 4J3FA 2PWZA 4BNFA 3S8MA 4I5FA 4D44A 4IJKA 1JA9A 2Y1FA 4NBTA 1JQBA 4HX5A 2WMDA 3BHJA 4PG6A 4ZRNA 2J3IA 4S1VA 4GX5A 1G6KA 2Q4BA 1J4AA 2V65A 3PHLA 3VTZA 2E49A 3QIVA 2C82A 2PD6A 4IINA 4ALKA 4OSOA 1I2ZA 2PKQP 2QRLA 1HDZA 3SEFA 1HTBA 3NT5A 2VT2A 6ADHA 4ND4A 4N5MA 4FS3A 4CQLA 4YJHB 1YRLA 1PGJA 3PHIA 4NR0A 4XB1A 5HBRA 4U7WA 3JQ9A 3HNPA 5JPIA 3ZWWA 3GOHA 1UXKA 1I3NA 1IULA 1G0NA 2EV9A 4BO7A 4MP3A 2EJWA 5CP8A 1E7WA 4YTEA 1LQUA 3HDYA 1UP6A 3HN7A 3OICA 3VPFA 1MV8A 2CDCA 2C54A 4FFNA 5THQA 2OXIA 1E6WA 1M75A 2ZB8A 3FPCA 4RDHA 3FTPA 1HLPA 3F4BA 4CLRB 1NM5A 4JX8A 4XR9A 5LDHA 2DBVO 2UAGA 1U3TA 4PVCA 4EZBA 1IHYA 2HCTA 2O3RA 2VUSA 1SCUA 2C7VA 5MGBA 1X13A 2V6MA 1VE9A 4AL4A 1XU9A 5L4NA 3VKUA 3QY9A 3TNLA 2W2LD 1LLQA 1PTJA 3E5RA 1KVQA 5AXBA 1DLJA 1TEHA 2Y68A 1H94A 3P7MA 4EUFA 3GAFA 1ADGA 5ILGA 5CDYA 5FEUA 1T2AA 2ZYAA 3DMTA 4C7JA 4GSLA 4EEXA 4MVJH 1NYTA 1P1HA 3D3WB 4M87A 5DBGA 4BIIA 1XELA 2NSDA 2DFDA 3PFFA 4PIVA 5CDTA 1GDHA 1X0VA 3KO8A 1YBMA 4KP7A 4RF2A 1XDWA 4BNZA 3BTUA 1JW9B 2VZ0A 4YB8A 2FPPA 1JKFA 1B0AA 2O23A 1XQ1A 4E0BA 4RPHA 4ZA2A 2XOXA 1MUUA 5IAAA 1WLYA 1LDNA 1YBAA 3DAFA 4CMIA 3OJ0A 3WB9A 1UAYA 3RIHA 3DZFA 2J3KA 5C3MA 1Z6ZA 4I8XA 3UFXA 2VWQA 4B3JA 5LDGA 3ZHBA 4DA9A 1F17A 3GEGA 1EDZA 1E3LA 3KEQA 5JY6A 4BKPA 1CDOA 1WAMA 1QMGA 2UUPA 1Q1NA 3DAPA 1Q7BA 3ZGYA 1KERA 5G4KB 4I08A 1B2LA 3K5PA 2O2SA 1K3TA 1L7EA 4IQ8A 5K0ZA 1R0LA 3GGGA 4DLLA 5IN4A 2PGDA 4MP6A 2O3JA 1WDKA 4OXNA 3WJAA 4A7PA 4CM8B 1HZJA 1DRVA 2P68A 3OIDA 1VLLA 1SNYA 2GN6A 4D41A 1J0XO 2JD2A 3BMOB 1V3TA 2EWMA 3JQGB 1KC3A 2VUUA 4CLDA 2I66A 1PZGA 4JNKA 4B3HA 1PZEA 1ZSYA 3EY4A 3JQBA 1EBFA 4J49A 5A9RA 4PG8A 4MJLA 3E03A 3KSZO 4ZQEA 3F47A 5K1SA 3E9QA 2A4KA 3R3JA 1GZ3A 2OOSA 2ZYGA 1A7AA 2YQ5A 1ENZA 4HFNA 3O8QB 2QZ9A 2JHGA 3GUYA 4DIOA 1D4FA 3ZU5A 1MG0A 1ZZEA 3WYCA 4GX2A 3IAHA 1MC4A 3KYDB 3L6DA 1XKQA 1BG6A 1GCUA 2Z1NA 2QX7A 4F46A 4YT4A 3WS7A 1MA0A 2NQTA 3DTYA 3EVTA 3GDOA 3KYBA 1MB4A 2HSDA 3QP9A 5A03A 1PL6A 1Y8QA 4DVJA 2DBQA 2X0IA 4W4TA 5IDYA 3UKOA 5JFOA 3ADPA 1P1RA 1DC6A 3HDJA 4URFA 4IZIA 5JYDA 1I8TA 1E7YA 1XA0A 2HMTA 1HSZA 1B8UA 3K73O 3HZZA 3OF2A 4U8GA 4YPOA 3DOCA 1ZMTA 1JVSA 1FMCA 3PHGA 1WZIA 4B3IA 2X5OA 2NVUA 3G49A 4HNHA 1SEPA 3MTGA 4XJSA 4E32A 5JNLA 3RBVA 2V6FA 3FHLA 3M2TA 2B69A 3H9JA 1YGYA 1KC1A 3X2FA 1KYQA 3RUDA 3GN1A 2D5AA 3NKLA 4JK3A 4MO2A 3AM5A 5KJEA 5B4UA 4BHTA 3ZCXA 1GYRA 3T4XA 4RVHA 4F3YA 4UVEA 2O50A 3DOJA 4CV0A 3U0BA 4CMEA 3TDKA 1PZFA 4MVJD 4ZQBA 1ZMOA 1DHRA 3CKYA 4INAA 4R51A 4XGNA 2AEMA 3HDHA 4YRAA 1PSDA 3Q11A 5C7LO 4GKBA 4DRYA 5BSGA 1ENPA 3GNTA 4PLVA 3GZNB 1G0OA 5COBA 1XLTA 4L76A 3BMCA 2CVQA 3WWZA 2J3JA 4TQGA 3L4SO 1PEDA 4TRNA 4P4NA 4BL5A 1XWFA 1GUZA 2B37A 4R69A 4AJ1A 3PHJA 1H6CA 4A5OA 1E7QA 2WWRA 5L4SA 1QV6A 3BAZA 1EFKA 4IGFA 2P2SA 3NUGA 3U49A 2VZ9A 1BSVA 2DU8A 2Y1DA 3H9GA 4UEOA 4I1IA 1LQTA 2YJZA 4YJHA 5A9TA 5JYEA 3W6UA 1LU9A 3SVTA 2W8ZA 2Q1TA 4ALMA 4BNNA 3JD3A 5JW6A 5B12A 3AI3A 5L7TA 1E0DA 1SOVA 5GMOA 5ES3A 3BMNA 1ZSVA 4CLOB 1F14A 3AJRA 4QFDA 3GVIA 5JC1A 3TWOA 3VHRA 2ZQZA 3ZWNA 4TKLA 3PIIA 4Z0HO 1BDMA 2YDXA 1EVJA 1E1LA 1D1TA 1N8KA 2NU7A 4J1NA 1EUCA 4ZRMA 1LJ8A 5KVSA 5B37A 1QYWA 1MFPA 4OKNA 3COSA 2DTDA 1DAOA 1Q0HA 3O4RA 1O89A 1ENYA 3MZ0A 2C0CA 4TWRA 4PFJA 1T2EA 2X8LA 2D4AA 1PL8A 2X5JO 2B4RO 3AUTA 4W9NC 2W4QA 4CMAA 1LLCA 5CG1A 1PJBA 4FOSA 2X0RA 4OO3A 3SBOA 1YB1A 2PZJA 1EDOA 2UYYA 2ZTMA 5U4QA 1WDMA 5L9AA 4FR5A 3RFTA 3L9WA 2CDAA 5K9ZA 2HMVA 2VNSA 3JQ7B 2O48X 5EQFA 4ZQFA 4WLUA 1O95A 3ANLA 2GCGA 3ZWVA 4PRLA 4M86A 4J90A 3WXBA 1EUDA 3FWNA 1EUZA 2C2XA 1NFFA 1B3BA 4U0KA 3KV3O 5DP2A 1UJMA 2JJYA 4RVUA 4RQTA 5KWEA 2PK3A 2P9CA 2Z95A 1ISGA 2VUTA 1DIHA 1LI4A 1P1JA 4K6CA 3H7AA 6LDHA 3B1JA 5BNFA 4R9RA 2OORA 1YL5A 4TMFA 5I7EA 1I24A 1EK6A 2RCYA 2DPGA 1ZUD1 3ITDA 5TQVA 1T4DA 3INGA 4TRRA 4E5PA 1UXJA 4NBRA 3ZWCA 1KY4A 4NJMA 2VNAA 3F1LA 4JBIA 1IL0A 3AOEA 3ONEA 4E33A 2CF6A 3OA2A 2D3TA 3ROPA 3ZWMA 1O8CA 3EK2A 4KUEA 1N7GA 1A27A 1DPGA 4KWIA 5JSFA 4BGIA 3HG7A 3NYWA 4RL6A 3CPSA 1PIWA 4GGPA 4O59O 3VKVA 1UR5A 3LVFO 4IDCA 3JQGA 1UP7A 2A9FA 4TRJA 4DMMA 3PQFA 3OJFA 4EYEA 3AM3A 1R15A 4ND1A 2EGGA 3CZMA 1NR1A 3H2ZA 4BNVA 1R0SA 2UVDA 4RLHA 5I7FA 4FJ1A 4BKUA 2Q50A 4WPGA 1BGVA 3O8QA 3DFZA 3GR6A 3F4LA 5F21A 1LDEA 1Y6JA 4XYMA 4YVFA 1Y81A 3BMQB 4D42A 1I3MA 5T57A 1CETA 3PZRA 4FFMA 3ZWPA 4CL3A 4LMPA 3E9NA 2YW9A 4LISA 1LTHR 1YONA 4FOOA 1HDXA 3E48A 3ANNA 5LC1A 5KJFA 4HWKA 4NFHA 2HQ1A 2WD7A 2YFQA 3AW9A 1DHTA 2GLXA 1PWZA 4IQ0A 2WJPA 2AQIA 2YY7A 4PZCA 1A5ZA 3LT1A 2FOIA 2Q1UA 3OIFA 4YCAA 4XDYA 1B8PA 3KZVA 1IPFA 1TVEA 4BV8A 1U8XX 4LW8A 1QKIA 3D64A 2PD3A 4Z9FA 3ASUA 3LF1A 4NBUA 2NU6A 1Q0LA 3WMWA 1XHLA 4JROA 4J1QA 4CQLB 4I5GA 4WLFA 1D1SA 3IJPA 4EI2A 3D4OA 4ROSA 5KVVA 2RIRA 3IQDB 3IP3A 2J8ZA 3KVOA 4R3NA 1YH3A 1FDSA 3KSUA 1NX6A 2O3TA 1C0KA 4BMVA 4RORA 5F1PA 2WE8A 3OQBA 4FB5A 3K2BA 2X9GA 4NNJA 3WLEA 1EQUA 3C8MA 2OZPA 4PLGA 2CDBA 2W2LA 3LT4A 1YDEA 3DHYA 1M67A 1QYXA 4RQUA 4W7HA 4UVGA 2JKVA 4B7UA 1ZO8A 1SOWA 4RLSA 2OBNA 3FR8A 1ZXBA 2G76A 1TA4A 1VKNA 4II2A 2PH5A 1A4IA 4D43A 4NJOA 2O3SA 2DQ4A 5IZCC 1I3LA 2GR9A 2Q99A 1CQIA 2QQ5A 4DUPA 3G1UA 1R16A 3HE3A 5AOVA 2VOEA 2Y0EA 5A04A 2ZJ0A 1VJTA 2ZK7A 1XU7A 2VCYA 5TLSA 2NWQA 3ZU3A 4R5HA 2DUWA 2DPHA 2PFGA 1UDCA 2ZQYA 3DONA 3HDQA 2EHDA 3A06A 3GT0A 3PXXA 3C24A 4EJMA 4M8SA 1LBEA 3IL2A 1NNUA 3ROQA 4E13A 1NVGA 3D4NA 5CPFA 2EEZA 2P5UA 2X4GA 4HFJA 3IMFA 1C1DA 1XGKA 3C3XA 3FI9A 2C5EA 5IFLA 1ISIA 4QQRA 3WGQA 1DLIA 4UVIA 3R3SA 2NQ8A 1E5LA 1B3RA 3HJAA 3AM4A 2HRBA 3KTDA 4GSKA 3HADA 4OL9A 3RROA 4D0RA 5KCZA 3WLFA 4JGBA 2FWMX 3OEYA 1PJ4A 5TGDA 1DJNA 3GVHA 2FMUA 4B7CA 2J5KA 4FN4A 1M76A 2OO5A 3AOGA 3G17A 2AG8A 3GEMA 1YO6A 1YS4A 1NPDA 3V2UA 2F00A 1HXHA 2PD4A 5T67A 7MDHA 1P44A 4CR6A 4NZ9A 2H6EA 4TSKA 2C5AA 3AU8A 4GH5A 1GEGA 1W0CA 1UH5A 4Z3KA 5BQFA 2VRCA 2IODA 3Q2IA 4R9SA 1LXCA 1QLJA 4EUHA 4QTZA 1OI7A 4K28A 3GRKA 5BSHA 5DCYA 3F46A 3I9MA 4N18A 1VC2A 3HB4X 4J0EA 3VZPA 3W8EA 2JD1A 3LC7O 3BYZA 4MIOA 4RVSA 4YJFA 4YJGA 3TZ6A 1PX0A 4LRSB 4RV9A 4WLEA 3BIOA 5A02A 5I9MA 3OJOA 3WR5A 1KEPA 1DDOA 4LSMA 2ZB3A 3RU7A 4R5MA 4IJVA 5AVOA 2GD1O 3I9JA 4J0FA 3VZQA 1FJHA 4CPDA 1Y9EA 3GPDG 1WPQA 3DXFA 1QR6A 3U09A 2FZEA 1LDBA 5G2OA 4IMPA 5F3RA 4EITA 1JU9A 2WM3A 4J7XA 4KTTE 3L77A 3IJRA 1NQOA 1DEHA 2AQ8A 2P91A 3HQ4O 1NQTA 1SMKA 3JQEA 3ULKA 1YJ8A 2YHIA 2PKRA 1UAGA 1NVMB 1Z74A 1LA2A 2NU8A 1HL3A 1ULSA 4YT8A 3BA1A 2PY6A 3PK0A 1TLTA 2W90A 5ENDA 2G5CA 2VWHA 1KEVA 1I10A 1GEEA 2B4TO 2NVUB 4BOYA 4RVGA 3VC7A 3AUUA 3QVWA 4PN3A 3FCOA 1L1FA 1NWHA 2ZATA 4MVJA 2AEJA 3DZGA 3DZBA 3QVTA 4JLWA 4IBOA 1FDWA 4NG5A 4BQPA 4D0SA 3VZRA 1ZK4A 3BMQA 4CLHA 1HE3A 2BFMA 3H4VA 5J23A 5DULA 5CEEA 2GASA 1OFGA 4UUNA 4DPKA 2FR0A 1M6WA 1ISMA 4GQAA 1PS0A 3QWBA 1IYZA 3GGPA 4FC7A 5JDCA 3WGYA 1V8BA 4NMHA 3LC2O 2Z5LA 1DAPA 4GGOA 4JP2A 4RF4A 4ZQGA 1P0FA 4KMSA 3OETA 1PGQA 2BI7A 2X7HA 2ZTUA 3FNGA 5L4LA 3SX2A 3KB6A 3BMCB 2DBRA 3I3OA 1HYEA 1QRRA 2JFFA 3CMCO 1PGPA 3Q6IA 1G1AA 4FD3A 3TOZA 1HSOA 2HK7A 4ND5A 4B7XA 1BWSA 1JAYA 3BXXA 3QWHA 4DYDA 1HE4A 2F1KA 2GUGA 3H8VA 5HM8A 3JQAD 4HP8A 4Z0PA 3Q3CA 4Q39A 3F5SA 4OM8A 3TRIA 3ENNA 2G1UA 3FNHA 4EW6A 1DIRA 3RD5A 3IKTA 4ND2A 3ZU4A 2J5QA 3I5MA 4J4BA 4DXHA 1E3SA 4BO1A 4Y6SA 3O38A 4J7UA 1DRUA 1SAYA 3H5AA 1U5CA 1E1NA 4WUVA 3BMNB 1HF3A 2X5KO 3ZHYA 1DIGA 4ZN6A 3I9KA 5HRUA 4FJ2A 4A27A 3ZWBA 4WLNA 2FSSA 2JFGA 4LK3A 5H82A 4YQZA 4ZU3A 1R4MA 4R3WA 2I3GA 4Y67A 2VYND 3Q9UA 5JC8A 3AUAA 4OSPA 1Y7TA 3JYOA 5F5LA 4U0JA 3KLPX 2Q2VA 2WYVA 5DCWA 5K6AA 2IDZA 1Y8RA 3PJEA 4K9DA 1H2BA 1S6YA 3JD2A 5CPBA 4NBWA 2Q49A 1ONNA 2YZ7A 4Q9NA 1QYDA 1H5QA 2DKNA 2X0JA 1PJQA 2X86A 4KUGA 2HK8A 2QRKA 3RC2A 5AXAA 2ZTLA 5IDWA 2VYVD 4E5YA 5C5IA 1T24A 3U4DA 3JYNA 3U62A 5I7SA 1UZLA 3W6ZA 1I2CA 2JFHA 1N1GA 4H15A 4CL8A 4NI5A 4BO9A 5BR7A 3PQEA 1ZBQA 3FNFA 4NU5A 4B4VA 1UDBA 3PRJA 1GY8A 3JQ9C 3E8XA 1ZK0A 4O6VA 4RPGA 4OIMA 3EW7A 5FYDA 2O4UX 4NQZA 4P4LA 4R1SA 2GERA 4B4OA 3DBVO 3EZYA 3EGOA 3PVZA 3SC6A 1IZ9A 3GMDA 4LVUA 5EERA 2O3QA 3GA0A 4PVDA 4CV1A 2CFCA 5F1OA 2G0TA 4MVJF 3RU9A 4GMGA 1N5DA 3B6ZA 5A06A 4XRGA 3ZZNA 4HKTA 3EUWA 1ENOA 4BNGA 3FSRA 4RO0A 4TVOA 1VL8A 1R12A 1X0XA 1ZK3A 4A73A 3W8FA 3H5RA 3FD8A 1CIVA 1ZW1A 4JIGA 5TJHA 1PWXA 3GC6A 4HXYA 3PPIA 5A1TA 2H63A 4NJMB 3E18A 4XB2A 2BKAA 1MFZA 1V35A 2BFAA 3GQVA 4IJWA 4Z9XA 5L95A 1ISJA 4YDRA 4NFSA 3D5QA 3M1LA 4Y6RA 4MIEA 3DMTC 3WTBA 3EAGA 3KM0A 1OC2A 3I4CA 1CJCA 3GHHA 3PYXA 4E2ZA 1H9AA 3LYLA 1LC0A 1YWGO 2IEBA 3KXDA 3ZV3A 3INTA 4XQGA 3I52A 2HAEA 1ZXLA 3UUWA 1HKUA 1U9JA 1YE3A 3L07A 1YVEI 4UVHA 1EQ2A 1RYEA 1IZ0A 2BLLA 3GVCA 1HDCA 4GX0A 1H9BA 3QVXA 3UICA 3QRWA 1NHWA 2VRCD 1MXHA 3JQDA 4KOAA 2BMAA 5CFZA 3DAGA 3RUAA 4TROA 3ZI0A 1PQPA 2WDZA 1O0SA 2NUAA 1BXGA 5JMPA 3UF0A 4CM4A 4UEKA 2IZ1A 3ZWOA 4JXKA 3H2SA 3B70A 1PGOA 4L9RA 3UVEA 4BO2A 1WWKA 3VPSA 3V1TC 1T1RA 2NTJA 1K6IA 3GVPA 3FTNA 4PZEA 2HO5A 3E1KA 4XQEA 4CQMD 2Q2WA 2GZ3A 5L40A 2D1YA 2VTEA 2WD7B 3ZHXA 2E82A 1E7SA 3WGTA 2Y1OA 3UAGA 1H6DA 4FDAA 1NXQA 3S2EA 3JQAB 4FBGA 4A03A 1X1EA 3WG9A 2PV7A 4IIVA 4DC0A 5ICSA 2JCVA 2VWGA 1T25A 3PHHA 4Q3DA 3QHAA 1B8VA 2Y67A 2CVZA 1IUKA 1DIBA 4PLYA 4WNCA 4BS9A 2ZCVA 3JQBC 5EPOA 2EERA 1GYPA 1H93A 3BTOA 5DN9A 4EJ0A 1ADBA 1IY8A 4G65A 2DBZA 4Z9YA 3PP8A 1D8AA 2B36A 1V9LA 4QUKA 3VPHA 1CWUA 1MX3A 3PTZA 4IS2A 4FGWA 4WASA 2Y0DA 1GU7A 3W4JA 4AJEA 2CVOA 1VRWA 4WECA 2C07A 1GPJA 3OQ6A 1S7CA 3L9XA 4OGWA 5EQDA 3WICA 2GGSA 5DP1A 2LDBA 2H1SA 4AJIA 1ZKMA 2JD0A 4Y98A 1X7HA 1U4SA 1UXIA 2QYTA 2PZMA 2BRUA 2EG9A 4AICA 2PGJA 4L4RA 5EIOA 2X58A 3D0OA 4BV9A 1YKFA 3PGJA 1P33A 1DC5A 3L4BA 5IF3A 5HWSA 1NHGA 4IDFA 3ZW9A 3VVCA 4C7KA 1UUFA 4XZ3A 5I9LA 3C1TA 3GDGA 1YB5A 4P4GA 3JTMA 1I32A 1VKOA 4LGVA 1ZEJA 3AY6A 1HLDA 3KSDO 4NU6A 2CZCA 2DUUA 1HETA 3FN4A 1RJWA 2EW2A 3HFSA 3LC1O 4K1LA 3H65A 4MVJP 1F8FA 4ZICA 4TZKA 5ITVA 2HLPA 3EC7A 5BSEA 4CMEC 3AI1A 1M66A 4W6ZA 3ASVA 1AHIA 4IGEA 1FDTA 4J91A 1SBYA 3KHUA 1JDJA 3S55A 1ZJZA 1WP4A 4XIYA 1U2DA 3TQHA 1E1KA 3TZQA 3DMYA 4MPDA 1MC5A 1VL6A 1C1XA 3TZKA 1GL3A 3M1AA 3S2GA 4CM6A 1Z45A 3U3XA 4Y8VA 2ZIZA 2NM0A 5G0VA 1U7HA 3NAQA 5EL0A 1C1DB 3E5MA 4YJDA 3GUCA 1K5HA 3CTMA 1U1IA 1I01A 3I9OA 2Y99A 4PGFA 4CV2A 1XYGA 2FHSA 3T7CA 1DO8A 2DVMA 3PDJA 3HB5X 1KETA 4KTVE 5G0SA 3H5NA 3CINA 1P1FA 5IN5A 3JD1A 1K0UA 3DBRA 1YOVB 4Q3NA 4NK5A 8ADHA 3ONDA 3GH3A 2BFPA 3PLNA 4N7RA 4GWKA 2P4HX 4R4JA 3QQPA 4ID9A 4B4WA 5TF4A 3K31A 2IYOA 2JL1A 1EE9A 2WSBA 3JQ6A 4CR7A 1XIVA 3I1JA 4RZIA 2ET6A 3I9NA 1RPNA 2HMSA 4HUJA 4OAQA 4JCOA 4CMHA 4PZDA 3WSVA 1GD1O 1W4ZA 1PJTA 5GZ3A 2GO1A 1B14A 2DLDA 2QRJA 4NIMA 4P22A 4RPKA 2EF1A 1HYGA 3HHPA 3JQFA 1ZVMA 2J5RA 1V6AA 4KDFA 2D8AA 4BNMA 2Q2QA 3NTRA 3S1LA 4YJFB 1CERA 2HJRA 2OP1A 4YJGB 2EGHA 4LSWA 3WTCA 1U2GA 3TL2A 4I9UA 2J3HA 2BGKA 2CD9A 3GG9A 5T8KA 3EZLA 3HWRA 4CQMB 2GN4A 3B1KA 2FP4A 4UUPA 1UZNA 3DTTA 5I8WA 3AY3A 5KVQA 2Y66A 1E3IA 2I5PO 3P19A 1ZK1A 3GAZA 4S3MA 4FFRA 5TS3A 4E12A 4GVXA 2VWPA 2X9NA 4AJ4A 4ZQHA 3UXYA 1BRMA 1D3AA 1Q7CA 1MXFA 2UUOA 2YHIB 3GPIA 4OQYA 1DFHA 1DC4A 3VDRA 4DIFA 1IPEA 5TIIA 8LDHA 3NDRA 3BZUA 3DZHA 3PWKA 2POQX 2WYWA 4YXFA 2Y1EA 1GFSA 4YWJA 1PS9A 4WJZA 5FF9A 3PI7A 3GVXA 5MDHA 5JCXA 3QSGA 1EFLA 5U9CA 4IM7A 3OBBA 3ZWXA 1TT5B 2OGUA 3CH6A 5ER9A 3WBFA 4DQXA 1ISFA 1AHHA 4J16A 1BTOA 1ML3A 4LN1A 4O63O 2XAAA 5JLAA 2VHWA 1EVYA 4MVJE 4RCVA 4A10A 5DDIP 1OOEA 4OH1A 1CYDA 4PLPA 1VL0A 4DMLA 1LLUA 1EMDA 3GEDA 2AE2A 3AOEC 4E21A 2I3AA 3DBLA 1A7KA 1R0KA 4OYRA 1NFQA 3UCXA
chains in the Genus database with same CATH superfamily
2QA5A 2YWFA 5EJMA 2PS1A 1YCDA 2HIHA 3RLFA 1R37A 4D80A 4MV7A 5B4TA 1ZQ1A 3FYUC 4LCEA 2ADOA 2WWFA 1HQCA 3A1UA 4JLDA 1Z5OA 4EEZA 3KEGA 4QRHA 1ETHA 3H2JA 1U6JA 3AH8A 3SJUA 1Y1LA 4JCCA 1QOPB 4BO8A 3F3KA 1Y5MA 1VPTA 3LQYA 5JLJA 4EG4A 2IEDA 1HK7A 1WE2A 1AGRA 3MTEA 5HOEA 1XMIA 4ZU6X 1TJ5A 5FHQA 1GGHA 2QAJA 2ZYUX 1H2FA 3GJSA 1WG8A 2EL7A 1P80A 3GFFA 5EKUA 1P1CA 4BJ6A 1P0QA 3NLLA 3VR6D 2D00A 1FXUA 3T1HB 3JAMA 3ZZ0A 4BO4A 5C2JB 4ZQIA 3VXKA 5J2UA 4AN1A 5THKA 3U4CA 3FSEA 5DN6A 4EG0A 4BY9E 1II8B 1E3TA 3VOBA 4XWYA 1W85A 2A0UA 2WIKA 2XMDA 5ADHA 5KTMA 3IVMA 1YDWA 4IWXA 1L7AA 4HNSA 3Q7RA 4MYHA 4UQOA 1NNI1 4WN9A 1ETUA 1KAOA 2X0DA 1WVGA 2GBLA 2R3SA 1BCSA 1ZM9A 2JAPA 4QX6A 3E0QA 5HS4A 4OHBA 4RS3A 4WCFA 1S02A 4R98A 2QLBA 5E9WA 4Z7JA 1Y6ZA 2HHLA 3MWYW 3N2ZB 1ZMBA 2CMHA 3OCZA 2WICA 1B15A 1IRIA 2CBZA 3ZGNA 3B82A 4LF5B 2Q5JA 4TVSA 3KXLA 2VAPA 2YX1A 5CCDA 1Y34E 3E9YA 2BM0A 1TEXA 2YIDA 3RR2A 1QR2A 1W8IA 2C3PA 3R3ZA 2NO6A 3CUWA 3COYA 4K2AA 3ZD8A 2AN5A 2VTDA 3SEQA 121PA 3PICA 4QBFA 1P2FA 1OCEA 2B4QA 3MFQA 3GRPA 3AETB 4TYPA 5CYFA 3RSLA 3RFFA 4MB6A 3USES 4PFSA 4P2GA 2BR5A 3KB8A 1M34E 1U0SY 2CSUA 3L01A 3OD1A 4MITA 1FBNA 5EIWA 1TZKA 4WBNB 2VDWB 4DV2B 1JAXA 5BSMA 2BTQA 4MYDA 2JGJA 4BMCA 2DPXA 1YRYE 4GKVA 5REQA 4CIDA 4P82A 2ZETA 4RKEA 3FF1A 4RADA 3PLAE 2NZUG 2V96A 5IBCA 1TTHA 2AR7A 5TARA 3FAKA 1HDYA 2GPAA 5BSFA 3C16C 2QL5A 4D8UA 3WHIA 1SUSA 4W5TA 5JAQA 2WJJA 2PUJA 4CG0A 3F6EX 4X1KB 5C51B 3LLMA 2E89A 5SY9A 5IAOA 2A92A 4B3DA 4L72A 1U2SA 2B0JA 1CJSA 2WJGA 4DA0A 1N4AA 5BVGA 3FNIA 3PITA 3ZTYA 1YBHA 3FF4A 3BPSA 4Y2TA 3AR9A 3MT8A 4HDCA 4ZAZA 1SQ6A 4US2R 1GPKA 2XNSA 5AUQA 2R4UA 2Z1MA 3L8ZA 3WGKA 4RVNA 1ZM4A 1HEYA 2X23A 3DQZA 3STTA 4D56A 1QHXA 1R0RE 1HOXA 1U4NA 4YMTA 4D9GA 2XUDA 1WW8A 1XK7A 1XZDA 1LDYA 3IC5A 1P62B 2UVPA 4HC4A 4RZ3A 4WK2B 3VSAA 2PYZA 4IX9A 1T29A 1QHHA 2XCIA 5JD6A 3FOZA 1YOVA 4K6FA 3QUCA 3ISTA 2X8AA 1L5VA 5JEDA 4G0ZA 4DR1B 3ZV7A 5DYWA 3RSQA 1ZH0A 1FSZA 1K3FA 2X9LA 3WOHA 3FNEA 1Y63A 3RQSA 1OWOA 4AX4A 1EXDA 1G8AA 4FFLA 1FVHA 4PSCA 4PPNA 2HTFA 3CWQA 1UM9A 2F48A 3IVRA 3AJ9A 1DB3A 4OHRA 4Q4DA 4MV1A 4LF7B 1AKMA 5JECA 1UEJA 1H65A 3RQIA 2CXHA 4G9GA 3UB3A 1E7RA 4NK4A 4BQFA 1A8UA 1PJLA 1N34B 3NEPX 4OFXA 4LF8B 3JALA 1E5QA 4RH3A 3ZG6A 2BC9A 5C8XA 1Q3TA 3HR7A 2C84A 2P9YA 1OUMA 1ECCA 4ZMSA 3INYA 3P2KA 4V2IA 3UPUA 1DQSA 3PSHA 4KW7A 2PUTA 4LYGA 1ZH8A 2EIHA 3DHEA 3IOCA 3C7DB 4XQCA 3KQYA 1BGWA 2QE7A 4KWCA 1H1LA 3RSHA 3TF5A 4L7VA 4HXFB 4TLEA 5FJIA 1J8MF 4MWDA 4WCDA 5IG2A 3DXZA 3ZWYA 3BFPA 2CHFA 3ELUA 2FFJA 4R8SA 4CM9D 1OXUA 3JZDA 3W06A 4GYWA 3BD7A 3A1SA 4CQMA 2ODQA 3V1UA 4LY6A 2QVZX 1BXGB 3W78A 2FEMA 1PWEA 4BGUA 4CM4B 3ZYCA 4PYNA 3IPCA 3HS3A 2WYHA 4IX1A 5ARDA 3DDHA 2XXBA 2HEGA 3GNSA 2DFLA 3WP1B 4DS3A 2RE8A 5BOVA 4MW5A 4FS8A 3QI2A 4TS9A 2DFVA 3DQQA 2H5JA 4BB0A 4OHFA 5K01A 2QR2A 2J33A 3LC0A 2ILTA 2Q1SA 1ZSNA 3N0WA 2OO3A 2FX3A 1ZCZA 3DTNA 5JXJA 2XIQA 4RH0A 5B6IA 3LUBA 2C94A 3EGIA 4EGAA 4EFMA 1QG4A 3IA7A 1MVOA 2DHDA 2QSZA 3B5JA 2IK8A 2GEVA 4MHOA 3RTCA 2C4UA 5K99A 1T26A 2FZWA 2J6CA 3ODGA 3Q9NA 2GAOA 4U5XA 5ALGA 1BQ4A 1E3EA 1EYZA 2RJNA 3AIMA 1CUEA 4RJIA 3BQMB 2FWNA 3AHHA 3E7FA 4WUTA 4BU0A 1QYRA 5KWJA 3D1LA 4LGYA 1O58A 1TT5A 3AQIA 5LNK6 3N0XA 2HA2A 3W90A 1Z7GA 1YQDA 1ID1A 2AFVA 2XW6A 1A9XB 3EPPA 5DI3B 4EBBA 4MZDA 2QPLA 1WZEA 3P0JA 1TE2A 3IEIA 4PZZA 5JAIA 2XTZA 3DFFA 5D3QA 3HA7A 5CEFA 1RJ9A 1QNFA 2AFHB 1N3IA 2VT7A 4P5PA 4RZHA 4AX8A 2V74B 3A8TA 3PRYA 1BX0A 3MOIA 3I2KA 3GB9A 5C3UA 5JPCA 2GJ4A 3EDMA 3LQ4A 4WFKA 3FW1A 3OJEA 2ZIGA 5GJCA 2CNLA 1GZ4A 3NDIA 4LC0A 1SCBA 2YXLA 4JI3B 2JAQA 3SXPA 4TRMA 2ZQ5A 3H9QA 4DB4A 1A9TA 5E0OA 4K6KA 5BUZA 1A69A 1Q14A 5CVTA 1QO7A 3TG8A 2PUBA 5CFLA 1LK7A 2HYDA 1BWQA 2WU8A 2ID8A 1OGYA 3ZGZA 4PSDA 4X94A 4KLNA 4RVFA 4F45A 3LP5A 1PFUA 3TDMA 3TR5A 2V7WA 5FTNA 3OZBA 4FJ0A 3T7SA 4E2YA 1UF9A 3MCZA 3PRHA 2NTNA 3P0EA 3A3OA 4DLVA 2XJ9A 2ZCUA 5DNDA 1Y80A 1BOOA 2PKEA 1TK2A 1YCFA 1AK9A 1YC5A 1ZDMA 4KX5A 4HNTA 1MB3A 4BO6A 4YY3B 3RB8A 3BCRA 3I2FA 2GD6A 3F90A 3BJZA 1QP8A 3DVAA 1FF9A 3P9KA 4US0R 4YRQA 2O8FB 4C06A 4D26A 1ZIDA 3ORRA 3SAJA 1AXEA 1Z7BA 2WEKA 5EHXA 4W7SA 2VSNA 4ZZIA 1IQRA 1VPLA 1U3UA 1W94A 1YA8A 1UWCA 4TTSA 3KKMA 3R0XA 3TW8B 2XLCA 1N2CE 4B9AA 5HTOA 2ZVQX 1LEHA 3BSYA 3D43A 3U4IA 4G1VA 2ONYA 1JKXA 2YWXA 4R7ZA 1S7GA 5GVSA 1E6LA 4G86A 4E5VA 5U1PA 3DBHA 1XMPA 4DR6B 3C0KA 3RWOA 2P3OA 1P9WA 2C4TA 1NFRA 4BMNA 2OXFA 1YJ5A 1YFLA 3IXQA 1OV6A 4FYXA 4S0ZA 5CB0A 4EMBA 3TUZC 1TAUA 4HB4A 3LHIA 3NTOA 4KREA 1V8OA 4D9KA 4QECA 3CQ9A 1T1IA 3MRSA 1SC6A 3PPXA 1JLKA 1LBQA 2GS9A 2DUJA 3AHCA 3CE6A 3G0OA 4RIIA 3K8ZA 4UC0A 4WXHA 4GM0A 4A2CA 4CI9A 4EG1A 1H2AS 1BS1A 1GCAA 2ZJBA 4D9FA 1XN4A 1F5SA 1GTG1 3OD5A 3GZ4A 4NV0A 1T4GA 3C70A 4JZKA 2NTYC 5JXIA 4BDSA 4ETWA 4GOXA 3KG2A 3FUVA 4RW0A 2H2IA 1NYLA 3DZIA 1N2GA 4KVZA 1SBHA 3TN7A 1OBFO 3JZIA 3GEHA 1A97A 2O2ZA 4OP2A 3VJLA 4O02B 1F06A 3VTZA 1T2UA 1XZQA 2XBUA 1TTQB 1DJLA 2IVZA 4FCWA 4FGKA 1FMFA 4M3NA 2QT9A 2D2VA 2VZEA 3V2HA 5IC5A 3ZD9A 1SKYE 3VR5A 3IVXA 3ZNOA 4UHHA 3SYRA 5A4AA 3E6AA 4IJ5A 1QXSA 4PFKA 4NBKA 1TKBA 2HGZA 1R64A 1DXYA 4OMUA 2WWIA 4RJTA 1EGHA 3GCDA 4GPD1 5KB3A 4A0SA 1G21E 2R66A 5E38A 1NR7A 3MJCA 3TJRA 4DLKA 4JJ7A 3T3MB 2ZCJA 1XYYA 1YD7A 3BK1A 2J0QA 1TFUA 1PGNA 2WQ6A 1KQFA 2FPIA 4I1SA 3DR3A 4NDNE 4W6QA 1NYQA 1GG8A 2FP4B 2IIVA 1ONPA 3OHSX 1DBWA 3C8ZA 4HBGA 5IH3A 4GOKA 1AN9A 1UKZA 2WTBA 4D6PA 1ISSA 2R0QC 4WINA 3T7EA 2I34A 2QN6A 1VA5A 4WAUA 3W6NA 3UH1A 2Y8EA 3BH0A 4F4DA 2O4CA 1JBEA 1B6TA 2H9YA 4JBGA 3L5OA 4O8CA 4ZEXA 3I01A 3HN6A 4KGZA 1KOLA 3M4XA 4ZANA 3RIEA 5AW0A 4MV5A 2YYZA 3M4YA 2GSWA 1KI2A 1K2WA 2IEAA 4EH1A 3ET5A 4BVGA 4HV4A 3G5TA 3LHFA 4EGFA 3EHEA 5EMJA 4M37A 1KI3A 2PFSA 4KI7A 3TGPA 1W36B 4X54A 3TO5A 3QX3A 1LLDA 4R1PA 3HP7A 4N49A 2IYQA 1WCYA 1HL7A 4E3WA 5HHTA 1LB1B 1M1NB 2X3UA 3I9FA 4L9AA 4NEGA 4ZAGA 4XYEA 3BDVA 4AULA 1M5UA 1Z82A 1ZA1A 3OOJA 5KNDD 5LQCA 2FW8A 2O2YA 4ZAYA 5B3AA 4E2FA 1AQNA 2QTLA 3NETA 1X38A 4KDEA 1P74A 4JLJA 4NZZA 4DRZA 3ZJTA 1OASA 1RZVA 5DRYA 1YCHA 3AKZA 5LYJF 1L5WA 1XZJA 3GN2A 4KWTA 4P98A 3PL5A 5C8YA 3UMBA 1MABB 3U31A 5KNLA 4J4HA 3I23A 1Z8HA 4GZMA 3FCEA 1Y5RA 1Q7EA 3G9QA 3IUYA 4X7BA 1AX9A 1BVRA 2R8YA 2ZR9A 3C85A 2G0NA 3LUKA 4AJKA 1C14A 1Z7EA 1MC1A 2NT4A 3MWDB 1SUBA 2FQQA 2QE7D 1V1MB 2XHZA 3CONA 4HG2A 2IZOA 2EZ8A 4YLYA 4F9GA 2V55B 4YJ3A 4FKMA 4KE8A 1KDYA 4FKBA 3A25A 1UQUA 5CH3A 5EZSA 2ZP1A 3WNZA 2FPKA 2I8CA 4D9HA 2I3ZA 1NV9A 2XWJI 4BNDB 2V5AA 2BFCB 1BCRA 1CZRA 4NYJR 4Q4HB 1LRJA 4EGQA 2EXXA 3KTAB 4UFPA 1J6UA 2CE7A 5LZ9A 1A9YA 4EHHA 4TYNA 3A1NA 1N36B 1XVUA 4F2PA 4UJ5A 5BXQC 2F55A 2IBMA 1FNBA 2YMQA 4KQEA 2FUNB 4QZVA 9LDBA 4URWR 1SK9A 4QPPA 5K3AA 1R27A 2VCEA 4I3HA 4CKBB 1RWMA 1KHHA 1E2BA 3WI7A 3BE5A 1CV2A 3DEYX 5H68A 4DV1B 2EKBA 1R6XA 4IXNA 2MHCA 3EF3A 1TIKA 1WHTA 4KO8A 4DN6A 1F5NA 2GK7A 2VNHA 4L9WA 7MHTA 1RM3A 2HOQA 1I0LA 2QP4A 4P5DA 4QGBA 5HJ2A 3HSKA 3TSWA 3UGTA 3NRCA 1GLNA 4N3GA 4DYVA 3NMUF 5CAEB 3WIVA 1E3WB 5J4HA 4XRRA 3WGIA 3B8EA 3T61A 2ZUWA 3GWZA 1Q84A 4KRXA 1RYDA 4C6TB 3RNOA 1E1MA 2VRNA 3WIDA 3NHAA 3B1WA 3O3CA 2VQ3A 2ZM5A 3TI7A 1OSNA 1XTIA 4RMNA 1M7GA 2JAWA 4OI1A 1Z12A 3VNQA 2Q28A 5FUYA 4UTXA 1NT2A 2XWBF 4XW2A 4TLAA 1ULUA 5KJ1A 4H4CA 4RFVA 2EU8A 3UK2A 1ZI6A 3JSAA 4JLUA 1T1JA 4KX3A 1SOMA 1Y9AA 3LO8A 5EWMB 1MQAA 2QB5A 3O7WA 2LKDA 4HUTA 5DTRA 5AXDA 1ZUHA 1GTVA 2AJLI 4GI2A 1TB4A 4U6QA 2AYXA 3Q9LA 4KR2A 3HXPA 1GLVA 3LK7A 1F2TA 2CYAA 3OTHA 4XKJA 1HLGA 3RIMA 3ROMA 2C5FA 1QTNA 5AUPB 3TSCA 3OWXA 3V4PB 1SGWA 1WOMA 1JA0A 2CB0A 2JJMA 2OD9A 3EFEA 2Z3ZA 3OIYA 4IFBA 4L8VA 4OHZA 4ZI7A 3GJ4A 1CQJA 1L9KA 1D0IA 2C0PA 4ZODA 5ILOA 2BZ0A 4B1FA 1BJKA 2GEBA 1KVTA 4JN6B 1VDMA 1F8XA 2WMYA 2ZB7A 2E2WA 4IDAA 3BM5A 2XVAA 4DM4A 2CDRA 4BCCA 4C4SA 4NCXA 1TT7A 3H5IA 2H4FA 2ZVJA 4BQIA 1YE5A 4UDYX 1J20A 1Z4MA 5AT1A 3OFND 1GO2A 1WY7A 1XD2A 3EY9A 3PIRA 4U5QA 2V7TA 5EZ5A 4ZCMA 4TYYA 2IY7A 4ROTA 1ZRMA 2ZU6A 5LU8A 2ZBGA 4HLUC 4L8GA 2FKAA 4TUYB 2GMWA 1H0SA 4OQZA 2WHPA 4UCQA 1O6ZA 2YV1A 1TA9A 1B6RA 1DQNA 3FPHA 3LQ1A 1QZXA 2RH8A 4MYTA 1P1BA 1Y3BE 3DMDA 1P9LA 2IU3A 2ZWIA 3KNZA 4MGIR 1AA9A 1J8DA 2F90A 1C7RA 3PRKE 3ZE9A 5JCZA 2VT3A 2YUTA 1G3QA 1GPAA 3S68A 3I6QA 2EFEB 4LXTA 1PR9A 2FF7A 3MTDA 1N0HA 3I8XA 3QW2A 4GXTA 3KS9A 3Q7PA 3K0FB 1MEEA 2E4VA 3D7LA 4K6OA 5EQTA 2IYAA 1U5BB 3BD6A 3ENKA 4PAOA 2W2KB 3W4IA 5ESXA 2IUYA 1H5NA 4CLRA 4TTVA 1ZH4A 3KDAA 5FUWA 3WDKA 3WIEA 1NATA 4HRXA 4QO8A 4ER6A 2FMKA 2JGFA 4K9SA 1J0AA 3BWVA 2F3QA 1GAWA 1JYEA 1AKYA 4Y3UA 1R4NB 4CMJA 4YAKA 4ZMBA 5JTTA 2VFAA 2ATCA 4PCUA 1ULTA 4RZXA 1A88A 1QB8A 3RUCA 5CJJA 1NN5A 2I2WA 5L45A 1YMQA 2MSNA 3JASB 3ND5A 1F3OA 2XV1A 4FFOA 4FP9A 3UJ9A 4QJ5A 3NWOA 2OPHA 2ABWA 4L16A 2DMRA 1D4AA 2R7NA 1K8ZB 2R1VA 2XMZA 2ZWAA 2I2BA 2Q4OA 1UFQA 3TMAA 2DB3A 5FPPA 2DT8A 6GPBA 4RF5A 4S05A 3E7WA 3BRSA 3HJTA 2WJZB 1Z6QA 4GI5A 1GQ2A 2C3MA 3B6JA 2YJ6A 4GMXA 5BY2A 4MJ3A 1Z88A 2QPAA 3NTQA 2JIMA 4NMLA 1XTSA 1DQRA 2B1JA 3W7AA 4G81A 3DKVA 3NBUA 5CT5A 1P17A 1UZUA 2JFYA 4KWHA 4E09A 1NMYA 2C2BA 2FSVA 4ES6A 3DBIA 1FXSA 5ALOA 2W4MA 4X7PA 1NOJA 2H1FA 4IH1A 4YQFA 4QKQA 5LN1A 3TFOA 4B8WA 4Y9DA 1RI5A 2E4XA 3ZE1B 1GV1A 2DETA 1XCMA 2O7VA 4RC9A 1MP0A 2QRQA 3PYLA 4BFXA 1AJEA 3TLEA 4M55A 3Q98A 4KQXA 2ZVDA 3BRWA 1NF3A 5KKAA 1NUAA 1N92A 1E69A 3B3JA 1ESDA 3FDXA 3BGDA 1Z0UA 4B0OA 1PQ4A 4H16A 5ALIA 4NU0A 4OXRA 1Z6YA 1FNMA 2AOXA 3DKPA 4BVBA 2LR0A 4M98A 5H4GA 3A4NA 4FDMA 3DDZX 2IPAB 4J1SA 3JV7A 3DMRA 1DEAA 3GF4A 4MTLA 4N1AA 3N70A 4ZVRA 2HJVA 2YWEA 4JMPA 4I5DA 3RCBA 4D7AA 2B1IA 1IEVA 1OXBB 4KPFC 4F6CA 1HE5A 4MP8A 4O4LB 5G4KA 1FUUA 2QI9C 4IG4A 4TWIA 3DWFA 4XYBA 5FFNA 4BKRA 4DWOA 4F9EA 5A4MS 1XVTA 4BLTA 4I9NA 3D7RA 1GUDA 2IIQA 3PXCX 5KYYA 5ER6A 4XJTA 3N8KA 4KQ6A 5D5PA 2Q45A 5H83A 2B7LA 2PJDA 5EZYA 3QQ5A 1FL9A 5WRFA 1CVIA 3A1TA 1JEOA 3RUFA 5A4IS 4OQDA 2C9CA 3BMOA 3VYSB 4E08A 5T8KC 3F9IA 4FIZA 3CUYA 1WMDA 4M0PA 1UANA 3O2JA 1NW7A 2VBFA 2XF8A 1IBLB 1NRJB 3F8TA 3JAWB 3ZOKA 5H59A 3MAAC 4YRCA 2XT6A 4Q16A 3DM9B 1UMDA 1PG5A 2X1HA 1KIAA 3CN7A 3L84A 4ER3A 2V7XA 1OZAA 2DLCX 4E5NA 2NU9A 3EQ6A 1WXWA 1H0KA 2J07A 4C4YA 2R6JA 4GQIA 4LC9A 2UV8A 5LB2A 1WCIB 3N2GA 4GM4A 1PKXA 3GNQA 4MWSA 3G8YA 1AQJA 1ZIYA 3Q8XB 4YCBA 2CN1A 1QDEA 4ITRC 5E8RA 2F1OA 4DXAA 4O4JF 4Z4IA 1ORWA 3K96A 1G98A 2VBIA 3QXGA 3W77A 5DOZA 1LZLA 3L04A 3G88A 3IERA 3QFRA 3ASZA 3P9RA 1OMOA 1U7TA 8MHTA 2AJ8A 1NQ5A 5BQXA 1L7OA 2BFDB 1JG7A 4P38A 4QIHA 5GAJA 4XR4A 1PR6A 5DLEA 2AKEA 1TZJA 3DO5A 3DE6X 2HEIA 2ZDQA 3KZCA 5MHTA 4TZ6A 2UDPA 2UZIR 2BGWA 3N6VA 3CUEF 3JR7A 3WA7A 4WOKA 1LCIA 2Q62A 1T0HB 4K5QA 1PYOA 3ZLVA 1TJ3A 4RCZA 5IEJA 3FPLA 1FFDA 1I14A 4W1PA 3UGKA 3P0FA 3ZVRA 1J06A 1J33A 3C6YA 3LT2A 2FUKA 2FUG1 2W43A 4LNUB 2HMUA 4C6HA 4BFLA 1ILWA 4F3CA 1HRDA 2B9EA 4PZ0A 4UDOA 3WRWA 2PEZA 3OG9A 2BI4A 2OG2A 3MMNA 1L7VC 1JFFA 1WX1A 2WKQA 3H42B 4RUKA 5PGMA 3TFQA 1FMJA 3G3EA 4I4NA 2H4ZA 2VSOA 4O8ZA 4AVYA 3ZX4A 4YCLA 5HUJA 4GPAA 2IWHA 1W0JA 2RBEA 4HOYA 4Z8XA 1T13A 3T5AA 4TTAA 1P2VA 1GN8A 2BBWA 3HKCA 3PJGA 5A3VA 3SHFA 3VH2A 3VTFA 4BAUA 4MRPA 1T9DA 2IL1A 4RANA 3LX8A 1HLFA 4BFTA 3PFCA 1O9BA 4WK6A 1ZWLA 4WKBA 5DHSA 5I7HA 5K6RA 4XASA 4XX1A 1FXWF 5AQ1A 4WK4B 1CD5A 1X7ZA 4FT4A 3RJ5A 3O8OA 1EJ0A 3F3MA 3QEKA 3QVUA 2IXBA 2B34A 3JATB 3INRA 4MQEA 1QH8A 4MRAA 4QBIA 5F5XA 1W4BA 3V2GA 4BKQA 5JCOC 1W93A 4N5IX 2LZ0A 3MUFA 5AVKA 2Q3EA 4HXEB 3IXLA 4J6FA 1Y4SA 1OV4A 1T9BA 5F4BA 4D8VA 1RRCA 3QKTA 3VU0A 1SA0B 2ZT8A 3FCAA 1UC9A 1CRWG 2DRIA 3IRUA 3CLSC 3EAQA 3DEKA 3LKBA 2VDKB 3IV7A 4XD7A 5DZSA 2B5VA 3OQNA 1VSTA 2FSGA 4GZLA 4ATNA 3W8DA 4C88A 4PPQA 2XQKA 1DJOA 1OFUX 4OA8A 1G1MA 3AF3A 3C1OA 5JS6A 2N42A 2R65A 1U0TA 3CVJA 3CBGA 3A9WA 3O8NA 2O8BA 5KOYA 1SB9A 1UPTA 4NCNA 4QFCA 1HGXA 1TCVA 2HHJA 2WF6A 4YFVA 1SO8A 2QGNA 3IV6A 3R0IA 2O3UA 3EASA 3FJOA 4YAEA 2OR3A 4Y2SA 3ZUPA 3ZD7A 3PDCA 4QJ3A 1R9MA 3BIFA 3C6BA 4GRIA 4LZWA 3L7CA 1YZNA 4OPMA 4X93A 5KNBA 3AO0B 1KO4A 1TJNA 4WDRA 4GE0A 1TCCA 5LL6P 1JEEA 2QIPA 1K3UB 1GSAA 2D4HA 3C5VA 4FMCB 4JJIA 5BN3A 1UBTS 5TMEA 4QDTA 3ZNPA 1K7FB 1TL7C 2NNLD 4XIJA 1YHYA 1U3FA 3RKUA 1UZMA 1UBSB 1MX9A 1KFEB 1N6KA 3S99A 2QT0A 4LXHA 3ZU2A 4EYQA 5AD1A 1BXKA 1CUGA 1CRLA 2WSMA 5IT5A 3HFJA 3ANYB 4BXOB 5A3RA 5KX5A 2JGMA 1C3OA 4Q24A 1Q20A 4WT7A 2QENA 5GQSA 4JMLA 3OIVA 1IJBA 3CRVA 3PC6A 4IXMA 1WQ3A 4KSYA 4L57A 4RGBA 3RRMA 4RTMA 5G0UA 1D6SA 1F6WA 1ESCA 1AZSC 5I8ZA 3ZDZB 1KNXA 1YDFA 4PBRA 1GQSA 5C53B 2HF9A 5CG1A 2GN0A 3FR7A 3SLKA 1N2ZA 1VSBA 2QWXA 1QGUB 1V8PA 4JDUA 1Q7GA 4EHAA 3L8MA 3ZQ4A 4DMRA 3RAPR 1WS6A 4N3AA 4UHFA 5DGDA 5EXDA 3TRFA 2V03A 2ZJ1A 4NF2A 5BQOA 4BVLA 3BEDA 3BB1A 3ESRA 3JQ7A 3M4ZA 4WV3A 3RBZA 1KAHA 1X14A 1L5FA 3SF8A 4C7MA 1X15A 4S35A 5U4XA 1ZNQO 3OX4A 1A72A 4DWVA 3VBEA 2BIFA 3CR7A 1D2EA 1G42A 1SWVA 4IZOA 4J8PA 4YAFA 2YWCA 5E2BA 3IQHX 4KXQA 3OX3A 1N1DA 3L41A 2GPYA 3TNYA 2JGNA 4BNWA 1E0SA 2RJ3A 1TKAA 3HB0A 1GRRA 5DYYA 3CZAA 2R7AA 4O1HA 2ZRBA 4P84A 4D4MA 2ETVA 4RIFA 2HDOA 4EG8A 4YRIA 3C6QA 1L4FA 1GXSB 4C0KA 2PUAA 3C4QA 3IUQA 3MGAA 3VAZA 4ENVA 3B51X 3KZ1E 4ML3A 4R8RA 4ZDJA 4TVBA 1QMPA 4B79A 5J5AA 3SOZA 1XJ0A 5FTMA 4DG5A 2ZTSA 2EVWX 2R47A 3KYIB 5CLJA 3OIUA 1DTEA 3LA8A 4FW8A 2OL4A 4WNAB 1FFAA 1CJVC 3OH8A 3P5SA 1XK6A 2TECE 2I3DA 4MW1A 1EBUA 3CUSA 5FWNA 2WKWA 1SR8A 3NEYA 5FJJA 1HT1E 2MCFA 4AZWA 4EF5A 3QMMA 3K0AA 3PJFA 3HL4A 4L75A 2FR1A 4MVJM 2QVXX 4MA5A 3V8BA 4DDVA 1PL0A 4CTJA 4BLOA 4F3RA 1AGYA 1RQGA 2O8CA 3RO7A 5T4FA 2Y0CA 4FYJA 3QTTA 5COAA 1LK0A 5LR6A 3F1KA 3MTAA 4AMZA 4CG1A 3K30A 4AK9A 5DGXA 2QRPA 1NBAA 1YZHA 5CVJA 1LPOA 3AX6A 2JFOA 4FI3C 2C59A 4DCOA 4UPEA 4FDUA 2A1UA 1AKEA 1R18A 4UZFA 4EQ6B 3CYFA 1GKLA 1M7BA 4QFBA 4V0OA 3EEOA 1EEHA 3L93A 1TMGE 1NSTA 3MWLA 3Q5DA 3MJVA 2YASA 2FR8C 4H59A 5DHTA 3O26A 1CZUA 1PFKA 3U4QB 4ZTUB 3AEYA 3FDZB 3VH4A 3ENZA 2ZI3A 3DT6A 1H1TA 4PC2A 2P0EA 5DB4A 4DADA 3F73A 3QKIA 4OLBA 3LKDA 3WMXA 3WYBA 2B83A 4TQUS 1G3MA 2AW5A 3HUFA 5E1OA 3KKOA 1N0WA 2P3SA 1H6AA 3LECA 1BS2A 3V6LA 1O94C 5EMLA 4CHTA 1L5OA 3MG9A 1RJGA 2WWWA 4OKIA 3GBPA 5DEIA 1S9HA 1VMKA 2PSFA 5GOZA 3V97A 4BX0A 3K71B 3GGOA 1QDUA 2B92A 3W5VA 3EH2A 2OC4A 3EVFA 1PHRA 1C0EA 2R97A 3M2PA 3NH6A 4YRBA 3KQNA 5IVHA 3UB2A 2GX6A 2L17A 1RAFA 3IODA 2R11A 1A77A 4IMIB 4AIIA 2XXAA 2PWZA 4L8FA 4I5FA 3Q7SA 2XRFA 1Q50A 3TCNA 3TLAA 4D44A 4NBTA 3OE4A 1K8YB 5GGXA 4DABA 4CIVA 3AVTA 2Y76A 1J5XA 3BB3A 1GTL1 3BHJA 3DV9A 3H5WA 4G97A 3S29A 4PG6A 1Z2PX 5F7ZA 2J3IA 2OE2A 1BX3A 1JALA 2V65A 1J4AA 1RBQA 1US8A 5A2QA 2E49A 1UDXA 4DDMA 2R1TB 2GILA 2I29A 1SM4A 2QAGB 1Y7HA 3FYHA 2V9CA 2IW1A 2NZWA 3LIPA 3RYTC 4WESA 1HTBA 4CTMA 3IAXA 2DF8A 3UMMA 4FQ7A 1PYDA 1UPCA 4KQFA 5KYVA 1KPIA 2QP9X 3AI7A 4ND4A 4DZRA 1YRLA 1C4KA 2PMDA 2QRUA 3HNOA 3OE7A 4I55B 4XB1A 4KXFB 2BUBA 5HBRA 1L1RA 3OQOA 5ALLA 5D7NA 3UAYA 1UXKA 1I3NA 1IMJA 2AFRA 2WK1A 5AJTA 4AY5A 3T8YA 2E4UA 3WL8A 4S1TA 2FG5A 1Y82A 2EJWA 4HVLA 1K7XB 5FBZA 4CG3A 3B53X 4KQCA 2GTHA 5GONF 1H3NA 1W0JD 1TYBE 1XDGA 4UMFA 5CXSA 5E8JA 1JDVA 1KZ9A 2Y2VA 3KWJA 4MGHA 1KL7A 1P9NA 2CDCA 2J3EA 1JR4A 2XNJA 2I03A 4JP2A 4RDHA 4ZHQB 4FYWA 5GOTA 5F23A 1P2UA 3JVUA 4NENA 3ZXUB 3ISJA 4U6NA 5LDHA 1V7PC 4ZKDA 4Y7CA 1OFTA 4A2WA 3FPFA 2BDTA 4DV3B 1SCUA 2XAUA 2RG1A 4DTCA 4FW9A 2CNKA 4LXUA 1ATIA 2CJYA 2XE4A 2XUIA 3FVWA 3GJ8A 3PD7A 3MQFA 4DEXA 3VKUA 1B41A 1V7QA 3TNLA 5F7OA 2PE5A 2B8JA 5KPDA 4OP1A 2W2LD 4ZKEA 4TPKA 1YDMA 1RXYA 2FV8A 3UZUA 1K4YA 3B78A 1UBEA 4Y2HA 5AXBA 5I45A 4V0LA 1AQ6A 2IOQA 3P8ZA 2GYUA 1AT1A 2Z0MA 5HKKA 1TEHA 4A8JB 1H94A 3FMFA 4AS2A 2CUNA 1COWA 5ILGA 5CDYA 1U02A 3NHLA 1T2AA 3LFTA 2ZYAA 2O0KA 1SUPA 1L4BA 3E22B 3LCMA 4EEXA 1P1HA 3UUGA 3HM9A 1ZINA 3IAAA 2Q7XA 1GDHA 1RS0A 2XQVA 1GZ5A 3PPVA 1NLYA 5IBQA 1BYUA 2VZ0A 1LJLA 1EUDB 4OUDB 3WVNA 1A8HA 3QELB 1S8AA 3EODA 4M9CA 4WRRA 1LI5A 3KUUA 3QIAA 4RJKA 5AW7A 2HXSA 5E6SB 5K3OA 3FPEA 4RPHA 4HN2A 4ZA2A 2BPOA 2RBKA 4TL8A 4C0WA 1E9SA 2GO7A 1LDNA 3PNBA 4QJBA 3A6DA 3BILA 1QH1A 1EWVA 3OJ0A 3WB9A 3KFLA 2J3KA 2SICE 1TO1E 2P7HA 2G7ZA 4MUMA 3CH4B 3AR2A 3L02A 4MARA 5IFKA 4H7DA 1I4WA 5FORA 1EDZA 2GUWA 4EW3A 2OLKA 2DLNA 1AA6A 3NATA 4OAPA 1LTQA 1N5MA 4TV9A 1WAMA 2IYTA 1QMGA 4M1WA 4WY5A 5GP1A 1O9GA 4KV7A 3S2UA 3L1VA 5AKLA 4OSEA 1Q7BA 3OPVA 4KFTA 3QITA 2EX0A 3K5PA 4CW7A 1FU7A 2O2SA 5C1BA 2JI6A 1U8CB 3L0ZA 4V0MA 4L5IA 3GCZA 4UBIA 4DLLA 1PI3A 4LSGA 3WJAA 4OXNA 1WDKA 5L3QB 3I42A 4CM8B 1SC9A 5TMDA 1DIOB 2A88A 4R8MA 1D7AA 1T8PA 3GIWA 1QWOA 2PVPA 4CEIB 4PCLA 1VLLA 1SNYA 4HPXB 1NBMD 2I7VA 3SS8A 3AKCA 4CMIB 4DR3B 4AWAA 3DMHA 2VUUA 4MKFA 5CXXA 4OX9Y 1VYTA 5LLDA 1GT91 2WPDD 1ZSYA 3EY4A 4J49A 4BQEA 1VBMA 5A62A 1YHZA 1TNDA 2G4VA 1JLMA 4MJLA 4YRJA 16PKA 1FQWA 2ZW9A 3KSZO 4Q1AA 3SQLA 2AC4A 1UL1X 3EH1A 3MWFA 1W5SA 3R3JA 4YS6A 3G59A 3UYKA 4KR9A 1WEHA 1GIAA 2J0UB 5EP3A 4UD2A 1I6MA 2R7MA 2YQ5A 2C9YA 3BRQA 3O8QB 4RKYA 1R6BX 2XDYA 1R6TA 2C4MA 3C3WA 2GK3A 4Q7JB 3A32A 3DTVA 3OE5A 4MDYA 4Y1RA 1CY8A 1D4FA 4DIOA 2OK8A 4YGXB 1MG0A 1ZZEA 4AN0A 3ADKA 2J30A 4DJTA 2JK0A 3IAHA 2FMFA 2DHEA 1MC4A 1V7CA 1IDOA 4D1YA 4G85A 1JT2A 3W0LB 3WS7A 1XDSA 1WUYA 4FOLA 3MJFA 4JJKA 1B1CA 1AF4A 3QP9A 1MB4A 3MCAA 4QAJA 4UBNA 5A03A 3L7JA 1OILA 3HP1A 3PX2A 4PYIA 1E62A 1E66A 1VP3A 4MQ5A 4H31A 3UMRA 3LNTA 3NG1A 2UXDB 1A7JA 4IZIA 4HH1A 3RKSA 1HSZA 2H2DA 2BBSA 1Z35A 5ALYA 1VPWA 4PGMA 4IDOA 4LYJA 3DOCA 4LRYA 2IA5A 5DM70 3DGEC 3AKYA 4P33A 1YZUA 4P5EA 4EHBA 2R96A 4GHWA 3GP3A 4YCSA 5GTDA 2X5OA 2GHTA 2NVUA 2QUJA 1IBSA 1YZTA 4IUBS 3UWKA 5CFPA 4XJVA 5ED4A 4S04A 1SEPA 1W1IA 4XJSA 2HI0A 5JQGA 5DMXA 5JVDA 1UK6A 3GEEA 4CDGA 1LVHA 2GEKA 3D8UA 3X2FA 1KC1A 1KYQA 3RUDA 1G66A 3NKLA 4HYYA 4Y7DA 5FL7A 5JJ5A 2WZBA 3E23A 2Q5LA 5B4UA 3PCRB 3BX1A 4RMIA 2BMWA 1CE8B 3BMXA 1Y5IA 1GYRA 2Q6LA 3MGKA 4IHQA 3ZCXA 5B6PA 2TMYA 1QPZA 1BC5A 1ESMA 2GPNA 4H3SA 3DOJA 1EK1A 3QVMA 4OQQA 4Y18A 5FUXA 4CMEA 3HYSA 1FP2A 1TM3E 2JLSA 4UM5A 4B43A 1R3DA 1CUJA 4WI1A 4ZQBA 4RK4A 4V39A 3S8EA 2VTKA 3ZQJA 1FVFA 1FW6A 3RS3A 4XGNA 5CLLA 1SCDA 1JR3E 1AKNA 1C9EA 1M2VB 4J29A 2QRVA 5M04A 2H4WA 1II0A 3ZVLA 1E2HA 3OPNA 4YPVA 2ZXFA 3JZMA 4RK5A 4FWTA 5COBA 3ZLJA 3L8GA 4NDZA 5DVZA 3U7RA 4KO1S 1HDEA 2J3JA 4HAOA 4TQGA 1JIVA 5LYYA 3O92A 3SN6A 2IHYA 3VAYA 3WSTA 5EHZA 3VR4A 1XWFA 3CA8A 5EZQA 1YU6A 2XT0A 4AJ1A 1Q77A 5LP6C 4HVCA 1F1BA 3AVQA 1E7QA 2WWRA 3V1KA 3MS2A 4EJSB 5L4SA 1QV6A 4IGFA 1JQAA 1VA4A 1Z6TA 5A5VA 1C2TA 1ZD5A 4HS9A 2CEAA 3NUGA 4PO1A 2Q4DA 3KOXA 4JYMA 3TSZA 2V8OA 1HOTA 2OZKA 4JENA 4TTPA 2F2TA 1IXKA 3O1JC 3B2EA 3T3DA 2FUEA 4DDHA 4A2PA 5CDHA 2ZUTA 3W6UA 3OESA 2A5FA 2OXEA 4ALMA 3SVTA 4QYWA 4BNNA 1V5WA 5B12A 1W49A 1NVBA 2OV3A 5IYZB 1E0DA 4YXWA 5GMOA 4B73A 1CEXA 5ES3A 1ZMXA 4GI1A 3RHSA 4B09A 1F14A 1WMSA 2F3UA 1RI3A 2Z4SA 1QZZA 3GVIA 1RI1A 1ZZGA 2PGOA 5JC1A 1AGPA 3TWOA 5K0TA 3GP5A 3OSZA 4WACA 4JT2A 2ACVA 2MSEB 3UK0A 1HDIA 4TKLA 3PIIA 3ZJUA 2YDXA 1EVJA 4U2CA 1JLLB 2ZIVB 5CXUA 2WHEA 1CEYA 2ILVA 2NU7A 1K98A 1RMYA 4JI7B 3WJ1A 4YALA 5B37A 1P5HA 3K94A 1QYWA 3LOPA 3G5AA 1L1QA 3TINA 3RYCA 3COSA 4RLQA 3B3AA 5JD3A 1PT9A 4D5EA 5JWOA 1DAOA 2D5IA 4HZUA 4ZCPA 3GJQA 3IMCA 4P86A 2OBXA 4IHJB 4CTNA 1TM2A 1GAQA 2QMZA 3GL9A 3MSXA 3MZ0A 1NUUA 5E6RB 2ISQA 2P0AA 4TWRA 2YXBA 4PFJA 5KI6A 1T2EA 4URHA 3PR2B 2FEWB 2G9VA 4DR2B 1R2QA 1JZSA 5EHQA 2D4AA 5C46F 4GXQA 2QXYA 4JLVA 5LZ2A 5CNKA 3WMGA 1GUBA 1P7CA 5CFOA 1DBQA 3MSCA 1PJBA 2P4SA 3BERA 5FUVA 3UXMA 4MXDA 5FWXB 1I4TD 2EG5A 3F3YA 2ZTMA 3CCCA 1EDOA 4PC1A 3VSBA 4BQSA 1WDMA 3L9WA 4HDAA 2Z6QA 2XTAA 2ZSIA 3CGGA 2HMVA 2VNSA 2WTMA 3GFVA 5HKKD 2O48X 5EQFA