3WLFA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with (r)-1-phenyl-1,2-ethanediol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
335
structure length
335
Chain Sequence
b'SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 97
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wlfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wlfA01
1T26A 1YE3A 1FK8A 2YFHA 5AQ1A 1E5LA 4RV9A 4IDGA 2VHWA 4ND2A 5T6BA 3WDSA 1Z7BA 1DAOA 1Q7BA 3OM9A 2CUKA 4O6VA 1BXGB 4EEZA 1BXGA 5KJFA 2LDXA 1X7DA 3T7CA 3LT4A 3TN7A 4CV1A 1VL0A 1D8AA 3FNEA 3A1NA 2F00A 4OMUA 1B15A 3WTBA 3IOYA 3I83A 4OO3A 3E6AA 5A9SB 5A9SA 1TT5B 1TT5A 2G76A 4N5LA 5CP8A 4K6CA 3F1LA 3S2IA 2O3TA 1Q0QA 2ZTMA 1I32A 1ZVMA 1LNQA 2ZYDA 3E18A 2OP0A 1QYWA 2YYYA 4BOYA 2EERA 1GEGA 1EUZA 1N7HA 1P33A 1SB9A 2X9GA 5F1PA 5EN4A 1DLIA 1B8VA 2DAPA 3JQ6A 1R16A 1XQ6A 1EQ2A 5JPIA 4GMFA 5B4TA 5C37A 1RPNA 4BO8A 1JWBB 5L53A 4NQZA 5IN4A 4IQ0A 3CIFA 3UOGA 4YT8A 3LLSA 5TC4A 3AOEC 2ZB8A 3L6EA 2DLDA 1LEHA 2EP5A 1NAHA 1V3VA 2JJYA 2W2LA 4G65A 3U0BA 1LSSA 3JQ9C 2F1KA 1GD1O 2NU8A 2XF8A 3GMDA 3ZU2A 1HE3A 5F5LA 2OGUA 2DFVA 1NHWA 2CMDA 3O9ZA 3PQDA 1BGVA 3TZ6A 4MVJA 4UUMA 3ICPA 3ZWMA 5HS4A 3GPIA 1O8CA 3LQFA 4R9RA 5TF4A 2ZB3A 4D42A 3KLPX 2EJVA 4CMKA 3PDJA 4A10A 3MWEB 1YO6A 1ZNQO 4R41A 4BV8A 1GUZA 3RBZA 3RUFA 4BNFA 4GX0A 1BXKA 1GZ3A 1XGKA 3MJEA 4E5YA 4YWJA 1ID1A 4XEHA 1EUDA 3I4FA 1E6WA 3INTA 1Y8QB 1HDZA 1Y8QA 1QLHA 2QHXA 4PVCA 2X8LA 3UUWA 3ZNOA 3MZ0A 1EEHA 3WFIA 2LDBA 3CE6A 3DEYX 3GUCA 1HXHA 3BTUA 1U8XX 4EJ6A 1WMAA 2X0IA 3C8MA 4WKGA 1LTHR 3KETA 3BMQB 3OIGA 1YBVA 2Q99A 3BMQA 4ZVVA 4DWVA 3D1LA 4TKLA 3DZHA 3H9QA 4ZN6A 3WFJA 1ML3A 4D43A 1N7GA 2DC1A 3WS7A 1VM6A 3VZSA 4Q3EA 1NBOA 3GOHA 1N5DA 4NG5A 4YPOA 2EW2A 4DA9A 3OETA 1AGNA 5I9MA 5KJ1A 1GPJA 2VOJA 4BNMA 3M1AA 3JQ7B 3PIIA 3JQ7A 3ADOA 1OAAA 4GL4A 4CV2A 3PPIA 3H2SA 4AL4A 4GMGA 3IUSA 2PV7A 4CQLB 3SC6A 4J7CA 5IJZA 4A73A 4EYEA 1YDWA 1Y8RA 3P5SA 4R54A 5ES3A 4Q9NA 4CMGA 2O4CA 5FI5A 1E6EA 3OIDA 4QX6A 4RQUA 5CEEA 2V65A 3K92A 4PLCA 4NBUA 2I99A 3IP3A 5DZSA 4L8VA 2P4QA 1ZSNA 1DC4A 3HN2A 3OBBA 3LVFO 1P1RA 5ER6A 3GA0A 3W6ZA 3NT5A 1OC2A 3F6YA 3ZZNA 3EUWA 4JP3A 4BB6A 1K89A 3HDJA 5ICMA 3U09A 5BSGA 2GF2A 1GCUA 3UCXA 3RKUA 1FMCA 5K0ZA 1VKOA 1FDWA 2DKNA 3FPCA 3KB6A 1EK5A 5EJ2A 4BV9A 4XD2A 3ZHBA 3ZV3A 2E37A 3H3FA 3GN2A 3RC9A 5DNAA 2Q50A 1XU9A 2XAAA 1PTJA 3EVNA 3CZMA 2Y05A 4YT5A 4YAIA 1PS9A 3QWHA 1G1AA 2PLAA 4PLGA 2OO5A 3EMKA 2HJRA 4JN6B 3RJ5A 4PCVA 1NXQA 4ND4A 1QP8A 2FPGA 5KKAA 2Y99A 2ZYAA 2WM3A 2JAHA 3AJRA 4JP2A 4KZPA 4WJZA 1N8KA 4OSOA 4JCOA 1PWXA 1ZW1A 5I7SA 1LDEA 1L7EA 4ZGWA 2J3JA 1B2LA 4RGBA 3D4NA 1EZ4A 4AJLA 4LMPA 3M1LA 4W82A 4BKUA 1B8PA 2FP4A 2JD1A 4I8XA 3Q2KA 2GCGA 3P7MA 3M2TA 1GY8A 3E5MA 5ENDA 5K9ZA 5EIOA 2QX7A 2AXQA 4P4LA 4F45A 2Y93A 4QECA 4W9NC 2GZ1A 2PTGA 3TPCA 1X0XA 1MUUA 1XKQA 3JYOA 4KQXA 2CVOA 3PQFA 3EVTA 4UVEA 4CM7A 3NGXA 2E4AA 2FR0A 2YV1A 2ZJ1A 5TX7A 3RUIA 3PJGA 2IODA 3AU8A 4LGVA 1JKFA 4GWKA 3FF4A 3QA9A 3WWYA 4AVYA 3WJAA 3PGJA 1J49A 2E82A 2Q46A 4Z0PA 1I0ZA 4YR9A 2Q49A 2WD8A 1HETA 2VYNA 5TNXA 1DRUA 4WLUA 3WMXA 4NU5A 3K31A 4IXTA 5COQA 2RCYA 3M2PA 2EKQA 2JAPA 2W8ZA 5EL0A 5L4LA 4L73A 3ZW9A 3DFUA 2ZB7A 1QYVA 2EW8A 2ZIZA 4OL9A 1DRWA 5DT9A 4GPD1 5G4LA 2BMAA 1ZJZA 1ONOA 2V6MA 1A7KA 3QVOA 3ZI0A 1YONA 4PG8A 1D3AA 2FRDA 3CEAA 5JW6A 5A5EA 4IMPA 4BNGA 5JCXA 1E1LA 3GR6A 3KRTA 3UCFA 4R1NA 5JFOA 5MGBA 3VHRA 2E48A 3JQBA 1ULUA 2ZCVA 5ER9A 2P68A 4FBGA 3U4DA 1ZK2A 1F17A 2I3GA 2Y1DA 3AI3A 3KUXA 3WYBA 3DBRB 4QO8A 2BFPA 2JFGA 3DBRA 4JXKA 4YAJA 2D1YA 1JA9A 1W73A 3I4CA 3KTDA 3AOGA 3DBVO 2Y1FA 1E3SA 1R4MA 2WTBA 4ZRMA 5KVCA 2X9NA 1ZK0A 1U5CA 4WNCA 2Y68A 2A35A 1DOHA 1O6ZA 3VPFA 1DLJA 3ZGYA 2HMSA 3H8VA 4D3DA 4DBVO 3S2GA 4BO4A 3NYWA 3B6ZA 5IDWA 3ITKA 4B79A 2NU9A 3EW7A 4KWHA 3QVWA 4BB5A 3FNGA 3KVOA 4TRRA 2HO5A 1BG6A 4RVDA 1M6HA 3WGHA 4OXYA 3ZWYA 4Z3DA 2W2KA 1NQOA 2BGMA 2B37A 2QIOA 2VRBA 1DAPA 1NQAO 3C7CB 4AFNA 3HUDA 1Y1PA 4FFLA 1I8TA 2PGLA 3PLRA 2EXXA 4OGWA 1OI7A 1P9LA 3UW3A 3D3EA 3LLVA 3WG9A 3G79A 1TT7A 3DB2A 4QFCA 2R00C 2CVZA 2VUSA 3OF2A 4I5EA 1C0KA 3L4BC 2QW8A 3S8MA 3I23A 3NRCA 1P45A 2POQX 2ZK7A 4L4XA 3JQ8B 4FFNA 3FR7A 4DTIA 3ZU3A 1TLTA 4ID9A 3FNHA 2AQ8A 2Q2VA 4ALMA 4E5KA 5TLSA 4RVFA 3A9WA 3ZHZA 4A7PA 3ANMA 3KZVA 3E9QA 1JAYA 5L3ZA 1PJ3A 4S1VA 4XB1A 5F1OA 1MC5A 4FW8A 5T57A 1NTOA 1CIVA 3VC7A 2G17A 2H6EA 3ZNPA 1HWYA 3D4OA 3NTRA 3P2OA 3SVTA 1C1XB 1C1XA 2IZ1A 4PG5A 3RAJA 3IIEA 1ZK4A 4PLZA 5L4SA 4I5FA 5K6AA 4YJFB 2WD7B 4E5PA 2X5KO 4K28A 4BNXA 4M49A 1PL6A 5A4DA 1D1SA 4H3VA 1ADBA 4ZQEA 3D3WB 4CLOA 3D3WA 5TSDA 2VHYA 4BVAA 2JCXA 4DGSA 4IM7A 4K6FA 1OZAA 1E7YA 4FC7A 1ULSA 2R2GA 3WSVA 2AG5A 3L6OO 1EVIA 1ZJYA 4BQPA 1TVEA 3RWBA 4B4WA 4GBJA 1S6YA 2PZJA 1ADCA 2HAEA 1PGQA 4MKZA 3GVXA 4CM3A 3JYLA 4CMEC 2J3IA 5EQFA 4XDYA 4XYLA 5KVSA 2OBNA 3JQAB 4MVJG 4F3YA 4FJ1A 1DC6A 2GN9A 3WIDA 2B36A 5EQDA 1O9BA 3FHLA 3UN1A 3HDHA 4Y98A 2VHVA 1IOLA 1GQQA 4J2OA 4YB8A 3W4IA 4BKRA 3K2BA 4LRSB 4DMMA 3WYEA 2D0IA 1SNYA 1MG0A 4Y67A 2IRWA 4UEJA 4XYBA 1VRWA 4NFHA 1BTOA 4WCFB 3VH3A 3ST7A 4I9HA 1B16A 4N7RA 3GC6A 3I6QA 3JSAA 2NVUB 3RU9A 2NVUA 3VTZA 2ET6A 1E7WA 3IL2A 4KDEA 4YT4A 2FHSA 5KWEA 2CF6A 3G3EA 4XR9A 3S2EA 5KJ6A 3R3JA 1I24A 2NNLD 3Q3CA 1O0SA 2DU8A 2I3AA 3QVSA 2DBRA 4LK3A 4R5MA 3WX0A 1ORRA 4HY3A 5KVVA 1C1DB 1C1DA 1DC3A 2DTDA 3UKOA 5KOIA 4FIZA 5IDYA 2DQ4A 5KTKA 3IDSA 5JNLA 1JAXA 1DFHA 1PQPA 1SOVA 2WYVA 3C1AA 5I9LA 1H94A 5FFFA 4P22A 1YH3A 4FFOA 4UVIA 4OAQA 3PGXA 1QYXA 4XQEA 2BGKA 4QSMA 3OQ1A 2O3RA 4MP8A 2GD1O 4OXNA 2VWGA 4XWYA 3HNPA 3KYDB 2WE7A 5KKCA 2HK8A 3CPSA 4DQUA 3GGOA 2O3JA 4JLWA 4CQMA 1X0VA 4W6ZA 2VNSA 4MO2A 5B1YA 2JFFA 4C7KA 3C7DB 2Q45A 5C7IO 3ETGA 4WLNA 1ADFA 1HDRA 1HE4A 2BFAA 3BAZA 4WLEA 4DMLA 1FF9A 1ZK3A 4IDDA 4WECA 1HDCA 3Q2IA 2GO1A 5AXAA 4EGFA 3GDGA 3NKLA 4O5OA 4OKIA 4A2CA 1C0PA 3UF0A 5IDQA 1B26A 3ONFA 1UZLA 5B4UA 1RM0A 4B7CA 4E5NA 4NBTA 1CWUA 4FJ0A 3JCZA 3AY7A 1ZKMA 5JLAA 4RF4A 4A27A 3LF2A 1YRLA 3U49A 5JDCA 4FOSA 4LRTB 4DQVA 2X86A 3QIVA 1YBAA 3EZLA 3DOJA 3H65A 3DAGA 1VJTA 4UULA 2ILTA 3QWAA 4E6PA 1XG5A 1C3VA 1I2ZA 3GVIA 2VZ9A 1I3KA 1V3UA 1H2HA 1PX0A 3BMNB 3DL2A 2AE2A 2HMWA 5HTOA 2PKQO 4Y9DA 1XSEA 1NX6A 1M76A 2IYOA 4HFRA 3ZWXA 2W4QA 3FTPA 4JBIA 2AA3A 3RSHA 2FZEA 3F5SA 1LI4A 4J43A 3JD1A 2PD3A 1Z6ZA 1MA0A 3W8DA 4BIIA 4WLOA 5EERA 3FNFA 4Z0HO 2IZZA 1IHYA 2I6TA 3QP9A 1ENYA 3F1KA 5C3MA 4IJUA 4E2YA 1X13A 4AJIA 2P5UA 5CDSA 4E32A 1Z73A 2Z1NA 1LC3A 4DVJA 5DDIP 3DZIA 4BO7A 1GPDG 3TSCA 3BMCB 1KVTA 2H63A 5A02A 4MDHA 1K6JA 1NFFA 4U8GA 3AI1A 3JD4A 2PKQP 2HMUA 4B4VA 1PJLA 4OKNA 1KVSA 2QZZA 3WYCA 2G82A 5G0TA 3ZWOA 2YFQA 1XCBA 3WQQA 2P9CA 4NMHA 3G1TA 4MIOA 4MVJM 2IE0A 2UDPA 3QWBA 4M87A 2EJWA 1ZXLA 2J3KA 5A05A 4AG3A 4YEDA 4YBZA 4DBZA 2EP7A 4HADA 3AM4A 1I3MA 4P4GA 3QWIA 1LBEA 2QQ5A 1V0JA 3IJRA 1KOLA 1EK6A 1A71A 4CMJA 3C3XA 3KV3O 5F1KA 1E7MA 1I30A 1MV8A 2Y0CA 4IDFA 2CDBA 2O23A 4J4HA 1OC4A 3Q11A 4W4TA 3QW2A 5DN9A 4GLLA 1QRRA 4E0BA 3LDHA 3JQAD 3OHSX 4B3IA 4KP7A 1Y9EA 3PI7A 3JTMA 5I9NA 1JN0A 4PLPA 4GAEA 4NK5A 4YQZA 1NYTA 3ENNA 3SX2A 4PLHA 3HADA 2C29D 2PZKA 4XRGA 4DREA 1JWAB 1LUAA 4A5OA 2EIHA 3ZNNA 4D44A 4PGFA 1KVRA 3GNSA 4LCJA 4PFJA 3L0DA 2Y1GA 4YA6A 5ILOA 2D59A 3ASUA 3E8XA 3GDFA 4ESOA 3E03A 1PQUA 1EVJA 2ZATA 3VPXA 1KEWA 4MKXA 5JDIC 3PYMA 3I3OA 3DAPA 2NUAA 5JCJA 3ZCXA 1L7DA 4XJSA 5BSHA 4OIMA 1WW8A 2FR1A 1UAGA 2YQ5A 3PWKA 4Q3AA 1UDCA 3L77A 3LT2A 3MCVA 3MOIA 1WMBA 4L0QA 4ONEA 2O7SA 4J7XA 5HRUA 3U62A 1YB4A 1QG6A 1UXIA 1LU9A 1WNTA 5JSFA 1D1TA 5MDHA 3ZV4A 1DIBA 5THQA 3DTYA 2X0RA 3EC7A 3ORFA 3K5PA 4PLYA 5DP2A 3U3XA 3LC7O 3ZDFA 1LRLA 3E82A 3DMTC 1ZO8A 4XIJA 2Z95A 2BFOA 3OJLA 3VZPA 3BHMA 2B69A 1PS0A 3FBGA 3LF1A 4FGSA 4I5GA 5A1TA 2VN8A 1W8DA 4XQCA 4YDRA 3WIEA 3GG9A 2V7PA 1IY8A 1QLJA 1R0LA 1YJ8A 1F12A 1ZSVA 3H4VA 2JL1A 4IPTA 1R0KA 4II2A 1ISHA 2NACA 3ON5A 1HDGO 1KVQA 3KO8A 1TB4A 4GGPA 5CFZA 2PWZA 2Q1WA 5ILGA 2RHCA 4CLRB 4CLRA 8LDHA 2BHLA 4BO1A 1HTBA 3ZWVA 4N54A 2QYTA 1IL0A 3NT4A 4BMSA 1QMGA 3HDYA 1H6CA 2NTJA 2QYSA 2DBVO 3WNVA 2NU6A 3TL2A 3UHAA 4D41A 1ISJA 3QVXA 1NQTA 1VSUA 4EEXA 3JQFC 4QTZA 4R16A 1YVEI 3DZFA 3U4HA 3V2GA 1O95A 4U5QA 3NDRA 3WGZA 3A14A 4EI2A 2NSDA 2Q1SA 5H83A 4Q3CA 1EMDA 3OP4A 4MVJF 1DHRA 1QV7A 1ENPA 4LMRA 3E9MA 4TVOA 3V8BA 1T4DA 1G0OA 3ENKA 3VVBA 1HRDA 3E9NA 4N5MA 3Q6IA 4YCAA 2DBQA 4ITUA 2GGSA 4GWGA 4ROSA 3SLGA 1P44A 4DPLA 3RUHA 3FCOA 2NQTA 1AXGA 4K26A 3GT0A 4Q3BA 4IDEA 1XIVA 4MVJE 4WNIA 1XLTA 4YYZA 1FXSA 3R3SA 3VDRA 2BKAA 2Y67A 3COSA 2AEJA 5IZCA 4MVJH 2EG9A 2QZ9A 4FB5A 4IINA 2V6FA 3QRWA 3JV7A 3STHA 3AY6A 4H7PA 1SZJG 3VZRA 1YL6A 3NUGA 5TQVA 3GY0A 3ROPA 2FMUA 3NV9A 4R01A 2CVQA 2FWMX 3K96A 3N7UA 4GSLA 2QRKA 4NIMA 2C5AA 3BHJA 4CUJA 5IDXA 4XYMA 1C0LA 4KOAA 2QRJA 3TRIA 3ZU5A 4CMHA 4CR7A 1T2DA 4FFPA 1Y8RB 1UH5A 3AUUA 4IIVA 3O4RA 3U4IA 4N18A 4RQTA 4E31A 3DZBA 2O50A 3OEYA 3QJ5A 2X4GA 4J91A 3F4BA 3QHAA 4M1QA 3OJOA 1P1JA 1VKNA 3WQRA 4FFMA 4OQYA 1YKFA 3EHEA 4E21A 4BHTA 3UXYA 5TJHA 1PGNA 3NJ4A 4YAKA 1ZMOA 1JVSA 3ONDA 1SCUA 2B5WA 1T4BA 4CM5A 1GYQA 3OECA 1XWFA 3S2FA 1SC6A 1UP7A 1A9YA 5T67A 4CM9D 3CKYA 4E30A 4Y6SA 1NFQA 3ZHXA 1SMKA 2BF7A 3CSDA 5JAMA 2AW5A 5BR7A 3RUCA 1QYDA 4JJGA 3QSGA 2VYVD 1I10A 1MC4A 2BRUA 3PJFA 2DT5A 4KWIA 4M86A 3X2FA 1PJ2A 4HXYA 1U1IA 3UH1A 2PA3A 1UJMA 4Q3NA 3GN1A 3OJFA 3CTMA 4LCEA 3AM5A 2X7HA 4IS2A 2X9VA 2VRCA 1PS8A 3WTCA 2IEBA 5GZ1A 4DIOA 2XXJA 4ZQFA 2AEMA 3BTOA 1NAIA 1EE9A 4GKVA 4HP8A 2YZ7A 2EKPA 2WJPA 3LK7A 3GG2A 3KEQA 4C7JA 4URFA 4E13A 2BFMA 1YS4A 4IDBA 3ZU4A 3OFSA 3DOCA 3MWDB 2Y0DA 3HFGA 1P77A 2B83A 3LU1A 3IS3A 5B37A 1CEQA 2DFDA 2YW9A 5COBA 1AE1A 2NVWA 5B12A 1DIAA 3BYZA 4J0FA 5I8WA 1N92A 1Y9AA 3JQGB 3JQGA 1CERA 1R4NB 1R4NA 3PJDA 4RZIA 2EF1A 3FN4A 1JDJA 2GYYA 3NJ8A 5CG1A 5THKA 1IULA 1M6WA 2ZQZA 2X22A 4IQ8A 4B8WA 5CDUA 4KUEA 2BI8A 2VT2A 1BVUA 4CLXA 1CDOA 4CUZA 5G0UA 1T24A 3PIDA 3WMWA 2PFGA 1CETA 1MX3A 4TSKA 2Y0EA 4Z3KA 1QXSA 3SC4A 4BNKA 5JAZA 1YQGA 2PD6A 4JIGA 2H1SA 1I01A 4HX5A 1UUFA 3JD2A 4R4JA 1MGOA 1NPDA 2X1HA 2PH3A 3OICA 5I7FA 3HDQA 2AG8A 3H5NA 4MINA 1HYEA 2NQ8A 1F8FA 2W2LD 1VE9A 2BD0A 2NTVA 3OQBA 2VHZA 3RBXA 3AUAA 1P1IA 4RVUA 3B20A 1KETA 2OL4A 2YHIB 4XRRA 2YHIA 2OXIA 4CMAA 5IAAA 3DQPA 4MVJD 2O3UA 4WOKA 4DC1A 4L74A 3SJUA 4NU6A 1PWZA 2GERA 4QFDA 4XKJA 3F47A 4IXWA 1L1FA 4EITA 4ZQBA 4CJXA 3D64A 1QV6A 4IDAA 1KEVA 3FBTA 6LDHA 4XDZA 1LXCA 1M66A 1IPEA 2X23A 1YL7A 3ULKA 1R4MB 2BLLA 3O26A 4MPDA 3ZV6A 3O03A 4GSKA 5ITVA 3GH3A 5FI3A 2IEDA 1NPYA 4TRMA 2Q2QA 5J23A 5TRTA 4TWRA 3B1FA 3PYXA 4UVDA 5LDGA 1E1KA 2GUGA 1U7TA 3QLJA 1I33A 2VWQA 1E3LA 1HT0A 2O2SA 3BXXA 3BA1A 4G81A 5AVOA 1DIGA 3JYPA 5GZ6A 4E12A 3CUKA 3AFMA 5L51A 2W2KB 1H6BA 3PHJA 4AJOA 3TZQA 4I9UA 1F14A 1SOWA 3C1TA 4IQGA 4NBRA 5JYEA 4AJ1A 1LLUA 3I9LA 1U3TA 4YJHB 1ZH8A 4YJHA 5TGDA 5H81A 1DRVA 2HJSA 4FSHA 4IY1A 4Z9YA 1E7RA 1Y5RA 3N58A 4PLVA 3AUSA 3DOOA 4NI5A 5BNIA 1U4OA 5G4KB 4BO2A 5G4KA 1VL6A 5EESA 5CG2A 1J6UA 3VKUA 4E2ZA 4J1TA 2V6BA 4CR6A 4U6SA 2O7QA 2FSSA 4BNLA 3AWDA 4EJ0A 3RUEA 3BMOB 1WDLA 2CD9A 3BMOA 1CQJA 3PHHA 4HNHA 5C7LO 2TMGA 1LSJA 3DO5A 1GUFA 4R1SA 3DWFA 4D0SA 1A4IA 2Q1UA 4RPKA 1YB5A 1DIHA 4ZQGA 3GLQA 2D3TA 5B4VA 3ZW8A 1CQIA 3GEDA 5AYVA 3BIOA 3TFQA 5KNLA 1DEHA 1SEPA 4UUNA 1O94A 1RKXA 3D4PA 3R1IA 4XYGA 5JAIA 3U5TA 1P0CA 1WDKA 1U2GA 1JKIA 5U9CA 2AHRA 5KJCA 3H9GA 4RF5A 4ALIA 1GQ2A 4U6QA 5AXCA 5A5FA 1NWHA 3RVDA 4CLOB 3I1JA 3RI3A 3Q1LA 3V2HA 1Y5MA 2FPPA 1P1FA 4ND3A 2IXAA 1WWKA 1AXEA 1E0DA 4DLBA 1I3NA 3ABIA 1Y7TA 2JKVA 2VT3A 2UAGA 3E48A 1YQXA 5DF1A 4BNNA 3I9MA 1EFKA 3VDQA 1PGPA 4CUKA 3GK3A 5CDYA 5JO9A 4J16A 5BNTA 3RFXA 9LDBA 1UXGA 2DPHA 3VAZA 5T8KA 3IAHA 1DDOA 4IDCA 1V3TA 1LQTA 2RH8A 1N9GB 4PRKA 1N9GA 5A3JA 1K2WA 1ZCJA 2JCVA 3K6JA 1T2FA 3MJCA 3QE3A 3WJ7A 3OJEA 1DFIA 1Z45A 2GZ3A 5IFLA 1H0KA 1KC1A 3GGGA 2WDZA 1BWSA 4U0KA 3O38A 1XR3A 4LW8A 1UXKA 2Q4BA 5DCYA 1R0SA 1IE3A 2NADA 1KEPA 2ZTVA 4F6CA 1WVGA 2VHXA 5L7TA 2JCYA 5IZ4A 1I5RA 3VH1A 4R1UA 4CLHA 3QVTA 4ND5A 3W8EA 2J6IA 1DJQA 1B14A 4N5NA 1H9BA 3V2UA 2NTNA 3VZQA 1CYDA 3MJ4A 1LA2A 7ADHA 4B7UA 5DBFA 3PDUA 3GHYA 4NFYA 1EDZA 2Q2WA 3HE3A 3ZWWA 1NM5A 4WLFA 5JS6A 9LDTA 3E1KA 4J6FA 5KVQA 5K1SA 2FSVA 1V9LA 1B7GO 2P4HX 2PZLA 4E33A 1U4SA 1BVRA 1CJCA 2VYND 2UVDA 3T4EA 1X15A 3OIFA 4NPCA 1IHXA 3WR5A 4TQGA 4U0JA 3D7LA 1V8BA 3PRJA 4RLHA 4R9SA 4XQGA 5K6AC 4R3NA 1B0AA 5JC8A 4Z9XA 3MJSA 2NLOA 4GVLA 2R6JA 4HWKA 4TZKA 1I3LA 3C24A 2JHFA 4Y6RA 5A3VA 4CM1A 3K9QO 4X54A 3I9NA 5TT0A 3GF4A 4HFJA 1I36A 1WPQA 5BT9A 2FR8A 5LCXA 3OA0A 4CQMB 3HG7A 3HSKA 2WYUA 4A26A 3CINA 4B7XA 3NT2A 1VJ1A 1LX6A 4Y6PA 1H2BA 3CMMA 1PL7A 1FDTA 2G5CA 3INGA 4R68A 1VJ0A 1Y6JA 2RBEA 5L95A 4W99A 4BQRA 1O89A 1GV1A 3FD8A 1KS9A 3GPDG 4Y8VA 3JQCA 4DRYA 1RM3A 4NFSA 4Q39A 3MEQA 1HYGA 4FD3A 2O48X 1X7HA 4YVFA 1AUPA 3R0IA 3RD5A 1RWBA 3UAGA 1E3WA 2E49A 4XR4A 4D7AA 5CEFA 4YAGA 4MVJP 2D8AA 4TRNA 1ZEJA 1WLYA 3WB9A 1E6UA 2XPCA 3AFNA 3OA2A 4M55A 1LDYA 1AN9A 5F21A 1B8UA 4NZ9A 1UDBA 1DJNA 1ENZA 1B3BA 3A28A 1YGYA 2C82A 2HDHA 3F4LA 3HFSA 3NX4A 4WCFC 4DL9A 5JXWA 1JW9B 5I7VA 3I6IA 3KYCB 3RJ9A 2I5PO 1ONPA 3KYCA 4BKQA 3GRKA 1HYHA 4ZA2A 1ZFNA 3KLMX 2D2IA 1DXYA 1NR1A 1RJWA 1NPTO 3KYBA 3FI9A 3VKVA 3PZBA 3MJTA 2NM0A 1Q0HA 4CMCA 1DSSG 4NJOA 1UP4A 3PFWO 1E3JA 2DVMA 4EBFA 4JBHA 3DXFA 2VOEA 4JJFA 4ND1A 3I9JA 3KSZO 4I08A 3RFTA 3DHYA 2ZTUA 2DUUA 3H7AA 2HQ1A 1DHTA 2X0JA 3T7EA 1PU2A 2ZTLA 1AHIA 4GX2A 4BNZA 3VPSA 4BMNA 1T1SA 4PVDA 3H9JA 1P3DA 4XB2A 2GN8A 4G2NA 3I9KA 1BHSA 3UCEA 2AQKA 5GY7A 3RC7A 4E2WA 1YOVB 1YOVA 3ZH2A 4YQYA 1SBYA 3RUDA 4FN4A 1UXHA 4EW6A 5IXYA 3IJPA 4ZICA 4GI2A 1DBVO 2Q3EA 3KM0A 3TOZA 5JDIA 3QY9A 2CDCA 4CODB 1FDUA 4CM6A 3PP8A 1TXGA 3GEGA 4GH5A 4AJJA 1OMOA 2IDZA 3BZUA 5DBGA 5H82A 1MFZA 4NNJA 1C0IA 1T25A 5HA5A 3BTVA 2HCTA 1MXFA 3NDIA 3F46A 1HE2A 1EQUA 5JC1A 2Z1MA 1H6DA 3RROA 5TS3A 4WOJA 4DPKA 3EK2A 3V1YA 4B8ZA 4C4OA 3AW9A 3ANLA 1P31A 1U5AA 4YAEA 4ZU3A 4D79A 3ICCA 2C54A 1WZEA 5JDCC 1MP0A 1R66A 1SEVA 3DZKA 5FWNA 4TVBA 3CXRA 2EV9A 2B35A 3PQEA 2C20A 1XYGA 3WGOA 3TDKA 1GEEA 2PR2A 3AOEA 3G49A 1ISFA 1M2WA 3LZ6A 3GDOA 2C2YA 3JQ9A 3GQVA 2P2SA 5JMPA 1VC2A 4JX8A 3L6DA 4PLFA 4OOFA 2B4QA 3K73O 1MB4A 5G0SA 3PXXA 3SBOA 4DIFA 2GLXA 5L9AA 5ADHA 3PYLA 1PEDA 4ALLA 4CMBA 4L4RA 3ZWCA 1XA0A 4DXHA 1IB6A 1HE5A 1T2EA 4PN3A 4YACA 1WXDA 1P0FA 1NQ5A 3Q9UA 1GV0A 3ZWNA 4DYVA 1GZ6A 3ASVA 5L40A 4BO0A 5GZ3A 4OSPA 2QRLA 2UUPA 1GCOA 4DQXA 2ZKLA 2NWQA 3KSUA 2IXBA 5U1PA 3FWZA 4RDHA 4RPGA 5BSFA 1LQUA 4CR8A 3WQSB 2X5OA 5TJ9A 3JD0A 1Q0LA 4MKRA 1IYZA 4WEQA 4F6LA 1E92A 4OQZA 1PSDA 1LDMA 1QORA 4RDIA 1K3TA 1EE2A 5L45A 2C2XA 2RH4A 4FPXA 3H5RA 1PZEA 4RF2A 1KERA 3B1KA 3ANNA 1HLDA 4BNIA 1H9AA 1UXJA 4CMIB 3TJRA 4CMIA 1JLLA 2YDXA 5A03A 1RM5A 4BGUA 1ZSYA 4PZEA 1NFRA 4CV3A 1ISMA 2FN7A 1YQDA 2PZMA 2X6TA 4J90A 1HF3A 1F06A 4J2HA 4YT2A 2VUTA 5G0VA 4KTVE 4CQMD 3WGTA 5LC1A 3I5MA 2B4TO 2OP1A 4PG7A 1E5QA 3S55A 2PK3A 3RIHA 2GNAA 1Z75A 3CZRA 1HZJA 1SB8A 1PJTA 2CZCA 1E1NA 4AJ4A 1DPGA 4ZQHA 4MJLA 1O5IA 5G0WA 5DCWA 1Z74A 4XYEA 1I2BA 5A9TA 1ZEMA 4GLOA 5JAQA 1G0NA 5I8ZA 3NTOA 3JYNA 1Q2XA 1IZ9A 3UVEA 2J5QA 3U4CA 4GGOA 1GZ4A 2ZJ0A 5CDTA 4JGBA 1A9ZA 1TEHA 3PVZA 2RAFA 2P9GA 3TFOA 3P2YA 3Q9NA 2HUNA 3DBLB 4GVXA 3DBLA 1EFLA 2GSDA 4UEOA 2CY0A 4YRAA 4UVHA 3DHNA 4L9RA 2J8ZA 1GR0A 1PIWA 3EZYA 1IPFA 2AMFA 5ICSA 4K9DA 4ZJUA 2VUUA 2NU7A 1PR3A 1X14A 3NGLA 1GUYA 4CLEA 3WLEA 3LT0A 1XHLA 2BGLA 7MDHA 4G5HA 3ETDA 5TIIA 4WGGA 2YV3A 3DAFA 4HKTA 3GUYA 4ZD6A 1LRJA 3G1UA 3WGQA 4HFNA 5JMWA 1XELA 3PJEA 4NBVA 4R5HA 1UDAA 3WGGA 4QEDA 2YY7A 4P8RA 2WMDA 3MTJA 2X5JO 4IZHA 4RJTA 4PRLA 4F46A 3C7AA 5FEUA 3D0OA 4OJNA 1CRWG 4RPJA 3UICA 2OBYA 1R37A 1M67A 5JO0A 1W4ZA 4CPDA 4PIVA 4E2XA 2GASA 3W8FA 3BHIA 5FYDA 4DYDA 2OUIA 3A4VA 4J9UE 4IJKA 1HL3A 2A9FA 4KMSA 4I5DA 1F0YA 4AICA 1K0UA 1SPXA 4BO3A 1KEUA 4HBGA 4NDNE 2QG4A 3RUAA 2C7GA 3IC5A 5AOVA 5EINA 1NP3A 3JQEA 5I7EA 1NVGA 1J4AA 3L4SO 4W9NA 4CQLA 1E7SA 4BNHA 1A5ZA 4BMVA 5HM8A 2CFCA 4EUHA 4QUKA 1MG5A 4D45A 1HZZA 1Z82A 1HDOA 1E3IA 2OFPA 3TL3A 1B3RA 4TZTA 4BNTA 1KYQA 4XGNA 5CPBA 1VL8A 3DONA 3GVPA 3QV1A 1ZZEA 1IZ0A 4XIYA 4BGIA 4JBGA 2I67A 3LSYA 3RKRA 3FWNA 1VLLA 1ZUD1 3EDMA 4KQWA 3TNLA 2GRAA 3K2EA 4QQRA 1H93A 4BGVA 1HSOA 2I65A 4FGWA 4AJNA 3LT1A 1BDBA 4WASA 4A03A 2B0JA 1U3VA 3GZ4A 3D5TA 3O8QB 3O8QA 4GX5A 4WK6A 3DC2A 1ONNA 4J0EA 5BQFA 2EGHA 1JVBA 1UP6A 4BNJA 5IZCC 3SLKA 5A04A 5C5IA 4WLVA 3WGYA 3TWOA 3KEOA 3DZJA 1PZFA 4UUPA 3L9WA 4E4YA 1LSUA 3I9OA 1GYRA 3M6IA 2WYWA 5KCZA 1EVZA 3K30A 3ROQA 1R12A 3OSUA 4KUHA 4R69A 4XCVA 5JCJD 2EEZA 2FPIA 3FR8A 1RYEA 3JD3A 4ALKA 3ROKA 4W7IA 1NASA 4AJEA 2DTEA 3OH8A 3RASA 4ALNA 1ARZA 1X1EA 2HK9A 3DFZA 3H5AA 4CM4B 4CM4A 4CL8A 3EYWA 3IKVA 1W6UA 2FZWA 2OHXA 3AI2A 4LVUA 3W4KA 4P38A 4AJPA 4XGIA 4E5MA 4IGEA 3E5RA 1J0XO 4AJ2A 3GAZA 4IUYA 4RVSA 1OBFO 1P1KA 1Q7GA 4JQCA 4B3JA 2CF5A 4OOEA 3S1LA 2JD2A 4WPGA 2D4AA 3KSDO 2EHDA 2IYPA 4JJIA 3H2ZA 4Q3DA 5T5QA 1WP4A 2XOXA 3ZN2A 1E3EA 5DP1A 4O0LA 3LC1O 4TKMA 3VVCA 1YWGO 2PNFA 2HLPA 3PWZA 4ZHSA 2R00A 3OMLA 3ZV5A 4BO9A 4BNUA 2XXBA 1NWCA 1K6IA 3L4BA 4KDFA 3F5QA 3SEFA 3L07A 4CLDA 3HZZA 2IZ0A 4WUVA 4J9VA 4A0SA 4PZDA 1NNUA 4RPLA 4EJMA 2VQ3A 1KC3A 1V6AA 4IJWA 1N1EA 4XJTA 4UEKA 2JFHA 1K6XA 1VI2A 1YJQA 4BNVA 4HV4A 2ZYGA 2CNBA 2AE1A 4LSWA 4NHEA 4J7UA 1GYPA 4R1TA 1ZBQA 4S3MA 4XQ9A 5F5NA 1EBFA 4ALJA 1JU9A 4IGFA 1PL8A 2JHGA 4DUPA 1MLDA 1U2DA 2VTDA 3H6KA 2I9PA 3PZRA 3CH6A 1Z7EA 4LN1A 3PK0A 5CEJA 4RVHA 3WOHA 1C14A 3DTTA 2DTXA 2NVBA 1UAYA 4BKOA 1UZMA 1PQWA 3PHLA 3IMFA 4RORA 4UVGA 4EDFA 2WE8A 3GVHA 2X58A 3WGIA 5JY6A 5CAEA 1A4UA 4KTTE 1GFSA 3GFGA 3GFBA 2VCYA 4NR0A 2J5RA 4NBWA 3DR3A 3VPGA 2YDYA 1N1GA 3RC2A 5DOVA 1Y81A 3D5QA 3HB4X 2BI7A 2O3SA 1T2CA 3A06A 1Q1NA 2HU2A 3G0OA 1ADGA 4OH1A 3AK4A 3Q0EA 1GDHA 4LISA 2H5LA 2YJZA 4MVJI 3WWZA 4R3WA 1PJ4A 1DC5A 5A9RA 4CV0A 4B4OA 3DHEA 2EKLA 4CM8B 1YB1A 4CM8A 2VWPA 2Y1CA 4LVCA 4CMEA 4FOOA 4J1QA 3C85A 3H3JA 1RM4A 2EGGA 3ONEA 5AXDA 2JD0A 1U28A 3K8ZA 1R15A 1HEUA 1EUCA 3NDJA 2GPTA 3B1JA 4L4SA 4DLAA 4XX0A 3DZGA 1U3UA 3GEMA 3VOSA 4I1IA 1W0CA 2RIRA 4CL3A 3QQPA 1HLPA 4OXKA 5COAA 3TZKA 1EVYA 2J3HA 2P91A 4RLSA 1QSGA 4HFMA 4EUEA 3LYLA 4U7WA 5EPOA 2GN6A 1N2SA 3DMYA 1KY5A 4MOWA 2EWMA 1ISIA 3WBFA 2PGDA 4FS3A 1QKIA 4RO0A 2WWRA 1OFGA 1RYDA 1LDNA 3JQ8A 3GNQA 1BW9B 3MOGA 1BW9A 3WXBA 3FTNA 1AHHA 3JQBC 3PLNA 2HMTA 1ZK1A 4IBOA 4PZCA 4YTEA 2ZB4A 3HHPA 3PEFA 5L4NA 4RL6A 3IP1A 3PHGA 1EBUA 4IMRA 3HQ4O 5DULA 4RPHA 2OMEA 3FPLA 1YXMA 5DCUA 1KVUA 2C5EA 2ZCUA 2SCUA 1GADO 3CMCO 4XZ3A 3IUPA 4BUCA 1TA4A 2Q4EA 5T64A 1DIRA 1WDMA 2O2YA 2GN4A 3MJVA 4MIEA 4NH4A 5IF3A 1LLCA 4H16A 4WE3A 3ETEA 5ITWA 4R51A 1BDMA 1U7HA 3C1OA 2AEFA 3V5NA 2VRCD 4YJFA 2WD7A 4L75A 4TMFA 4FCCA 4M89A 3PHIA 5IG2A 5LDHA 2Z5LA 1P1HA 5TT1A 4RVGA 5DBIA 2BELA 1PGJA 3FSRA 4DPMA 2D5CA 3ZWBA 4O63O 2AQIA 1M75A 2VZ8A 3VH2A 1E77A 1BXZA 2VWHA 1BMDA 1PJCA 3DBHB 3DBHA 3F3SA 5BSEA 4OHUA 3WSWA 5JYDA 2ZQYA 2A94A 4OM8A 3GHHA 4HUJA 4ILKA 4BNWA 2GZ2A 2O3QA 4YRBA 1DO8A 2P5YA 4JNKA 4BKPA 2W98A 4D46A 2HMVA 2P9EA 1A72A 2I76A 3EAGA 2A92A 2C59A 3JQAA 2CDAA 3JQDA 3W1VA 4K1LA 4JK3A 3H9EO 1QYCA 1HDXA 2PGJA 4FC6A 5U4QA 4IJVA 4WCDA 2Y1EA 3RFVA 4BGEA 4BL5A 2DPGA 4DLLA 5ENVA 1T2AA 1LDBA 1ZXBA 1S7CA 1P74A 5GMOA 1FJHA 3ZNQA 4O1MA 1X7GA 2Y66A 3KOUA 1UR5A 4INAA 4IZIA 4WCFA 5AXBA 5JE8A 1KY4A 1Q7CA 4B4UA 1XEAA 2DUWA 6ADHA 4RCVA 4D3SA 3RU7A 4QXMA 3WLFA 4XA8A 2NV6A 1HKUA 1YDEA 4UREA 4W7HA 1A27A 4DC0A 2HRZA 4PG6A 1X1TA 3X2EA 3GRPA 1ISGA 4P4NA 1BRMA 5FF9A 1PR9A 2HK7A 2C7VA 3AY3A 5F3RA 1MFPA 3BTSA 1J5PA 4UUOA 3SJ7A 2OORA 4M54A 1YBMA 1JTVA 1WAMA 1FDVA 2B5VA 4M8SA 4UAGA 3WBBA 4ZRNA 1E7QA 2H9IA 3EGOA 2UUOA 1EDOA 2C07A 4FR5A 1WZIA 1NR7A 4JROA 3GGPA 4MP6A 2YQ4A 2HRBA 3HWRA 3RC1A 3P19A 4EZBA 1VSVA 4QO7A 3NTQA 1D4FA 3SXPA 1GQYA 3TZCA 5T8KC 1F8GA 4OYRA 3H9UA 5DOZA 1E3WB 2G0TA 1FDSA 3KYDA 4AJHA 1MXHA 3TZHA 2VTEA 1E1MA 5CHEA 1G6KA 1T1RA 4IS3A 4BS9A 3KHUA 4FJ2A 2PH5A 4TRJA 4J1SA 1NHGA 4PG4A 4RF3A 3RCBA 1NVTA 4Z9FA 2I66A 1JQBA 2VZ0A 3I52A 3ROMA 3VTFA 2CSUA 4I9NA 4J49A 1XQ1A 3IQDB 3L9XA 1VPDA 3AM3A 3WICA 3OEWA 1PGOA 3GAFA 1LLQA 2C0CA 4WEOA 2WSBA 1H6AA 3AUTA 2GDZA 1H5QA 4J3FA 2J5KA 3PTZA 3QWFA 3WNQA 3AU9A 3JYQA 2RHRA 1HSZA 1V35A 1XU7A 3DDNA 4Z0TA 1SAYA 1PJQA 4H15A 5G2OA 4FQ8A 3GVCA 2YV2A 3PWSA 2Y1OA 4O59O 1LRKA 1ENOA 3GZNB 3GZNA 4KUGA 3IKTA 1KBZA 1SO8A 3FRJA 3ZHYA 4J1NA 2A4KA 3OJ0A 3N74A 1LC0A 4YJDA 4LSMA 3RBVA 5HWSA 1GL3A 1UZNA 3ITDA 3BMNA 5C7OO 2B4RO 4FFRA 3VPHA 2V6GA 5A06A 3V1TC 4NK4A 1ZIDA 3T4XA 5KJEA 3ZWPA 1GU7A 4PLWA 4E3ZA 2X0NA 4BNYA 1JKJA 2BH9A 1U8FO 1DFGA 2YUTA 4IIUA 3HN7A 3UGKA 2PD4A 1TI7A 5BNFA 1U3WA 1QR6A 1KIFA 5EMHA 5CPFA 1K5HA 4PLTA 1NVMB 2AQHA 1U9JA 4BO5A 2WEKA 4YXFA 4L76A 3INRA 3B70A 3HJAA 4TROA 1LDGA 4BO6A 2YHUA 4D0RA 2FOIA 3TQHA 4AJKA 4QT0A 1R6DA 8ADHA 1D7OA 5JBIA 3TF5A 1LJ8A 4GX1A 3UFXA 3U9LA 3R6DA 1XDWA 3BMCA 2UV8A 3PFFA 4DIBA 5HBRA 3LC2O 4YRDA 2D5AA 3RQSA 1PJBA 3W6UA 1OOEA 1PJSA 1GTMA 3MTGA 2DBZA 1A7AA 3HB5X 2HSDA 4J4TA 3ZWAA 3EY4A 4GQAA 4MIYA 3TOXA 1BSVA 2E6UX 3VH4A 3GNTA 2W90A 2DM6A 3DMTA 1I2CA 4FDAA 2O4UX 4D3FA 2PY6A 2OZPA 5HS6A 5IXSA 3KXDA 2PKRA 2Q1TA 1HDYA 5L7WA 1LLDA 2FY8A 4EUFA 4B3HA 3KBOA 4CM9A 1IUKA 1ZMTA 2UYYA 5JY1A 5L7YA 4NJMB 3W4JA 4NJMA 3NEPX 2VYVA 4RZHA 3F9IA 3V1UA 4Z6KA 1PZGA 3G17A 2OOSA 1CF2O 1GAEO 5IN5A 1DB3A 3ADPA 1LSOA 2GR9A 3GMSA 3NAQA 2HKIA 4J4BA 5CDGA 4II3A 1YL5A 2TMDA 4GKBA 2G1UA 1PZHA 4MP3A 4HNGA 3JQFA 5KIAA 4YJGB 2VNAA 4YJGA 4XGKA 3OQ6A
chains in the Genus database with same CATH superfamily
1T26A 1H2FA 3FB4A 1FK8A 1VBKA 3DMFA 3ZHRA 1E5LA 4TYPA 4ND2A 5T6BA 2C4WA 1ZL2A 4RDCA 3SMVA 1Q7BA 3R6GA 5KS2A 1GGHA 4IXNA 5ALLA 2CUKA 1EWTA 1ZD3A 1BXGA 1F5NA 3QBEA 3CZ4A 2QL5A 4L8FA 1D8AA 4Y2SA 3CNQS 4C04A 4D80A 3EIUA 3FNEA 3A1NA 4F2GA 2OXCA 1XRMA 2C5LA 3R5HA 1HE8B 2ROQA 2IEIA 1GGMA 1Q20A 4KHPB 2P40A 1I1OA 3IAAA 1NNSA 4GNRA 5CP8A 3NIFB 5HJEA 4EG7A 3HCBA 3UOWA 1ZVJA 4IIJF 3RV3A 2JGAA 2KB0A 3KAJA 1R10A 3GRUA 3L0PA 3V1KA 5C7YA 4LQ4A 2ZTMA 1I32A 3E18A 5AQEA 1G21A 3RYHA 2LBPA 3VU1A 4HUTA 5JH7F 2DPMA 1PFQA 2OP0A 3ASYA 2EERA 7REQA 2FN9A 6NULA 1EUZA 1GKIA 1RBMA 5IJAA 3OQVA 4H1UA 4ZVPA 4OCZA 4OMCA 1XQ6A 1HBJA 1OB2A 5B4TA 4EMTA 1UJBA 4YO7A 5CYGA 3BREA 1FJGB 1KZ9A 3IIIA 5IHPA 4I9GA 1VPTA 3HO6A 1I7PA 2OHHA 3GFOA 1DKLA 3OJXA 4TXMA 1YE5A 3CX3A 4OGLA 3L6EA 1J8DA 3ZW7A 4MGHA 1U0SY 2J0SA 1DAIA 1RXIA 2W2LA 4O4HB 2IS2A 1FX0A 4ZVMA 1AZTA 3JQ9C 2QZPA 1GD1O 3PRKE 2NU8A 2EFYA 3GMDA 4BDTA 3NI2A 4YFYA 1HE3A 3PWTA 3OURA 3NQ41 3S0JA 2PUFA 5BWCA 4QJ4A 4HQ0A 5SY6A 3FTEA 2ASVA 4EKNB 3DLIA 1UBOS 1O8CA 3GPIA 1FTSA 2OM6A 4UE2A 2ACWA 3OZFA 2QJRA 3PNPA 4N03A 2FH5B 1WX1A 2HCRA 5GJVC 4PAQA 3IQFA 4N1AA 4F3CA 4HNTA 4AO8A 2H29A 1ZNQO 4X6UA 4MS1B 1QKKA 3V1NA 2H08A 5KI6A 4F9EA 1QOPB 4Y9UA 1GUZA 2ZUVA 3RBZA 3AP2A 1YDGA 4GX0A 3W5AA 1RZUA 1X1QA 1KDOA 1Z17A 2PBRA 1NBAA 1K06A 1U8CB 1XGKA 2FGJA 3MJEA 3NHKA 4KIWA 3KVVA 4JR2A 3EMVA 1WCYA 4DZZA 5DHFA 1QHFA 1YFJA 3KQQA 4KRFA 4BFXA 3PNMA 1EUDB 2XNDA 1GQFA 3I4FA 3INTA 1Y8QB 2QHXA 3S2SA 4PVCA 1ADYA 2GRJA 2BTQA 5EWLB 5KNDD 3RM3A 3DYIA 1A2QA 2BFBA 3WA6A 4DUYB 4BVLA 2FK7A 4I4CA 3JAMA 5J47A 1S3FA 3H2BA 3BTUA 4ZANA 3W7AA 3AP1A 2X0IA 5A2QA 3C8MA 4J2TA 5DJ5A 4JITA 1LTHR 2I8CA 1PJAA 1YBVA 2GT1A 2N9UA 4B2LA 4ER7A 1XVTA 4DS3A 4DWVA 5JRJA 4KNVA 3VO8A 3EVBA 3QX7A 1DQRA 2ODQA 1ML3A 4BZZA 4ZI3A 3GUVA 5EXDA 2ERCA 1VM6A 1YAJA 1BX1A 2X76A 1JSZA 1Y7HA 3NP9A 1SUBA 1MJ5A 1ZW6A 3ESQA 4JLUA 4OHPA 3E2MA 5YASA 3IILA 4NG5A 4YPOA 1CLEA 4DA9A 1FE8A 1AGNA 1FP1D 3E3MA 1JH9A 2XWSA 4GOXA 3PIIA 1GPWB 3DD1A 4TX1A 3M5WA 4FMBB 3ADOA 3TS1A 1CV2A 1ZA1A 1UBEA 3DW3X 1E63A 1SZPA 1T43A 2XUPA 3AONB 1IG3A 4IIGA 4ZARA 4ER6A 3JARB 1XMJA 4RCYA 4P3YA 3IEIA 3RRXA 4GF5A 1H2ZA 1T6YA 2WT4A 3DAOA 1ESZA 4HUQA 4PHTA 3B9BA 2QTVB 1F2TA 4R54A 5BSKA 4FLMA 1FZQA 3I05A 3EGIA 4FHGA 3UT0A 1IJEA 4KPGA 5E1OA 1UT8A 2I99A 5CURA 3K6RA 3IP3A 3FUWA 5DZSA 2BMWA 1HDEA 4IF6A 1DC4A 2O1EA 3KT0A 4R2XA 5ER6A 1P1RA 2XTZA 1P5HA 4JU9A 4DY4A 1EBBA 1GTG1 5CFOA 3RAPR 3NT5A 3M4ZA 5DXJA 5CFNA 4OHYA 4FZ5A 1XZ8A 3TLAA 4OBXA 3ZZNA 4JP3A 1K89A 3PVCA 4BAGA 1RIIA 2I8AA 5BVGA 3S6JA 2IYNA 3QSYA 4Y2XA 1Z4KA 1SR8A 3W1EA 2P69A 4IX9A 1Z0ZA 2ZSIA 3DE3X 2FMXA 4DT1B 3MELA 2F90A 2DKNA 4UBIA 4WX2B 4E4RA 4MUBA 1XPOA 2BYTA 1EK5A 2C5BA 4KLNA 4EGJA 4G07A 1SUCA 4P7JA 1WXFA 1PD1A 2IS6A 4D8UA 5HM6A 4PPFA 3RC9A 1P9OA 1X6VA 1KRXA 4IIEA 1RQXA 3DF7A 2Q50A 2RI0A 4NZOA 4Y9TA 2DQZA 3MWYW 1C0EA 1U2ZA 1G6Q1 2VQSA 5LA6A 4YT5A 1MTOA 3WLLA 4YAIA 3KR1A 3LUJA 1YRBA 4MGKR 1EYZA 1E2IA 1G1AA 1OLUB 3CSUA 2OO5A 3EMKA 3EWIA 3H6GA 1EI9A 1OV4A 2FWAA 2GAAA 1OLXB 4M0DA 3PCTA 4PCVA 4ND4A 4YAWA 2BBTA 2FPGA 4AP5A 4BQIA 4EPRA 1OH6A 1FXWF 1NQXA 1USKA 1UBRS 1V8OA 4D99A 4W8HA 3A1VA 2JAHA 1QE5A 3N86A 4YP1A 3CKKA 4WN3A 3CUWA 5AO9A 1TK3A 3UMCA 2WHQA 4PN7A 4QT4A 5BMVF 3IMGA 1W47A 2DE0X 3QKUA 3D4NA 1PHPA 3T5GA 2QG9A 4AJLA 1TAUA 1GQSA 2Q8QA 1JLSA 2O1WA 4W82A 3SYNA 4BKUA 4BE9A 1Z63A 3C3DA 3EXHA 3ITEA 1R6XA 2XDWA 3B2EA 4MVYA 4Y2TA 1KNQA 3FTCA 1W30A 2GCGA 2MSEB 4TMZA 2YZNA 4MMZB 3UHPA 3E5MA 4WZZA 1JFSA 2VPWA 1VGRA 4KBGA 5EIOA 3FRIA 4AJ9A 4P4LA 4F45A 4DIKA 5KQSA 4Y1EA 3TPCA 4AQ7A 2QXYA 4KIFA 4F9FA 1ZJ6A 3L5OA 1PT6A 2BCEA 5TE9A 3ZDRA 1FQWA 3E7PA 2RMKA 1AMNA 1Q0UA 3VKHA 1HLGA 4F56A 2YV1A 3RUIA 3T5TA 3U3KA 1XDGA 3PJGA 3AU8A 4LGVA 4L16A 2WW8A 4AN0A 1JKFA 2L19A 5FBRB 4HLDA 2X8BA 1FMFA 3WJAA 3QPCA 4D9BA 1JTFA 4F4IA 4D2IA 2Q2NA 2QS9A 1S4MA 5HQ3A 2OTCA 2X8WA 2ZDHA 1HETA 1EFVB 1STOA 1DRUA 2VYNA 4B3MB 4NU5A 3K31A 4IXTA 4XEUA 3H5IA 3T1VA 3UHFA 4OLHA 3M2PA 4BFZA 1KMHB 3HXTA 4UD6A 2QBYA 2EKQA 3B5IA 3WI7A 1KO7A 4R8LA 3UTDA 5KUTA 4L73A 2WM2A 2ZB7A 2ZIZA 1IVSA 4OL9A 2YHBA 2GXQA 4GPD1 5G4LA 4GNKA 1FL9A 1U4NA 4AXXA 1WOMA 1YONA 4D9GA 1D3AA 1GFZA 3UMSA 5JW6A 4C2AA 2RBKA 2R7LA 4MTLA 3ZG6A 2EWVA 2NXNA 2RGUA 1BJKA 1E1LA 4F96A 2UU9B 4R1NA 5AJXA 2IA5A 5MGBA 3WSTA 3OEHD 4QNNA 4I5IA 2OMKA 2CFIA 2O8CA 1ULUA 1XXLA 5ER9A 1CY2A 1NBIA 1G3UA 1UFRA 4YJ2A 2Y1DA 4RY2A 1Q5PA 4HTFA 4JXKA 5JAPA 4YAJA 1W73A 1QQ6A 2QTHA 3I4CA 3JTEA 3KTDA 3NNSA 3AOGA 4RTLA 3DS8A 5D5QA 1DBRA 1E1RA 4UZFA 1ZK0A 2RGWA 4WNCA 2FWNA 2Y68A 2AKAB 2XDQA 3ZGYA 2CE7A 3DDCA 2JH9A 2LWIA 2Q6LA 3B6ZA 3GARA 4V1CB 4QA9A 3T9FA 4B79A 2BT4A 5CB4A 2DERA 1J33A 4BB5A 3FNGA 4TRRA 2HO5A 4OX9Y 2RD2A 1M6HA 4B3SB 1DCMA 2MYTA 2YVQA 3EXIA 4IGAA 1YR3A 2FW6A 4D3YA 4E5SA 5CD1A 4OXYA 1GN8A 4D8VA 2XXAB 1JFFA 3CNBA 4DJEC 4O3MA 4GKJB 1NQOA 2QIOA 2PGAA 4D82A 2ZIUB 3L49A 5BWOA 2VRBA 1DAPA 1NQAO 3OZGA 5JATA 4RD4A 4AZWA 1KEKA 2H85A 5DE3A 1I8TA 1IDN1 3MT8A 1PCXA 1SG9A 2XB9A 1TCCA 3T7AA 5WRFA 3EOAI 3WG9A 2J7PD 1QQ5A 2ZPTX 2F8TA 2FPUA 4OJQA 5G3YA 1IY2A 2CVZA 2YRWA 4I5EA 4ZI7F 4WOBA 1QHNA 3DLAA 5HFNA 3CTPA 4G1BA 4MI6A 2ZK7A 4L4XA 4PZLA 2YS7A 3FR7A 4DSAA 3K6SB 4BWFB 2VIIA 2HDNB 1K8QA 3VGPA 1DC7A 3NCTA 4BNDB 1HQKA 2WIBA 5SYNA 1TLTA 4Q15A 4HD8A 3PXAA 4JLMA 2NUTB 4ID9A 5KOJB 4MA0A 4CU2A 5TLSA 4M1SA 1JS1X 3IPXA 3DC7A 4EHAA 3CLTD 1VE7A 1A9XB 3ZHZA 5ERYA 2I3BA 2NXCA 3E9QA 3JVDA 1WXHA 2HSJA 2ZSEA 4D8TA 4XB1A 4PZAA 1NTOA 2X5NA 2PXXA 2M98A 2PFKA 2Z8YA 1OXXK 2Z2JA 3VC7A 4DADA 2PUCA 3IJ5A 3I4LA 1CIPA 3Q8WA 4C76A 2QENA 4DLZA 1A7UA 1E2LA 3HSSA 3R3WA 3RODA 1L5SA 1V4BA 2FWBA 2YVLA 3HB1A 5JHHB 4FUQA 4J76A 2JEZA 2JJQA 1KYTA 3RAJA 2GKOA 1E2FA 1SUPA 3H4TA 4I5FA 2OXEA 4MH0R 4QJIA 3HBAA 2JIMA 1Y3HA 3JRNA 4DV7B 4E5PA 4BJHB 2DYKA 1IY1A 2QSYA 3OSZA 1ULZA 4M49A 1PL6A 1KIMA 1R4AA 4CLOA 1YFZA 2I6QA 3D3WA 3LXRA 1BCRB 2VHYA 3L40A 3N2YA 2X0DA 4BVAA 4B3DA 5ALPA 4DMUB 5KREA 4IM7A 4KGXA 1OZAA 4V39A 3BT7A 4FC7A 4DLWA 4MITA 1SUFA 1QH1B 4MS4A 1K3FA 3L6OO 2I4TA 3I6BA 4BQPA 4LXIA 2IW3A 2LCQA 3K5HA 3VBEA 1UC4B 2GK4A 1UWCA 1WMDA 2VZEA 4MKZA 4DANA 4OQMA 5E1DA 1JLMA 2J3IA 1F1BA 5DVZA 3Q7EA 1SRRA 4IXMA 4URVR 3EQ2A 1AQUA 3C5CA 4HOYA 4D9CA 3V8MA 4U7GA 4BKMA 1E2GA 1H4VB 4MVJG 2I7VA 2BEJA 1E18A 1SC4A 3O6VA 3W5JA 1DC6A 4UOZA 1SXHA 4L8GA 1Z13A 2GN9A 2IKSA 3SYRA 3WIDA 5EKSA 3PUIA 5EUMA 3VR6H 1O9BA 3QTTA 2XTAA 2MYPA 1QDEA 4LDQA 4Y98A 1RXVA 1S9HA 4HYTA 4EJSA 2AN1A 5L3SA 4FMPA 3NMUF 1AB6A 1PN3A 1SJ9A 1GTZA 4BKRA 3WV5A 2OSVA 1YFLA 5EHQA 4Q93A 2D0IA 4CNQA 2FW7A 4CIBA 4UEJA 3LOPA 1JFLA 3SQNA 1VCOA 1VRWA 4R1OA 1L7PA 4UMDA 1K5GA 5C51B 4HEJA 1B16A 3DHWC 2VPPA 5J2UA 4EO7A 2NVUA 3A6PC 1O94C 4M53A 2I4RA 3NOXA 1E7WA 3S8YA 1ST2A 2Z08A 1OJLA 1OR8A 5EG5A 2IWHA 1A2BA 1AUQA 4DM7A 4YT4A 5BWBA 1CRPA 4UHEA 4UAJA 1H2YA 3DOFA 4MX8A 1CEYA 3BRQA 1MNQA 5K0GA 2KSQA 1R9NA 1Y1LA 1QQ7A 1LWNA 2ARKA 2Y8EA 4MW5A 1I24A 4EF5A 4F60A 1O0SA 4GE0A 4RTSA 3Q8LA 3IQIX 1TEZA 2DTDA 4HYEA 2C9ZA 1QH8B 4YRZA 1T8WA 1PSZA 2OAQ1 2WBLC 5BR4A 1PQPA 2FZGA 5I9LA 3AZOA 1SBHA 2JLSA 5IANA 3FOFC 1G4AE 3LCMA 4XVCA 4MW2A 3E8SA 4YP9A 4YS6A 4P22A 2PX2A 1NULA 1MW8X 1BWPA 2XYVA 5FTWA 4EGSA 4HGZA 2NO5A 5AI5A 3N2NA 4V03A 4QSMA 1I1HA 3REQB 3OQ1A 3P2JA 2O3RA 4MP8A 2ATVA 3O2QB 1FQJA 2XMBA 3L8DA 4V2IA 4NZMA 2BE9A 1RWOA 5EQJB 1Z29A 3QNMA 3R7FA 1J07A 1JDUA 2F6RA 2WE7A 3GXOA 3JVEA 4DQUA 2AI1A 3LY9A 4A8JA 3ZVMA 1HK7A 1XNGA 4FZ3A 3MBIA 1RRCA 2GKGA 2JFFA 2GCPA 5F9FA 2YV4A 5EP3A 1HDRA 3A70A 3LVRE 1TGVA 4MVXA 4Q01A 1L5NA 4IGIA 3V55A 1P8AA 2LCFA 3WYGA 3ZZ0A 2FX2A 4JB8A 2Z2KA 4IDDA 3F3YA 3TEFA 3TPFA 4KRXA 1U1FA 5JCOA 3NPAA 2C97A 2NZWA 3NKLA 4N7MA 3RPEA 1PEAA 3HWWA 1BN6A 1ZUIA 2ONYA 1AC5A 3DMGA 3ONFA 1X9IA 4UDOA 5EY5B 5F33A 3UF0A 1U2RA 3Q41A 2GEFA 4E5NA 4YRGA 1CWUA 4XWKA 2OWDA 4G1CA 1CB0A 1JHQA 3NHLA 2DXIA 4EIWA 4OBBA 1D6JA 3ZVKA 5HUJA 2QF7A 4LZLA 4P3XA 4RGYA 2BFCA 4UMFA 1WE2A 3RU3A 4QBHA 1OJ7A 5HIMA 3U49A 4LRTB 2X86A 1YBAA 3EZLA 1DUVG 3DOJA 1XEWY 3H1EA 2FZCA 3I2FA 4KPFC 4YRNA 3H2HA 4UULA 1V7PC 2I3DA 1UEIA 1VE3A 2ZZNA 1Y37A 1C3VA 2VZ9A 1V8ZA 3GVIA 1EWQA 1I3KA 2IU6A 1H2HA 3F6BX 5TMDA 1U0TA 1JWLA 3H97A 3EDQA 3V46A 1N2JA 4YIKA 2AE2A 2HMWA 4P4SA 1KFEB 2PKQO 1XNQB 1ZC3A 3K5WA 5REQA 4BBAA 4KFSA 2IYOA 4GBED 4L7VA 1QO0A 2ZETA 3F2IA 5LZ8A 4FZVA 3ZDYB 2WD9A 2I9KA 2AA3A 4FXOA 4M6WB 5HCNA 4GOLD 1U3FA 4MB6A 3TIFA 1CR6A 2AGVA 5K09A 2Y4OA 1LI4A 3ZHOA 3JD1A 2PKEA 5TB5A 2BY4A 2PD3A 4B4KA 4WLOA 5EERA 1ZCBA 4X20A 2FCRA 2IZZA 2I6TA 2IYWA 3LHKA 3CE9A 5B64A 3KKKA 3F1KA 5ALTA 2XA9A 5ERGB 4Z2YA 3UOAB 1GKLA 2C5FA 3JWHA 3BXEA 3GMTA 5H1YA 5KYYB 2P5UA 4E32A 5B30A 1Z73A 2CMGA 1UJ2A 2HEIA 2FETA 3NATA 4KSYA 4MRMA 4DVJA 5DDIP 4C6TB 5FH9A 5FWYA 2YHAA 3LZCA 1XMSA 2IY9A 4REMA 3RSQA 3WDKA 4GZLA 4CCYB 4U8GA 3MTBA 1WVIA 5DM0A 4ZT2A 4A0RA 3RVBA 2JEOA 4B4VA 2D0OB 3WMRA 4ZVRA 4ZGGA 3WYCA 1J22A 3KSAC 1VKHA 4TLDA 1Z0KA 3GLHB 2XR1A 4P9NA 5JQGB 3B1WA 4EKYA 2CT8A 2P2GA 1FVFA 3G1TA 4IH4A 1MMFB 1MT3A 1ACJA 2UDPA 1IEQA 1ZXLA 5EIBC 3E5HA 1LVHA 4DZTA 2QORA 3R44A 4FZRA 4AG3A 1VZ3A 1YZTA 3TLGA 3KOXA 4DBZA 1Z4LA 1CY4A 5DNCA 1RQRA 5FD8A 4P4GA 1QMPA 2PZGA 2QTRA 3ILXA 2HOQA 3QWIA 4D9FA 1QHEA 1FDOA 2ZULA 2C9BA 3WE7A 3WKAA 5K0JA 2FE4A 3U1BA 1T1JA 1QGOA 3RHSA 1ZM4A 3KQPA 3T95A 1ZVVA 1JQEA 2A5FA 4Z7NB 1EK6A 3ETNA 3IEXA 4FMCB 4U7HA 2GTHA 3C4JA 2YWCA 2R1ZA 2DMRA 1MV8A 2OECA 4UE3S 2NO1A 3LXXA 2YWXA 3EQ7A 5TPZA 5CMLA 2IS4A 4AZ0B 1NLZA 3Q11A 5IX8A 3QW2A 5M7EA 2XEXA 3BC1A 3I2YX 1TZKA 2ZUFA 4HZIA 1Y9EA 5IASA 3JTMA 5I9NA 2GNOA 4ZAYA 3K1TA 4NK5A 5GIOE 4DLXA 5K0CA 2GXAA 1PWYE 2ZRKA 3DLTA 4PLHA 4XRGA 1CVLA 4KLRA 2NT3A 4N40A 3GD7A 3GRYA 4L28A 1XD2A 3ZNNA 1VL2A 4PGFA 2HA0A 3H3XA 1KVRA 3HKCB 3WRYC 1GVNB 2P1RA 4UZEA 5E9AA 2PR7A 3L0DA 5EPUA 1T9CA 5EWMA 3TDNA 3ZDDA 1IBCA 3E8XA 1JAIA 4ZAVA 2WPNA 5IBQA 2DCMA 5IYZF 1RMYA 4QPNA 4LBZA 3VV2A 2B2XA 4RWEA 3HEAA 1NVUQ 1FFBA 1P5FA 2FZVA 3HKEB 3VPXA 1KEWA 4MKXA 1PVOA 5FL7D 4CF6A 4HDOB 2NUAA 4XJSA 1GFWA 5EJFA 2FR1A 4M1EA 2ZG6A 5TPWB 2QIPA 2NSJA 3ZHTA 2ZTHA 5BV7A 1UDCA 2W4MA 3JZIA 3LT2A 3N0XA 2R44A 2QZSA 2XRYA 4ONEA 2XUKA 2WVAA 4BZQA 2CHEA 2JGNA 3EMBA 4M0LA 4WD3A 4CKBA 1QG6A 4M1KA 1UXIA 4TOIA 3SDBA 4RKQA 1LU9A 3BDIA 4DZRA 1WNTA 1F6DA 1NSFA 4CFYA 4ZAFA 3ZV4A 5MDHA 1DIBA 2Q5JA 4BWYA 2ZE6A 1UKEA 3QXCA 5DP2A 2KLHA 3MJDA 5C18A 4CF7A 1PVVA 3DMTC 2BP7A 1VA5A 3TMAA 4QUJA 4OFBA 2W5UA 2Q7DA 1I6LA 1AO3A 3H04A 3BHMA 4LXYA 4KC0A 3LF1A 1QVZA 4N41A 2P0EA 2W6MA 4UFNA 3N2GA 5FRDA 5KPJA 2AJCA 4OI2A 4D4IA 4YY3B 1OTYA 4C0BA 1XMIA 3UEOA 2DSTA 4LY9A 2PT9A 3BWXA 3H4VA 1XZPA 4AK9A 2FMHA 2COEA 1EIZA 3ON5A 2CNKA 4HGPA 1KVQA 2C2ZA 2NX2A 1A9TA 3OZUA 1KFCB 4UARA 4X7RA 4EKEA 1TQDA 5INTA 5CVCA 2Z57A 5ILGA 1JP7A 2EFGA 3R7BA 4CLRA 1J9EA 2BHLA 3DMHA 2NZ2A 3K9GA 1G9TA 2RDMA 4BO1A 2FRVA 4Y18A 2BFDA 1R1DA 4DABA 1L8AA 3HDYA 3UJAA 1OLSB 1H6CA 2QYSA 3RQIA 5JD3A 2NU6B 4U8HA 3WLKX 1MW9X 1FVXA 4C0SA 3TL2A 3MB5A 1ISJA 1BA2A 1KBQA 3JQFC 4IZOA 4NICA 4QTZA 3DZFA 3V2GA 3DMDA 5AVSA 1TKCA 3NDRA 1WB9A 2VSXA 4EI2A 3VR4D 5H83A 1J2UA 4KCGA 1EMDA 4YGXB 3CNNA 3S5JA 3D9QX 3AF1A 4B71A 4FILA 3OOEA 2OAGA 4EA7A 5CVDA 5CXSA 1GNQA 3LQKA 3E9MA 4BLSA 4ODIA 1T5HX 1F4LA 3FPFA 5AIAA 5FQNA 3ENKA 1HNZB 4PYOA 4H2DA 4MW0A 3E9NA 3RSCA 2O8FB 1W52X 1F4VA 2ETXA 2HH9A 4N5MA 1UOPA 5CA0F 3PNKA 3ZD6A 3ZS8A 5DBOA 2DBQA 4ITUA 4ROSA 2IYYA 5B3JC 1YZFA 3B9QA 4URYR 3RUHA 1CY6A 1G7CA 2R8EA 3FCOA 4TUYF 1AXGA 4GWLA 2QMZA 3RRNA 4YXWD 4K26A 2UKDA 3JVIA 4GXNA 1U0BB 3GELA 1V1RB 1KWKA 1ZOOA 3JAWA 3KPUA 1XIVA 3M6FA 3PD1A 2PXCA 4MVJE 4A1OA 2WICA 1DADA 4WNIA 1ZINA 4IUDS 1G5TA 4LBWA 4KU4A 3STUA 3VDRA 4BMZA 4QULA 4RSRA 1FQOA 3K32A 1UBCA 3MERA 4A6DA 2Y67A 3COSA 5DEIA 1AQJA 1LI5A 2C7PA 2IXGA 2Q5EA 1KPIA 1XHFA 2B34A 3B7GA 2QZ9A 5ECWA 1I7DA 5A0TA 2ZUSA 3SKXA 1S8AA 2RJ3A 2L0XA 1OGJA 1H85A 1VKRA 3A32A 3AY6A 3JV7A 1SZJG 4GEGA 3RHTA 3RSGA 2ZJ2A 3NLLA 3ROPA 1HH4A 4WZBB 4U2EA 2ACVA 4X61A 3UENA 3AR3A 3DGEC 2TS1A 3K96A 4LXXA 4ZO8A 4DUGD 4G5GA 2JKZA 2QRKA 4K9QA 4NIMA 3BHJA 4BFLA 3P4YA 5IDXA 4XYMA 4HGRA 4CMHA 2QRJA 4YV1A 3OM1A 4PU0A 4CR7A 1XJWA 2JAWA 4IIVA 1UH5A 3U4IA 3W2HA 4WFIA 3OFKA 5KTTA 5I9IA 1UBKS 2OYCA 3D6VA 4BRSA 5J9FA 2X4GA 4GC5A 3QHAA 1BN7A 1E1QD 1KQGA 1P1JA 1VKNA 3GRFA 3Q98A 4K7JA 3WQRA 4FFMA 2VFAA 1YKFA 3EHEA 4R83A 4AU1A 4EABA 5J4VA 3LDFA 4OTZA 3UXYA 5IMSA 3H9BA 4M60A 4FDUA 2BFFA 4QLAA 1V8PA 4JUIA 1VCMA 1R0BA 3U48A 4WOCA 1IRXA 1FFSA 2BF4A 1OASA 3ZDBA 1CFJA 1BCSB 1Q83A 2EOAA 2FW0A 2X4IA 3BCSA 3JALB 3OECA 4P53A 4X8MA 3S2FA 4C5BA 4CM9D 2AJLI 1M2EA 2IEGA 5CXQA 3A6EA 3P4XA 2B3DA 3EGDB 5JAMA 2ZE5A 2AW5A 1IQRA 2JB9A 2VRWA 4JJGA 3WYNA 2P5TB 1I10A 2JIRA 2QNBA 1CIJA 4P81A 3FHCB 2BRUA 5KBYA 1UPAA 1R0ZA 3WL6A 3C43A 4FFSA 4M86A 4Q02A 4HDMB 3UAYA 1PJ2A 4HXYA 3TSAA 1JQ3A 2I3ZA 2PA3A 2B78A 4FHFA 4K6OA 4LV5B 3NEYA 3HV2A 3WIUA 2B1IA 3K09C 3DF9A 1W87A 2I80A 5AI6A 3T5AA 2IEBA 3PC8C 3PFIA 1GILA 3WB0A 1VQ1A 4LTMA 1SY7A 2AEMA 2WDPA 3B1YA 1EE9A 3G88A 4HP8A 3PS9A 1EPUA 1IB0A 1TM7E 1UOEA 1D9ZA 3S5UA 3VX3A 2ZYSA 4EQ6A 1XPRA 1SKAA 3EPJA 2HFJA 2O5VA 2QV7A 3VR3A 1QP0A 2EKPA 3DJFA 3EJ6A 3LK7A 4HXFB 3H8JA 1FMLA 3KEQA 3VR5H 4EJ2A 3DOCA 3MWDA 1CF4A 2FNAA 4L8YA 5K8VA 4LJ9A 4X71A 1U11A 4H4DA 1XN1A 3ZIUA 2C31A 3UJ6A 2DFDA 5COBA 3RJTA 4R0VA 2ZBFA 3CVVA 3Q10A 4A92A 2HHJA 2ID8A 4CYMA 1HX7A 5HXAA 1Z6XA 1FBTA 3T94A 4REQB 3SXUA 1SELA 3JQGA 3DGFC 3MA0A 3TSOA 4UEQA 2EIXA 2EF1A 3AV0B 3FN4A 1JAZA 4RZIA 4E7PA 4MYTA 4FBLA 2GYYA 1TC1A 2B3TA 1HZZC 3NJ8A 4XTRA 5CG1A 2IHTA 3ER8A 3JXEA 4UM9B 1IULA 1Z0IA 4ARBA 1R2QA 3U1VA 1KH2A 1FPQA 3IRUA 2H2IA 4KUEA 2VT2A 5CDUA 1KJIA 2BGTA 2JZOA 4ZVOA 3TUZC 1WCIA 5G0UA 2AFHB 1W4RA 2WZQA 4Q24A 4ER5A 1MX3A 4Z3KA 3SC4A 3I01M 1M33A 1MJGA 3FROA 2HQSA 4G5SA 1SQ6A 2H18A 3ABOB 3L41A 3TE6A 1XAHA 1NW7A 1UUFA 3F6SA 4AX8A 4C43A 3RUPA 3KJIA 4MWEA 1XI2A 3UK7A 2GK7A 3UK0A 3S81A 3DMPA 3OICA 4XM0A 1HYEA 5KOHA 4FFDA 2IYQA 4P5PA 1ZN7A 3AUAA 1E2MA 3VI3B 2M6SA 2D1QA 4MKFA 2BSXA 1KETA 2YHIB 1H66A 1RYBA 3K0AA 4XIFA 5IAAA 2H0QA 1VMIA 2O3UA 4MVJD 4QELA 3B52X 3H1GA 3BJMA 4W8OA 3W9YA 4RU1A 4M9SA 4AAYA 1O96B 1GG5A 1PKEA 3EGXB 4YASA 2YVAA 2F1IA 4XKJA 4IXWA 3CXUA 1PUJA 2QDKA 3Q3EA 2V7QD 4CZ2A 3UA3A 2FW8A 1BOFA 2K5UA 4XDZA 2VJMB 3TLKA 2WHPA 3COPA 2WWGA 5AUQA 1YI0A 2PZEA 2ZWAA 5I3ZA 3IDZA 3PU6A 1YL7A 2DWOA 3ULKA 3OD1A 3RWOA 4GO1A 2X19A 4OX9B 3L8EA 1P2DA 3EG9B 4EW3A 1K0FA 3BJIC 1SM4A 4O2BB 5FI3A 1VE6A 3BBPA 1B6GA 2IEDA 3JVUA 3KPJA 3V00A 5F1YA 3B1FA 4P7BA 1EG2A 1XAJA 3CH7A 5BMOA 3UNXA 2EQBA 5BQ5A 3HB9A 5LDGA 3UWSA 1JU4A 3QLJA 2NUPA 2H3EA 2VWQA 1GR1A 1E3LA 3D81A 1HOXA 4JEHA 1AU9A 2AOTB 4MQUA 5AVOA 4B0PA 1U8UA 4Q4JA 3CUKA 1CSEE 1IIBA 1I0IA 2A1UA 3O2NA 4I9UA 3WLIA 3ZJTA 1UL1X 2ISSD 5CNKA 4P35A 5JYEA 2EW1A 4OJMX 1XLWA 4TL6A 3VU8A 5FWXB 4WK4B 3RF6A 1YIDA 3X1DA 3K0HA 2W6OA 4B5LA 4EKIA 1JNYA 1Y5RA 2UUCB 2PJRA 3AUSA 2EYUA 1EU1A 2FQXA 5HX7A 4NI5A 4F5ZA 1O6FA 3C5HA 1GM5A 3N9IA 1U4OA 1X2EA 4EG6A 1J2JA 4AS3A 3MMPA 3MRSA 1ZD9A 4Y2UA 1J6UA 2PMBA 3R75A 3LCJA 4IDNA 2A0FA 2GI4A 4E2ZA 1Z7YA 2B61A 2V6BA 1NOKA 2O7QA 4EJ0A 3X1YA 1EINA 4M1MA 4HNHA 1DBQA 3VYSB 2V3VA 4ZREA 4FK8A 1WZ2A 2XYGA 2ACEA 3ECAA 4WNAA 1LSJA 2IZ6A 3DO5A 3KSRA 5FAXA 5DK4A 4D0SA 3M1IA 1A4IA 4MDYA 4QOSA 4ON9A 1YZGA 4Q4AA 4TLMB 1B8OA 4IHJB 1OBCA 1GG2A 1N5MA 4I1PA 3VBCA 3DZCA 2D3TA 1NJ2A 1W581 3HYNA 5B4VA 3K05A 1DX9A 2V5UA 4IKEA 3MPOA 2CD7A 4MAFA 5ED0A 5AYVA 1WPGA 1F7UA 1J2EA 4RK4A 2Z3ZA 2WF8A 4BCDA 1SEPA 2FOXA 3QOXA 3RWMB 3NV7A 1O94A 4C4TA 3D4PA 4QYIA 1QIKA 2J30A 2GZSA 4U63A 1DZ3A 5TEWA 2WKQA 4FHEA 1JKIA 1TQHA 4G4SP 5KJCA 4QYTA 2HYIC 4EFDA 4O2RA 1N2IA 2WK1A 3H9GA 1Q1BA 5AXCA 5A7FA 4M9RA 4O2AF 1FBNA 1FFXB 3QHPA 4FLFA 4HC4A 2FPPB 4NFLA 5DIZA 5JSKA 3FHTA 3HJCA 2IXAA 1WWKA 3ENZA 1VGVA 2I22A 3MCZA 4YCCA 1UC8A 4QGSA 1GPAA 2WPDD 3IALA 1I3NA 1J7JA 2XNKA 3ABIA 5J1TB 1ZHFA 1RI2A 1U9ZA 3D5EA 3LLMA 2JVJA 5HTKA 4EVRA 4BNNA 1JGTA 1IZYA 1EP1B 2XA2A 3GJXC 3I9MA 4H18A 5EI5A 4EFKA 1Z8NA 4TXLA 3R5XA 3D6FA 4UPVA 1NVVQ 4BBJA 3RS8A 2CLEB 3SS8A 2YIVX 2DPHA 5TGZA 9LDBA 4DCSA 3N2KB 1HFWA 2GRUA 1N8SA 1F6BA 3FMFA 2QPAA 4A0FA 1IN8A 3SKVA 2GEDA 1UEXC 2WUEA 3KDPA 1N9GA 4PRKA 1O54A 4QUDA 5DTJA 5ES4B 4GC9A 1SXPA 4HDSB 4NECA 1ZCJA 2JCVA 4RJIA 4F04A 2P6OA 1QX3A 2GLTA 4LUCA 3OJEA 3O8RA 1Z45A 1U5BA 3THSA 2GZ3A 5ALDA 1Y4ZA 2WDZA 3UGTA 3TTXA 3OJWA 2H5IA 2V4ZA 5BQPA 2V55B 1SCQA 1OXSC 3UQYS 1AGYA 1Q6ZA 4WADA 4EI8A 3QELA 1KEPA 5JS7A 2X2PA 1R00A 3VAYA 4AROA 4D6XA 5EEGA 2JCYA 3FNIA 4FB4A 5IZ4A 4NE9A 1C5KA 2Q28A 1I5RA 3JY6A 4R1UA 1XMXA 2I2CA 2J4FA 2QSZA 3QVTA 1JA0A 4MZXA 4URWR 3KXLA 4ENWA 1TM5E 3RYIB 1IN4A 3Q6NA 1DJQA 1I7NA 2V6JA 3QKWA 1B14A 2Z56A 3LZDA 1LTKA 2QX6A 2YUIA 3EVAA 3GYGA 2OBXA 4FYIA 2AMVA 2J6HA 2NTNA 3IBTA 4C0XA 1EP2B 2CHFA 3DV0A 3LFUA 7ADHA 4JJ8A 4YGYA 3GHYA 5LWHA 2CFSA 1PW5A 2Q2WA 3BEDA 3A1FA 4LJSA 2NYVA 5DT2A 2E0IA 3VYVA 9LDTA 1EFCA 5IM5A 1B7GO 1NZFA 1XDUA 2JA1A 3I2GA 2O0KA 1W6RA 4JJEA 3K0KA 4OM7A 4LFAB 1WB6A 3MSXA 4PYKA 4BYMA 2CDRA 2VP6A 3UMMA 2YC2C 3W9UA 1M7HA 5IMBA 3TKLA 4IDQA 4PHFA 3MLBA 1CR1A 4U0JA 3NIGB 1BMTA 2PKCA 2FFJA 2QE7A 1XZJA 1PFVA 2R4QA 1N6KA 3P0IA 4JJZA 4RLHA 4ZV7A 1GTJ1 2ES4A 4PZYA 2NLOA 3LBAA 2OK8A 4HWKA 4TZKA 4Y6RA 5JXGA 4GP7A 5KCMA 3FTFA 1MVOA 3MM4A 4AZVA 4B40A 2ZM5A 1RPZA 3I9NA 2FDCA 4FN5A 2ZBQA 5TT0A 4NATA 3GF4A 4OHXA 4WZAB 3VO2A 5BT9A 4E5VA 5LCXA 2ADOA 2P2LA 4R3UC 2QQ0A 4CQMB 2XTNA 2JLBA 3EOZA 3HG7A 3HSKA 4DR7B 3CINA 4B7XA 2DETA 4ZO6A 1DI0A 1FDTA 4P82A 1VJ0A 4W99A 2D54A 2ZJ8A 3ILSA 5I8PA 4MR9B 4Y8VA 4BAZA 1MPXA 3L06A 1RM3A 4BE4A 4NFSA 2YH2A 3PQCA 4YMSA 3P0HA 1E9RA 4Q39A 3ZTTA 1XVLA 3ZIAA 3UK6A 3IURA 3WLAA 1X7HA 4YVFA 1AUPA 3R0IA 1DO0A 1RWBA 3BL5A 3RD5A 2DWUA 1YULA 2HRRA 2JI4A 2RGGA 4D7AA 5B1HA 2QN6A 1HTTA 1WNFA 5DBHX 3BZBA 4YAGA 1JZQA 2D8AA 8ATCA 3WB9A 4L5JA 1V16B 1FLAA 4LRWA 4L22A 3OA2A 4I3GA 1IY9A 3M4NA 1YZ3A 2BZSA 3COJA 3LMKA 1JDTA 2JFOA 4KQMA 4Y6GB 3RFCA 3CSSA 1C9KA 4AXBA 3PDHA 1B8UA 4C07A 4DL9A 3F4LA 4DG9A 1X8XA 3N28A 1YQUA 4NZPA 3KXPA 4F8YA 3CEMA 4HMPA 3R41A 3I6IA 5EXXA 5KAPA 3OPYB 5I7VA 1NVEA 1BMFA 1DPFA 2I5PO 2B8EA 2OAEA 3GRKA 3HI4A 1D2GA 3IOMA 3KYCA 4NAHA 4RMNA 4ZA2A 4AY3A 1T8SA 2D2IA 2BGRA 2X14A 3GUHA 4EF6A 2QMHA 4A6EA 1NR1A 4DCCA 3R8FA 1NTRA 2JAOA 3U19A 2WOJA 2X1MA 4URZR 2R1TB 1IXZA 4ABTA 5BPHA 4CCSA 1RC1A 3T1OA 4DSTA 4CMCA 1DSSG 4NJOA 3UAWA 4R40A 3P9ZA 1PJ8A 2Q1YA 1DDGA 2HMYB 3H1AA 3R76A 5L3QA 2PQMA 1VSQA 4DBLC 2H1OA 3RS7A 3G9QA 1CFZA 3K15A 4YC7A 3OIWA 3DHYA 4ZTBA 3G8CA 2BEUB 1DHTA 2X0JA 4HDAA 1WF6A 1YKGA 1HYQA 4BLPA 4RHCA 4BNZA 3L01A 1FFAA 1T1SA 4C22A 1HT1E 2XE4A 3CO5A 1GFIA 1FRVA 2G8NA 3H9JA 1NDQA 4XB2A 4YRLA 3TSYA 3WRYA 4B73A 4XM2A 2PRSA 4ETIA 5DH9A 5C8VA 3EIOA 4V1CI 2P3LA 4E2WA 1YB2A 4LJYA 3P45A 2YVUA 4MUNA 4V0RA 4M1WA 1N6PA 2VDPB 4XB6B 1G55A 4PFKA 3TOZA 3KM0A 4L6IA 5KHOC 2DRIA 3KKLA 1FDUA 2E85A 4OYYA 1EP9A 2H1WA 3EULA 4CODB 2K87A 3QA3E 4FFBB 3WLTA 4AJJA 1QPBA 5HCUA 3Q8XB 3B89A 5K0SA 2IDZA 1QIDA 4TN1A 5ALSA 1NVVR 3CVUA 3ZD8A 2H92A 1CJVC 1AGRA 1WZNA 1MFZA 5JI3E 5HA5A 1S0UA 3BTVA 3EMDA 3KOWA 5E3HA 3HY4A 1KR5A 4K9MA 5FXMA 3HSYA 1AV6A 3KTAB 3BFJA 3UT5B 3ZUGA 4TTPA 5TS3A 2LD4A 1MDFA 1AQYA 2Z5VA 4CWAA 3OY2A 4ZIRA 2VTBB 2DBYA 2ZYRA 4B8ZA 1XLVA 4BLTA 3GLKA 4BQNA 3AW9A 1UK9A 4AMUA 2AZXA 3RIMA 4D79A 3AT1A 2QN1A 3I2IA 3FFAA 5FWNA 1MP0A 1SEVA 4TVBA 5EKUA 2YCLA 2B35A 2PCLA 3P26A 3HEMA 4H4CA 1GEEA 1XZKA 1ACMA 1D0SA 1EDBA 1JMVA 1H0RA 1U9IA 3LZ6A 4NX2A 2C2YA 2CB0A