3WLFA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with (r)-1-phenyl-1,2-ethanediol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
total genus 97
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wlfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wlfA01
3RKUA 4R54A 1EQUA 1FDWA 4OYRA 3GEDA 1IULA 4ITUA 2VTEA 1AUPA 1QYCA 3A1NA 4CQMB 2ILTA 3KSZO 3WR5A 4A03A 3GPDG 1J4AA 4JP2A 3KETA 1RWBA 3CZMA 3GGPA 1LRKA 4OAQA 5BSHA 4NBTA 1ZK1A 1YQDA 1C1DB 1VRWA 4ZN6A 2DVMA 1KEVA 5I9LA 3I6QA 5JY6A 3R6DA 1FDSA 1N9GB 1NQ5A 3FNFA 3U4HA 2W2LA 3PJDA 1V0JA 1V9LA 2VUSA 4I9NA 2V6FA 1E3LA 1DAPA 4DTIA 1U2GA 5JCJA 3PYXA 2BELA 1EK5A 1K6IA 3BTOA 4PZCA 4QEDA 5TF4A 3ZU3A 4YYZA 3GFGA 4D43A 5CEFA 4B79A 4LCEA 4RF3A 3OBBA 4NBUA 2B35A 4HFNA 1X1EA 1I3NA 1YS4A 1QP8A 3WSVA 1U7TA 4FJ2A 4YJGB 1T26A 3GMSA 3M2TA 3ZV3A 4RF5A 1GYQA 2JD2A 2VZ9A 3L07A 1EZ4A 3AI2A 3GG2A 3ZH2A 4CMIA 4U6SA 2JL1A 5THKA 5CHEA 1U4OA 4GKBA 3H9UA 1I3MA 4M55A 3DTYA 5AXCA 4EEXA 2EW2A 4FC7A 3RUAA 4ALLA 5KNLA 1PQPA 4DRYA 3PGJA 1SB9A 3ENNA 3LT4A 1HKUA 3VH3A 4BNTA 4AJNA 3TJRA 3JQFA 2BFOA 1FF9A 4PG5A 1LRJA 3RC1A 1NHGA 3GZNA 2X0NA 3T7EA 2CDBA 2Q3EA 3TF5A 3JYNA 3PZRA 1KS9A 1PJQA 4O5OA 1I5RA 2IXBA 3ETGA 1H6CA 3GEMA 2HU2A 2Y1EA 3MEQA 3VKVA 2GNAA 2CF6A 4ND1A 3NKLA 1W8DA 1U8FO 1GPJA 2GN6A 2GD1O 4BUCA 1OAAA 3ZWAA 3KEOA 4HBGA 1DDOA 1GL3A 1YKFA 1UXJA 3FR8A 3AUAA 2VTDA 3B20A 4IDAA 1D8AA 1T4DA 3FWNA 3UKOA 2VOJA 2PLAA 2ZCUA 4H15A 3VH2A 4XQEA 4XQCA 3FNHA 1KVUA 3BHIA 2C20A 4WKGA 3RC7A 3V2UA 3DMTC 1Y9AA 1MX3A 2GLXA 3V1UA 5ILOA 3AI1A 1SNYA 4J4BA 1X7DA 1B2LA 2BKAA 4AJJA 1HDXA 2C07A 4R41A 1N9GA 1ONNA 1NR1A 3IAHA 4CR7A 1LQTA 3MWDB 4IGFA 3AJRA 3OEYA 4BOYA 5HA5A 1P77A 5K1SA 3BTUA 5JMPA 5ER9A 5DNAA 1XU9A 2PH5A 2X22A 2CNBA 4RGBA 2O50A 3VPXA 1JQBA 3K8ZA 3RUDA 1SB8A 3W4JA 1V8BA 1ORRA 3BHMA 1DIGA 3X2EA 9LDBA 2C0CA 3QV1A 4CV0A 3VAZA 3OSUA 4J7XA 1KC3A 3ABIA 3PI7A 1C0LA 5AXAA 4E2YA 1A27A 1IHYA 4WK6A 2PD4A 2DUUA 4FJ0A 2Q1SA 3GAZA 3CPSA 3QWAA 4ND3A 3S2GA 4TMFA 1W73A 1JVBA 3JYQA 1CDOA 4PRKA 4XRGA 1YDWA 3DHNA 4F45A 2VYNA 1P3DA 1KEUA 5JO9A 5T5QA 5GZ3A 1R4MA 2O3TA 4ZQBA 2OHXA 2QQ5A 3ZW9A 4M49A 4ALIA 2Q99A 2CZCA 3L9XA 5L7TA 3EMKA 3RQSA 1P0FA 4J16A 3MTGA 4D3FA 4W9NA 1ZK0A 2I65A 5HTOA 2BGLA 2FPGA 1JVSA 3AM5A 2HLPA 3MJEA 5HWSA 4JP3A 3AUSA 1ULSA 5KJ6A 1WLYA 1X0VA 5JAZA 3AUUA 3AFNA 3EGOA 3DBRA 3UOGA 2YUTA 3VDQA 3GVCA 1A7KA 2FP4A 4CPDA 4DGSA 5BR7A 1R15A 3M6IA 3U4DA 3QE3A 2FN7A 3AOEA 1IHXA 3NGXA 3BTSA 1LUAA 1Z73A 5GY7A 4CM4A 2GN4A 5DDIP 4LSMA 3GF4A 1DB3A 1NHWA 2H1SA 3L6EA 3RFXA 1M67A 5G0VA 3BZUA 3IIEA 1BWSA 3DQPA 3GVXA 4E5PA 1JW9B 4G81A 3DAGA 1E1KA 3ITDA 4N7RA 2ZTMA 2UVDA 2ZYDA 4EUHA 2Q1TA 3KLMX 5ES3A 3C8MA 2DFVA 2NWQA 2OO5A 4L0QA 4RF4A 1NP3A 3JQAB 1EBUA 1N5DA 3WWZA 2X5OA 1ZBQA 3RIHA 1E3EA 4EGFA 2I9PA 3JYPA 4GMGA 4OXNA 5A1TA 1UXGA 1G0OA 2XXBA 2GO1A 4Y6RA 5EPOA 3INRA 3KB6A 4DL9A 2C29D 1F06A 3DFUA 4GGOA 4XYBA 3KOUA 3KYDA 4QO7A 1C1XA 2OMEA 4PLHA 3BMNA 1DC3A 2GYYA 3ZHZA 5I8WA 4XCVA 2C7VA 5U1PA 3RFTA 3H9QA 2V65A 5L51A 4PG6A 1O8CA 1QV6A 3FD8A 1DSSG 5G0SA 2ZQYA 1IYZA 1NTOA 4DUPA 5HBRA 1PGOA 2P9GA 3GK3A 3IC5A 4QTZA 4PN3A 3KSDO 2E37A 1GCOA 4XB2A 3JQ9A 2IZ0A 3D4PA 4OGWA 1YOVB 4J43A 4WPGA 3ZNPA 4DIOA 4B4UA 1HYHA 3EAGA 2NACA 3K31A 1NVMB 1IOLA 3JTMA 1Y8QA 5L4SA 1E1MA 2PKQO 3DO5A 1E3IA 5KWEA 4TKMA 3LC1O 2WM3A 1GYRA 2PNFA 5KJ1A 2AG5A 4H7PA 4MP6A 1LDYA 1E7QA 3JQDA 1B15A 4EJ6A 3JQCA 2EEZA 4G65A 1ZEMA 4UULA 4WGGA 1KC1A 1GCUA 4XDYA 2CVQA 3WGZA 4GWKA 1I3KA 3ZHBA 3WMXA 2LDXA 5JAIA 4J2HA 4W99A 2IZ1A 3PFFA 3E5RA 2PGJA 1VSVA 3OQBA 3F9IA 2W2KA 3RUFA 1CIVA 5L3ZA 3ZDFA 4MPDA 5G0UA 3OFSA 4HWKA 1BTOA 4RORA 4KMSA 3SC6A 4BMNA 4BO5A 2G76A 4W7HA 4YCAA 1J0XO 4O63O 3GAFA 3WG9A 1NWHA 4Z0HO 1QYWA 1C1XB 5I7SA 2B69A 4BO8A 3IDSA 2HO5A 4JJIA 2YDYA 4DYVA 3JQAD 1PJTA 1AHIA 1ISMA 2AG8A 2D0IA 2GERA 2YFHA 3M2PA 4NU6A 3F5QA 3R3SA 1O6ZA 5F3RA 3W6ZA 1U3TA 1QORA 4TWRA 3OETA 4YR9A 4XGIA 2C2YA 3RFVA 1RPNA 2HKIA 3F6YA 1NQTA 3V1TC 2VNAA 1MLDA 3NDJA 7ADHA 1NVTA 3VPFA 1NNUA 3ETDA 4YT5A 1XCBA 3AU9A 4KDFA 1K2WA 2FOIA 2JCXA 2J3IA 5A9SB 4NK4A 5ENDA 4FOSA 4C7KA 5FEUA 1HLPA 3WLFA 3TOZA 1QSGA 4FS3A 2O4CA 3MJTA 2JFGA 4NJOA 5JDIC 1A5ZA 1HT0A 2X86A 4H3VA 1TXGA 3FSRA 2GF2A 4RF2A 4I5DA 5IAAA 4N5MA 2EF1A 3O8QA 3QA9A 1I2BA 3EHEA 3LSYA 2X7HA 3TL3A 4DC0A 1IPEA 1ISFA 1LLQA 3GDFA 3DBVO 4IDGA 3QWFA 4B7XA 1B26A 4BNIA 3NRCA 5B4UA 3GDOA 3WDSA 1PGJA 3PQFA 4FFPA 4L76A 4LK3A 4PIVA 4WLEA 1DAOA 1UAYA 1Y8RA 2P68A 3JYLA 3I9KA 2PA3A 4GVXA 2UAGA 3MWEB 3H65A 5IDQA 3DBHB 5H81A 3DAPA 5G4KB 3H4VA 5KIAA 4NG5A 4IDCA 2ZKLA 2VUUA 1UXIA 1XYGA 3ZWXA 3PWKA 4CMEA 4L4XA 4CMKA 5EL0A 2IEBA 3DZJA 3UVEA 3WGYA 4BO9A 4BGEA 2DPHA 3GVHA 3DOCA 3MZ0A 3PHGA 5F1KA 4EYEA 1A72A 1JWBB 1NR7A 2EW8A 2O23A 2I3GA 2UUPA 1CERA 4IQ0A 4R4JA 4AICA 2HAEA 2GZ1A 5KVQA 1XHLA 5DF1A 2X0IA 3I9NA 3LT2A 3U4IA 4GWGA 5CEEA 1VKOA 1GR0A 3ANMA 4GBJA 3V2GA 5JO0A 1MA0A 2W2LD 3F5SA 4MIYA 3DZFA 1ONOA 2O2YA 5BNIA 1CWUA 2C5EA 3MOGA 2PY6A 4TKLA 3ONDA 3AM3A 1PS0A 2WSBA 1LQUA 3WGOA 4AJOA 3E9MA 5COBA 2VWGA 1EK6A 1B14A 1WZEA 1EE9A 1GU7A 2WYVA 3UGKA 1R37A 6ADHA 1EDZA 3S2IA 3H5NA 4XQ9A 5C7OO 1BW9B 4HNHA 2Q45A 1HXHA 4R1TA 2G82A 4D7AA 4KDEA 1GYPA 4UVDA 1E3SA 2XXJA 4OMUA 4RDIA 5TRTA 2ZYGA 1EVYA 3JQBA 2AHRA 2PR2A 4BGUA 4R9SA 2ZB3A 4Y98A 2Q2WA 3WJ7A 4FC6A 2V6GA 3ZV5A 4M86A 1QLHA 4Q3CA 3GN2A 5ICSA 4CLEA 5DOZA 4PLCA 4IQGA 4FR5A 1R0SA 4YJHB 5G4LA 2D5CA 3L4SO 4DLBA 4XZ3A 2JKVA 1YBVA 4CV1A 3NT2A 4ESOA 4R1NA 4YT2A 3C7DB 4CLRB 1EMDA 1OFGA 4JJFA 3GT0A 4K1LA 2YJZA 3EDMA 1EVIA 1ZEJA 3GHYA 2VYVD 4LW8A 2PGDA 1N1GA 4P4GA 1H9AA 1KERA 3F1KA 4AL4A 1E77A 4GH5A 2OUIA 3DOJA 4YAKA 3S55A 3X2FA 5AYVA 4E2XA 2BMAA 1E7MA 2C5AA 4CLHA 4TRNA 2DU8A 1MB4A 1CQJA 1MXFA 4CLOB 3HDQA 1BXGB 4WLUA 1LSJA 3FNGA 4J1QA 5I7VA 4ZVVA 1VM6A 2NNLD 3AI3A 1PR3A 1E6UA 4MIOA 3F46A 3H9EO 1NXQA 3RJ5A 5CDSA 1PR9A 1U9JA 2IZZA 5DP2A 3GNQA 4Y8VA 2DC1A 2DKNA 1ID1A 4BMVA 1A4IA 1UXKA 4WCFC 4DPLA 5DZSA 4DIBA 3JQEA 4BV9A 4JLWA 1BW9A 3M1LA 3PDUA 3ZNQA 2NTNA 1C14A 2E49A 2AMFA 3TWOA 3K30A 2Y66A 1WMBA 2EGGA 3T7CA 1P0CA 4NFHA 3LT0A 3CEAA 1DIBA 3LLSA 3DONA 2R00C 2BGMA 4QUKA 1M6HA 2FPIA 3OECA 1AN9A 1T1SA 3ICCA 4U5QA 3PHJA 5IDXA 1Q0HA 1J6UA 2B37A 4I1IA 5C7LO 5T8KC 4ZU3A 3LYLA 2ZB4A 2DTEA 4CV3A 1W6UA 1YB4A 1VI2A 4J2OA 3O4RA 4IDDA 3CIFA 4MVJF 5JYDA 4HV4A 3IKVA 4BO0A 2EIHA 4GX1A 4R9RA 5A03A 4WUVA 5C3MA 3TFQA 3DOOA 1LNQA 2AEMA 4CLXA 1D1TA 5B37A 2I99A 2EERA 3AOEC 4X54A 5JNLA 1RM3A 3I9OA 1VJ0A 1EBFA 2A35A 4CODB 1ISHA 1EUCA 5FWNA 3A06A 4XJSA 1YH3A 3W1VA 3RUHA 4Z6KA 3EY4A 2OP0A 1IPFA 3PQEA 4IS2A 4BNMA 5KCZA 3ZU2A 1T2AA 2AEJA 3GZNB 3TN7A 2NTVA 3KV3O 3VZQA 3CSDA 4ZICA 3OEWA 3U62A 1EFKA 3WYEA 3DR3A 3OJFA 1YWGO 4PLFA 4IJVA 5BSGA 1LSOA 3OJ0A 5TT0A 1M66A 5CAEA 1YOVA 1M2WA 1W0CA 5CDUA 1Z75A 3K73O 3LF2A 3HDHA 3A14A 4JBIA 4CM8B 1KVSA 1QKIA 1ZFNA 2FR1A 5KVVA 2PZLA 3O9ZA 4NZ9A 4MVJI 4Y9DA 3CUKA 4MVJM 4DQVA 4CM7A 3QWIA 3PTZA 4WLOA 4GQAA 3ICPA 4YWJA 1B0AA 1QYDA 1L7DA 1C0IA 5DCUA 5KJFA 3GC6A 5EERA 3DXFA 1WP4A 3ROKA 3L9WA 4RPJA 1VJTA 2P5YA 1Y9EA 1BXGA 2E4AA 1TA4A 1F14A 4Q3DA 2EKPA 2Y1OA 1DLIA 3PVZA 1LLDA 3H9JA 2WD7B 1PWXA 4NBRA 1MFZA 4MINA 1V35A 3BIOA 1I32A 4YB8A 5DOVA 2YHIB 1Y6JA 1JTVA 4QFCA 5JMWA 4NMHA 4FGSA 3E82A 2JCVA 3C1OA 1EEHA 1VL6A 2AQHA 3CMCO 1PU2A 1XQ6A 5ER6A 2O4UX 2I76A 2AQKA 1O0SA 1YGYA 4BKUA 1MUUA 5CFZA 3OIDA 3H7AA 4GVLA 5IN5A 1D3AA 1DLJA 3TZKA 3PDJA 3GN1A 1GTMA 4RDHA 1N92A 3WGHA 1TT7A 1PSDA 4W82A 1ZXLA 2PZKA 2C2XA 2J3KA 4CM4B 3DEYX 4K6CA 5G0TA 2GDZA 3H5RA 5T67A 2C7GA 2BLLA 2OZPA 2CSUA 1KBZA 3E9NA 4YJFA 3S2EA 2GRAA 4J9UE 2AEFA 2CUKA 3KYCB 4MVJE 4UREA 3FRJA 3R1IA 3ADPA 5COQA 3PEFA 1SBYA 4J1SA 2YW9A 4OSPA 1Z7BA 4L74A 1F8FA 2O48X 4CL8A 1UJMA 2DBZA 1LU9A 1CYDA 4E0BA 4AJPA 2ZTVA 4WLNA 2J8ZA 1Y5MA 1UP6A 5IXYA 1HL3A 4RVUA 1SC6A 2DQ4A 3IJRA 5T8KA 1NQOA 1NAHA 1PJBA 1PZHA 1R4NA 2CVOA 4IPTA 1QG6A 4HXYA 3SLGA 3JD4A 1TB4A 3IOYA 3RD5A 1X7HA 2Y67A 4BKRA 1C1DA 2X0JA 5G4KA 3GUYA 3E5MA 4CUKA 3G17A 4FDAA 4KTTE 1AE1A 5FFFA 2EXXA 3DZHA 4BIIA 1M75A 2VHVA 1TT5B 4ILKA 2NU9A 4Q3AA 2PK3A 5KVSA 3JQAA 4TZTA 4YTEA 2H6EA 3Q2KA 4OSOA 4Y67A 5F21A 3WYBA 1GZ6A 5KJEA 1E6WA 3W4IA 1HETA 1U5CA 4BNYA 4RZIA 3DZGA 4NDNE 3OQ1A 2RHCA 3NDIA 2HJSA 4O1MA 1LI4A 4BVAA 3TFOA 2WDZA 4NFYA 1WW8A 3JQ6A 2Q46A 3WBBA 1DJQA 1Q7BA 3ZHXA 5T6BA 3D5QA 4CMIB 4YVFA 4B4VA 1IY8A 2A94A 2VYND 2X5KO 3KUXA 4NBWA 4W7IA 1HE4A 2GUGA 3GGGA 3Q2IA 4CM9D 4RPLA 3ZCXA 4LMPA 2G17A 3P19A 4BO1A 2RAFA 3OHSX 3DHYA 4IZIA 3H2SA 3QWHA 1K89A 1JN0A 4N54A 3VH4A 4XYLA 3DL2A 3N74A 5EIOA 1WZIA 1HEUA 3QSGA 2D5AA 1E0DA 1P1IA 4QECA 3BHJA 4UUNA 3VZPA 4CL3A 3RJ9A 4J7CA 1Y8QB 2JHGA 4MVJA 3AW9A 5L95A 4NU5A 3TZCA 3SEFA 2QX7A 1BXZA 1PJ2A 2FZWA 1ADGA 1N7GA 3D5TA 2JFFA 3JD1A 4IIVA 5JXWA 3A28A 2NVUB 1NFRA 2PZMA 1I2CA 4ZQGA 2IE0A 3D4OA 3CZRA 1T25A 1YB5A 2X23A 1ISGA 4XYMA 1F12A 2VQ3A 3QJ5A 4MIEA 5JCJD 2VT2A 4CLOA 1XDWA 3GRPA 3WX0A 4RLSA 3VC7A 4JBGA 4XIYA 4BO6A 4YT4A 2V6BA 4BO7A 1MC4A 2VHYA 1OZAA 3WQRA 2XPCA 4J4TA 3KHUA 3RUCA 5G2OA 2QRJA 1HF3A 4DMMA 4ALNA 3UUWA 1HE2A 1I33A 1EUDA 1T2DA 1NPYA 1RYEA 3QP9A 2BFPA 2CY0A 1OC4A 1KIFA 2Y0CA 3DZBA 2Q49A 5F1PA 1W4ZA 4EJMA 3DB2A 3L4BA 4JK3A 5U4QA 4QX6A 3WMWA 4CUJA 1PZFA 1BDBA 4UVHA 4MP3A 1ZSNA 4JGBA 1YBMA 6LDHA 1JWAB 4U8GA 4J1TA 4UVIA 4E2WA 1ZCJA 3NAQA 4JROA 2OXIA 3UHAA 3NTQA 3DBLB 2EP7A 1MG0A 2DBRA 4C7JA 3WSWA 2WYUA 2D4AA 1DIAA 2F1KA 3Q6IA 4E21A 1QXSA 3K92A 3ULKA 5EQFA 2ZYAA 1BHSA 4M1QA 1EDOA 4XB1A 5CDTA 4CM8A 4NQZA 4MOWA 3VTFA 4CM6A 1I0ZA 4IJKA 1PJLA 4YQZA 1B8PA 4DMLA 3L4BC 2YQ5A 4UVEA 4RLHA 1PX0A 4KQXA 3W4KA 3PXXA 3VPHA 3BMOA 5A3JA 1SEPA 4I9UA 2HUNA 1UDCA 4C4OA 1ADCA 4YJDA 1KEWA 2HMUA 4WCFB 3IQDB 1OI7A 1PJ3A 2NQTA 3VH1A 1K3TA 4TQGA 5B4TA 4WE3A 4OXYA 3EZLA 4M8SA 2H63A 1KEPA 2VYVA 4E5KA 3ORFA 5HM8A 5IZ4A 1B3RA 1FMCA 5I7EA 2QRKA 1C0KA 3Q9UA 5B12A 1LDEA 4A10A 1UXHA 2TMGA 1EVJA 1JDJA 1ZJYA 1BVUA 5A3VA 3RU7A 1SOWA 5JCXA 2E48A 3HN7A 1HYEA 1IZ9A 3E6AA 1GQ2A 1WMAA 3VKUA 2G5CA 3WNQA 2NM0A 3GEGA 4TRMA 3RC2A 4FIZA 3WGQA 1ZUD1 5F5NA 4ROSA 2VRCA 1LX6A 4R68A 4P4NA 1DFHA 2DPGA 2O3QA 4EEZA 2P5UA 4CV2A 4WJZA 3E03A 1SCUA 4PLYA 1VJ1A 1XQ1A 4BKPA 5F5LA 5A06A 3PK0A 3WICA 5T57A 4KWIA 2X9NA 1HZZA 3VTZA 3GPIA 4DLLA 4AJLA 3EK2A 3ZWBA 5LDGA 4FW8A 5ITWA 3WGTA 4MVJH 1DBVO 4Q3BA 2G0TA 3BMQB 3W6UA 3T4XA 3HADA 2WWRA 5TIIA 2OFPA 1RM5A 2OORA 5DCWA 4N5LA 1VSUA 5I9NA 5BNFA 2PGLA 2ZIZA 2NU7A 1SMKA 4R5MA 4CLRA 1PS9A 3HHPA 4MKXA 4PLTA 4NK5A 3RU9A 1DIRA 3ZV6A 1KYQA 1T2CA 5JDCA 2AXQA 4BNNA 2IRWA 4MO2A 4IDEA 4PRLA 3KLPX 4E2ZA 1H5QA 5IXSA 4WLVA 4O59O 5L40A 1P1RA 3FTNA 3JSAA 4R3NA 1E7RA 4XGKA 4OOEA 1PGNA 4CMAA 4NFSA 3D7LA 5JYEA 1FJHA 2PFGA 2IDZA 3LLVA 3UXYA 3GHHA 2FSVA 2OBNA 3NDRA 2J5RA 1F0YA 1DC6A 2ZTUA 4XQGA 1UP7A 3T4EA 3U49A 3I6IA 4UEKA 2FR8A 2W4QA 2Q1WA 4ZQFA 1LEHA 3PRJA 1I30A 3HN2A 1R4NB 4KUHA 1X13A 1NFQA 4TRRA 1ZSYA 3NUGA 3I52A 5JS6A 1P45A 2Y1GA 3GLQA 1GEEA 2B83A 2IEDA 2WD8A 4MVJG 4Z0TA 2XAAA 4CMGA 3UAGA 5TSDA 3NYWA 2GZ2A 4IM7A 4II3A 1A7AA 3DZKA 5GZ1A 5EINA 3DTTA 3VPSA 4WASA 2BFMA 1PQWA 3FCOA 4DYDA 4JNKA 5IG2A 1H6DA 2OL4A 2VWHA 1E6EA 2X1HA 4R1SA 3PJGA 4CMEC 3HWRA 3WXBA 2ZATA 3I4CA 1Q7CA 1GY8A 4QFDA 4O0LA 2DUWA 5DCYA 1KVRA 1QV7A 3JCZA 3I9JA 3L6OO 3O38A 4OIMA 4E5NA 2TMDA 1XLTA 3N58A 4L75A 2B4RO 3I9LA 4RV9A 1OMOA 1GQQA 2QYSA 3KO8A 4HUJA 1Z6ZA 1E5LA 3BMCA 4ND5A 4YPOA 5IDYA 4NR0A 3IP1A 4URFA 2YDXA 3TDKA 1PZEA 1U3UA 5K6AC 1WWKA 3VHRA 4DPKA 4BS9A 4F6LA 4TROA 3BYZA 4ZRNA 1I3LA 3AUTA 3DHEA 4FGWA 1LLCA 2R00A 5JE8A 2X0RA 1L1FA 3PHIA 4BB6A 2O2SA 3ZWNA 2YHIA 4YA6A 4PLWA 1CETA 2O7QA 3G1UA 4B8WA 4GX0A 3KXDA 4FSHA 1ZXBA 3VPGA 3L6DA 2VWQA 1WPQA 1ZO8A 1R12A 4PGFA 1Y5RA 5U9CA 5I7FA 2UV8A 2Y05A 4D44A 4BL5A 1LC0A 2D8AA 4L8VA 1IL0A 1XELA 1HYGA 4XYGA 2YYYA 2B4TO 4ZA2A 1G1AA 5TS3A 3NJ8A 1P74A 3O03A 4S1VA 2DBVO 4U7WA 1YQXA 3TL2A 2C59A 4Y6SA 3UW3A 3GVPA 4JX8A 4RVGA 3ZI0A 4E12A 3DZIA 2NU6A 3GG9A 3DBHA 3IS3A 2GN8A 4QSMA 4RVDA 4UEJA 4XX0A 3E1KA 4EZBA 1M6WA 5EQDA 2B4QA 2POQX 2YV3A 4ALJA 4D3DA 2HRBA 3E48A 3GUCA 5K9ZA 4GX5A 2WD7A 1TLTA 2SCUA 1R0LA 1ZSVA 5F1OA 1AHHA 2QG4A 1F17A 2AQIA 3UH1A 2EGHA 4XGNA 4CUZA 4D0SA 1WDLA 4DA9A 1YVEI 3KZVA 1E7SA 3A9WA 4RQTA 4PZDA 3DMTA 3OIGA 1K6XA 2ET6A 2FPPA 2JAHA 1B7GO 1LTHR 1XU7A 4NBVA 2BF7A 4HY3A 1B3BA 2B5WA 1LSSA 4Q9NA 1U7HA 2BI7A 4K26A 3RSHA 3JQGA 4IGEA 2WE8A 3CTMA 2RHRA 3F4LA 4A73A 3RI3A 4YAJA 2E6UX 2DFDA 1LBEA 2GGSA 4MKRA 1H94A 1G6KA 3G1TA 5ADHA 3S2FA 1MV8A 2D59A 2JCYA 4FFOA 1T4BA 1Q7GA 3VZRA 2Q4BA 1U8XX 1RJWA 3QVXA 4FFRA 5T64A 3WTCA 1TT5A 4D79A 4OOFA 5IF3A 1U1IA 5ITVA 3FPLA 3KSUA 2NSDA 3HB5X 4IDBA 3RVDA 3SVTA 4UEOA 1Z7EA 2R2GA 2VZ8A 3LDHA 4IQ8A 2HCTA 1O9BA 1K0UA 1S7CA 4BNGA 1QLJA 4GLLA 4E33A 3GY0A 4F6CA 1PL8A 1EQ2A 5JC8A 1Y7TA 3H5AA 2I67A 1HSZA 3QQPA 4YXFA 2W2KB 4XD2A 3U0BA 2CVZA 1XSEA 3C1AA 1YBAA 3JYOA 4NJMA 1T2FA 5AOVA 1H0KA 3WGIA 3PHLA 5TGDA 1GZ4A 4N18A 4K28A 5A9TA 4CM3A 4IJWA 4LGVA 1H2HA 2P2SA 1N2SA 2P9CA 3IUSA 4QT0A 4E5YA 4Z9YA 1PIWA 4BKOA 1DOHA 1R66A 1YQGA 4DC1A 1AGNA 4YQYA 4HFMA 1E1LA 1JLLA 1LDGA 4XRRA 5DT9A 1GUFA 3HUDA 5BT9A 2ZJ1A 1X1TA 4CMCA 4PCVA 3FBTA 4E3ZA 2YZ7A 1O89A 2VHZA 1JA9A 2OP1A 3ZW8A 4R69A 4R16A 2X6TA 3AY3A 3JD3A 4P22A 2EG9A 3MJ4A 3MOIA 2VCYA 4PG7A 5A9SA 2NUAA 1ZH8A 1MP0A 1YXMA 3OICA 4PFJA 4F3YA 3WGGA 2Q4EA 5JC1A 1VL8A 1GUZA 3NGLA 4CJXA 2EJWA 3G0OA 4BNLA 2Z95A 1YONA 3AU8A 3SC4A 4LSWA 1P31A 1WDKA 4P4LA 5FYDA 4W4TA 3JD0A 5A4DA 5JAQA 2QYTA 1E3WA 3P5SA 3QVTA 1NASA 1XWFA 3S1LA 4YT8A 2NVWA 1HWYA 5LCXA 5TQVA 2IYPA 3C24A 3HZZA 3STHA 1PQUA 1J49A 1I24A 3SXPA 1GZ3A 2NTJA 4RZHA 3ZU5A 4PG8A 3ONFA 2IYOA 4HP8A 4P38A 4R1UA 3H2ZA 5L9AA 1ISJA 3JQ9C 4WEQA 2A4KA 5EESA 4B8ZA 4RQUA 3OJOA 3TZQA 3UN1A 3VVBA 3NTRA 3WYCA 2IXAA 3LF1A 1YE3A 3PPIA 2Y1DA 3W8EA 5I8ZA 3I1JA 4XDZA 5H82A 2YV1A 3G3EA 1HTBA 1YL5A 4L9RA 4AJ1A 2J5QA 3MJSA 4Q39A 5BSEA 3CXRA 3VOSA 2GN9A 2EKLA 3FR7A 1ZZEA 3WLEA 1HDOA 3RAJA 4CM1A 2DM6A 1PZGA 4JQCA 3CKYA 4AVYA 4CQMA 2PD3A 5THQA 1GAEO 5C5IA 5EJ2A 1IB6A 3HG7A 3E9QA 1NQAO 1ENYA 4FJ1A 2I66A 3OA2A 2OOSA 1NBOA 3GNTA 5LC1A 3U3XA 2O3JA 4RVSA 1HLDA 1TEHA 3L77A 3MCVA 4Z9XA 3ZWWA 4Z0PA 3U5TA 3ANNA 4KZPA 3FPCA 2BFAA 1X14A 3GOHA 3Q11A 4IXWA 3TSCA 4E13A 4OL9A 4KP7A 1N8KA 5J23A 3AY7A 4ALMA 1ENZA 1NM5A 2AA3A 3WBFA 2Z1MA 4BNHA 3DMYA 1LDNA 4AJEA 1MC5A 5FF9A 3Q0EA 1S6YA 4BO3A 1ZK3A 4XR4A 2FZEA 4IMRA 1Q2XA 1IE3A 4B3HA 3LQFA 3FWZA 2NQ8A 4IS3A 2Q2QA 1TVEA 3C3XA 1YDEA 3M1AA 1ENOA 2X58A 5KJCA 3DWFA 2PD6A 1Z82A 1DRWA 1CRWG 3KM0A 2BH9A 3LVFO 3V8BA 1LJ8A 1A71A 4A7PA 7MDHA 2PWZA 4GPD1 2AQ8A 3KRTA 1G0NA 1I2ZA 4CM5A 3TNLA 1P1KA 1R0KA 3VZSA 3K9QO 5TC4A 2UYYA 5BQFA 5TT1A 3C85A 3TOXA 3MJCA 3E8XA 1DFIA 1E3WB 1WAMA 4QO8A 4BQPA 1XA0A 4BNVA 1DXYA 1SZJG 4L4SA 4TSKA 5FI3A 4DBZA 4GAEA 4ZQHA 4MP8A 4E31A 1PEDA 4AJIA 1HE3A 3HB4X 3RASA 4GX2A 3RBVA 5ICMA 1E7WA 2PTGA 3FI9A 3B1JA 2VRBA 3EUWA 1B8VA 3PJFA 1GPDG 4ID9A 4JBHA 3WOHA 4XIJA 3LC2O 1DEHA 2HK7A 3W8FA 3PJEA 2ZJ0A 4B7UA 3QW2A 5JAMA 3SBOA 3V2HA 5B1YA 2WE7A 4RVFA 2O3SA 3KBOA 3RWBA 3V5NA 2P4HX 1NAIA 1X7GA 4ND2A 1JKFA 1XGKA 3QLJA 1BRMA 3PIIA 3WQSB 3WQQA 2D2IA 4KQWA 1ZKMA 3HSKA 4OKIA 4Q3EA 1SAYA 3A4VA 1B8UA 2GPTA 5TJ9A 2XOXA 2VWPA 4AJKA 1U3VA 3WIEA 1CEQA 3ASVA 1TI7A 4FBGA 1JAYA 1MG5A 4J4HA 1ML3A 2GSDA 4XYEA 2NV6A 3PP8A 1BDMA 1FDTA 3HJAA 1HRDA 1DPGA 1P1JA 4OKNA 3AK4A 3IL2A 3U09A 3D64A 4BMSA 3IJPA 2VZ0A 1KVTA 5DBIA 2X9VA 3WFIA 3GZ4A 3RROA 3SLKA 1BXKA 1PJSA 2I5PO 1SEVA 3P2OA 3U4CA 1QYXA 4II2A 4JJGA 2CMDA 4PG4A 3RBXA 1MXHA 2O7SA 4OO3A 5JDCC 2RBEA 3AM4A 1I01A 4FQ8A 3W8DA 4J3FA 2B0JA 3JV7A 3F3SA 4ZD6A 1ZNQO 2F00A 3PWZA 2EP5A 1UP4A 2AE2A 3KTDA 4BNXA 5A9RA 1E92A 4A27A 5L4LA 5L53A 4TZKA 1M76A 2XF8A 4ZGWA 3Q3CA 5A5EA 2FRDA 1U4SA 2EHDA 5DN9A 4FOOA 3KYBA 4YBZA 2HDHA 3OM9A 5CPBA 4DQUA 4GI2A 5A5FA 3R3JA 1B16A 1HDRA 1HZJA 1PS8A 2GCGA 3CINA 3OQ6A 3PYMA 1VE9A 4DLAA 5IDWA 1P9LA 3IKTA 4BNKA 3C7AA 2CFCA 4ZHSA 2VRCD 1NX6A 3L0DA 3UCFA 3H9GA 4EW6A 1ISIA 1HSOA 2QHXA 4GKVA 1D7OA 4RVHA 2JD0A 4M87A 4R01A 4Z3DA 1WNTA 2EKQA 2FHSA 2FR0A 4BNFA 2PKRA 3KVOA 3OIFA 3ADOA 3TZHA 1N7HA 1EUZA 1N1EA 4U0KA 4I5EA 1ONPA 3QIVA 3ZWCA 1F8GA 4RPGA 3DDNA 3QVWA 4UAGA 4YRBA 2JFHA 4MJLA 1BMDA 1DO8A 4EDFA 1E7YA 1A9ZA 1AXEA 4FFNA 5GMOA 5B4VA 4WECA 3ROPA 1KY5A 1ZK4A 1KOLA 3GFBA 2YQ4A 3FN4A 4RO0A 3UICA 1ADBA 3BAZA 4BO2A 3I4FA 4KUGA 4NH4A 1H9BA 3H3FA 1LA2A 5IN4A 1DHRA 4K9DA 3K2EA 4HFJA 2QW8A 4J9VA 3VDRA 4XA8A 1V6AA 4PZEA 2FWMX 2J3JA 3BXXA 2Q1UA 3V1YA 2EWMA 3BMNB 1ZK2A 3NT5A 4AJ4A 4FPXA 2G1UA 1UH5A 3BMCB 2VHWA 5CG2A 1YJQA 3ITKA 3JQ7B 5GZ6A 3ZWPA 2VUTA 5JW6A 2GASA 2V6MA 2H9IA 3INTA 1HDZA 4WOJA 4ND4A 4OXKA 4YAEA 4CLDA 4QQRA 5JBIA 5MGBA 1WXDA 1FDUA 2VHXA 1UUFA 5AQ1A 3H3JA 4J49A 4KUEA 1JKIA 2DTDA 1H2BA 2RH8A 3I5MA 4YJHA 1RYDA 1O95A 4E32A 5JSFA 5L7WA 2OGUA 2AE1A 1P1HA 4L4RA 4OQZA 3ZWOA 1SOVA 2Q50A 3OP4A 3KEQA 2Y99A 1K5HA 2LDBA 1I36A 3F1LA 3ZWVA 1HE5A 2X4GA 3ZZNA 4YDRA 2GZ3A 4IJUA 2CDAA 1NFFA 2BRUA 3TRIA 2J6IA 4HFRA 3GVIA 4NIMA 4GSKA 2HQ1A 1OC2A 4TVBA 2YY7A 1DHTA 3NV9A 4R51A 5TJHA 4FFMA 4HNGA 3AFMA 1NWCA 3DFZA 3IP3A 4MVJP 4D3SA 5AXBA 1YO6A 2EJVA 1H93A 1EE2A 4A26A 2Z1NA 3RUIA 1ZW1A 1D4FA 2NU8A 2HK9A 3NX4A 3FHLA 4M89A 5CDYA 2BHLA 3LC7O 3CMMA 2IODA 2NADA 4IY1A 3VVCA 2O3UA 4B3JA 3PLNA 4BB5A 1CF2O 3D1LA 2CD9A 1GFSA 3F4BA 3COSA 4W9NC 3C7CB 4NHEA 4D46A 8LDHA 2ZCVA 3U9LA 5TLSA 3ZWYA 3MJVA 1T24A 4HKTA 5C7IO 4CR8A 5IZCA 4WOKA 4J6FA 4BNUA 3ONEA 5AVOA 3NEPX 1VKNA 4L73A 1GUYA 4UUPA 1ENPA 1PL7A 4B4WA 2WEKA 3DAFA 1IUKA 4JIGA 1I8TA 2HMVA 4INAA 4FD3A 3QY9A 3IMFA 3P7MA 3QVOA 1H6BA 3WNVA 9LDTA 4NJMB 1DIHA 2RH4A 5CP8A 2B5VA 4EBFA 4E4YA 1E3JA 1QRRA 1DC5A 5TNXA 2Z5LA 1UZLA 3B1FA 1ZIDA 1DRVA 3EYWA 4IIUA 3D4NA 4BNWA 4BV8A 1A9YA 1ZJZA 4O6VA 2QIOA 1XEAA 4ONEA 1R4MB 4F46A 1UR5A 2HJRA 4RL6A 5HRUA 4LVCA 3ZWMA 3OJLA 4RPKA 2PV7A 1ARZA 4R3WA 4B4OA 4WNCA 2BGKA 4M54A 3TZ6A 1VC2A 3WIDA 2DTXA 1JAXA 1SO8A 2D3TA 3GNSA 4LVUA 4I8XA 4LMRA 4UUMA 5JLAA 1PTJA 3OA0A 3RCBA 1DC4A 3BMQA 3I23A 2UUOA 2ZB7A 3WTBA 4B7CA 2VN8A 3PQDA 3LZ6A 4LCJA 2ZK7A 4YACA 1HDYA 5CEJA 1EFLA 3JQ8A 4BNZA 3FF4A 1UDAA 1XR3A 4YRAA 5A05A 2P4QA 1V3TA 3G79A 4GSLA 4ZRMA 3UF0A 1BSVA 3FBGA 4WEOA 1NYTA 1L7EA 4EI2A 3F47A 4D45A 1BVRA 4IMPA 3ROQA 3ST7A 5KVCA 2PH3A 3RBZA 3GH3A 4G2NA 2H5LA 1VL0A 1RM0A 3HDJA 2WMDA 4NI5A 4FCCA 3PZBA 4TVOA 4Q3NA 3WFJA 2YHUA 3PFWO 2X8LA 3LT1A 4IDFA 1QMGA 2B36A 4HX5A 2E82A 4P8RA 1NVGA 4BGIA 3GRKA 3ROMA 5L7YA 4MVJD 1PGQA 2AW5A 4EJ0A 3ZNOA 1J5PA 4PVCA 5HS4A 4S3MA 4E5MA 1RM4A 3NTOA 4IXTA 4CQLA 2HMTA 4A0SA 4KOAA 4IINA 3Q1LA 2X9GA 2FSSA 2P9EA 3EW7A 4OH1A 3OH8A 2W8ZA 4ZQEA 2NLOA 1E5QA 4U6QA 1OOEA 1ADFA 1I10A 1V3UA 2VOEA 3GQVA 1PJCA 2HK8A 1U5AA 1NPTO 3QWBA 4LRTB 4K6FA 1QYVA 3FNEA 1O94A 3EC7A 5BNTA 1YJ8A 2ZB8A 3D3WA 4HADA 1X15A 4LRSB 3DBLA 4DIFA 4OQYA 4BO4A 3SJ7A 1U3WA 4J1NA 2PKQP 5MDHA 3FTPA 4GMFA 1UZNA 4FN4A 8ADHA 3GGOA 4JN6B 3B1KA 3KYCA 2GR9A 3Q9NA 1R6DA 1GADO 3N7UA 4E6PA 3I3OA 3KYDB 1KY4A 1PJ4A 2BI8A 4DXHA 3EVNA 3JD2A 3JQ8B 3R0IA 4CM9A 2DLDA 1LRLA 3NJ4A 1YL7A 4MDHA 4TRJA 2JAPA 3GA0A 4DWVA 3SX2A 5CDGA 1U28A 5DBGA 4I08A 1LSUA 3ON5A 3QHAA 3QVSA 4I5GA 4CMBA 3D0OA 4JXKA 1ULUA 1QR6A 3MTJA 3INGA 5JY1A 3LK7A 4UUOA 4CMJA 4N5NA 2R6JA 1XG5A 4DQXA 3H8VA 4EUFA 3GR6A 3OMLA 4ALKA 5DULA 3JQFC 2WYWA 4PVDA 3K2BA 4I5FA 5G0WA 5JPIA 1FK8A 2HSDA 3AWDA 4UVGA 5L45A 4AFNA 4KWHA 3RC9A 3ASUA 2OBYA 5CG1A 3B6ZA 1XKQA 3AY6A 4J0FA 3ETEA 3HFGA 2JD1A 3IUPA 4GGPA 4IUYA 3HDYA 1WDMA 1E1NA 1O5IA 1DRUA 4AJHA 3DC2A 1GD1O 1XIVA 4Y6PA 3EZYA 3O8QB 4A5OA 5KOIA 2FMUA 4YEDA 3OF2A 1CQIA 2PZJA 4J90A 2Y68A 1Q1NA 1VPDA 1Y8RB 4KTVE 2VT3A 3C1TA 1BGVA 3ZU4A 5COAA 4PLPA 2A92A 1IZ0A 2W98A 2HMWA 3TPCA 2EV9A 1D1SA 1JU9A 2C54A 1MFPA 3AOGA 1KVQA 3JQGB 4R5HA 4B3IA 2P91A 3UCXA 1HDGO 4PLVA 4XJTA 2DBQA 1BG6A 1VLLA 1NPDA 4FB5A 4YAGA 3K6JA 3PIDA 2WJPA 4JCOA 4WCDA 2Y93A 5L4NA 3BTVA 3ZNNA 1V3VA 1YL6A 4OM8A 5AXDA 3UCEA 4E30A 1GDHA 5DBFA 4CQLB 4CMHA 4EITA 5IZCC 2V7PA 5ENVA 1RKXA 3K5PA 5TX7A 4YAIA 1ZMTA 1C3VA 1FXSA 2VNSA 1Q0QA 1GQYA 4EUEA 4WNIA 5FI5A 5I9MA 1DJNA 2HMSA 3TQHA 4I9HA 1Z74A 2Y0DA 4OHUA 3DBRB 4Z3KA 2CF5A 3ANLA 3JQ7A 1GV1A 3PYLA 4GL4A 3WB9A 4U0JA 1LDMA 3D3WB 1PL6A 3ENKA 4D41A 5KKAA 5A02A 5K0ZA 3I83A 5KTKA 2RIRA 3CH6A 2WTBA 2Y0EA 1DFGA 1YB1A 1Z45A 4RJTA 5A04A 4NNJA 3ZHYA 1PGPA 2QZ9A 1PWZA 4AJ2A 2NVUA 3ZGYA 2A9FA 4XEHA 1LXCA 1GV0A 4A2CA 2Y1CA 1FDVA 5ILGA 5HS6A 4BKQA 1P33A 2W90A 3HQ4O 4PLZA 1P44A 3PHHA 5IFLA 1GEGA 4RPHA 2FY8A 3BA1A 3ZN2A 4DBVO 1R16A 2NVBA 3E18A 1OBFO 2QRLA 2JHFA 4G5HA 1JKJA 2Y1FA 1AXGA 1K6JA 3SJUA 3OJEA 1X0XA 5EN4A 4DVJA 4D0RA 4AG3A 2ZTLA 3GDGA 5DP1A 3EVTA 3WWYA 1ZMOA 1T1RA 5LDHA 4IBOA 4WLFA 4J91A 1P1FA 2D1YA 2UDPA 1HDCA 2ZQZA 3NT4A 4NPCA 4DREA 2C82A 1UZMA 5JFOA 5EMHA 3JQBC 3GMDA 1LLUA 3WJAA 4BGVA 3LU1A 4CR6A 3WS7A 5BSFA 5CPFA 3D3EA 5H83A 1ZVMA 4IZHA 2DT5A 4RCVA 4H16A 4ZJUA 1KETA 2J3HA 4BHTA 1YRLA 3S8MA 4XWYA 4XKJA 3PGXA 3G49A 1SPXA 2Q2VA 1LC3A 1Q0LA 3PLRA 4Z9FA 3UFXA 2I3AA 2DAPA 5KKCA 4GLOA 1WVGA 2YV2A 4J7UA 4PLGA 1CJCA 2O3RA 3RUEA 3ZV4A 2YFQA 3B70A 2QZZA 1MGOA 1T2EA 5C37A 1C0PA 4WCFA 4FFLA 3O26A 4D42A 4MKZA 3K96A 4YJGA 5JDIA 2I6TA 3QRWA 3PWSA 4J0EA 2JJYA 2BD0A 1Y1PA 4LN1A 4BQRA 4BNJA 3RKRA 3CE6A 3HFSA 4QXMA 4CQMD 2RCYA 1U2DA 2CDCA 4DPMA 1UAGA 4YRDA 2X5JO 1A4UA 1EVZA 4YJFB 3HNPA 3H6KA 5IJZA 1H6AA 3BMOB 3HE3A 3P2YA 1LDBA 4OJNA 1UDBA 4W6ZA 3I9MA 4LISA 2HRZA 5K6AA 2J5KA 4XR9A 1Y81A
chains in the Genus database with same CATH superfamily
3QFHA 4NEQA 5IARA 1EQUA 4HPWA 4IUDS 4ZEVA 1N6HA 2PEYA 3GEDA 3K71B 1Q14A 1TGYA 2G63A 1IWBB 3EQ6A 4CQMB 5BNWA 3BBPA 1KU0A 4HS9A 3WR5A 3CVXA 1J4AA 5AW1A 4DE5A 4OAQA 2PMEA 4DDWA 2XGSA 5B3JC 4NBTA 1ZWLA 2GI4A 3HU2A 4B5LA 2EVWX 1X7XB 1YQDA 1C1DB 3O1HB 4PR0A 1CKEA 2W4MA 1KEVA 1DX6A 3ZWDA 2AXPA 1AKEA 4MR8A 2ENUA 1K8RA 1FDSA 2VJAA 3FNFA 3R6DA 4RD6A 2CJYA 2XTMA 3UNXA 1Y1QA 2WF6A 1KJ8A 3EXIB 4NZYA 4HWGA 1XVUA 1I3CA 2XA9A 3WDKA 4DBLC 2UU9B 2HF7A 2VUSA 4ZI2A 1YJ5A 4RGQA 4AKSA 4BE9A 4HC4A 2YN4A 5JCJA 2BELA 1EK5A 2C2WA 4QEDA 1Z7GA 1E3TA 2ENWA 2R6GA 5EJ6A 4YYZA 4B47A 1K7YA 1WO8A 3GFGA 5EZYF 4F0JA 2XD4A 3OBBA 2MYNA 4FMPA 3HY6A 2Z4SA 4NBUA 3P2KA 1VJ5A 3IUBA 1FU7A 1K4KA 4M1YA 3WNCA 1IFXA 2Z3ZA 1YS4A 3NHAA 1QP8A 2DKOA 1CLUA 4FJ2A 2QXYA 5J43A 3EH2A 3NCHA 4CIVA 2YY5A 3EEIA 1SU7A 4OXRA 2JD2A 3TVTA 1KI6A 4MUXA 2OC4A 4A8TA 4B32A 5HK8A 3FCSB 4C7BA 4RTQA 1CUWA 3ZH2A 1YMVA 1N78A 2RHDA 3AQIA 4XWTA 1P7PA 4ZU6X 1E6MA 1VCOA 1ZU5A 2ATXA 2TS1A 5CHEA 1OY1A 3KHSA 4QGBA 4DY4A 3OX4A 4I1PA 1QWSA 4L7VA 3LTNC 1ZPDA 2EW2A 4FC7A 4TSRA 4TLLB 3OI7A 1DKNA 1SB9A 3PGJA 4F6RA 3VH3A 4BNTA 4CCWA 3TS1A 3TJRA 3ND6A 1ZU4A 2WWFA 1FF9A 4RTMA 2J9RA 3RC1A 4FYVA 2CDBA 3EC1A 4LHSA 5LP6C 4N0PA 1NMYA 4HVTA 1C81A 1U1EA 5JROA 3FTQA 1PJQA 1XDUA 2LV8A 5ALEA 1PRYA 2D13A 3EZ6A 1I4OA 1Z33A 3O4GA 4JC5A 3WLPA 5F7OA 2PSDA 1YCFA 2VP3A 2R6HA 3A4TA 3GEMA 3PNOA 3QEOA 5BSUA 2O8FB 4X7RA 2IWRA 3NBZC 4ZCPA 1U8FO 2DR3A 1PO7A 1I4WA 2GD1O 2GN6A 1OAAA 3GW8A 4GHWA 2ZYIA 4UTPA 5JRDS 3PU6A 4TT3D 4ILEA 1VPWA 1DDOA 1UBNA 3PQ4A 1UXJA 3MHPA 3INYA 3AUAA 3DOUA 1J39A 1TL7C 2IEZA 3I0NA 4HN9A 4U3JB 3S1SA 4YRMA 4I55A 4P3NA 2ZJ2A 5IAOA 4EI8A 4MRNA 3M81A 1HFEL 1MZPA 1G5HA 5TR9A 2C2KA 2PLAA 4S05A 1G16A 2RG1A 3E0XA 5TGZA 2FA9A 2GRUA 4Q05A 3CZ4A 1KVUA 8GPBA 2H8KA 2JGKA 1RHMA 3H2JA 4WKGA 4MUKA 5BPHA 5JQGB 2SECE 3ZDDA 1MX3A 4N6OA 3AI1A 3ANSA 4KIWA 1DBIA 4J4BA 5BYBA 3T5GA 3ZEAA 2BGWA 1DAMA 3UMMA 3D54D 3GPCA 4G23A 1B2LA 1J42A 3E3AA 3LWBA 4XX1A 3VC3A 1YDMA 2HXSA 3LCUA 2VHEA 1HDXA 4JOQA 4QUIA 1WB5A 3LUBA 3ZDAA 4B3GA 1VCNA 1ZHFA 2E3JA 1LZLA 4LBWA 1NR1A 3IP5A 4BQIA 4YXWA 4BVLA 3MWDB 4IGFA 3OEYA 3C14C 1CEXA 1TOAA 4WNAA 5K1SA 1CG6A 4CHGA 2WIDA 1T3ZA 1DGQA 1F1JA 1ZISA 4TL8A 5DNAA 3AEUA 4Q4AA 4XWOA 2XBUA 3QOXA 3FCXA 4H0FA 2W37A 2W83A 3HLTA 4BNDA 3KELA 5JISA 2JGRA 1JQBA 1MJ5A 4O08A 3NWJA 2X4IA 2YWHA 4J7AA 2JJ1D 4JA0A 1KDZA 1ODCA 2FZCA 2C0CA 3HCFA 2C1ZA 4JI1B 4N40A 4CEHA 1GZDA 1KC3A 5EOVA 5IT4A 3T9AA 5FUYA 5EEHA 4E2YA 5I9IA 4D0LB 1A27A 1IHYA 2JCBA 4ZWNA 2J3MA 2VRWA 2DUUA 1VYTA 1JE0A 4OCZA 3AONB 1NUSA 3JYQA 3DNFA 5IK2D 2XGGA 1W85A 1QE3A 4N7BA 2FX2A 2AS0A 3W3AH 4XRGA 2E89A 5DTMA 1YDWA 2G6BA 3VVLA 2WAYA 1F6WA 1L5WA 3MAJA 4A3SA 4QT4A 4EMSA 1R10A 4FYHA 4KE8A 4DNXA 4B6RA 2O3TA 4ZQBA 1O2DA 2CHVA 3FTFA 1ID8A 3K4PA 2CZCA 5L7TA 3EMKA 2COKA 5H9VA 3NORA 1ZZGA 4RHYA 4CTMA 1Z18A 5KNCH 5C4GB 5HTOA 1L6IA 3EFOA 3OZXA 4TM8A 5HWSA 1ULSA 2YCLA 1RSZA 2BF4A 3AUUA 3ZIAD 5JWOA 1AQNA 3DBRA 4M1TA 2W2VA 3NBYC 3K9FC 3FZGA 3VDQA 2W6IA 2Q4RA 1R9GA 2FP4A 3GVCA 4K7JA 4MUAA 1LNSA 4CPDA 4DGSA 3QE3A 1Q50A 4LOLA 2A67A 4WY2A 1E63A 1CD5A 1IHXA 5ALZA 3WRVA 1CFJA 4DJFC 4FFBB 1LUAA 1NI4B 5GY7A 1BQ4A 3GLSA 5I3CA 5BR1A 3AJ9A 3CW2A 4HDKA 1TF2A 2VT6A 5DDIP 1QC5A 1XQVA 3W5CA 3KVNA 2WVAA 1AT1A 1E60A 4FQ7A 2FSIA 3CR3C 4IO1A 1GA1A 1BWSA 2XGOA 4QVKA 4F21A 3ZOKA 2ASEA 5C80A 4G81A 5BOSA 3LCJA 3D8NA 4WXEA 2NUPA 2ZS7A 1GG8A 4GOJA 4YRQA 5K3AA 1J5EB 4KFCA 3U4MA 3ITDA 4XVQA 3UJBA 2ZYDA 2Q1TA 1ILWA 4JLSA 2Q7DA 5EPUA 3C8MA 3WB2A 2DFVA 4DCSA 2I6GA 4KFRA 4RF4A 5BWCA 3L2OB 2FN9A 2D00A 1I4DD 2VXOA 5KTTA 1B00A 2JAQA 1E3EA 2OBBA 1FLNA 1XOIA 1ZMRA 3OPVA 4GMGA 3TQQA 4AN0A 4N41A 3PEYA 1OH5A 2G77B 2FEKA 4TTJA 5EPOA 1TMOA 3INRA 1UQRA 5EUQB 5AVKA 1F06A 3E58A 1D2CA 2AJBA 1VA4A 4QO7A 2Q2OA 2ORWA 4TLDA 1XTZA 5K0LA 4CFZA 4NMXB 1SXJA 4MB2A 1XYYA 3DOEA 2VDVE 1HTTA 1QH8A 2B4YA 3G23A 3L6CA 1XNRB 2C7VA 3N53A 1SHKA 5U1PA 4TOIA 2AC7A 2EZ4A 2AC2A 3H9QA 1R9JA 3WMEA 5L51A 1O8CA 4P4TA 1DSSG 2ZQYA 3O4IA 4BX0A 4JUBA 3AFOA 4Y6OA 4H27A 3TQOA 4EPTA 1A04A 3S6JA 1NLYA 1NTOA 2KLHA 1PGOA 2OK7A 5HPYB 1Q44A 2H4FA 3PXGA 3G6KA 1C4OA 3P1JA 4TV9B 1Z4MA 1EQAA 3KE8A 2O14A 1KH1A 2ZSDA 3D4PA 4M9UA 4OGWA 1VMIA 2FSHA 1NBWB 3EEFA 3IV7A 4Q6WA 4BMCA 5LM3A 4Z4EA 4DIOA 4M0KA 2O7NA 4P82A 2X0EA 3K31A 1SKQA 3NV7A 3JTMA 1Y8QA 2ETVA 2JKZA 2AZDA 2ZRDA 3PRYA 4IOMA 4R40A 1OWOA 3DEZA 4GXNA 3I6ZA 1CTQA 3LC1O 4IFEA 4BTLA 3IV9A 4NV3A 1EUDB 4Y3UA 2AG5A 4MP6A 5IT5A 4UHEA 1LDYA 3VR5A 4ZOLF 2XGMA 5KDOA 2IYTA 1NIJA 1NJFA 2Y3IA 1B15A 2HIAA 4EBBA 1MC1A 1KKUA 4EJ6A 4FNMA 1ZEMA 4ZVNA 1B23P 4XDYA 2CVQA 3RNOA 1TKRA 2WMOB 4MCIA 4NE7A 4PNZA 3VYVA 1IM2A 4IXMA 4L2IA 2W2XA 4J2HA 4R3UC 1BX0A 5JSQA 3HCNA 4ECEA 4QICA 3EEOA 4X1OA 1ZNWA 4YJ2B 2QSJA 3ONWA 1VSVA 2OR3A 3DMGA 4C06A 3A1EA 1UMKA 2W2KA 3F9IA 4FZRA 3ZDFA 1DEAA 4I46A 3CVUA 3KKPA 1OFVA 1EYZA 1F6BA 1V16B 1BTOA 3E23A 3GFTA 4HWKA 1UIMA 1XAIA 3SC6A 1GL7A 3HHEA 5EIWA 4BMNA 2BEWA 2VPZA 3PE3A 4LJ7A 4TYMA 3T5AA 1J0XO 4O63O 2BE7A 1NWHA 4P4UA 4XOIA 4Z0HO 1C1XB 4BPBA 1Y7LA 4BECA 2CFRA 3UAZA 5FNVF 3EGXA 3LG2A 3HB7A 3WB0A 3R9KA 2HO5A 3QPUA 5CYOA 3X1XA 2ZT8A 5I45A 5LIPA 1AHIA 2GRJA 3M2PA 4Q4HA 3O8LA 1V4BA 4RE5A 3HGTA 4ZMSA 1IY2A 4R1QA 4MW1A 1ZINA 2QRMA 1U3TA 3H0EA 4HDRA 2G06A 4QUAA 1RIIA 4XGIA 1FNDA 2C2YA 3RFVA 1CFZA 1KFBB 4G0NA 2J3QA 2B99A 2PCLA 4LBVA 2VNAA 2I7VA 4B4KA 3VR3D 3VPFA 1NNUA 3TNDA 5IC5A 1I9CA 2NV0A 1E8NA 1XCBA 1T5IA 4JDUA 1V96A 2OFXA 4OQPA 4FZ3A 1K2WA 1SU4A 4JR1A 4C7KA 2PXHA 3WLFA 3TOZA 3A26A 3CF4A 5K8TA 3H8WA 4FS3A 4DKXA 3SZUA 3TBHA 2JFGA 3ZS8A 3NEJA 1G7TA 1Z2AA 2W6NA 2X86A 3DC7A 5JDIC 1KQFA 1M6VA 4I5DA 3M1YA 3OU6A 1NJ1A 4N5MA 4YV2A 2JLXA 1WD7A 3QA9A 3EHEA 5HJ2A 3LSYA 4ZT4A 1RWWA 1J1IA 3R7BA 4KN5A 4YRPA 1B26A 1FP4A 3ENVA 4GI1A 3SIRA 5B4UA 4WLEA 2B1JA 1UAYA 3KZOA 1ISRA 5BRJA 4EG1A 4DJEC 3KWMA 5JR3A 5IK2A 4R2XA 4Y2VA 4ZKEA 2VHCA 5ESWA 2NOAA 5AHOA 3E4DA 1E6LA 4AWAA 4LJRA 2Z9BA 4TMZA 2ORYA 3F7MA 5CB6A 5LXTA 4MJ7A 5H81A 5BWOA 2GBLC 3DAPA 1QH1B 5G4KB 4IVPA 1U8CB 4NG5A 2D0OB 1W1UA 1OLXB 4AZVA 3CVYA 3PWKA 4CMEA 2K7ZA 4RAOA 2C88A 1IZ8A 2C04A 4MB6A 5EL0A 5DBOA 2OB1A 3ZGNA 4BO9A 1E3DA 2FDRA 4BGEA 5CFPA 3PHGA 3AHGA 3JVDA 3WLKX 2PJRA 3FLBA 4LGCA 4BQSA 3ETLA 2OLJA 5IJAA 1M2JA 3TQCA 4V1CA 4IQ0A 2I3GA 2WFMA 4R4JA 2PRKA 3U7JA 5BVHB 1GM5A 1OTXA 1XHLA 2Q5LA 5DF1A 4M76B 1CX9B 3U4IA 4YCBA 5CEEA 2AKAB 5ALSA 4BAGA 1ETHA 3ANMA 4CT0A 3NRJA 3HVHA 1GGKA 2VTBB 5ARDA 1ONOA 1C8BA 2O2YA 1I5EA 4HUTA 4G0QA 1LS6A 3BEDA 3MOGA 4FYPA 1QHIA 2XZPA 3ONDA 1LKZA 4M0LA 2F3UA 2WSBA 1LQUA 4IJQA 5JVDB 1YZGA 5COBA 3EGXB 4RIIA 4P4SA 3T1VA 5U4XA 1GU7A 2H00A 1EDZA 1GSIA 4KJXA 3EF0A 1BW9B 3CO5A 4QWMA 2Q45A 4CQNA 3KPYA 2OM6A 3N3BC 3V32A 4CFSA 2CXXA 4R1TA 2BKVA 2VP0A 3CQ9A 5GIPE 4I99A 5KTOA 1K06A 1X3LA 2XXJA 2X7JA 3H16A 4QQNA 1ZGJA 5AI4A 3IRVA 5LQJA 2Y8EA 2SHKA 5IXJA 1BMFD 4UM5A 4R9SA 5J4HA 1HEIA 1GZHB 2EYUA 4OUDB 4Y2GA 1GUBA 3R76A 4M86A 3WWPA 3ZV5A 3WAKA 5EP4A 4KITB 3L4JA 2HX1A 5ICSA 1BGWA 4CLEA 2WSMA 3VI3B 3NVKI 4FR5A 4HDMA 4G0MA 2FRXA 2FPLA 1P6UA 3U7QA 1NDQA 5G4LA 3MG9A 3GP5A 1LQ2A 3LPDA 2YXDA 3OT4A 1CEEA 2I71A 2JKVA 3D5EA 4ZGBA 5KSPA 5LQAA 1OXTA 1XFAA 2W00A 3NT2A 3UJ7A 1XDSA 3T06B 2ZRIA 4CV1A 2XBMA 5BURA 3OURA 1EMDA 4JJFA 2WM2A 1AUXA 5ALXA 1JYSA 2RGNA 4AY5A 1UJ2A 2PGDA 2BRUC 1GVNB 4P4GA 3OLCX 1PQYA 1KERA 3DMDA 2E5LB 4D4JA 5AKKA 3L84A 4QDZA 1E77A 5E3HA 1TJYA 3NIFB 2CDNA 4GH5A 5HKKA 3E9EA 2QMEA 1UOPA 4NG4A 4LYYA 5A71A 2P69A 4C6RA 4WV3A 2O2CA 5JWHA 3FVRA 3X3HA 3NHSA 1IJFA 4OQEA 3LUKA 2WHEA 1NNEA 3OCZA 3A04A 2ZREA 1KK0A 3DCJA 1MO5A 2ZSIA 3TSOA 2B8WA 3DLAA 4K03A 2XQGA 4JZYA 2JAXA 4MUEA 5FTMA 3I04A 3UTCA 1V71A 2OCPA 4ZVVA 2XVMA 1RADA 3IDZA 4WVFA 4F9GA 4QXAA 1E6UA 3EOAI 3H9EO 3K72B 2AB0A 1NXQA 2AF4C 5FOTA 3SJCA 5LBUA 3DG9A 2PNJA 5DP2A 2PRZA 4YI3A 5CB0A 2BH2A 4Y8VA 4JP5A 5A1JA 1ID1A 4IVNA 4V0KA 4TQ9A 4YAFA 4JT8A 3RSFA 9ABPA 3SSOA 5C1PA 4DPLA 3F2IA 1EVQA 3GAMA 3LOPA 2OZLB 3JQEA 5TMPA 2QNBA 2GPAA 2WZDA 4FINA 4JLWA 3BWYA 4S1PA 4DJAA 5LPNA 5A0VA 4L9SA 4TLBA 3T9CA 1E1QA 4MLPA 3ZDBA 5FL7D 1RC0A 4FUQA 1MR3F 1RHJA 1LV8A 1P0CA 4JLVA 3GCWA 3ETJA 3BXZA 2R6DA 1GVHA 1M6HA 3OECA 4MSUA 4QBHA 2H0AA 1T1SA 2CV1A 1E32A 4U2KA 4PC2A 3SG0A 5JHHB 1Q0HA 4AXXA 2YWGA 2IXTA 2QG6A 2XUOA 4BX8A 1GKLA 2IY7A 1SXIA 1SIBE 3F3YA 3EPLA 1W6UA 2EZ9A 1BS1A 5KB3A 1P4GA 1VI2A 1YB4A 3D6JA 3O4RA 4LSZA 3DUWA 5HFNA 5JYDA 3MD0A 2IU0A 1QLWA 4UHBA 2EIHA 2H48A 1XRMA 4BO0A 2JFZA 1AK1A 5C3MA 2VHJA 3A4LA 4KCGA 4AB1A 5BORA 2RARA 2FN8A 2R7KA 3BPSA 3C7TA 3DV0A 3NNDA 3WRWA 4CLXA 4NU8X 3KCNA 3TBKA 3EXFA 2Z8XA 2EERA 3WLSA 1RM3A 2XUKA 3WIUA 1XQWA 4CODB 2MSWA 1ISHA 5SZIA 1DMRA 1EUCA 4TTQA 4UUBA 3C4JA 1XO1A 2JIRA 3A06A 4LIPD 1ZI9A 2R11A 3MWYW 3RUHA 5DX8A 3EY4A 2IHUA 3W9SA 2A1IA 1OZHA 2HT1A 3ZU2A 1P60A 2ZUSA 1PTJC 4OHZA 1HV8A 2AEJA 3KQVA 1ZGHA 4UBIA 1FZQA 2FZKA 4GI7A 1USVA 3C16C 3CSDA 2BBOA 2CWDA 3OCXA 1JDUA 3MGGA 4GVPA 5F3WB 5CXQA 3AXTA 3B51X 4PLFA 2AFIB 1JQJC 3W2EA 1MTOA 3TOSA 2OGZA 1GRRA 2BHSA 2ZRKA 3OPMA 1C3LA 5AKEA 3WSTA 1H3EA 4G1FA 1FW8A 4BP8A 4C7OA 2VBFA 4HUQA 5CDUA 1AA9A 3K73O 1SBIA 3T1OA 2WKPA 4V0RA 3HDHA 1UFQA 2PQ6A 4EUNA 4JBIA 3EBLA 2WG0A 4JL8A 1FFAA 1OHHA 1RYBA 2BSQA 3BCUA 2ZJ5A 2MINB 1QPBA 1I1OA 1PUJA 3NWPA 6YASA 3CRVA 4P7GA 4IJ6A 4EG8A 4GDMA 3QPCA 2PKYX 2D06A 2QVZX 5HFAA 3H5VA 1Z2PX 3L8DA 3P0HA 3TLCA 4JI4B 2J3DA 1B0AA 1QYDA 1C0IA 5D5PA 4D8XA 4P3XA 2D1FA 1KDTA 1YQEA 1UMCA 3TTXA 1FMTA 2B78A 5ALPA 3L9WA 3ROKA 3WLTA 4DQ0A 4UQLA 3K70C 1VJTA 3GJQA 3KKMA 2WV7A 3IA2A 1Y9EA 3FRHA 5GPBA 2QTGA 1U94A 3R3YA 5IYZA 4QFBA 2Y1OA 5BSMA 1DLIA 4EVQA 3PVZA 4G9EA 1YT5A 5FLYA 1V5EA 4HLUC 2P0YA 3NLLA 1MFZA 4NBRA 4MINA 5ALRA 1V35A 1ZCBA 1ZL2A 1I32A 4QNMA 1WNFA 4X44A 3ROTA 2DH5A 4W5RA 3ZCQA 1JTVA 3TLGA 1B8OA 5JMWA 3GRYA 3GUZA 2HIGA 2AG0A 1HDEA 3L1JA 4AZTA 3QX9A 4YASA 3HXPA 2J0EA 3T4PA 4IGKA 4XSGA 2C3PA 1JPUA 2V54A 1W36C 1TRHA 3QKSA 1JFFA 3K1ZA 3F74A 3JAMA 1EU1A 1V7QA 4H35A 3SEQA 2CK3A 3LDAA 2YINC 2H2HA 2DX7A 4G1EB 4TLCA 5E4JA 4OI4A 3CJRA 4RDHA 3RVKA 5AW0A 2R44A 4DV6B 2V5UA 3E53A 4W82A 1XLTC 1Z5UA 2X8BA 2EW1A 3V7WA 1AK2A 3CBGA 1HEYA 4GUDA 5JD4A 4MKGA 2C2XA 3KKOA 2J3KA 1P2SA 3N0TA 4JQOA 4F2DA 4FONA 5DYNA 2GLUA 3I37X 3FHOA 5DJ5A 1M2VB 2XY4A 4MI3A 3IIJA 4PX5A 3CKLA 5T67A 4AMVA 2XB9A 2VK2A 5KOJB 4JOBA 4NECA 2OZPA 4TXLA 3O1IC 1W1WA 4YJFA 4JLMA 3S2EA 1G4HA 1EJ0A 3AUKA 4J9UE 2BGNA 2QN1A 1BE1A 1U7WA 3BGDA 4UREA 3DM9B 4F3TA 2IHVA 4F2PA 3QF7A 1T2NA 3LECA 4L5YA 1A3CA 4MVWA 4YMTA 1HT1E 3H3XA 2WAOA 3RNLA 4OSPA 4O8CA 3AHFA 3QU4A 1KZGB 1PK7A 2GO7A 5K4AA 2P65A 1OIVA 3WYFA 2H31A 2I6FA 2V1UA 4WDRA 4UXIA 2RGDA 4WLNA 4KLNA 1KI2A 3UPDA 2IV3A 1L1QA 1NAHA 1PJBA 2HJVA 2OCBA 1LGYA 2VJPA 1SBNE 3B7GA 3L4EA 4AMZA 1KOJA 3W5AA 1AO0A 4IPTA 1RZUA 1G6OA 2H18A 3O31A 1QG6A 3O8OA 1KXZA 2KI5A 1XN4A 4REMA 5ALKA 3JD4A 1XRJA 1NJ2A 2R1VA 5D1NA 2Y67A 1CIJA 4LY6A 1C1DA 1D6MA 4BKRA 4NBKA 4DDHA 4ENUA 5LQDA 3IAFA 2REQA 2JI9A 2WAXA 3MQ4A 3F3KA 1X86B 1CJKC 4YRJA 4YXWD 5JD5A 2B98A 1DKRA 4MS3A 5FFFA 2X2PA 4ZT6A 3NOVA 5DYWA 4BIIA 1GNTA 1JBEA 1I51A 1TT5B 1WXXA 4WBXC 1A77A 1TVKB 2PK3A 3RJMA 3JQAA 4ISBA 3BRCA 5FB3A 4D0GA 1ZD5A 4YMWA 1P5JA 1S3SA 1TM1E 2WSSD 5HF5A 1EPUA 4F4DA 4TYWA 2GDJA 1UANA 2UZAA 3KXIA 4NOMA 4PWYA 2I6QA 1VIAA 2WOJA 4NDNE 4AW9A 4GOXA 2MMGA 5CXXA 1W49A 2PPLA 1JUDA 1XC7A 2WM8A 2WDZA 1WW8A 2XMCA 2X0FA 1KTVA 1YACA 1DJQA 2W2QA 3ZHXA 4AMBA 3SN6A 4JD5A 3D2CA 3KKZA 4C0KA 2WPDD 5T6BA 5JCOC 5IM4F 1GSOA 5IAEA 5CLHA 3MK31 2FEXA 5GJWC 4F6RB 2QSUA 3EVCA 1IY8A 5LN1A 4WZZA 1RI4A 4OI0A 1DUIA 5E9AA 1JE1A 2X5KO 5E2AA 3SQNA 2Z6UA 2Q3FA 4BX2A 5JBQA 3PITA 1HE4A 3GGGA 3Q2IA 5TPZD 1JL3A 2XWJI 1YRYE 2YJTD 4FX2A 1K98A 1Z4NA 1GTSA 4GU5A 1EA7A 1EJBA 3FDFA 2O8FA 1RP7A 2DFTA 4HXEB 4RA6B 1E1DA 1JN0A 1SOAA 1ZC3A 5KQSA 1JHPA 1RLJA 2IOHA 1TIKA 4TWAA 2R87A 2SNIE 3I53A 3VV2A 3OLWA 1P1IA 1STOA 4UUNA 4CL3A 2B8NA 2EQBA 3I39X 3W2GA 1FFGA 2QF7A 3PG5A 4LXTA 3U3ZA 3PXCX 2EFEB 3FM9A 3OZVA 4L27A 2Y9PB 4HJXA 1FNCA 1GNQA 1NYQA 1KEEB 3V9AA 4DB4A 5FOVA 2JFFA 5CVVA 5C8YB 4DM4A 1NIPA 4NULA 3OCYA 4KN6A 1DC8A 1O77A 1W5EA 2OEPA 1M7GA 1SM4A 2PL3A 1G8YA 4ZVOA 2PZMA 1WCWA 4H7HA 3QLVC 4ZJZA 4ZQGA 2H08A 3VX3A 5CFOA 3MC1A 1VRCA 3SHWA 1YB5A 4OBBA 2ECFA 1F12A 1HTWA 4MIEA 1PFQA 4N3AA 1JHOA 1WG8A 4L3WA 2VT2A 4RBNA 1GARA 1NBHA 3QNWA 1DEKA 1CE8A 3FTEA 1U02A 3GRPA 1MO3A 2CW5A 3OE5A 2IIBA 5IASA 5HX7A 2CHQA 3MLAA 1JQEA 3EAQA 1Z6QA 2Y1LA 4JBGA 3GV0A 4BO6A 4BU0A 1XTBA 3BSSA 3I9V6 1GHTA 5IJXA 1WD5A 2VHYA 2WUDA 1DRJA 2AOWA 2XPCA 4X1KA 3R7WB 5H4GA 1IVSA 5K8VA 5G2OA 1HF3A 5AM5A 1GILA 4MXDA 5DNVA 1T2DA 1EUDA 1TW2A 4KAAA 1NPYA 5JANA 1RAGA 3M7IA 1SRQA 1T5DX 3KV1A 3QP9A 4OEHA 2HHHB 4TTSA 4BFLA 4HDQB 3ZHSA 1XU4A 1PV2A 1CHDA 4QX6A 2TMKA 1GZVA 2DMRA 3O3CA 1PZFA 1BDBA 1EFRD 2BM1A 1SZCA 2AT1A 4JGBA 4DCJA 4EPWA 1T5TA 4E2WA 1W75A 1OWNA 1X1CA 3MILA 3UHAA 2RI0A 4K9QA 3VU9B 2GFHA 1S2NA 1QFXA 3KEFA 3LSTA 5ERYA 3TW0A 3WLRA 1SHJA 2JFNA 4E22A 4W5NA 3TQSA 3CVOA 1ZS9A 3QX8A 4X94A 4XASA 1XQYA 1DIAA 4E21A 3I0MA 3M9WA 3N5KA 3SY8A 2G4VA 3P52A 1K68A 3ZD9A 4DEYA 1ZN8A 4M1QA 3IEIA 2VFAA 3M5WA 2EFDB 4NQZA 1P4SA 2EQAA 3O84A 2H1VA 5EFOA 2BGGA 3HU5A 1D4AA 1PJLA 1YE8A 3FAKA 1Y3BE 4YQZA 1IUNA 4DMLA 3X1JA 1QMPA 2R66A 1V11B 1UBJS 2QEQA 4TTPA 5CBKA 1JIIA 3SQMA 1JMKC 3W4KA 3GDWA 3BMOA 3Q87B 1BHQ1 3SZMA 3GEEA 1UDCA 3R5FA 2N1BA 1DE0A 5CH8A 5JNVA 4JWKA 2CHEA 2WU1A 1ADCA 2DPXA 1ZC4A 2P2DA 1PK9A 4OM7A 2GBGA 3CJQA 2ANCA 1I7LA 1QTRA 2H2GA 2C4HA 2P3OA 3GI1A 3A2KA 3FCUB 1Q16A 4HH0A 4U7PB 4NL4H 2QWXA 4OXYA 5EXSA 4EB0A 4WTOA 2KPOA 4FHFA 2CC2A 1PUIA 4LYAA 4M8SA 4J0GA 1B42A 2I22A 4KGZA 2X0KA 3ORFA 1EFVB 4E5KA 4M9CA 4BVHA 5FOSA 1E8MA 1WV0A 5EC8A 5EE5B 3DB1A 5IZ4A 1B3RA 1GA6A 3PE4A 4DA0A 2BYTA 4G1VA 4LMAA 2CL6X 2JK1A 1C0KA 3ZY5A 5B12A 4GUAA 1XJWA 4S1WA 1F5NA 2TMGA 2ACWA 4HI0E 3WWEA 1OHHD 4KXWA 4ZMRA 2G9UA 2OGWA 1ZJYA 1AMNA 2RK6A 5K51A 3OU7A 1IZYA 3FWPA 5JCXA 5E6UA 2DY0A 5A3SA 2Z1DA 3I01A 3QUCA 4ZVKA 3TKLA 2GPBA 4EB8A 1HYEA 2RB4A 4EA6A 1CZHA 3LQ1A 4PZZA 3VKUA 4CGYA 3WNQA 3W78A 1SVIA 4GKAA 2XB2A 5AIAA 4Y9TA 1PT6A 1QH8B 1SBHA 4MNTA 3OC0A 4TZ6A 3R5KA 1M2EA 1OE0A 3Q15C 4MVXA 2FWPA 2QRPA 3ASZA 4I3HA 3FWKA 3M6LA 5JXJA 1WCIA 1J70A 1LX6A 2CN1A 2VUHB 3GJ7A 2AUMA 1AQYA 2QR2A 4JI0B 1L4BA 3ZCPA 1PW7A 4EEZA 5JCJD 4CV2A 3NHRA 4EMBA 5BWBA 4URYR 1LPMA 2Q3HA 4DCCA 3IERA 1W4RA 3EPKA 5A06A 4PLYA 1VJ1A 1JILA 5T3YA 3PS9A 3R6LA 2CNDA 1TEVA 1AX9A 2W6MA 1W47A 4KWIA 2XH8A 2X9NA 2EWWA 3VTZA 4BWYA 1XVLA 3EUEA 4AJLA 4R8MA 1O4WA 2IZ6A 2J7KA 1W36B 1PWHA 2KQUA 8OHMA 2F1HA 2J9YB 1JXAA 3SHTA 1THGA 4H7IA 3Q8XB 3KOOA 3LNCA 4MMXB 5DRYA 1BYUA 3H75A 4FS8A 4AM8A 1MRNA 5DGIA 3U56A 1U5BA 2DULA 1OPRA 3NHUA 4LWOA 1OB2A 2I34A 4YGYA 4BFXA 2QJTA 2OFPA 2HRCA 3PX2A 5DCWA 2OYCA 4REQB 1RRPA 2FPKA 3AIOA 1MAWA 4QQ8A 5A7HA 4K6OA 1H1DA 4R98A 1F3OA 2Y1KA 3VGJA 3O8CA 1SMKA 2GAIA 1E1YA 1ZAYA 3IVXA 1JVNA 1EHCA 1D0IA 2FFQA 1NSTA 4O1HA 2W42A 1T2CA 1A98A 3ONNA 3VJKA 4BNNA 1U1CA 1CR6A 1W30A 2JJ1A 4KQ2A 3K0AB 4UTXA 3T41A 4PRLA 1O54A 5JT1A 4YV0A 3EPPA 3O3MB 2Z6QA 2ZI5A 5L40A 4O59O 2VPXA 2GTIA 4R3NA 4XGKA 4DQDA 3NM4A 4EJSC 4NFSA 3D7LA 5KDDA 5TEWA 2PZ8A 1FJHA 1SCBA 2B1QA 2IDZA 3LLVA 3NVAA 1C4XA 1LZKA 3SHVA 1X3SA 3CW8X 2RGEA 2J5RA 4Q4LA 1I6KA 3T4EA 2O1EA 3G7SA 4OHFA 3U49A 1X8JA 2ZOSA 2YWBA 2FR8A 2W4QA 2Q1WA 5GGXA 3FOEC 1LEHA 2H1LA 2C9OA 3DXXA 1JX6A 1Y33E 4QTYA 3G13A 4Z53A 2WWXA 3NUGA 2A5JA 3LS2A 4G1UC 4ZEMA 3P20A 2HTEA 1GEEA 5T41A 1WA5A 2IEDA 2XHZA 4CMGA 2XAAA 1FXWF 1MIHA 1BU5A 1D6NA 2QXUA 3V8PA 5EMJA 1D4OA 3ELUA 2ECPA 2EATA 2IV7A 3SFVA 1CRQA 1ZUWA 4PEVA 1OH7A 2XMPA 1G8MA 5EINA 2OXEA 2XITA 5JARA 3H1AA 2OA0A 1PQWA 5CIQA 1WDWB 1EXVA 4RKYA 3BE8A 2C42A 2NAPA 4Z5XA 1WSDA 5G3YA 1Z3CA 1X1QA 1DO0A 2X1HA 2IYZA 2VF5X 3F5MA 1J1ZA 3PJGA 4Q48A 1GIAA 4CMEC 5KTYA 4JP1A 1P1BA 3GOQA 5CR9A 2MTBA 5CGQB 4YO7A 2V8BA 5BYJA 3SJAA 1H3FA 4O0LA 4UHJA 1NVFA 4E7OA 1AURA 1QV7A 3L6OO 3CFYA 3I9JA 4AMGA 4D4LA 4KGXA 4OIMA 3F8WA 5GJVC 2TMDA 4K9PA 2JVKA 1GQQA 3Q12A 4JJ6A 4HUJA 1PV1A 4M1MA 2HIHA 3G5AA 4XWWA 3BMCA 2PO5A 1MW9X 2R1ZA 1G20A 3JY6A 4BATA 4TUYA 1EG2A 1JJIA 3MOSA 1K7SN 4EA9A 5LU8A 3WDMA 3HB9A 4X3OA 3QUTA 2IH5A 3I05A 1P80A 4FFSA 4JVOA 5EJ9A 1IMJA 2QMUA 2QUZA 2YKGA 3SDBA 1M1YB 3AUTA 3CPJB 3VUEA 2Z43A 5KYKA 3ACBA 3VRHA 3LHFA 2DQZA 3P0EA 4FGWA 1PW5A 4B17A 1M5TA 1BKSB 3SSMA 2Y27A 3AP2A 2CD7A 3DWEX 1TEZA 3G0CA 3ZWNA 3OKAA 2PSEA 3AILA 4O2AA 2V97A 2WTAA 3JTEA 4GX0A 2R6CA 3ZHOA 2BWJA 2P75A 1R6UA 1TO6A 3I64A 3VPGA 3L6DA 4PYIA 2BFFA 2NYAA 4MV5A 4A0QA 1WDTA 1V2GA 3AR8A 1Y5RA 2Z9DA 1NW8A 1XZFA 1U2EA 2MYPA 5CYPA 1YCDA 2Y05A 4LZNA 1HLFA 2JA2A 4BL5A 1ULHA 2D8AA 2QRZA 4RHXA 4L8VA 1JDBC 4BV2A 3BHNA 1EUCB 4DEXA 2QT1A 2I3BA 2HLDA 3OZGA 4P2BA 3NJ8A 1NURA 4PTLA 3ZJ5A 3LQ2A 1P74A 4S1VA 4JWTA 4D98A 2DBVO 3NIBA 1TQ6A 3SR3A 2FDXA 3UW3A 4LKOA 4KIGA 1KIAA 2Z56A 3UAOA 5C1OA 3GVPA 4JX8A 1OAOC 2VYFA 3TGLA 3DF7A 4OQFA 3DZIA 1K66A 1OYWA 1QOZA 3GG9A 2GN8A 4QREA 1Z3IX 4I1VA 4O02B 1JPJA 2D54A 1SQFA 1FXWA 1XXHA 2WM9B 2PJDA 3MYRA 1JDZA 2B4QA 4YRFA 3USCS 4ALJA 4B2YA 3E48A 5K9ZA 3IQEA 5JZSA 1W5FA 4G8CA 1TLTA 4QUDA 3GNLA 3GJZA 3T3PB 4KE6A 5CT5A 4YJ2F 1ZSVA 1K7XB 5KOHB 2QG4A 1C2TA 1CB7A 3D02A 3P9XA 4N3BA 4PYKA 2EGHA 2ZUBA 4CUZA 4D0SA 4KXVA 2AUNA 3ZC3A 1P8JA 4LXQA 4MR8B 3ZCRA 5LYJA 2BKUA 4DA9A 1W5AA 1G8JA 4PZDA 4Z49A 1N0VC 2FH5B 2H65A 3PC7A 1K6XA 2ET6A 4IIDA 3RARA 1B7GO 3K32A 1LTHR 1CNMA 4NBVA 4ZTUB 2BIFA 4IFBA 3OCUA 1P7VA 2FF7A 4HY3A 5ICFA 5T4EA 4Q9NA 4YREA 1AKVA 4FMBB 2BI7A 4BLOA 1YI0A 1SQGA 5BO5A 3FDZA 2P0EA 3NKVA 3QITA 2RHRA 1TJ3A 4M1EA 4KE9A 3RI3A 3RSQA 3ABSB 2IC5A 2W48A 1XMVA 4YAJA 4B43A 2QRVA 2CFTA 1LBEA 3PUYA 1Z0FA 3DZCA 4HK4A 3D4LA 4KFUA 4P81A 3SBXA 3TDNA 5HIKA 5LQRA 2COEA 3FNBA 2C2OA 1G6KA 4HTAA 1WKVA 5ADHA 2EC5A 2E4UA 3KZCA 1G6HA 5JASA 1PN3A 2D59A 2CJWA 2I1LA 2JCYA 1UBKS 3IOMA 5GTDA 2IIPA 1Q0TA 5B3AA 3H05A 1KWGA 4URHA 1NVVR 4FFRA 3C3EA 4HWSA 4MQBA 2XODA 4TV8F 5T64A 1VJDA 1BEZA 1U1IA 1M1YA 1BOOA 4EG0A 3KSUA 2NSDA 1DP4A 1JLKA 1UPXA 1GZ5A 3ZBQA 3EGIA 1CR1A 5D3QA 1U1GA 2WW8A 2PL1A 3FHJA 3GGJA 1PVDA 2DGDA 3C3CA 3DD5A 3I5UA 3QTLA 4GIBA 3SD7A 3THXA 1O9BA 3FVVA 3VZCA 1QOPB 3UOAB 1QLJA 2GHTA 3GJ6A 4RNCA 1G2PA 3GY0A 1Q83A 3ZU6A 3ADKA 4U2CA 4UATA 4OJYA 3K9GA 2R6AA 1G63A 3QXHA 3AR3A 5AW9A 1Z5VA 3QQPA 4FLMA 3N6VA 3F7OA 1QIEA 3FH0A 1G64A 4HN4B 3U0BA 5KX5B 3WMFA 5IUJC 1P3Y1 4EHDA 2E4XA 2WKQA 1CBUA 2YJNA 3O9VA 1H0KA 4HAVA 4NJMA 5E6RA 2ZXEA 5TGDA 1IN1A 1NE2A 3HYTA 4GXTA 3L1KA 1M72A 4IJWA 1BD4A 4EKDA 3PTLA 5CVTA 5EWJA 1H2HA 4JSRA 5A4FS 5DW0A 1H8HA 3CF6R 2CKMA 1Y6FA 5M3BA 3ZD8A 4QT0A 1GGEA 3SSAA 3WJ2A 4Z9YA 3GGSA 1H0RA 1XZQA 3RFUA 4RELA 3TM5A 5B6IA 1PIWA 1E0SA 1RZRA 2F6RA 4E11A 4E5SA 3DAOA 1AGNA 2NO1A 4YHHB 3EDRA 3N7AA 1LDGA 4XRRA 1QZXA 1ZBDA 3HUDA 4ETWA 3TMKA 1XCOA 2G4LA 3A2LA 2XVZA 1JT2A 4S04A 4QNRA 4PCVA 2YZ7A 2X3FA 2Q3BA 1A9XB 2J6HA 3P0JA 2WR8A 1JA9A 3AHCA 3TINA 3BUSA 4R16A 1XVAA 2KJQA 4P5PA 3VBCA 4Z4HA 3EXFB 3NU1A 3MJ4A 4FIDA 3EULA 5E95A 4FM9A 2QUIA 1JDSA 5AK6A 5A9SA 1ZH8A 1YUNA 1YXMA 1RLIA 3AERB 1U7XA 4PFJA 4RKFA 2NPFA 3PKIA 3ZLTA 4DMRA 1XCGB 4C5CA 5JXGA 1GUZA 1XD2A 4GPTA 4OD0A 4JLPA 1EA5A 3HXLA 3R0XA 5JCOA 3L7CA 4LRWA 3TLBA 3OIYA 3BL6A 3GRUA 4R0VA 4P4LA 3MVEA 4PX2A 1PG2A 4RMGA 4P7FA 2E1RA 3T7TA 5TS2A 5C8ZA 5DBHX 1KARA 2I4RA 4NHOA 4QDXA 1O0CA 3G2PA 4C7OB 1DXOA 3AH8A 5E6SA 3S1LA 4FZ5A 4LUCA 3V6LA 1VKJA 3OZ7A 1HWYA 1J06A 2JJQA 5TQVA 2V8OA 1XMQB 3F97A 2J4DA