3WLFA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with (r)-1-phenyl-1,2-ethanediol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
total genus 97
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wlfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wlfA01
1T26A 1YDWA 2EGGA 1GV0A 4KQXA 4RVHA 2EW2A 1MP0A 1DIGA 3OJLA 3UXYA 4CJXA 1JKFA 2DVMA 3FBGA 3Q3CA 3VH3A 2ZCUA 1F0YA 1UZMA 4KUGA 2DC1A 5F1KA 3QVTA 3DBLB 2VWHA 1Y8RA 2XOXA 5BNTA 4XR9A 8LDHA 1NTOA 4UAGA 2BKAA 2HAEA 3H3JA 2RIRA 4NPCA 3QWBA 5G0TA 2EHDA 5A4DA 1BW9A 1CERA 1C14A 3OHSX 4S3MA 1QR6A 4IGFA 4PVCA 5T5QA 1E1LA 1VSUA 3W6UA 4E5MA 3GLQA 1SBYA 4J91A 1F12A 4MINA 3S1LA 3TFQA 2V6GA 2OUIA 1QORA 4JK3A 1CEQA 3HZZA 4WLVA 4BUCA 5A02A 4WNCA 1XG5A 4Y67A 1MGOA 2Y66A 4BNWA 2YY7A 2CD9A 2ZB8A 3I9MA 4H3VA 2OBNA 3GPIA 3KRTA 1XQ6A 1E3JA 3GMSA 5G4KB 1XGKA 3HB4X 3KBOA 2IYPA 5JDCA 5HTOA 1LDEA 3C7CB 2QRJA 4GX1A 4MKXA 3RWBA 4RVFA 1DDOA 4YCAA 2YJZA 2FOIA 4NJOA 4P4NA 3IKVA 3KSDO 4UREA 1UXGA 4O6VA 4R3WA 1ZZEA 5JW6A 4OJNA 3K5PA 3TL3A 5FWNA 5MDHA 3SVTA 4WOKA 1JQBA 3PJFA 3PZRA 1ZUD1 2D2IA 4CMJA 4IJWA 1UP6A 5C5IA 5CEJA 1SO8A 2ZTVA 4J16A 3G17A 4YJGA 4C4OA 3BTVA 1GAEO 2CZCA 3AW9A 3X2FA 4DQUA 2CFCA 1HETA 1GQYA 3GQVA 2D3TA 2EWMA 3MWEB 3V8BA 4YVFA 3ON5A 1YOVA 1U5CA 4BO0A 3QQPA 3WNVA 4CM9A 4CLOB 5B4VA 4HBGA 3ADOA 1U3WA 1T2DA 2Y1DA 2H1SA 3GN2A 3H2SA 4GBJA 1H2HA 2DT5A 3KYDB 4IJVA 2IE0A 1I3KA 1I3NA 5JMWA 3UCFA 3DTTA 3N7UA 3BMOB 2Q4BA 3QRWA 3IAHA 5JE8A 5CEFA 2UAGA 4FR5A 4DBVO 2VUSA 3LSYA 3I9JA 4XDYA 3WSVA 2C2YA 3PP8A 1C1DA 3CE6A 3KSUA 4OQYA 1NNUA 3HG7A 4PLZA 4BNUA 3LZ6A 3ZWBA 4MVJP 4RPHA 4ZD6A 4BB5A 4E4YA 4YPOA 3JQAB 2X23A 4CLRA 1SOVA 1DC6A 4OKIA 3T4XA 3ZHXA 3GGPA 4RPGA 3GVXA 4DTIA 5I8ZA 3FD8A 2FWMX 3FTNA 4J4HA 1TEHA 1ZW1A 4JROA 4A7PA 3HN7A 2Y99A 2X5KO 3PVZA 4IDDA 5CG2A 1PL6A 2W2KA 4W4TA 4YJGB 4HXYA 5DNAA 4BKPA 1PWXA 3JQGA 5I7EA 4D7AA 4Q3CA 1E7QA 5DCUA 1KYQA 3JD3A 3ZWOA 3HUDA 3DB2A 2HCTA 4IJUA 1NAHA 1OC2A 4UEOA 4AFNA 1VE9A 5KWEA 1RWBA 3DR3A 4AJLA 2WYVA 4DBZA 2O3UA 3MOIA 1PEDA 4ALMA 4DIOA 4CM8B 4WASA 4U5QA 1GV1A 1HT0A 1YGYA 1OI7A 3EY4A 3JQBC 5TF4A 4G81A 2PZLA 3VVBA 1GEEA 4D44A 3DZKA 5EL0A 3MWDB 1HRDA 1J0XO 1BVUA 3BMNA 3ZV3A 4YT5A 5H82A 1XU9A 3G3EA 3EAGA 1U7HA 4Z6KA 2PZMA 3IUPA 3B6ZA 3PWKA 3TL2A 3PWZA 1DXYA 3ANMA 1O89A 4Y8VA 3H9EO 5JNLA 2Q99A 4NBTA 1CWUA 3FPCA 3KYDA 3P2YA 3BIOA 3K9QO 5BT9A 3WIDA 5B12A 2QYSA 2YZ7A 3CMMA 3TF5A 1YWGO 4EUHA 2FR8A 3DMYA 4P8RA 1MFPA 1E1KA 2C29D 1H9BA 2CVZA 1ZNQO 3EMKA 1I24A 1B15A 1B16A 4A10A 4BGVA 3KYCB 3DBVO 1PGPA 4BHTA 1OC4A 4FB5A 3AK4A 2IXBA 3KB6A 1BXZA 2JFFA 2BFPA 4OL9A 3Q0EA 4WKGA 2GERA 3DZJA 2Y1FA 4B8WA 3RD5A 3PJGA 1JU9A 4FFOA 2PGDA 2C5EA 4XR4A 2G76A 4WLOA 2H6EA 3D3WA 4I8XA 3QW2A 4YTEA 3PQEA 4XRGA 2GF2A 2QRLA 1XCBA 1X1TA 3O4RA 4ZQEA 3RUAA 1D3AA 3E1KA 3NYWA 4I5FA 4NNJA 2WDZA 4BNZA 1CF2O 2P68A 4Q3BA 4C7JA 2P9CA 3ENKA 3WS7A 1KIFA 4WUVA 1XEAA 5IDXA 4L76A 4M86A 3ULKA 1J6UA 2J3KA 5EQFA 4UUMA 5I9LA 3K2BA 3JQ6A 1VJ0A 3SEFA 3ZZNA 2GLXA 4IMRA 3D7LA 3L4BC 4BMSA 5ENDA 1I33A 3D4PA 4CV0A 2FHSA 1YB5A 2Q49A 1C1XA 2RH8A 4BVAA 3UVEA 4HP8A 1A9YA 4R41A 4RQUA 2HO5A 4BO9A 1LI4A 2YHIB 2AQHA 3K8ZA 4CM8A 1BHSA 2Y67A 1I0ZA 2PKQP 1QSGA 4E5KA 2ILTA 1A71A 4I9NA 4OH1A 1VI2A 2ZJ0A 3DOJA 4PG5A 3HE3A 2CDBA 1EVYA 3PK0A 2HMVA 4HFMA 2AHRA 4EYEA 3GFBA 2CDAA 3V1YA 4UEKA 3WGGA 1E92A 4PN3A 4CLOA 3BMNB 4ND5A 2B5VA 5H83A 3PFFA 4RVUA 4AL4A 1HYGA 4GI2A 4FDAA 3JYNA 4PG4A 4PZCA 4H7PA 2PNFA 2JHFA 2HJSA 4XYMA 1A7AA 3JD2A 1M2WA 2JAHA 1KY5A 3EVTA 1DIHA 1MUUA 2XF8A 2WSBA 3NV9A 1R16A 3WLEA 3KV3O 5CDTA 1G0NA 3BZUA 3EK2A 3QVSA 5AXAA 4OSPA 1K6IA 4F6CA 1O9BA 5A1TA 1P1RA 4EITA 5DT9A 5AXDA 3KHUA 3UW3A 3RFXA 4U7WA 4XDZA 1H5QA 4OXNA 4RGBA 3SLKA 2A9FA 3U62A 3BMCA 1YBAA 2EIHA 4GH5A 1QRRA 4FFLA 2WE7A 3NGXA 3V2HA 3WDSA 1Y1PA 2B4QA 1P44A 1RYDA 1KVQA 3PXXA 4II2A 4YAJA 3OJEA 3E9NA 3FNHA 1WNTA 2FP4A 4NMHA 1AXEA 3BXXA 4D3SA 3EUWA 4GQAA 1O6ZA 5L45A 4J6FA 3H9GA 5EJ2A 3VAZA 2X0IA 1LDBA 2WD8A 1G6KA 5JMPA 1ZXBA 3I23A 2P2SA 4I08A 4BKUA 2UVDA 3HJAA 4XRRA 4BQPA 4IDGA 4QFCA 4JQCA 4QSMA 4I9HA 3ZWAA 5CEEA 5KVQA 4WCFB 9LDTA 1ZK0A 5LCXA 3Q11A 2Q3EA 1VKNA 3O26A 1KC3A 1HDXA 4NFSA 4DYDA 3IJPA 1NPYA 2GZ1A 2CF6A 3VKVA 5T6BA 2G1UA 2Q1TA 1M6WA 1PS0A 3C85A 1H6DA 3IIEA 4NHEA 4PLFA 2QHXA 2HUNA 4Q3NA 1HKUA 4GLLA 2ZTLA 2GN4A 4CM4B 2W98A 4DPKA 2PGJA 3DBRB 2NVWA 1GUFA 3DDNA 5L95A 2NTNA 4IMPA 5ER6A 4ZU3A 2O4CA 4G5HA 1U3VA 1PU2A 3BHMA 3ICPA 1GFSA 3ITDA 1XR3A 1QMGA 3B70A 3CH6A 3VH4A 1FDTA 3STHA 3M6IA 1R66A 3RAJA 2EKQA 6LDHA 1UXHA 1M75A 1JA9A 3GC6A 3CMCO 3ZWNA 1S7CA 3GEMA 1U2GA 2JKVA 2CSUA 5A5EA 2W2KB 3JYLA 4FD3A 1ZFNA 5EESA 5JCXA 2PFGA 4OYRA 3H9UA 2BGMA 3OIFA 1ISJA 4J2HA 1ISMA 1DLJA 4XGKA 1QYWA 3OIDA 3O9ZA 4LGVA 4RZIA 2O3TA 8ADHA 4E2YA 4R01A 1U9JA 4RPKA 3IS3A 3WWYA 1DSSG 4XGIA 5IDQA 4HFNA 1NPTO 1XKQA 1EVIA 4O0LA 4TZTA 3UHAA 3WBBA 1XA0A 3D3WB 1G0OA 2NU9A 4WEQA 3AUAA 3KXDA 5BSEA 2LDBA 2DUUA 1B26A 1ULSA 2ZCVA 3GAFA 5A9SA 1E6UA 1DHTA 4M55A 1E3SA 1O5IA 5THKA 3A9WA 4EI2A 3UAGA 1PX0A 1XELA 1EDOA 1TA4A 4U0JA 3AOGA 2YDYA 1HLPA 2Y1OA 2DBQA 3NDJA 5ER9A 2O50A 3DZBA 3AY6A 1FXSA 1GD1O 7MDHA 2FY8A 1ZVMA 1IZ0A 2HMWA 3H6KA 3W4IA 2AQIA 4KTVE 2VHWA 1LU9A 2TMDA 5F1PA 1PR9A 1WDLA 2GRAA 3QHAA 3ROKA 4UVIA 1HSOA 1P1JA 1V9LA 1UDAA 1E6WA 1LSOA 1VL8A 4E21A 5IDWA 4O1MA 1K2WA 2P9GA 1ZK2A 5ENVA 4DWVA 1SOWA 1C3VA 1ULUA 4CM5A 1MA0A 2X9VA 4R16A 1D8AA 1E7WA 2ZATA 2PY6A 4TROA 3F5QA 1MLDA 1BXGA 4Y6RA 1WZIA 5J23A 3HQ4O 4RVSA 3WYCA 1R6DA 2D4AA 4HWKA 4QT0A 3R6DA 3W1VA 2B83A 4CQLA 3GA0A 1WAMA 2HMTA 1F14A 1GQ2A 1IOLA 2G5CA 4JP2A 4ZQFA 5JY1A 2J5KA 3ZCXA 4RLHA 4JJIA 4CLDA 5TT1A 3C1OA 2X5OA 2EP5A 4DIFA 5CFZA 1N7GA 3UF0A 2GZ2A 2FZEA 3OECA 1N9GB 4CUZA 2O3JA 4EUFA 4K6CA 5LDHA 1ENPA 3PHJA 5H81A 4Q3DA 4I5GA 1JVSA 1R4NB 3OJ0A 1PJ4A 1HYEA 1WW8A 4KQWA 5A05A 3JQAD 3FPLA 1XSEA 1DEHA 1V3TA 1Q2XA 4ILKA 4I5DA 1X7HA 4IXWA 5F21A 2NVBA 4BKRA 4NU5A 1PJCA 3KM0A 2D5CA 2DKNA 4F6LA 1O95A 4YB8A 2X6TA 2OGUA 2ET6A 4H15A 2IEBA 3VC7A 1UZNA 4OXYA 1MX3A 4W9NC 3WJAA 3GG9A 4DC1A 3D4OA 2QW8A 5MGBA 3TZCA 5L40A 5AOVA 5FI3A 3COSA 5L7YA 3V1TC 4ALLA 1WPQA 2AG8A 2X8LA 3IDSA 5GMOA 3B1KA 3RC2A 2Q46A 3DZFA 3INRA 4TRRA 4WNIA 1ZO8A 4HFRA 3VH1A 5TIIA 3JD1A 2C59A 4Z9XA 1KC1A 4DC0A 3DEYX 3ROPA 4O5OA 2ZYAA 1J49A 1NXQA 1T1RA 1FDUA 1VJ1A 3JQ9C 4LCJA 5HM8A 5CPFA 1WLYA 2Q1WA 2NTJA 3GEGA 1V3UA 2YV3A 3MTJA 3WTBA 3ETDA 1ZEJA 1PWZA 1JAYA 1QYXA 4LMRA 4B7XA 4XJTA 4NI5A 3GNQA 1JWAB 3GHHA 4LCEA 1U1IA 3RASA 4TMFA 4J4BA 3DOCA 2D0IA 2CY0A 4U6SA 1EQUA 2V65A 4YBZA 3I6IA 1AXGA 1GDHA 5A06A 2V7PA 4XYBA 5BNIA 2QZ9A 3D1LA 3FF4A 4OM8A 4WLUA 4XX0A 3PYLA 4FGWA 5EPOA 2WEKA 4ZA2A 4M89A 2DLDA 4L8VA 4JBGA 1LRJA 1PQUA 2VQ3A 1NVGA 1TB4A 5IZCA 3ABIA 1UJMA 1V0JA 5CDGA 3DFUA 1HTBA 4FN4A 2OMEA 3ONEA 3PLNA 5T64A 2VUUA 2PK3A 3ROQA 5KJ1A 1YOVB 1ISIA 3ZI0A 2VOEA 2VN8A 1HE3A 1ZK1A 2OZPA 4OKNA 3GVHA 4URFA 4E12A 1HF3A 2HK8A 5G2OA 3ZU3A 1NR7A 2GR9A 4DLAA 4J7UA 3FCOA 4ALIA 3S8MA 4R68A 2OP0A 4WCFC 3WWZA 1Q1NA 3NT4A 2CF5A 2DFVA 4ROSA 4J2OA 2EW8A 4RO0A 2PA3A 4UVGA 3LYLA 1UXKA 2QIOA 1N7HA 4BO6A 2JD1A 4EDFA 4CMKA 1YS4A 3CIFA 3JQDA 5ICMA 4BMNA 4MKZA 3NT5A 4JX8A 4XA8A 3QA9A 3Q9NA 4WPGA 2FN7A 5F3RA 3GPDG 5DULA 1VRWA 1U8XX 4BNXA 3E5RA 4N5LA 1CIVA 1YE3A 3QE3A 4RLSA 2BLLA 2JJYA 3A28A 3EVNA 4TVOA 3ICCA 2O4UX 1AN9A 1FF9A 3OIGA 1Q7CA 4B4UA 1F8FA 1P3DA 3IUSA 3PFWO 4HFJA 4JJGA 1PJSA 3ZWPA 2HU2A 4TKMA 5K0ZA 4QQRA 5JY6A 1EEHA 3CSDA 1YL5A 4RDHA 3S2FA 3ZWCA 3L77A 3ZNQA 1NHWA 1I01A 2GDZA 4ZRMA 4CLRB 2Y1EA 1WMAA 2OP1A 2YQ4A 1R37A 1R4NA 5ICSA 3U09A 3ZWMA 2VRBA 1LC3A 2EEZA 3RBVA 1TXGA 1DRVA 3U4CA 2O2SA 1FDVA 5I8WA 1P9LA 3W8FA 4BL5A 1KY4A 1TT7A 3GZ4A 1R4MA 2VNAA 2HDHA 3I6QA 4PG7A 3LDHA 3WR5A 3JQEA 1O8CA 2YYYA 3UN1A 3S2GA 3LT0A 3LC1O 1BXKA 2WYWA 2ZB3A 3I5MA 5IN4A 2PTGA 2FRDA 4XZ3A 1GUYA 1XYGA 1ZMTA 1H0KA 4OIMA 3G0OA 1PZHA 4MVJA 5DOVA 4MVJH 1LLUA 1N5DA 4NQZA 3GUCA 3AM3A 2X86A 4YT4A 1Q0QA 3ANLA 3ZWYA 2Q1UA 4R1SA 3BMOA 5IXSA 2Y0EA 1B8UA 1GY8A 2Y1GA 1HDCA 5HWSA 1GZ4A 3PHGA 4OAQA 3DBHB 1Z82A 3BTSA 4AJIA 1SPXA 2V6BA 3P5SA 1WZEA 1DLIA 1VLLA 2AXQA 2X7HA 3TZQA 5L4LA 1IHXA 5FFFA 3NDRA 1X7GA 4BO7A 3U3XA 2AQ8A 4A27A 1E3EA 1F8GA 4NBWA 2A92A 1MG5A 4MOWA 4J90A 1XU7A 1LC0A 4D0RA 2O3RA 1UXIA 2VYVA 1TI7A 3ZHZA 4TRMA 2JD0A 1Z74A 4PVDA 3VOSA 1DAPA 1VC2A 1ZJZA 3C3XA 2X5JO 3GG2A 4BNGA 1MXHA 4ONEA 4FQ8A 3H3FA 3L07A 1GQQA 5IXYA 2PKQO 1UDCA 3DONA 3E18A 4WGGA 4J1QA 5JCJA 4E2XA 4NZ9A 3KEOA 4XD2A 3HDHA 3I9LA 5JDIA 1NWCA 2HMUA 2XPCA 1BDBA 1HDOA 3KYCA 4EBFA 1L7DA 4DLBA 4KWHA 3GAZA 2DBRA 1U3UA 2RAFA 2RHCA 2DTEA 4NJMB 3F1KA 4BO3A 1E1NA 2JCYA 1OMOA 3CUKA 4CMEC 5ES3A 2J5RA 2BRUA 3OJFA 1HE5A 1YQGA 4W82A 4YJFA 3M1LA 4X54A 1NQOA 2Y68A 1VSVA 2R2GA 4E3ZA 2ZJ1A 4J1SA 1R15A 1H6BA 2ZYGA 5I9NA 3BTOA 1Z7EA 2EKPA 4AJ1A 3MJ4A 1HDRA 4DPMA 4RVGA 2E48A 1SZJG 2DUWA 3K73O 3RI3A 1MXFA 1E0DA 3U4IA 1IB6A 1UUFA 5TJ9A 3VDRA 1PJ3A 4YR9A 2VWGA 1Z7BA 1B3RA 1JN0A 4IDAA 2EJVA 4WLNA 1Y8RB 3Q2KA 1LSJA 1GYQA 2PZJA 4YRAA 1DC3A 4IY1A 4I1IA 3SC4A 4LW8A 1U28A 4DL9A 4GMGA 1ZJYA 4ZVVA 5B37A 1HSZA 2PR2A 4DXHA 3GZNB 3GDOA 4GSKA 3WGZA 2VHYA 3T7EA 4H16A 2XXJA 4XQEA 3FBTA 1K5HA 4M49A 5TS3A 1BGVA 3DZGA 4F3YA 3NTOA 3OJOA 5EERA 2WJPA 4GVLA 4GWGA 4I9UA 2I6TA 2WE8A 3JQBA 4J3FA 4HY3A 1E5LA 2JL1A 3GNTA 3NUGA 3ZN2A 4ALKA 3B1FA 4CMEA 2VRCD 1B3BA 3D4NA 4TVBA 1VL6A 4A73A 2X22A 1NWHA 2DPGA 3WGHA 2GUGA 1IPFA 4YT8A 5IZ4A 3DZIA 1QYCA 1XDWA 4A5OA 5DOZA 1PQPA 3LC2O 1NX6A 3PHIA 3A1NA 3O8QB 2FR0A 1CETA 4QO8A 3E9QA 4PZDA 2J3JA 1YONA 1C0PA 3FR7A 3SC6A 4EW6A 5K6AA 1FMCA 2W90A 3H7AA 3GY0A 2Q50A 4FSHA 4NBUA 4CQMD 2DPHA 3R3SA 1YL6A 5HS6A 1Y9AA 4GSLA 2OBYA 1D1SA 3DC2A 3TQHA 4AVYA 4PLCA 4OQZA 2OXIA 2RHRA 2DAPA 4CUJA 1F06A 1ZSVA 5TLSA 4YXFA 2J3HA 4UVEA 5BSFA 5L7WA 2Q45A 5KVVA 4YJHB 1EVZA 3WMXA 5HS4A 4J0EA 2ZTUA 3FWZA 3ZHYA 1DJNA 3UCXA 5JSFA 3R0IA 2G0TA 3EW7A 4TKLA 3PTZA 2X0NA 1BMDA 1HE4A 3VTFA 4UEJA 1PS9A 4FC7A 1E3LA 4IDBA 5A03A 5G0VA 4PIVA 4CLXA 1DIBA 4A2CA 2G17A 1K6XA 1ZK4A 1NASA 3KTDA 4GMFA 2J6IA 5TRTA 3W4JA 3HFGA 1EFKA 3RC9A 5IFLA 4PG8A 3UH1A 4TWRA 1IYZA 4Q39A 1AHIA 4MIOA 1EQ2A 2CDCA 1T2EA 1RM0A 1A4UA 1IULA 3HDQA 4MP3A 5KKAA 3O03A 2GCGA 3CINA 2Z5LA 1AE1A 3FTPA 1ARZA 2SCUA 2DU8A 5B1YA 3ONFA 5CDYA 1WDMA 3DAFA 4ZHSA 3U5TA 1FK8A 3CPSA 3NDIA 1P1FA 3C7DB 1K3TA 4RF5A 2GZ3A 4BNKA 1KVSA 2W2LA 2JFHA 1HYHA 3W8DA 3RJ5A 3JCZA 4BO2A 1IY8A 4OOEA 5B4UA 1KETA 1B8VA 4ZICA 1X7DA 1HE2A 4FOOA 1C0IA 4JLWA 5JDCC 2TMGA 4BO5A 4BNVA 2NV6A 4BMVA 3U4DA 3G79A 3AM4A 4GVXA 5K1SA 2VTDA 4WK6A 2Q1SA 4FS3A 4NIMA 3F6YA 1DPGA 5AQ1A 1SAYA 4ZQBA 3IL2A 1C1DB 3F47A 3QWAA 4HADA 5CG1A 2GN8A 2NNLD 2Q2VA 4WOJA 4K9DA 3V5NA 3A06A 3PDJA 4XWYA 5A5FA 2V6MA 3E82A 4L4SA 2WYUA 2JAPA 1WP4A 4XQ9A 5DCWA 4CM3A 2ZK7A 4LRTB 3AFMA 1B8PA 3QWFA 1KEUA 1V35A 3QVWA 2VT3A 3PI7A 4CV1A 1I8TA 2ZB7A 3GMDA 1ADFA 3QY9A 5EMHA 1ZEMA 3O38A 1IPEA 3ADPA 3K2EA 4YJFB 5KJ6A 4I5EA 4J1NA 3TDKA 4MVJD 4WCFA 4XJSA 1PZFA 2GD1O 5TSDA 4E30A 2VHZA 1PGJA 2DTXA 3BYZA 4YRDA 4AJEA 2A94A 1LSUA 3F4BA 2RH4A 5L53A 3GVIA 1DFGA 2YHUA 2F00A 3ZGYA 4XKJA 4NDNE 3WXBA 4FIZA 4DMMA 4LVUA 3K6JA 5DDIP 1RYEA 4NFYA 3JYQA 3BMCB 1X13A 2X9NA 2HK7A 4YJDA 2HQ1A 2W4QA 2UDPA 2YDXA 4MVJG 4R5HA 2BD0A 3ETEA 3E6AA 4PLHA 3TZKA 3HDYA 4BNHA 1HL3A 2NUAA 5BQFA 3B1JA 1DJQA 2GASA 4ZJUA 1ISFA 4INAA 4YT2A 1GR0A 2R00C 5COBA 5I9MA 3DTYA 4E13A 1B2LA 4GWKA 4CM4A 1O94A 1ENOA 1Y7TA 3I9OA 4R1TA 3RIHA 3I3OA 3RUDA 4IGEA 2GPTA 4CMCA 4DLLA 4E2WA 1L1FA 1R4MB 4MIYA 4E5NA 3VZPA 4MJLA 1KEWA 4Y98A 4A03A 3JV7A 4Z9YA 1YXMA 5U1PA 3JYOA 4Z0PA 5GZ3A 2QG4A 2YHIA 2Y1CA 5BNFA 1UDBA 2BGLA 3PPIA 1DC4A 4EUEA 3TN7A 2EGHA 3PJEA 3RKRA 1J4AA 1G1AA 4NBVA 1TLTA 3GH3A 3EC7A 1ENZA 5JO9A 1U8FO 4II3A 3W4KA 2I3AA 3ZW9A 4U8GA 1LDMA 4RV9A 3U4HA 1V3VA 4J7XA 4E0BA 4QXMA 3R1IA 5GZ1A 2PGLA 1KOLA 5IJZA 1W8DA 1Y5MA 3OP4A 5DN9A 3WG9A 3OSUA 3AU8A 2YV1A 3F3SA 3AOEC 4JNKA 1NVMB 1P31A 1PZGA 2X1HA 4YRBA 2VWQA 1N92A 3MJTA 3F1LA 2PV7A 4ITUA 4K6FA 4XYEA 2NADA 3PJDA 1ID1A 1TT5B 2HK9A 5IF3A 4K1LA 1LXCA 4OHUA 2RCYA 4CQLB 3DHYA 2IXAA 4RF4A 3OA2A 3H9QA 4GX2A 4GPD1 1E7YA 2BFAA 3I9NA 5T8KA 3JTMA 4BIIA 4EJ0A 4IM7A 3H4VA 4JBHA 5COAA 1GCUA 1HLDA 2OOSA 4R9SA 3RC7A 4TQGA 3VPFA 3SLGA 3UCEA 3WQQA 1VPDA 2D1YA 3H5RA 4D0SA 3KEQA 2NU8A 4DQVA 3DOOA 1X14A 3JQAA 4Q3EA 1QP8A 3SXPA 4BO1A 1YQXA 4YA6A 1B14A 1NFRA 4XCVA 1WDKA 5ITVA 2R00A 4D3FA 4BO8A 1P45A 4WLFA 1DFHA 5JO0A 1NBOA 1MB4A 1ADCA 3V2GA 1QYVA 4J7CA 4N54A 1R0KA 5KJFA 2B0JA 2WMDA 3WJ7A 5I7FA 1OZAA 5JDIC 3VVCA 2H5LA 5CHEA 1B7GO 2HRBA 4CLEA 3P2OA 3JQ7A 3JQFC 4PZEA 5JXWA 3G1UA 3GR6A 2Y0DA 4Z3DA 3BMQA 1ZCJA 4OGWA 1KVUA 4UULA 2X58A 4HKTA 5T57A 1SC6A 4LISA 4YAEA 1LLQA 1VM6A 1LQUA 3OF2A 3DBLA 1YH3A 4U0KA 3OEYA 1NYTA 2Q2WA 3GDFA 2BFMA 1Z45A 3GEDA 1JVBA 3DBRA 1UAYA 3E8XA 3HWRA 3RSHA 5G0WA 3ASUA 1PGQA 1W6UA 5JLAA 2BH9A 2I66A 3FWNA 3Q6IA 2D5AA 1Q7GA 5IZCC 1V8BA 1PSDA 3PYMA 3NT2A 2AEMA 4FC6A 1VL0A 2AMFA 2QRKA 3HNPA 1A27A 5CPBA 4CMGA 1EE2A 3DMTA 3AOEA 3VZRA 1NP3A 3OH8A 3TRIA 2VZ9A 3VZQA 5JC8A 1X0VA 4E2ZA 3BHIA 3FRJA 3GVPA 2CVOA 1T2CA 3WICA 4BGEA 1GEGA 3KLMX 2JCXA 3HB5X 3AM5A 5DBFA 2VYVD 1U4SA 2HKIA 1OAAA 4HX5A 3NJ8A 3GF4A 4LRSB 2BMAA 4MVJM 2GN9A 3GVCA 4NJMA 3ZV5A 4LSWA 1PTJA 3AI1A 1YO6A 4HUJA 1YDEA 3N58A 3P7MA 4AG3A 5TJHA 2IZ0A 1EFLA 2HMSA 4BKOA 3RU7A 5KVCA 2QQ5A 4IZIA 1GYPA 4JGBA 1YKFA 4KMSA 4AICA 1LA2A 1H94A 3PHLA 1J5PA 2FR1A 3GOHA 3LT1A 1NM5A 4MDHA 4N7RA 5C37A 4HNGA 4AJ4A 1OOEA 2NQTA 1QLJA 1HEUA 1YRLA 4O59O 1JDJA 1Z75A 3RUFA 3WYBA 1TVEA 3JQFA 3HADA 2EV9A 1LUAA 4EJ6A 4M54A 1AHHA 3WYEA 1EVJA 1K0UA 3IJRA 1GUZA 2FSVA 5THQA 5JAIA 4R51A 3T7CA 3GUYA 1I3LA 2XAAA 1NQ5A 2H9IA 2FMUA 3BHJA 3P19A 3WOHA 4DGSA 1NVTA 3FNEA 3K31A 4E5YA 4M87A 1ZSNA 4YJHA 5F5NA 1E3WA 2BI8A 4M1QA 4CL8A 5FI5A 2VNSA 3BMQB 3QWIA 1ADGA 1HZJA 4BNYA 5U4QA 4D43A 3K30A 3DMTC 3MJEA 3PIDA 2O3SA 2EJWA 3ZH2A 1C0KA 1GZ3A 3ZNPA 2VOJA 4YYZA 2I76A 3IKTA 4KWIA 1WMBA 2PH5A 3BAZA 4GX0A 4YACA 3QLJA 4FFPA 3NEPX 3PDUA 1M66A 9LDBA 4DIBA 1DO8A 1KS9A 4IIUA 2B69A 1E6EA 1XIVA 1DBVO 2B35A 4IPTA 2WTBA 1T4DA 3H9JA 1LJ8A 4S1VA 3IMFA 3QP9A 4IJKA 1P1HA 1JW9B 4RDIA 5EQDA 3PRJA 2E37A 2UUOA 4Z0HO 4IS2A 3MTGA 5AVOA 2VYNA 4QUKA 3PWSA 2C0CA 1HWYA 2OHXA 1LEHA 1NHGA 4FOSA 1CYDA 4XQCA 4YQZA 3Q2IA 6ADHA 1RPNA 3ITKA 3H8VA 3WBFA 3CXRA 2GSDA 2JHGA 3TOZA 5BSHA 1GPJA 1A9ZA 1N9GA 2NU7A 1BG6A 2JD2A 2O23A 2POQX 4DREA 3JD4A 1T2FA 1GZ6A 5F1OA 5I7VA 1V6AA 4XYLA 3KUXA 3NTRA 4XQGA 3DHEA 1BXGB 3E48A 4BKQA 3EZYA 3LLSA 4NU6A 4R1UA 2PLAA 4CM6A 2I65A 1WVGA 5DBGA 5EINA 3LVFO 2AE1A 2JCVA 3K96A 4B3IA 2VWPA 4PRKA 5FEUA 3ORFA 4CMIB 1IZ9A 1FJHA 4YAKA 1WXDA 2B5WA 3HFSA 2C7GA 1GL3A 2BFOA 3U9LA 2FPPA 4DUPA 1BDMA 2BHLA 3KZVA 4DRYA 4EZBA 3D64A 3LK7A 3ST7A 4KDFA 3ZHBA 3DQPA 4BO4A 4CQMA 3OQBA 1Q0LA 4OOFA 3MJSA 4ZQGA 1BVRA 1H6AA 1U4OA 4GKBA 4J0FA 3CZMA 4JP3A 4YAIA 3KLPX 1E1MA 5T8KC 4CMAA 4GGPA 1DIRA 5C7IO 3OQ1A 3PGXA 1SB8A 1BWSA 3M2PA 2ZYDA 3GGGA 4CLHA 5DZSA 1ISHA 4RL6A 1T1SA 3KETA 1BW9B 3AU9A 5G4KA 1KEPA 1K6JA 4U6QA 2C5AA 1T4BA 5A9TA 4Y9DA 3GFGA 5TQVA 3VKUA 7ADHA 3PGJA 2CMDA 4ZRNA 1BTOA 2HJRA 1JAXA 1Z6ZA 2ZB4A 1NPDA 2AW5A 2CVQA 3ENNA 3DFZA 2AA3A 1ZKMA 1ZSYA 1Y8QA 2YFHA 3RUHA 1PJTA 4R9RA 1UXJA 5ILOA 1Y6JA 1EE9A 3VPHA 1JKJA 1ZMOA 1ML3A 2OORA 2PKRA 4L75A 1M6HA 2I9PA 3V2UA 1YJQA 2I5PO 5DCYA 1GADO 5BR7A 1E7RA 3MEQA 3ZWWA 5CP8A 5T67A 4ZN6A 1D1TA 1MG0A 1VKOA 3C8MA 3JQGB 3FNGA 3M1AA 3WB9A 4D42A 1UP7A 3EGOA 3OBBA 3L0DA 2FZWA 2IZ1A 2PD6A 1QV7A 3GHYA 1UZLA 3IP1A 2VZ0A 3SX2A 2W2LD 2EKLA 2OFPA 3VTZA 3C7AA 2EP7A 4LSMA 4CMIA 1E77A 2E6UX 2NSDA 3HN2A 3G1TA 5ITWA 2WD7A 4P4GA 1DOHA 4J9VA 3WGOA 5KKCA 3VH2A 5FYDA 5IDYA 1AUPA 5JAZA 4RZHA 5JAQA 1D4FA 3TPCA 4TRNA 3B20A 3OM9A 1YBVA 4N18A 2GN6A 3AUUA 4QECA 1PJ2A 2EXXA 4RPJA 1OFGA 2C2XA 1I10A 1ONOA 2UV8A 1P0FA 1FDWA 1YBMA 4BOYA 1UH5A 2ZIZA 4TRJA 3LF1A 3KSZO 1T25A 1HDYA 3AI3A 2VRCA 4FCCA 4Q9NA 2P5UA 4E6PA 3VPGA 4IS3A 1L7EA 4CM9D 1NR1A 1YB1A 2AE2A 1ZK3A 1P74A 3ROMA 3F9IA 1MFZA 5LC1A 2GNAA 2NU6A 3VPSA 1EDZA 1EUCA 1GCOA 3SJ7A 5CAEA 1DRUA 5I7SA 1RM4A 1IL0A 1KEVA 3OMLA 5CDSA 3OETA 1NQAO 3UFXA 4CMBA 3AI2A 1RJWA 2YV2A 4CR8A 4NFHA 4RF2A 2A4KA 4PLGA 2DQ4A 1NAIA 4FFNA 2DBZA 3LT4A 4DMLA 4UVHA 1LLDA 2EF1A 3DXFA 1I2CA 1X1EA 4FJ0A 2BF7A 1S6YA 4IQGA 3IOYA 3WTCA 5JS6A 4JIGA 3CKYA 1CQIA 4TSKA 4DVJA 3L6DA 4GX5A 2FPIA 4ND2A 5KOIA 3H5AA 4KP7A 5JYEA 1SCUA 4BV8A 2YQ5A 2I99A 3INTA 2DBVO 3FNFA 4BGIA 1ZH8A 5TT0A 2PH3A 2NWQA 3RBZA 4KOAA 1R0LA 2C7VA 3A14A 4L74A 4NBRA 3HSKA 5L3ZA 1R0SA 2O48X 3HDJA 5JPIA 4ID9A 4RF3A 1Q0HA 4LK3A 2W8ZA 3PQFA 4EEZA 5JBIA 4YQYA 4BQRA 4CV2A 4KTTE 3C1TA 4CMHA 3F46A 3I83A 1EBUA 4GKVA 5IG2A 1I2ZA 2UUPA 1EUZA 1T2AA 4B3HA 1YQDA 1BRMA 3I1JA 3AUTA 3LF2A 5JCJD 2LDXA 3EYWA 2AG5A 1QYDA 1JLLA 4N5NA 5HRUA 1Q7BA 2CNBA 3RVDA 3MJVA 4L4XA 3ZW8A 4DYVA 1QV6A 1OBFO 1VJTA 3I52A 1ZXLA 4B3JA 3IC5A 3L9WA 3QWHA 5G4LA 2F1KA 5ILGA 3WGTA 1E7SA 4FFRA 4IZHA 5DF1A 4AJJA 4AJKA 4WECA 4E33A 1B0AA 2C07A 3RUEA 2HRZA 1H9AA 1W4ZA 3A4VA 4HV4A 1NFQA 1SEPA 2J3IA 4MVJF 5KIAA 1LBEA 4BNLA 1PGNA 3PIIA 3ZU2A 1PL7A 3ANNA 3PQDA 4J49A 2NLOA 1IHYA 2Z1NA 3ONDA 4M8SA 4AJ2A 3AWDA 3NGLA 3Q1LA 4Z9FA 3PYXA 2X0RA 1SB9A 1I5RA 4PLWA 4QX6A 3FR8A 4FPXA 4O63O 1U3TA 3D0OA 3M2TA 4R4JA 4BNNA 4KZPA 3V1UA 1PR3A 1ADBA 4D45A 3DZHA 2GGSA 2Q4EA 3FI9A 1SMKA 4IDCA 3RUCA 1U2DA 1R12A 3TSCA 5U9CA 4W99A 4DQXA 3WNQA 1EMDA 1PS8A 4PLTA 3L4SO 3NJ4A 4F45A 5HBRA 4GLOA 1PGOA 2D8AA 3MZ0A 3WIEA 2D59A 3IP3A 1EBFA 2GYYA 3GGOA 2B36A 3H2ZA 1LRLA 4BNTA 2ZQZA 1LDNA 2P4QA 3CEAA 3N74A 3ZNNA 2J5QA 2QZZA 3BTUA 3KVOA 3F5SA 1PQWA 3KOUA 4XIJA 3LLVA 5KNLA 2DFDA 2B4RO 3OICA 3W6ZA 1ENYA 1LNQA 4Z0TA 4IQ8A 4R54A 2C82A 1XWFA 4FJ1A 1GYRA 4BNJA 2DM6A 3S2IA 4CODB 2P91A 3ASVA 5GZ6A 1LSSA 2WM3A 3EHEA 3H5NA 4GL4A 4LVCA 4TZKA 1C1XB 5JFOA 1YL7A 3TZ6A 3OEWA 1YB4A 2I67A 4CPDA 3L6EA 2YW9A 4WLEA 1PJBA 3QVOA 4XIYA 4IINA 4BNMA 3WMWA 3DAPA 5A04A 3TWOA 3DWFA 3W8EA 4NG5A 3WLFA 1YVEI 3QIVA 5G0UA 2R6JA 4F46A 5FF9A 1HDGO 1C0LA 2HLPA 4BV9A 4HNHA 3O8QA 4BNFA 4B7UA 4JXKA 4UUNA 2AEJA 4W7IA 2FSSA 1UR5A 3JQCA 5TC4A 3GDGA 3Q9UA 5A3VA 4RQTA 4ZGWA 5EN4A 1I32A 5F5LA 3TNLA 2QYTA 4MP8A 3WSWA 4A0SA 5IAAA 3PZBA 4GAEA 3OFSA 1IUKA 3I4CA 4AJNA 3E5MA 2XXBA 4J1TA 3RFVA 2FPGA 3GNSA 2X9GA 1RM3A 2P4HX 3LQFA 3UKOA 1O0SA 4G2NA 5CDUA 3DL2A 5L51A 1I36A 1LX6A 1U7TA 4RORA 5HA5A 1MC4A 4NH4A 1ZBQA 2IDZA 4CQMB 3VPXA 4ND3A 4EEXA 1W73A 3TFOA 1T24A 3GN1A 3QV1A 5COQA 5B4TA 1QXSA 4Z3KA 1PIWA 1P1IA 4CR6A 4J9UE 2VT2A 4R1NA 4IQ0A 3D5TA 4ESOA 4PLYA 2NVUA 1BSVA 2P9EA 4WCDA 4B4OA 1M67A 1SNYA 5G0SA 1LTHR 3AUSA 1E3WB 1KVTA 3DHNA 2EERA 1EK5A 1AGNA 4FGSA 3ZV4A 3T4EA 3GRKA 3ETGA 1CJCA 1N1EA 4OO3A 3CTMA 3JQ8A 4MP6A 4B7CA 4D3DA 1SEVA 2C20A 1RM5A 3CZRA 1PZEA 3JD0A 2E4AA 2Z1MA 3DAGA 3RQSA 1A72A 5L9AA 3RFTA 2PD3A 1KERA 5BSGA 3FSRA 1ONNA 2QX7A 3JYPA 4QFDA 4ALJA 4L4RA 4Y6SA 3RBXA 1JWBB 5KVSA 1CQJA 4B4WA 4CUKA 1M76A 1QKIA 2CUKA 3IQDB 1DRWA 2IODA 3WGIA 2O7SA 3TJRA 4Y6PA 3BA1A 3LU1A 4FJ2A 4MKRA 2C54A 3ZU5A 2IZZA 1NQTA 4KDEA 4QO7A 3E9MA 3MCVA 2BELA 3WGQA 4RJTA 3HHPA 2Y93A 1DHRA 4BNIA 4E5PA 4RCVA 3TOXA 1NFFA 3C24A 3UOGA 5C7OO 3INGA 3D3EA 3QSGA 4PFJA 4WE3A 4ALNA 1N1GA 3AJRA 4CL3A 2I3GA 2OO5A 1P0CA 2IEDA 2NTVA 3JQ7B 1DIAA 3RCBA 2PZKA 3NX4A 1N2SA 3UICA 1HDZA 1E7MA 4IUYA 2BGKA 3WFJA 1UAGA 5K9ZA 3C1AA 1Y5RA 1PL8A 4AJPA 1QG6A 4NR0A 4NK4A 1A5ZA 4IDFA 3NTQA 2B37A 1Z73A 1LRKA 4PG6A 1GTMA 4IXTA 3ZV6A 3ZU4A 3MJCA 4UUOA 4JJFA 2O2YA 2IRWA 3KYBA 4PCVA 2HSDA 2VTEA 3OA0A 4MPDA 1XLTA 1ZIDA 2EG9A 3G49A 1W0CA 2NVUB 5K6AC 5KCZA 1FDSA 1U5AA 2YUTA 4BB6A 4ND1A 5C7LO 3QJ5A 4MIEA 3LC7O 4PLVA 2WD7B 4YAGA 1EUDA 3QVXA 3KO8A 2Z95A 5AYVA 3VDQA 2ZKLA 5JAMA 2GO1A 3RROA 4G65A 4B8ZA 4PRLA 3EZLA 1Y8QB 3ZDFA 1LLCA 2Q2QA 2OL4A 1YJ8A 3JQ8B 2G82A 5AXBA 4MVJE 2H63A 4QTZA 4XB1A 4J43A 2NACA 2AQKA 4XGNA 3VZSA 2UYYA 2A35A 2Y05A 5TGDA 1QLHA 2J8ZA 4IIVA 3D5QA 5ADHA 1HZZA 4FBGA 1N8KA 3JSAA 1H2BA 4W7HA 4ZQHA 3S55A 1PJQA 5TX7A 4EGFA 3L4BA 4C7KA 3I9KA 4IDEA 4PLPA 3JQ9A 3ZNOA 3F4LA 4QEDA 4E32A 1K89A 3GZNA 3WGYA 3RKUA 1X0XA 1UP4A 1I3MA 1A4IA 4OXKA 4AJHA 3MOGA 5JYDA 1I30A 1E3IA 4L0QA 3AFNA 1HXHA 4WEOA 5KJEA 4J4TA 1CDOA 1Y9EA 4XEHA 3R3JA 2E49A 3RC1A 5A3JA 2PWZA 4P22A 1KVRA 1DB3A 1GPDG 4IBOA 4JN6B 2VHVA 2ZQYA 2NM0A 4JBIA 4CM1A 1XQ1A 3X2EA 5KTKA 4ND4A 5KJCA 5TNXA 4GGOA 2V6FA 5DP1A 4CM7A 4YWJA 2PD4A 3WFIA 3RJ9A 4OMUA 2Y0CA 3SJUA 4LMPA 4XYGA 4BGUA 5GY7A 1XHLA 3L6OO 2DTDA 3K92A 4UUPA 4PGFA 4EJMA 4K26A 2O3QA 5IN5A 2WWRA 5A9RA 1DFIA 3E03A 5JC1A 1P1KA 2O7QA 3S2EA 4YDRA 3SBOA 3U0BA 4YEDA 5EIOA 3NKLA 4RVDA 4K28A 4CV3A 4KUHA 4Q3AA 3AY3A 2X0JA 4R3NA 4WJZA 4E31A 1LQTA 5L4NA 2VZ8A 2B4TO 3GRPA 1ONPA 4FW8A 4L73A 1D7OA 1TT5A 5DBIA 2RBEA 1ORRA 1RKXA 2AEFA 3UUWA 4OSOA 3ZWXA 1DAOA 2YFQA 3DBHA 3H65A 1JTVA 3PLRA 4MO2A 1P77A 1GU7A 1ISGA 1P33A 3GT0A 3NRCA 4L9RA 2NQ8A 3U49A 4R69A 5LDGA 3UGKA 1EK6A 2VYND 5DP2A 4CR7A 1H93A 3RU9A 4D41A 4DA9A 2E82A 1LDYA 4LN1A 4W6ZA 2BI7A 3ZWVA 4N5MA 1PJLA 4MVJI 3WX0A 3L9XA 3VHRA 5L7TA 3FHLA 4R5MA 4W9NA 2X4GA 1I2BA 3FN4A 2ZTMA 1IE3A 3NAQA 4JCOA 4AJOA 2IYOA 5C3MA 1E5QA 1X15A 4P38A 4RPLA 3AY7A 4XB2A 4FFMA 3I4FA 4B79A 3TZHA 4UVDA 3EDMA 3OQ6A 3RUIA 1CRWG 1H6CA 4KUEA 2VUTA 1Y81A 3LT2A 1JKIA 3DO5A 3PHHA 4B4VA 2VHXA 4A26A 1DC5A 4NK5A 4BS9A 4D79A 4DPLA 1MV8A 1KBZA 1MC5A 5AXCA 4P4LA 1F17A 1A7KA 1WWKA 3GK3A 3WQRA 4D46A 1EZ4A 5L4SA 3WQSB 5A9SB 1LDGA 2VCYA 2JFGA 3PEFA 2P5YA
chains in the Genus database with same CATH superfamily
4XFDA 3T8YA 5DLDA 1AF4A 1YDWA 4C9BA 1GGVA 1RE0A 4XUEA 2LP4Y 1GV0A 3L7OA 2EWWA 4FU0A 1E1RA 3CYFA 1MP0A 1XZHA 2JJ2D 3MMZA 3OJLA 1SU4A 2AZTA 1SPBS 3LX4A 4CJXA 1TX4B 2DVMA 4YV2A 1AURA 4JBNA 3S2UA 3K72B 3FA2A 1YQWA 1OVGA 2CNWA 4IDHA 1TTPB 3SDZA 4MX8A 2Q5OA 4CHGA 2O8DA 1UJNA 1XRNA 3A9RA 2ODEA 1EFTA 2W37A 1F2DA 3NAGA 3QPUA 2BR5A 1KYTA 2GHTA 2PX3A 2XQIA 5JYBA 2QBYB 3TXXA 3L8DA 4JYZA 5A4DA 4B9EA 1GTVA 5E6RA 3FDFA 3VX3A 4S3MA 5B58C 5CH3A 3ZY2A 2DX7A 1BX1A 1ZICA 5K0GA 1E1LA 3KZCA 1PL0A 2LNDA 4E5MA 5HUQA 4N48A 3GLQA 4QTUB 5IWAB 2HRCA 1Y80A 1MAHA 2RGDA 3F3MA 3QPBA 1QORA 4A0GA 3OE1A 1L5HA 1XCLA 3WK4A 3HZZA 5A02A 4HK4A 2QR5A 4WNCA 2VJQA 1KEEA 4OYYA 3UA4A 4M8LA 1FUIA 3QXXA 5KQGA 1MGOA 4BNWA 2GYUA 1CUUA 2YY7A 2WJ4A 2X3FA 1QTIA 2LIVA 4LBWA 3I9MA 4AO7A 4F9TA 2V7TA 3ILHA 3GARA 1XQ6A 3GMSA 4EW6A 1N0IA 2QP4A 2C2ZA 1Y0BA 3KBOA 4L6CA 5K05A 4LY0A 1EA5A 3RWBA 5KOHA 3SKXA 2E3JA 3B82A 2GBLA 1DDOA 2GM4A 4NJOA 1Y63A 4FGZA 4IKPA 1KDTA 1UXGA 1ZI6A 4O6VA 5JW6A 1I4EB 3K5PA 5MDHA 3P32A 4WOKA 1Y1TA 1P5ZB 4ZU6X 2GM3A 4KX3A 2VJBA 3MMXA 4GHWA 4TGLA 4IJWA 3RC3A 4QTYA 1QRUA 4YJGA 5KOJB 1AM4D 1Y4UA 3CFYA 2IXEA 1DQZA 2DWQA 4DNQA 4WD3A 1CR1A 1PDVA 3KZ1E 2O8BB 1ACLA 1HETA 2C4KA 1FLNA 4NJEB 4Y2XA 3BZWA 3SK0A 3BCUA 2PBFA 4QFBA 3O4IA 1CQIB 1EH5A 5AJHA 2EWMA 4I8DA 5I4BA 3QVGA 1J90A 2ZEJA 3H2KA 5BQXA 4LYJA 5DE3A 2V4ZA 3WDKA 3QUBA 3AGQA 1DARA 1ZIPA 3TL6A 4YJ3A 1ORDA 1JHDA 1M2EA 4N7JA 2AYYA 3ADOA 3K0FB 1ZD3A 3N87A 4Q01A 4W63A 3G5AA 2OKCA 2DT5A 1GGKA 1NU8A 2WAYA 4C30A 1TUEA 1I3KA 2IE0A 5JMWA 2NMVA 1VP9A 3BMOB 4W5WA 3C16C 3O4VA 3W90A 3IAHA 2XBMA 2FQWA 3FJYA 5CEFA 3ZUPA 4YCBA 4PYJA 4DBVO 2VUSA 2QGNA 3LSYA 3I9JA 1Y4AE 2CBZA 1Y3DE 3O8LA 4XDYA 3PP8A 1K08A 1NNUA 2NV2B 4BNUA 5JIBA 3QKUA 2IIVA 3U48A 2CLKB 4MVJP 4JB8A 3ND7A 3SU8A 4YPOA 1RVDA 5TR9A 3TNYA 1JHVA 2RHLA 1L6RA 3JQAB 4KLZA 4LYHA 4TTTS 2HA7A 2WF8A 3A4IA 3DGEC 4N9QA 4ECEA 2OD2A 4OEHA 4QT4A 1XZGA 6NULA 4MZXA 4OKIA 2QM7A 4DTIA 3CZPA 3GVXA 4MRRA 5AVSA 3HYLA 1Y9JA 4UZEA 3DXYA 5BUSA 4M1EA 4OHCA 3WISA 2Y99A 2X5KO 4A7PA 2IBSA 1TMYA 1PL6A 3I9V6 4W4TA 1SOMA 3DT6A 4YJGB 2YWRA 1IATA 3CRNA 2AJTA 2IXDA 3MRVA 3DKVA 5DI3B 1E2KA 1TCCA 5I7EA 1P60A 5F35A 1EX9A 3LAWA 2ECPA 4KQ9A 1I4TD 1XQ9A 5DCUA 1Q7EA 5AVJA 4EFLA 1YIDA 2XNHA 2PZ8A 2PH1A 3R6TA 3DB2A 2W4IA 5DYGA 1EJ6A 3OMWA 4AFNA 1VE9A 3IE2A 1G9SA 2YHBA 1PFVA 3DR3A 4DLTA 3THXA 1E1CA 2ZJZA 4AJLA 5JISA 2WYVA 4JEIA 4PPNA 5K8VA 1DAIA 2HGSA 4XSHA 3R3HA 1PEDA 4ALMA 5CNKA 5EP2A 1AMUA 2CK3D 4WXHA 4OFBA 3FFAA 3HR8A 5HKLA 2YUIA 1GV1A 2ZKIA 3MGGA 4J0QA 3JQBC 2ESRA 4XVCA 4JVNA 2HJWA 4WOCA 1YRAA 3LT5A 3P2MA 4C2UA 2OR3A 1P9OA 2QD3A 3BWXA 1GKIA 3DVRX 3UAVA 4G2TA 1RQLA 3MWDB 5EWLB 1HRDA 3U80A 1YR7A 3C6KA 2BCEA 4L4YA 1Y1KE 3DVAA 1J00A 4IVQA 3HDVA 2A5YB 5ALYA 3ZV3A 4E3WA 2KLBA 3JPYA 5AJXA 5LZ5A 1C41A 3HCPA 3M4ZA 3UOWA 1VYTA 3EAGA 4YCCA 1TZCA 3F78A 1GL6A 1U7HA 2JIMA 3NHSA 4IFTA 4JP1A 3JU3A 3IUPA 3B6ZA 3A10A 5D3MB 5JSZA 4UJ5A 3C3JA 1OT5A 1E64A 1X80A 2HA5A 1TQHA 3MGCA 5T41A 1SUIA 4D81A 1O89A 4OYLA 3WHIA 3IBCA 5BMOA 1G64A 4BU1A 2HNAA 4ER3A 2QGZA 5AHXA 2OPBA 3FKQA 4K9PA 5BT9A 4PZUA 2IIBA 2HJVA 3HXLA 5HKKA 4IOJA 2QYSA 4OJQA 5CVTA 1O4VA 3PX3A 3TF5A 2VKQA 4QRIA 4EUHA 4P7BA 1HOXA 2YWEA 2Q8QA 2B94A 3SYTA 1TFRA 3QX7A 3RIYA 3DYVA 3I05A 1JEQA 1EKXA 1PFKA 3G2JA 3TIXB 2BMEA 5JNVA 2CVZA 5EE3A 4I7EA 2NSLA 5CA1A 4AMBA 4G0MA 3EF1A 2OUKA 2P6MA 3ACBA 4QUAA 5B2EA 5F98A 1T3SA 1X9IA 4BHTA 4FB5A 1YRBA 4TLLB 3GJYA 4M88A 1BXZA 3LY5A 4LHEA 2VPYA 2ZWVA 3E3LA 2PRKA 1MC1A 1OTYA 2GERA 3NGMA 5CUQA 4DA0A 3UK7A 1NA5A 3DZJA 4ZALA 3V4LA 4KE6A 4XTCS 3SWWA 5GVSA 5HFNA 3RD5A 5K8UA 2QTZA 2WY2D 2PGDA 1KNXA 2G76A 4K86A 4CW7A 3MHPA 1H0HA 3CA8A 4DM3A 2C9BA 2OQRA 3PQ8A 2NZYA 3CW2A 4NV1A 3PQEA 3SLRA 4DJ5X 4YYEA 1FX0A 1XCBA 1DAGA 2GCPA 4HI0E 1JFSA 1JDBB 3FOBA 1UOOA 2J4FA 2J33A 4I5FA 2CUZA 3MILA 2W2QA 4F85A 4H4CA 3HRHA 3M81A 4Q3BA 4Q21A 3IURA 4BLTA 3EAQA 4HH0A 5ALMA 3TH5A 2IX3A 2F4NA 3WS7A 4QQKA 1K5PA 2XTNA 4NZZA 2XKKA 3RAGA 4L76A 2V96A 5F3DA 4U2KA 5TF0A 4R2XA 5EQFA 4UUMA 1YK0A 1ZMRA 4XAQA 3TCNA 2ZRJA 5A4MS 1Y5IA 4ZZ2A 5J5VA 3SEFA 3L04A 3SEQA 4L8YA 3GJRA 3SM3A 2VA9A 4LNHA 1WXFA 5AK5A 1N9ZA 1JHQA 2D2EA 5HXAA 3D7LA 4CXMA 4IEFB 5LKAA 1W19A 2AOWA 3VO9A 4BMSA 5ENDA 5ALUA 4NARA 4QHTA 4CV0A 2ZPTX 1YMUA 4GOKA 1N2EA 3WL7A 3KQTA 3N39C 1THZA 3O2SB 4HP8A 1IY0A 2IPLA 2FZLA 4A2QA 3NHFA 4KQ2A 5AUOB 3ZHUA 4ZPXA 1P5RA 1MJGA 4X9XA 2PKQP 4KH0A 1JMYA 1UPAA 4E5KA 1SBNE 1DCTA 4BXOA 5KX5F 3KB1A 4PG5A 1RBYA 1O08A 3HE3A 2CDBA 5LKRA 2G9RA 4UXIA 5FPPA 1Z0SA 2AHRA 4P0TA 4ZVQA 3GFBA 4QUGA 3V1YA 5DKFA 2F43B 1TEVA 3CNOA 4ND5A 1F4LA 1X7XA 3BSFA 2IV3A 5JOQA 4EYOA 5EGSA 1JL3A 3CBQA 2NYRA 3PFFA 2K5UA 1U1DA 5FP0A 4A0QA 3KVNA 2OBLA 1W59A 1HYGA 2AI2A 1LPOA 4PZCA 3JYNA 5FUMA 5L3SA 1QVVA 5EKXA 3UFXB 4OQPA 2JHFA 3GJ8A 2FEOA 2H1WA 2HJSA 3I2HA 4P3NA 5DXAA 1A7AA 3WWOA 3JD2A 2J0EA 3EEQA 3LZCA 3F7NA 1M2WA 2PSHA 4FHGA 1MAAA 2I8AA 2WSBA 3FPFA 1RHJA 3DTVA 3D0KA 3H1TA 4CF3A 3JZFA 4F6CA 3I5YA 4OSPA 1K6IA 3HXMA 3CN9A 4CF4A 1O9BA 3DUFB 3EIQA 3TYXA 3ZTYA 1L3CA 3NORA 1PLKA 1A8QA 1NVAA 3UW3A 2D06A 3RFXA 4U7WA 4HNSA 5BQ5A 2BZ1A 2ZUVA 3LX5A 3U62A 3U6BA 2NNWB 1YBAA 2ISCA 2QL6A 1XD8A 5FADA 3TLBA 1D2HA 4OH7A 2QTHA 1QRRA 3PQ2A 4PBTA 1E5VA 1URPA 1NZDA 2FP3A 2QRUA 3HUEA 4NFLA 4KAXA 4FINA 4WXYB 2P2DA 3WDSA 3IBTA 4EY3A 2L42A 4UNIA 2GAOA 1JZSA 4PHHA 3OJEA 4S12A 3G2PA 3N2EA 4YAJA 4KR9A 1AO0A 1WNTA 3I1YA 4NMHA 3WZLA 4D3SA 3WKCA 4RUKA 1H2XA 3EGDB 3WIOA 4MUAA 1CUSA 4CKWA 2M9MA 1PLJA 4GQAA 1PWHA 3OPNA 3UUFA 4M37A 3IOCA 3UATA 2ZRBA 5JMPA 4GPIB 1I6WA 3U7FB 2WUWE 2P2SA 2FLKA 3C2QA 1WTAA 3JWGA 1UDWA 3CO0S 4PINA 2UVDA 1SG6A 3FJ1A 2R8RA 2HV8A 4QSMA 2VXBA 5H9VA 3W79A 4C7VA 5EHXA 1QQ7A 2OFXA 4WTOA 1SQ5A 4WCFB 1XTUA 2IS6A 2HT6A 1VSBA 2YCBA 2YVLA 4KE9A 5LCXA 4LF8B 3AV0B 1UBKS 3O26A 4WNAA 1KC3A 2V7GA 4M3NA 2CMKA 2C9CA 3FTFA 1NPYA 1Y8ZA 2CF6A 3D7MA 1OI3A 2FJ0A 4GOMD 1N6PA 3HLTA 1QX3A 3VX4A 4F72A 3TUIC 4BVLA 3C6ZA 3OX3A 1H6DA 2IGTA 3REOA 2LGJA 2XXAA 1K7YA 2AFVA 4PLFA 1GFZA 1ZESA 4I55F 2HUNA 3TE7A 5KWIA 5GAJA 4PX3A 2QD4A 1MVOA 1JEQB 3MK31 1GZSA 1NRIA 1PJRA 1FX0B 1QVZA 3DBRB 3OCZA 4G4IA 4UHCA 1C7JA 1PK7A 1SCIA 1UEIA 4CFZA 3NBZC 1PNTA 4HDKB 1U3VA 4TLEA 3BHMA 5JWOA 1C4XA 1XCOA 2VUIB 3KEMA 4TTIA 2BFEA 3T7AA 1QMGA 3B70A 4MMZB 3CH6A 2RK4A 3LVBA 1FDTA 3M6IA 1QGUA 1R66A 4LKOA 3RAJA 3FUUA 5BWNA 4W1PA 1N2JA 2B0CA 1M75A 1JA9A 1Z4KA 4EUSA 3U44A 1RXSA 2QLNA 3VR5A 2CSUA 1J9GA 1VG0B 4NESA 1PNRA 3LPMA 5EESA 3RV4A 2F3QA 2PFGA 4HGYA 4BBJA 3EZXA 3QUAA 4OYRA 1T10A 1XK6A 3IQWA 3F9RA 4EFKA 1WZNA 3R74A 3I2YX 2BGMA 5LVAA 2NXJA 2ZSDA 3AZQA 4C4RA 1ZRNA 4LGVA 2VDVE 3O9ZA 3OIDA 1G5HA 1I51A 1ZX1A 4RZIA 3W0LB 1G38A 2XRYA 4LFAB 1T5SA 1G8HA 3SOPA 4E2YA 4D5GA 1U9JA 3LX6A 5IDQA 4EECA 1DSSG 1GXSB 5BVHB 4HFNA 2HCRA 1DEXA 3NHUA 4K3UA 3G9TA 2CV2A 4N5IX 4O0LA 4TZTA 3L1VA 3VR5D 3J81A 1ZCAA 3FUVA 4GLJA 3D3WB 4OHPA 4ZV9A 2C2HA 5KYUB 5KYWA 2IU3A 1GCGA 4EGCB 3ELBA 4YUVA 2GRUA 3DKKA 3FPAA 4ZI7F 1XP8A 2FG6C 4NEQA 4KYTA 4IW3B 4AZVA 2ZCVA 5A9SA 1FFDA 1T4CB 2EJUA 4M55A 5THKA 3OKCA 4X1IB 4TV9B 3V46A 4EI2A 3UAGA 1OXMA 1Z5WA 1XELA 5K2MA 3FUTA 1S8AA 1RU3A 5B1HA 1PJAA 1HLPA 4LC9A 3H83A 2Y1OA 2DBQA 4WHMA 2PL9A 4Q03A 5ER9A 1KI2A 5IAJA 1QUFA 4KRFA 1GNRA 2ZE7A 1RHMA 3DZBA 2BJHA 4N47A 3W3AD 4CKBA 1GD1O 1W4LA 7MDHA 3M6LA 1QGDA 1V43A 2C3YA 2HMWA 3WL8A 3WLAA 4PTZA 1T13A 2AQIA 2ZU6A 3PXBA 4K9SA 2BSXA 4G8BA 4KTVE 4IZ6A 1NURA 3NYRA 3UY4A 4BWVA 3ZY4A 4IXNA 3MG9A 4AJ9A 4I9GA 2GRAA 1X9HA 1NMZA 2EJBA 1JT2A 4ER0A 1ORHA 4X1YB 1ODCA 2GS9A 4O29A 1RXIA 1WUTA 1VL8A 5G1OA 5B3KA 4N6OA 5IDWA 2R8EA 1H8HD 3BWMA 2HXYA 4JSTA 3PITA 2ISSD 1ZK2A 3C14C 3QUCA 5LXTF 3ZCPA 4CTNA 1SOWA 3DLCA 3BRWD 2CJWB 3HXKA 1Y5NA 4PHGA 3RS4A 3UWMA 2X9VA 3LYUA 1Z6GA 1RBMA 3L1JA 1KQNA 3UMFA 2B8NA 2VPTA 2DULA 3F5QA 5LXTB 3GJXC 1D2MA 3B78A 1XALA 2J07A 1O6FA 1ZWLA 1I6MA 1GKUB 1CP2A 3AJDA 1FXWA 1QH1A 2D4AA 4HWKA 4QOIA 3TBHA 3W1VA 4CQLA 2FCRA 1FSZA 3GA0A 2HMTA 1GQ2A 4OGLA 1IOLA 3PNMA 1OA1A 2J5KA 1OD6A 2VRWA 3ZCXA 2HJGA 3E7XA 4BJ6A 1QB7A 1FCJA 4CG0A 4CLDA 3B52X 1R0ZA 4R2LA 4XD7D 4A8JA 2GN0A 3F2IA 4YCMA 4MAFA 3UF0A 2BMFA 3C5HA 4K81B 2X7JA 1N9GB 3EVDA 3KWMA 1SURA 4U3JA 3VKWA 4EG5A 1CQZA 3CH4B 2HA4A 2QTBA 2FXVA 4ER5A 1R4NB 2DQSA 2OGTA 3KTAB 2Q3CA 1FMTA 2F8TA 1PJ4A 5EWMA 1HYEA 1OYWA 2OZKA 3CURA 4KQWA 5AKIA 5A05A 3LVQE 1Z4OA 4HWOA 3CE9A 3AKDA 4Q15A 2PNJA 3VO1A 1JA0A 1Q2XA 1U3CA 2E4XA 1SKMA 2Q6OA 2J48A 4I5DA 2G04A 1X7HA 4EB3A 5AIBA 1GUBA 2NVBA 1BFDA 2X2PA 3G2QA 3KM0A 2Z2KA 1G18A 16PKA 1O95A 1JVNA 3T7IA 2EX1A 1R88A 2ZRDA 3SZMA 3D54D 2ZR7A 2IGBA 3LDAA 3M5PA 1WZCA 2C0PA 3A0UA 3R5JA 4C0QC 4CG1A 2C9MA 2IEBA 1UZNA 3H11B 4OXYA 1E1QA 3PGVA 1XI2A 3WJAA 3D4OA 3FSGD 4X93A 4D8VA 1K8QA 4M7RA 5MGBA 2UVQA 3BXHA 4OAOA 4LYAA 5CXSA 5FBWB 2QTTA 4DUGD 1FP7A 1WPGA 4JYCA 5JZ9A 3Q3GE 1F5NA 1JPNA 3B1KA 3AR7A 5EZQA 2ZXFA 5GMOA 1D03A 4TRRA 4WNIA 4RU1A 3AC0A 3JS5A 1G2QA 4CIYA 1CZNA 3EWSA 3HJTA 4Z9XA 4DC0A 2WKPA 3F6PA 3DEYX 5LB2A 4KNYA 3VPAA 1WCXA 2QQGA 4O5OA 3PE6A 2ZYAA 1O6GA 1WSWA 2H7YA 3MJFA 1J49A 5E9WA 1MAVA 1VJ1A 2PPLA 5FIUA 3TRDA 4F9EA 3PPXA 2W11A 5M5BA 2DOKA 1GZUA 4OK6A 1ORTA 1WLYA 2J3QA 3GEGA 2YV3A 3MTJA 4DJJA 3IEUA 3L0PA 1A98A 2QNRA 2VFAA 3NWOA 1ZEJA 2ZIEA 1JAYA 1II8A 4LMRA 4AX4A 4HWTA 3RVOA 2WINI 3V9PA 3LPLA 1KP9A 1AGRA 1T0UA 3GNQA 3HLYA 4LCEA 4BFUA 1G8KA 1U1IA 4I1OA 2O9JA 2F8SA 1L7VC 2BBTA 1JA1A 2R66A 3DOCA 2D0IA 1KOGA 2FDRA 1JEEA 4Q1AA 4AI6A 1KEEB 2GRJA 2H1FA 4LQCA 2V65A 4NATA 4Q19A 1RI5A 3LNCA 4P83A 1RJ9A 4YBZA 1H66A 1OZ0A 1AXGA 4X20A 1GDHA 1TYAE 4IXDA 4J03A 3AXSA 5EHQA 3WNBA 5LQRA 2V7PA 2YWDA 4GRAA 1TECE 3MYRA 1YS1X 4DB2A 1L4FA 1WXQA 2Z4RA 3K0AA 4EF6A 3T7KA 1VE3A 2XUDA 1N8NA 1PQUA 1Q3KA 3ETNA 1MC8A 1V0JA 1V47A 3BAFA 2ZVDA 3VC1A 1GRRA 2QE6A 1XQWA 4OHBA 4JI1B 2BGJA 1PDWA 4QUBA 2A8YA 1KGSA 3HU2A 3K16A 1OLOA 4E12A 1M3SA 1MTZA 4P5DA 1C4KA 2RGGA 3VO8A 1KYVA 1NR7A 2Y1LA 4HRYA 3TLGA 4DLAA 3HYNA 3S8MA 2OP0A 1Q1NA 3NT4A 3I8XA 3IUBA 4RACA 4ARCA 4J2OA 4RO0A 3WC4A 2PA3A 4UVGA 4LRYA 1PZXA 3V42A 4BO6A 4EDFA 1YS4A 3JQDA 3FUWA 2N75A 4HDCA 5IWCA 4JX8A 4XA8A 1CZUA 4OI1A 3RRZA 3HUFA 2JDID 3RYFA 3V8MA 2GPAA 4QDOA 2WJWA 3FM9A 1VRWA 5CVUA 2DCMA 3OCJA 3NIWA 1CIVA 5CM2Z 1YBFA 1VB3A 2BLLA 4PF1A 2BEWA 1M1YA 4U2EA 4DXAA 3UJDA 4FYVA 3V8RA 3ICCA 4EG3A 1P8AA 3M6FA 2KS6A 2XKJE 3KWFA 4ISCA 4PTLA 3ZWPA 3ICVA 2Q5EA 4JJGA 5KJFA 2IYYA 4P4SB 1DBSA 1TYBE 3BGWA 3AP1A 3TB4A 4QIHA 5JY6A 4UMEA 5AKEA 1PVOA 2QPTA 1L7XA 1XTSA 2DPMA 3A1SA 4PSKA 4UNNA 5BQPA 4XJVA 3S2FA 2MYPA 1HFKA 3L77A 4I4LA 3ZNQA 1I01A 2GAAA 2R44A 4K40A 2HH9A 4ENTA 1JUDA 2B30A 4ZRMA 1TOAA 3W9BA 4C7MA 3RFUA 3OX1A 2XE7A 1R37A 1R4NA 5FT9A 3ZWMA 2VCEA 4I0WB 4Y18A 2CN1A 4BL5A 1JG7A 3EPHA 1KY4A 3GZ4A 4DDKA 4PNPA 2HDHA 2ZFUA 3I6QA 3UWDA 4PG7A 2WFZA 3LDHA 2E2WA 1O8CA 3JQEA 2Z6VA 4JENA 3GX1A 3S2GA 2C7OA 5BN1A 1Y7IA 2ZB3A 3VDMA 2FWPA 5JH7F 1Z0UA 1L1RA 2FRDA 1A82A 2VAMA 1DDIA 2VYFA 3QOYA 5K3FA 1NXTA 1XYGA 3CF4A 1ZMTA 4B2YA 2EZ9A 2BR4A 1ZN8A 1WUHS 1TQ8A 2QG6A 1EDEA 3A0RB 3G0OA 1RLIA 2I1QA 4MVJA 2JEZA 4MVJH 4R84A 3SHWA 1G19A 4B87A 2ZR8A 1U0GA 3UT5A 3FNBA 2QSZA 2R2AA 1SCUB 4I6EA 2OA0A 4NAHA 2P2YA 4GEKA 1ZC3A 3VU9A 1A76A 1SVUA 1Y8AA 3RS2A 3NP7A 1DMSA 2DH5A 3RH0A 2PS9A 4P58A 4E2FA 4LJRA 2CB0A 4OAQA 1QIDA 1Q83A 2IEYA 2Z3VA 2NG1A 2V6BA 2X40A 2IZOA 3P5SA 3WLMA 1H4TA 2AXQA 2X7HA 3KZXA 4TMYA 4UHJA 4UU1A 4QNRA 3TZQA 1DI0A 3HYSA 1A1SA 3L92A 1X7GA 2RC6A 2WKRA 3FMPB 4S1NA 2IKQA 5KYUA 1OH5A 1H3FA 2PZGA 5LP6F 4BTEA 2Y92A 2ABWA 2R4UA 3LM8A 1H2WA 1OHHD 2AF4C 3WLJA 3HJRA 4JYPA 3NIGB 1Y3FE 2EFEB 3QEMB 2ID8A 2DUJA 3EXFB 4QPCA 4RD4A 4D0RA 3ZCTA 2DFPA 3R4VA 1TI7A 1G20B 4RS4A 4MEJA 2ZTSA 4Y9TA 3GJSA 4LMBA 4DA6A 2GETA 3L18A 4QTXA 2AZXA 3DE7X 2BFBB 2PUVA 2E1RA 1J56A 4OJKA 4F21A 3KAPA 3CWQA 2QDXA 1CUGA 2X5JO 2YIJA 3WJ2A 4U00A 3V7WA 1DDGA 2CUNA 1NGSA 1DT5A 1U6JA 1GQQA 5HM6A 2PKQO 5DTMA 3TMKA 3LZDA 1NNI1 1T5DX 3E18A 3QGMA 2QP3A 3NNSA 4WBSA 1XKTA 2NTYC 5JCJA 5J2TA 5KDDA 2IU0A 3K0AB 2WZBA 2MSNA 3MUOA 4EAAA 1F7UA 3NPMA 1ZM9A 3HDHA 3MW8A 5L3QB 1UL1X 3HA2A 3SZRA 1J5EB 2XVXA 3GRAA 3PDHA 5GV8A 1BDBA 1L5WA 3K35A 3ENQA 2VTBA 3BH7A 4EY5A 1R9MA 1KF0A 3GAZA 4UMDA 1DG9A 1PEAA 1U3UA 2RAFA 1A3CA 3F2VA 1VFNA 4PE5B 1ZC4A 2NGRA 1K4MA 4QJ3A 5LXTA 1E9AA 4X8MA 1OMOA 4CMEC 1ITZA 2BRUA 4YECA 3MTDA 4MGKR 1YQGA 3JASB 4W82A 3L8CA 4Z54A 5B7GA 1NQOA 1CUCA 2A1TS 2PUTA 3VR4A 5AKKA 1TPZA 2WQZA 4ECAA 1RMYA 1VDMA 3PUXA 3WFZA 1H6BA 5LMCA 4M53A 4Q7JB 4DW8A 5JTUA 4EY8A 4UHBA 1YB6A 1WUKS 3A1CA 2IPXA 1KI4A 1KJZA 1M74A 3V1MA 1J9EA 2A3NA 3MJ4A 4XVQA 4FONA 3RBAA 2P65A 3C4JA 3LUGA 4JB3A 3SN6A 4DPMA 4K0RA 1E2NA 1KK1A 3QKRB 2ZSJA 1E2LA 2L82A 1XYVA 1JJBA 3DOIA 4J1TC 2HHLA 3DFMA 2D2XA 1MXFA 3HBNA 3EDRA 1D1PA 2EW1A 2YOHA 1UUFA 4BDSA 2COEA 3BWEA 2MWMA 2Q9CA 2YXPX 3MTBA 4QEZA 2WV9A 4ZCSA 1VCMA 5TJ9A 3VDRA 3QSYA 5E3JA 2A6PA 3BN3A 4FFSA 5FA6A 4LZPA 8ATCA 4IMJB 5C80A 1NLYA 1LSJA 2A0FA 4YHHB 2PZJA 4IY1A 3GEEA 1OKKA 2ZOSA 4BPBA 2AI3A 3AEXA 2Y0BA 4LW8A 3DWIA 1JQEA 2MTBA 4UMFA 4G1UC 4BVFA 1YS2X 5AI9A 1ZJYA 1IUPA 2P9TA 4ZVVA 2XVMA 1TM1E 1DAKA 1QZUA 2PR2A 3HZOA 1FNMA 2H8GA 3GDOA 4GSKA 3VYVA 1GPLA 4XQEA 1K5HA 2UXDB 3EPPA 3QLEA 1V8PA 1BGVA 1L5LA 3OT5A 4M1WA 5C18A 1XZPA 3OJOA 3W06A 5JBNA 1XZMA 4GVLA 3OQPA 1AZSC 3CNNA 4Q1CA 5JG7A 2WE8A 2J9RA 3JQBA 3LWNA 1E0KA 1V7ZA 3BE8A 3MBOA 5C31A 3ZBPA 1E5LA 2OHOA 1D2CA 1YHNA 4MQ4A 1YDHA 3ZN2A 4TYMA 2AZ4A 1OKKD 2JARA 2W6QA 2WU4A 4A1FA 4BFWA 4AY2A 4A8TA 5EKSA 3CWCA 1VXRA 4TVBA 1BOOA 2ACKA 4A73A 1DOZA 2LTAA 4S1OA 1W5BA 4AUEA 2MDTA 2P4UA 2YL2A 5HF6A 3AR4A 4GZ5A 1S3SA 1V16A 2NAPA 3BK1A 3PNVA 4YT8A 5IZ4A 4A5OA 1Q1GA 2R47A 4RIHA 1KFBB 3A1NA 5B53A 3O8QB 4EDHA 5B5SA 4MVWA 1NUHA 2O1WA 3P8ZA 4QJBA 3TSYA 3MRTA 1R00A 4PZDA 5CXXA 5LNK6 2R6DA 3M3HA 4JBXA 1RWMA 3PNBA 3RJMA 5C35A 4Q3KA 2G09A 2Q50A 2ZE6A 3P0RA 3QKSA 4FSHA 4IWYA 2FMFA 3QLUA 2WNSA 2ICAA 3AUYA 4W1QA 2DPHA 5DYWA 5J40A 4Z7OB 4LY3A 2P6PA 1YL6A 3QPDA 5AM1A 1JHZA 1Y9AA 5HS6A 3T5TA 3NOQA 3VSAA 1G5RA 3DC2A 1D1SA 3N3BC 4GI3A 3USES 4AVYA 3FXAA 4PY2A 4JODA 3EDQA 3PT9A 1EGQA 1Z33A 3UB2A 3C97A 1FJXA 1Q74A 5IJWA 4ZEMA 1QE3A 2J3HA 4I50A 5L7WA 221PA 2D00A 3ES9A 5KVVA 3FPHA 1I4LD 2FZCA 2HIGA 2HO4A 3M9XA 3DT9A 2IIPA 4X6YA 2JHCA 4J0EA 2GNPA 2ZTUA 3ZHYA 4DEYA 4V39A 5EYPA 5LYJA 1H4SA 1DJNA 1EHYA 2O2GA 2WG1A 3NBQA 4MWTA 1SVIA 4TYNA 3TQCA 3VTFA 3K9NA 1U0EA 2BV3A 4MNTA 4B47A 6REQA 1N78A 1GGEA 1E89A 4WJKB 5G0VA 3A6KA 2O2HA 3RRFA 5IK2D 2XDAA 2JVJA 4UTPA 4A2CA 4EM6A 1XQVA 1LJLA 3QITA 1XRRA 1K6XA 3DNMA 1NASA 3OZTA 3TRFA 2J6IA 4U2FA 1N6OA 1Q1AA 1Z8FA 2R8XA 2BVNA 2PKYX 1TM2A 3RC9A 4BC0A 1MABB 4PG8A 4YMVA 3UH1A 3BT7A 1YDFA 4TWRA 4N39A 5FQNA 4V24A 4Q39A 2V7QD 2XCLA 4MIOA 2EFJA 2CDCA 2CXQA 4PN7A 1T8PA 7REQB 1A4UA 1CJKC 4Z5XA 4K0KB 3QX9A 4DY6A 4HNTA 2Z5LA 1NJ2A 1ARZA 2SCUA 4JMPA 1M8PA 3V1NA 2ORIA 3ISJA 4ZZ0A 5MN5A 1R5JA 3HJBA 1YFJA 5LP6C 2LVBA 1QRSA 4FDTA 3QFHA 1QWOA 3QHPA 5AVZA 3H42B 3CZ4A 4HYYA 4YJ2F 3A4TA 3R4CA 4MWZA 5HMMA 3WRYA 4YUZA 3KEFA 3DCIA 1CR2A 2P2LA 1FPMA 1SHUX 5FV7A 2QE7A 2A1UA 3P26A 1P1FA 4H0FA 4JHLA 3VNRA 2JH9A 3GI1A 4DMUB 4RF5A 2C94A 1ORVA 1WO8A 4OLAA 2FUG1 2XMZA 4C2BA 1Y3BE 2JFHA 3AJ8A 3W8DA 1DQRA 3RJ5A 4Y1FA 3L82B 3MELA 4OOEA 1M83A 1KETA 2EJTA 2E87A 3AUXA 3CZQA 4JL8A 1SXJC 4ZICA 1HE2A 1NJ1A 4FOOA 2PUGA 1E18A 4JLWA 4BO5A 4A36A 3ZWKA 4BNVA 3F9CA 2NV6A 4OBWA 3UGTA 3IMGA 3AM4A 4BKMA 5K1SA 1SELA 3AEQB 5IUJC 4EVSA 4FS3A 1FVFA 2P9YA 5EA2A 2ZUFA 2HA6A 5AJUA 4ZQBA 4I55B 3F47A 2NNLD 3CF4G 2QZJA 2QV0A 2FFQA 5CH8A 1B0ZA 3V5NA 4I99A 2V6MA 1OR8A 3OEEA 4L4SA 2JAPA 2JBWA 1NF8A 2I7TA 3ECCA 1JR4A 4LRTB 3TAHA 3AFMA 4EZEA 1GFIA 1KSHA 5LQDA 4B4DA 2XMPA 4C0SA 4CV1A 2O1XA 4MVXA 3SF0A 1JBEA 1P17A 1JR3E 2GXSA 2C2KA 2J31A 4HQNA 3WGKA 3F6RA 2VA8A 2XUIA 4C43A 3ER9A 3ETHA 1L4GA 5KJ6A 1IOZA 4I5EA 1SOAA 4ARIA 1SRRA 4WCFA 1ZGGA 2GD1O 2PKWA 1XP5A 1RFGE 3WRXC 2BGWA 5FBHA 2ZWAA 3E35A 4RJLA 4BEWA 3V4PB 3WRXA 1Z16A 4OQ4A 4QELA 3JR7A 1WV0A 4OG2A 4P3PA 1ULHA 4AKIA 2P40A 4YN3A 3ADDA 3DMFA 4OA5A 1DFGA 1WKVA 1BN6A 5B3LA 4YDQA 5C53B 3BBLA 2IYEA 1UT5A 2Y2VA 4XKJA 4NDNE 4MQFA 1UWCA 4FIZA 4O2LA 3WXBA 1JYSA 2JKZA 3C3EA 3TGWA 1B0PA 5DDIP 2O19A 1A2KC 1CSEE 3BMCB 1X13A 2ZJ6A 3GEBA 3JYQA 1ZAYA 2X9NA 2QN1A 2HWUA 2G40A 1BAPA 2HQ1A 1ZOLA 1FNCA 3N75A 2W4QA 3K5IA 4GR4A 4LJKA 3Q7QA 1N6HA 1WXGA 2I71A 1CR0A 2BD0A 2VXCA 1YB7A 1JZTA 2ZRQA 1TC1A 2QUBA 3DZCA 3ETEA 2WWFA 2JRCA 1U8YA 4RLQA 1AKMA 3EE6A 2ZSIA 3LHIA 1J22A 4I55A 3R3UA 5D51S 3CPHA 4INAA 4ZJUA 3NEJA 4F8JA 1GR0A 3EDYA 4YT2A 5L6MB 2VPQA 4PQRA 5COBA 3LP8A 2G1PA 4EUNA 1EYZA 4I9FA 3DTYA 4IEIA 5A4KA 4ZREA 1ILEA 3ZKWB 2VPWA 4LJYA 3WLLA 4B32A 1KEKA 1ENOA 1L8XA 2C92A 3I9OA 5AJZA 4LHZA 5F2EA 4PCLA 2E5LB 3T9EA 4AP9A 5FLEX 4KIWA 4CMCA 1VJRA 3KNZA 1P91A 5EE5B 1IC6A 2GVZC 3C45A 1F2UA 2SBTA 3VZPA 4F92B 2HFKA 4QDTA 2P6NA 3FRHA 4KX5A 2QRMA 3OQJA 3I92A 1G7SA 2OV8A 3QE2A 4ZOLA 1X1RA 5U1PA 4JJAA 2OAGA 5DWDA 1AOXA 2QG4A 5DHRA 1CDEA 1H42A 2DQKA 3LHKA 5EZYA 5BNFA 3V7UA 5J2UA 2ADFA 2BGLA 3FCAA 3PPIA 3R0VA 4OB8A 1DC4A 3E1GA 3AKCA 4DCCA 3RTEA 4JJEA 2HU5A 4PQGA 3TN7A 2EGHA 1E62A 2EZUA 3L0CA 3PDWA 1P4RA 1M2VB 1J4AA 1G1AA 1Z0FA 4NBVA 5DTEA 1JILA 1TLTA 3CX4A 2UUCB 1VYHA 3EC7A 2R5WA 4HDNA 1KL7A 1U8FO 2I8LA 2PGIA 2Q28A 3GMIA 4LGYA 3A6LA 4WKNA 3KZNA 4ZT2A 3TQFA 3ZXXA 5H70A 4E0BA 4Z7NB 2D0PB 1T3TA 4KZKA 1QGOA 3EZ7A 3R1IA 2ACVA 2PTHA 1SUDA 3G02A 2Z8ZA 1KOLA 1UMCA 3OKFA 5KSPA 2FF7A 5DHPA 3HA3A 4G5RA 4FE7A 3K3PA 3DO8A 4OP3A 2I78A 1ZGHA 5DPMA 3AU8A 4KMRA 2CYCA 3EW9A 2W70A 1NW8A 4P92A 2PRZA 4JNKA 3TR5A 1NVMB 4D9NA 2DETA 1HR0B 4HSEA 3GB9A 3F0TA 1SJ9A 4XPZA 5EIFA 5FR2A 1F4PA 4DEXA 3MJTA 2FUKA 5ISMA 3SX0A 4ITUA 1DV1A 3D3JA 1S3FA 2G70A 3NVAA 3P4YA 3EUFA 3PJDA 2X9LA 4DWJA 3T1QA 1TT5B 2BMWA 1NULA 1DG1G 2SCUB 2BDTA 2W2NA 4OHUA 3LGAA 5T3UA 3P0JA 4TVSA 3KZMA 1J0EA 1L9XA 3FNQA 4U02A 1KI1A 3DHYA 3TQRA 3X1MA 4D92A 1SIUA 4ZOAA 4C4AA 4DT1B 2O2CA 3AINA 4GZ6A 4I4TB 3HXTA 4OUKX 4ZAFA 3TR6A 1OXKB 1MABA 1INLA 1UJBA 2ERCA 5T8KA 4ZVMA 1SUWA 3IKLA 4X60A 5EXXA 4BQIA 3GMTA 2I7CA 3D6AA 2YRFA 2B61A 3WMFA 3DULA 1PT9A 1S3GA 3TUJC 5BSUA 4I1VA 1QHHA 3A1TA 1C8LA 2OOSA 4R9SA 3SLGA 5CLIA 1QTRA 1VPDA 2I4LA 5KINB 2NYUA 2ZIWB 2Q6VA 3DMRA 5G53C 2VDUE 2X5XA 2QA5A 3H5RA 3WKAA 1M6VB 3VNUA 3RF7A 5IYZA 3N0TA 1U3GA 4KE7A 4X0EA 4DQVA 3K2IA 4TOIA 2CNOA 5JXJA 3JQAA 1CEEA 3E9YA 3SXPA 4Z86A 1YQXA 4DAEA 2XV1A 4Z53A 1CRPA 1KKMA 1NFRA 4EGAA 4F5EA 5JBQA 4F1JA 2XHEA 1DX6A 3KXLA 3SF8A 4D3FA 1DBWA 5HKAA 5ETJA 3OVMA 1O9HA 1NBOA 1CY4A 3ED5A 1NKVA 4R6WA 5EZSA 1OFVA 3UHFA 3V2GA 1J0BA 4JLJA 2HZBA 1X7XB 4J7CA 4P7GA 1YKSA 3PR1A 4U63A 3H4MA 3WJ1A 1C50A 3ZIDA 1KQPA 4JCCA 1TIPA 2Q4DA 2V0GA 4IDPA 2JIBA 3VHLB 2NT4A 3FMVA 5JDIC 3VVCA 2QWXA 3NOVA 5A4JA 5E6SA 3B7GA 2WF9A 2AV6A 3JQ7A 1FU8A 4RDXA 4PZEA 4LXUA 2RGCA 2Y0DA 3VHQA 4Z3DA 3B6JA 3BMQA 1ZCJA 4YMIA 5K8IA 3WNDA 3BIXA 4UULA 2QX8A 4HJRA 2QPAA 2CFIA 2VL7A 5H0IA 1WR8A 2ZP1A 3B3FA 1G3QA 1J7KA 1IOVA 4JJ7A 1VZ3A 3SVZA 4H2DA 1USVA 4G26A 5FD8A 3OEYA 4QOEA 1M8JA 2WTNA 9MHTA 1NY6A 3GEDA 2I91A 3RSHA 2XKAA 4MSUA 2R4TA 4PYRA 3ASUA 3E9EA 2UYQA 1V7QA 2QVXX 3LWZA 4UZSA 4BFYA 2BH9A 1SBCA 2I66A 3DTNA 1Q7GA 4Q4HB 4ZQCB 1PSDA 3QHQA 4R8VA 3NT2A 2AEMA 2AMFA 5DGIA 2G4VA 4NEGA 1AKWA 5FXMA 3PWTA 1A27A 4CMGA 3OT1B 5EJ6A 3UBTA 2C77A 4I14A 5H02A 5B6JA 4S05A 3VZRA 3OX4A 5LDDC 3CVWA 1KYWA 1GZVA 3BHIA 4S24A 2IWHA 4S2EA 3RSOA 1Z08A 1K0FA 4BP1A 5BVGA 5UKDA 1V7CA 3I0ZA 5B36A 1TM4E