3WMBA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with naphthalimide derivative q1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTLHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERFVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase
publication title A crystal structure-guided rational design switching non-carbohydrate inhibitors' specificity between two beta-GlcNAcase homologs
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wmbA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3wmbA01
5HXMA 2VX7A 1BVZA 2WLZA 5I79A 2VO5A 2WMFA 3IK2A 1V6WA 3MKKA 4R5EA 1ZBKA 2CBUA 4HZ7A 3SUTA 5A8MA 1EDGA 3PZ9A 3SCWA 4QLLA 4LXFA 4J3SA 5AY7A 5IDIA 1M53A 2XWDA 5JBDA 1J11A 3NSNA 1E1FA 1R85A 2BY1A 3EMCA 2WHJA 2BY0A 3IJ7A 1RP9A 1NQ6A 2VX4A 1QI4A 2WCGA 2VTFA 1UR2A 3AXXA 1UZ1A 4PTVA 4JAWA 3WD1A 1GQIA 2WC4A 4LGXA 2YDQA 3F5LA 3L4UA 3EBVA 2C7FA 2Y8VA 1GJUA 4C7GA 3WH5A 3FY1A 2OWCA 2WYSA 5JIPA 5KEZA 2ZIDA 1OIFA 1JZ7A 2UY4A 4BCEA 1V3JA 3F4VA 1DWHM 2IXVA 1UD5A 3W4RA 3CUJA 1LJYA 4M29A 2J4GA 2D3LA 1GOMA 3B9EA 4CN1A 4M8UA 4AD1A 2VNCA 3MSDA 1E4NA 3AIBA 3VDAA 1XYFA 2RGLA 1Y7VA 6A3HA 3OIHA 1E73M 2DSZA 4CN4A 7TAAA 2JIEA 1UA3A 4WLCA 1XH1A 1FH7A 4OOUA 2XGIA 1W3JA 1JFHA 1EOMA 2VT0A 1U2YA 4AZCB 2VQUA 3I3DA 1W1TA 1QPKA 1LF1A 4FLQA 2WBKA 3NIYA 1F4HA 3ZT7A 3SUSA 4UQAA 3WUGA 1UD6A 3I3EA 4U31A 3VD7A 2EPOA 2YOCA 4ATWA 2WZHA 1UWQA 1MW2A 1PAMA 1AQHA 1RP8A 3VO0A 4IPNB 1J0KA 2O9RA 3WH8A 3M7SA 2XIIA 3WDHA 3TTYA 1JL8A 1W2VA 4AIOA 4ACYA 4H7VA 1ISWA 2NW0A 5A2CA 2F8QA 1HN1A 1ISXA 1CDGA 1J9YA 1CXLA 4C7DA 1BAGA 5A2BA 1OSEA 1H41A 4DUWA 3WELA 4PCSA 1VENA 3WUFA 5AYIA 1MFUA 3OG2A 1HNYA 1GOQA 4JFWA 4JFVA 1V0KA 1WKYA 4F66A 1CPUA 3POHA 3MUIA 4JHOA 1KQYA 2ZOXA 1UD4A 1W3KA 3K4DA 3VDHA 1TFVA 2OSYA 4GIAA 4U3CA 3WFZA 3FAXA 4TTGA 1N82A 1OT1A 2XSAA 2XYLA 2J8GA 3CTTA 1GONA 5M17A 1LL4A 4P7OA 4J3WA 5E09A 3BLKA 4YN5A 1JI2A 4GQRA 3OLEA 1MQPA 4DWSC 3ARSA 1CBGA 1QNOA 5CGTA 3AHZA 1CNVA 2DSWA 4CU6A 1E70M 2DGAA 3VD4A 4HMEA 1CYGA 4FLSA 1C91A 1KCKA 4NSBA 1HJUA 3AIRA 3ZT5A 1V6VA 1FH9A 3TP4A 4CCEA 1CLXA 3PZTA 3ZJ6A 5LA0A 3DYPA 2ESCA 2Y4SA 3TTSA 1OWQA 3AICA 2OSWA 1HJVA 1W91A 2WHMA 3AIUA 3RDKA 5CLTA 5M5DA 5CSUA 3APGA 3W53A 1BG9A 3T2PA 3SCQA 5A3HA 1AVAA 2XVGA 5JIWA 1WPCA 2JF7A 4WSKA 1G01A 2EPKX 2J47A 1X6LA 1VJSA 1JZ4A 1J0YA 3SUWA 1EQPA 4YHGA 4Z2IA 4EK7A 5BYWA 1UD8A 3AI0A 1OBAA 3EDFA 3WIJA 3WMCA 1VB9A 3F5KA 2ZX6A 5CJ5A 1E4MM 1X1NA 4AD3A 3EDEA 4D6JA 4M24A 1HVQA 2VOTA 4Z2HA 2J25A 5IFPA 2J74A 1SMAA 1HF6A 5I2UA 5CG0A 4D1JA 4AY1A 2GDVA 4W7WA 2QHAA 3THDA 4QCEA 5ECUA 4BS0A 3A3HA 1JYWA 1EHAA 2CBVA 2OYMA 5HNNA 2VZUA 4OUEA 1BYCA 2VX6A 2ZX9A 1K9DA 3VU2A 1W2PA 1TA3A 4ZENA 1ECEA 5IFTA 2QMKA 3W6LA 3L4WA 4ATDA 2DH2A 2GJPA 3WD0A 3A4XA 1PIGA 4IISA 3AZRA 3ARXA 1C7SA 3UG3A 2UY5A 1B3XA 1NWUA 1E0VA 4KRUA 4C91A 2ZX7A 4J3VA 3VM5A 3RJYA 1OB0A 2OWXA 2DT2A 3GM8A 3PZQA 1UR4A 3ZMRA 5I24A 3VIFA 4AISA 2VZVA 2WMIA 1V02A 4MJ2A 3PBGA 1H1NA 3SURA 2X09A 3BAJA 2E9MA 5D8WA 5ABEA 1V02E 1WDRA 2XSBA 3KZSA 2WW5A 5CGMA 2F61A 1Q6DA 3WNKA 4A3HA 4EAMA 2W5FA 5HPOA 1V3HA 4DUVA 2WWCA 4GI8A 1GVIA 2ZUSA 5A94A 2O9PA 1EXPA 2HISA 5D9PA 3VGGA 4V2XA 4MB3A 1J01A 1B3VA 3WKZA 3K1DA 4EE9A 2J78A 1KXHA 1BF2A 3M46A 1QHZA 1JAEA 4PCTA 1XGZA 4UZSA 3UG5A 5CPTA 1YQ2A 3AIVA 4UTFA 4JFUA 5KZ6A 1WO2A 3U7BA 1A47A 1BQCA 2CETA 3QHNA 2AOSA 3BMVA 1TCMA 1DEDA 1UWIA 3SEPA 4U33A 3CPUA 2WVSA 7CGTA 2WCSA 1BPLB 1C3FA 1B31A 1HKJA 1CGWA 3ARWA 1W3LA 1E3XA 3CMGA 5DT5A 3OGVA 2G8ZA 1XC6A 4HOWA 1UWSA 4W8AA 2X1IA 4GI6A 4NF7A 1HKIA 4QCFA 5LA1A 1UOKA 5A6JA 2FGZA 2QF8A 3VGFA 4JCMA 3L2MA 4DWSB 1GOWA 4GZEA 2XG9A 1FFRA 2CHOA 3CIVA 4HP5A 2WVVA 1NWRA 5A95A 4B9YA 3LPFA 2EXOA 4OOZA 2A3HA 4YPJA 4UOQA 2PI6A 2VZOA 2AAAA 1JNDA 3GNPA 4YHEA 4QLJA 1TZ7A 5A8PA 5I78A 1NP2A 2WK2A 1UH4A 1V3MA 1PZ3A 3AS0A 2NT1A 3AHTA 2WBGA 3OZPA 4MNKA 5JUVA 4D6DA 1TVPA 2VRKA 5FKYA 2XPKA 1KXTA 2PBGA 1XD1A 4W8LA 2G4FA 1FH8A 3WSUA 1UKQA 3B9AA 1GORA 1P6WA 2XJ7A 4CD8A 4DWSD 4HU0A 4XV0A 3ALFA 3WQ4A 2YL9A 3VPLA 4WKHA 3MMUA 1EIBA 5E9AA 4XB3A 2YBTA 2EEXA 2BHZA 3FHQA 1W1PA 5GNXA 3UG4A 2IXUA 2JE8A 3D5HA 3ZQ9A 1E5JA 5BRPA 5M03A 2BVTA 1UH2A 1E0WA 4AEEA 3WL1A 4NRSA 3DC0A 1U30A 1EA9C 4UOJA 1Q6EA 1DWGM 4ZXLA 3SCSA 3EMZA 7A3HA 3A47A 2ZXAA 3AS3A 4CCDA 4QLKA 1H11A 4HZ6A 1JFXA 2J7HA 4UFJA 3ZT6A 3WENA 3RJXA 1RPKA 3D3AA 4P8UA 1J0ZA 3FXYA 4BA0A 1HL9A 3MS8A 3AXIA 1F4AA 3DECA 3L4YA 2E8ZA 1VFFA 1NH6A 2GVYA 1WNOA 4P8WA 5LA2A 2BY2A 2VI0A 1IT0A 2V5DA 1V6XA 2CYGA 1OGGA 1V0LA 2CKRA 1TUXA 4GO8A 3WMSA 1H09A 1PPIA 1MW3A 1HKMA 1U33A 1W9UA 1QBBA 5GNZA 3AXHA 3W38A 4A3YA 1TE1A 2V3DA 3NUKA 4R27A 3GBDA 1KR1A 3VUPA 2E9BA 2J75A 1EOKA 2VVSA 1V08A 1EH9A 3NCOA 3DHUA 1MW1A 4PMZA 1TR1A 4HA4A 1CLVA 2ZXBA 4DM1A 5CSYA 1Q6GA 4UCFA 2E9LA 1GPFA 1VF8A 1UD3A 4W89A 1PJ9A 4H2CA 3VGBA 3WNPA 4JKMA 3T0AA 3EDJA 1FP8A 2CXGA 2E0PA 2V3FA 3AHYA 2DSKA 3BXWA 4TXEA 1H5VA 3N1AA 1E40A 3VD5A 2JFEX 4AZ6A 2WKGA 3B8SA 1OM0A 1FHLA 4UFIA 2G3NA 4P7RA 5DMYA 2J8FA 2WVUA 5EFFA 3MUAA 4Z2GA 1VFUA 1CXEA 2DIEA 1HP4A 2VMFA 4GKLA 1V6UA 1K6AA 3WF3A 4E8CA 1EO7A 4KH2A 1UR1A 1R87A 3O2LA 1AQMA 2WANA 1W1VA 2J7DA 2DT1A 3CZLA 1D2KA 2D0GA 5CZKA 1NARA 2VZSA 1V0NA 1LL6A 4AMCA 1CGXA 4D6IA 3ARUA 4B3KA 4HOZA 1MVYA 4MNJA 3QR3A 2GJRA 3SCTA 1J12A 2FHFA 4Q22A 4HU8A 1QW8A 3ZR6A 3OA5A 3OLDA 3SUUA 4XX6A 1NOFA 5A6AA 2WXDM 1HJQA 3T09A 4UR9A 1KGWA 4D6HA 5JBEA 3GTNA 1GW1A 1KFWA 1Q4NX 4XUYA 1E56A 1LL7A 3ZSSA 5A8OA 1V3IA 2X2YA 3U7VA 2GK1A 3CHCA 1JZ3A 1ITXA 4AYSA 1BYDA 1H49A 3VIPA 2UY3A 1XV8A 2GUYA 1WB0A 3GNRA 2DSUA 1EDTA 2YKKA 4GZIA 4N0RA 4Z2JA 4JCLA 4CD4A 2VURA 1JYNA 2XVKA 1OCQA 5EB8A 4AIUA 4W87A 3WBEA 4ML4A 5HOSA 4PMYA 4PTXA 4UFMA 1VBUA 4U2YA 3I3BA 2YA1A 4U3AA 1B1YA 1DTUA 2X0HA 1HXJA 4PMOA 3NDYA 2YDSA 3BAWA 4MAVA 1MYRA 1ZBVA 5I0DA 3NSMA 5F7UA 1GQKA 1GNXA 4L4PA 4TTUA 4UQDA 3GZAA 1MW0A 1DWJM 3EDKA 5A6LA 4HOXA 2JF6A 4W85A 2X0YA 1B2YA 4HA3A 4ZEPA 3KE0A 3WQVA 1CXHA 2WLYA 5ABFA 3WD2A 4X0NA 4AC1X 2QV4A 5BWFA 4IUGA 2ZXQA 4NZCA 1WDPA 4U2ZA 3FW6A 3IJ9A 4UNIA 1WDSA 2ZWZA 6CGTA 3BAYA 4CU7A 4PMDA 3UR8A 2GSJA 2VR5A 4KGLA 1CENA 2JEPA 1K9FA 1E71M 3KEHA 3VDCA 4UQEA 3WF0A 1WZLA 2EPMX 1EQCA 1B3WA 1G94A 2ZUUA 1KXQA 2V3GA 1KWKA 1CGUA 2D23A 4W7VA 3MV01 3PZGA 3QHMA 4PMXA 2Z1SA 5D9MA 4TVUA 3CUIA 2EJ1A 1BGAA 3WQ5A 4NI3A 1TA3B 3B9DA 1UR0A 4H41A 1E6ZA 1AMYA 2O9OA 4GXPA 4OZOA 4P8VA 4URIA 3K8LA 1DHKA 1CXKA 4H8VA 1XCXA 4GQQA 2B31A 3ARRA 3WFLA 1JYVA 3VILA 1H0IA 3K46A 3SCRA 1GHSA 3PN8A 1ISVA 3BMWA 4GO9A 3T2OA 4AD5A 1ODZA 3OBAA 3CMJA 5A6BA 9CGTA 1UD2A 2EBNA 1E0XA 3PZVA 2RGMA 2WMIB 1QI5A 1GCYA 5D9OA 1GZJA 3BLPX 1KB3A 4CVUA 2A3EA 3WN6A 1W1YA 3AS2A 3ARZA 2XTKA 5FL0A 1HIZA 5CPQA 3JUGA 1CGTA 1MXGA 3W82A 2VCAA 2DH3A 3WEZA 1E4LA 1I1XA 2XIBA 1JDCA 4AW7A 5D9NA 3TOPA 3AMGA 4AD2A 2OLHA 1WZKA 4AEFA 3WDJA 2XGBA 4AZBA 4P7LA 1C7TA 4D6GA 1NM9A 1QVBA 4CU8A 1CGVA 5JBFA 2MANA 3SCNA 4W5ZA 4PUEA 2Y8KA 4Z2KA 3ARPA 3MANA 3AZSA 3NYDA 1PX4A 3PZNA 4RE2A 5AC5A 1MWOA 2ZUTA 1HP5A 3POCA 4GINA 4V27A 4E2OA 1L8NA 1B0IA 1E72M 4EKJA 2YA0A 2VRJA 1UG6A 1CTNA 1J0IA 1QHOA 1JG9A 1KGXA 3CZGA 4MADA 4U5IA 3ZIZA 3CHEA 4CD7A 4MPKA 5I77A 2YLLA 4LYQA 3LPPA 2V38A 4OJYA 4JZ5A 4C7FA 3ECQA 1CECA 2BV9A 2J62A 1JNEA 2VC9A 4JFTA 1CWYA 4B3LA 5I23A 4KGJA 3IAQA 3GDBA 4K68A 4L4OA 4AD4A 1PIFA 1EO5A 2Z1KA 4DUXA 2WSKA 2XFYA 4UQCA 3VNYA 3WDRA 3W26A 5CLWA 3WNNA 1VAHA 3L2LA 2WVVB 4JKKA 3BAXA 3IANA 2CPUA 3S6TA 3N13A 4W5UA 1EGZA 2WMHA 5DFAA 3RMEA 1NWSA 1RD6A 5A6SA 5EFDA 3F5JA 1OT2A 4XZBA 8CGTA 1VEMA 5IHSA 5DEZA 1J18A 5E70A 1R7AA 5I6SA 5A69A 4LYRA 3L4TA 4M81A 3AIWA 1FP9A 1JXKA 2PF0A 1VBRA 4PUDA 3W37A 4PTMA 1V03A 2J7FA 5A6MA 2C0HA 2WAGA 3BAIA 2VUYA 1SYTA 4MNLA 4U5KA 1OIMA 4PYSA 4BQ3A 3AIEA 2BVYA 3FN9A 1HJWA 2VJXA 2D24A 2CBJA 4AIEA 4WF7A 2BNJA 2WMGA 1KR0A 3EYPA 3VDBA 3MUZ1 3A4AA 1NP0A 1X6NA 1O7AA 1KGUA 1O6IA 3T0BA 1SR0A 1UKOA 5LYRA 4UQ9A 1DWAM 1FFQA 1E9LA 1RH9A 4MDPA 3VM7A 2YL8A 1E1EA 2NSXA 3DYMA 1B3ZA 2OYLA 1MXDA 4BQ5A 2GJXA 5E6YA 3RCNA 5AC4A 1J0JA 3WH9A 2DEPA 1OD0A 5A2AA 2PWFA 3ZOAA 1QW9A 5BXRA 1UR9A 3PTQA 3PHAA 4ACZA 1HX0A 2J79A 2CITA 3WNLA 1E6XM 1DWFM 1UQZA 1GVYA 1GOIA 2ZWYA 2DT3A 1M01A 3N15A 1VFOA 1PX3A 4H04A 3SUVA 4J28A 4RE4A 2PWGA 1E5NA 2A3CA 1ZB5A 3NSXA 1JZ8A 2VRQA 3VX0A 3QOKA 4FLOA 5FD0A 4S3JA 3VIMA 1VJZA 4ZFMA 2FH6A 5BXPA 2BS9A 2BHYA 4ZXOA 4D6CA 2W66A 3OZOA 3WD3A 3MU7A 1JGIA 3GYCA 2GFTA 3RM4A 1LG1A 3EMQA 4X0VA 4UFHA 1M7XA 2V5CA 3NDZA 2PC8A 4HZ8A 4GPNA 1CIUA 2XM2A 5AYBA 3WQ8A 3VX1A 2D0HA 2PBOA 2BXZA 1IZKA 1UZ4A 4CGTA 2PB1A 4UOZA 1D3CA 1JF6A 1XSKA 3CO4A 2W67A 2UY2A 2CESA 1PZ2A 1US2A 4WIWA 1QI2A 1C8YA 1E15A 2E3ZA 2PWEA 3AIQA 3AZTA 1PEZA 3N17A 3TONA 2BHUA 4MB4A 4BQ2A 1YHTA 4CD6A 2WSPA 2GDUA 4MAZA 2W91A 3VD9A 1UR8A 1R8LA 2J7BA 1MQQA 2WZIA 2CBIA 3KWXA 1BYAA 3ARYA 1QOXA 4QAWA 3WUEA 4E8DA 4JL1A 5D8ZA 4BZYA 4F79A 4MTVA 2WNWA 3VINA 2W92A 1B9ZA 4S3KA 1L0PA 2BXYA 1G1YA 4W93A 5HDRA 2FHBA 3VTRA 3WL0A 2G3MA 4D6EA 4E4PA 3U57A 3GH4A 1DWIM 3L4ZA 2YLAA 1LWHA 3G6MA 4HA1A 4AXNA 4N42A 1MQRA 2AMGA 1JAKA 3M07A 1NOUA 4PMRA 3OLIA 3CHFA 3ZSTA 4HPGA 3N9KA 3WMBA 5C70A 2WWDA 2A3AA 5BCAA 3S2CA 1UWTA 1KWGA 2O9TA 4OKDA 3W27A 5A8NA 3VMPA 2ZUMA 3CLWA 1LG2A 3IAPA 4PBGA 5I5RA 2DSVA 1G9HA 1W9VA 3WEMA 1XSJA 2HVMA 1BLIA 5GNYA 3TA9A 2CNCA 4J27A 1W9XA 1BFNA 2D20A 1ZU8A 3L4XA 3ARVA 1WZAA 3W29A 1XH0A 2NT0A 1ZL1A 1H0GA 2YDRA 5EMYA 4PMUA 3OGSA 1VEPA 1QI0A 1WAWA 1B3YA 2FHCA 2E8YA 5BXSA 2GK1B 1B30A 3CZKA 1W9PA 3WF1A 1HJXA 1GQJA 5GQBA 2DPEA 2XWEA 1E6SM 4BF7A 2F2HA 4OBSA 4WJXA 1ZJAA 2E4TA 4TVCA 3AMLA 2PWDA 5C8BB 8A3HA 4W88A 1WDQA 1Q6CA 1G0CA 2WPGA 2D3NA 5FIPA 4WKAA 1J10A 1NWTA 3FHAA 1XH2A 3BSGA 1HVXA 4TX6A 2X8RA 2QPUA 1WZMA 1V6YA 4PEEA 3VIGA 3FNDA 3NJ3A 4KWUA 3CH9A 3BGAA 3GXIA 1AQ0A 1W32A 5E0FA 4MJ4A 4LQ1A 1PBGA 3CUGA 2VCBA 4D71A 3FAWA 3PZOA 1E55A 2G3JA 5ABFB 3AOFA 4JL2A 4D6FA 3GXFA 1UUQA 3GXDA 3QOMA 3II1A 3UERA 3WDQA 2QLYA 3K8KA 1UKPA 1C92A 4HMDA 3BH4A 3VMOA 1VRXA 3THCA 3VVGA 2OYKA 4AZHA 4IM4A 2YIHA 3T08A 1KBKA 3AMKA 1JI1A 5TD4A 3WQ6A 2YA2A 1HKKA 1V3LA 5DT7A 2D2OA 1FOBA 1D7FA 4B15A 1HT6A 2Y24A 5FCZA 3G6LA 1XRVA 4PRWA 4AZGA 3ZM8A 2VVNA 1CZ1A 1PX8A 2XM1A 5EBAA 1UKTA 3WF2A 4MB5A 3W25A 4OIFA 2XVPA 4J3XA 4MB1A 2WC7A 1C90A 4DM2A 5HBFA 2YL5A 4D72A 2ZXDA 3WQWA 3AYSA 4AZCA 1JF5A 3WDIA 1H2JA 3WEOA 3K8MA 4PSRA 2XHYA 3PTKA 4JKLA 3UR7A 4X9YA 1S46A 1OGSA 2CIPA 1WE5A 1OGBA 3W28A 3GH7A 1BHGA 2JEQA 1G5AA 1C93A 3VD3A 3W0KA 2VX5A 1JD7A 5IHRA 1E6RA 3HJEA 1QNRA 3UCQA 1JXJA 2Y2WA 4CUCA 3LPGA 1J0HA 1JIBA 4KMQA 3UEQA 2JALA 2WMKA 1UWRA 2YBUA 1BG4A 4J3TA 1R7OA 3HMCA 5D4YA 3EDDA 3PZIA 4WK9A 5CPSA 1I75A 2IUZA 5BROA 4C90A 2ZE0A 3WD4A 2OSXA 3GXMA 3MMWA 4JIEA 5ABHA 2W62A 1QBAA 3CZJA 3MSGA 2X05A 1DP0A 3VIOA 3RPMA 3N18A 1H3GA 3VIHA 5A6BD 3BCFA 2FDMA 3QGVA 4WSJA 3WY1A 4D1IA 4A4AA 3PZUA 2EPLX 4TUFA 1KXVA 3VKKA 1BGGA 4B16A 4UQBA 1NOWA 1W3HA 1SFSA 3ZJ7A 4OBRA 1OD8A 4UFLA 3CGTA 1XD0A 2C8NA 4M56A 4FK9A 4J7RA 3WUBA 3RO8A 1ZJBA 1IZJA 5HPCA 3TTOA 1C8XA 2UWFA 1ISZA 2WVTA 3LMYA 1ZBWA 3WH7A 4HTYA 3BSHA 4CVWA 2DT0A 4FF5A 3J7HA 4F9DA 4TOQA 4W84A 3VNZA 5IXEA 2WKLA 1HL8A 4RL3A 1ODUA 4HMCA 2D22A 4XZWA 3HU7A 4B9ZA 3CZEA 3CHDA 2W4XA 1C8QA 1MFVA 3T0DA 2DDXA 4AZIA 2WHKA 4KRTA 3ARTA 2XVNA 4P7QA 3N11A 2EO7A 3O6AA 3GNOA 3U5UA 5M3WA 4F8XA 4TVDA 3KL3A 1V3KA 2FH8A 2V3EA 3SCUA 2VL4A 1TMQA 4IPLA 3CUHA 2FGLA 3BC9A 4CD5A 1JZ6A 3BAKA 3OB8A 1BSIA 1JYXA 2YJQA 4RE3A 1GHRA 3CZ8A 5A8QA 1ZS2A 4H8UA 1EHNA 1ISYA 4PMNA 4WKFA 2ZUNA 1M04A 4BQ4A 3WBAA 2PWHA 3ALGA 3N12A 3ZJ8A 1A3HA 4M82A 5C71A 1XHGA 4MDOA 4TX8A 3SCPA 1V0MA 3W6MA 2CHNA 1Q6FA 1UWUA 2EPNA 3OLGA 3TTQA 1WCGA 1UHVA 1QHPA 3AROA 5GPRA 1E4IA 2VQTA 4P8XA 1BVNP 2CEQA 2XVLA 3K4AA 2GJXB 1UQYA 2ZX5A 1QNQA 1XCWA 1E6NA 4JHZA 4EANA 1XYZA 3VGDA 1E6QM 3AISA 3E1F1 2VCCA 3DHPA 1R86A 4ACZB 3AHVA 3WH6A 4MNMA 4P7NA 1TG7A 2D0FA 2WZEA 1KQZA 3PZMA 1W9DM 3L4VA 1KCLA 4LPCA 1Z32X 2BFGA 3O9NA 4QP0A 2Q8XA 3VIJA 1E6PA 1SMDA 3MV11 1K9EA 2J77A 1CXFA 3AFBA 1JDAA 1QNSA 6TAAA 1LLOA 3GBEA 4CCCA 4Q7NA 5DO8A 5I3DA 3CBWA 3AHXA 5A1AA 3VGHA 4PN2A 3W24A 3WNOA 3CUFA 4FLRA 5CXPA 4PMQA 1VIWA 2WMJA 1BTCA 1WP6A 4AWEA 3A4WA 3AQUA 3WDPP 3WNMA 3UESA 2E40A 3VOCA 2WCAA 4LX4A 1E43A 2WHLA 3LPOA 5CQ1A 1US3A 2YL6A 3OGRA 3W81A 2J7CA 1KBBA 4GI9A 2A3BA 3GH5A 1ITCA 4FMVA 3AS1A 1W9BM 3VIIA 2DIJA 3M6DA 1ZBCA 5BXTA 2QMJA 1VFMA 2VZTA 5FOOA 5FL1A 3PTMA 4QDMA 2CERA 4Y7EA 2XFFA 4ZE4A 4UZUA 4V28A 1B90A 4HPHA 3VGEA 2J7EA 4H8HA 4JFSA 3ZR5A 3AMCA 2EQDA 1GOOA 2OWWA 4LYPA 3T2QA 3KL5A 4QFUA 3RIKA 1ESWA 3HN3A 2ZICA 1UKSA 2DQXA 3A6OA 2VR4A 1HJSA 2XUCA 2J7GA 1GQLA 1UH3A 2WC3A 4CN6A 4PSPA 2ZUVA 2Y5EA 3KL0A 3ZO9A 4CKQA 4AD0A 2CCRA 2G41A 3MMDA 1LWJA 2TAAA 3AYRA 4M1RA 2QPSA 4NRRA 4ZE5A 4PMVA 2D1ZA 2WB5A 4AZ7A 5DF0A 4DWSA 4Z2LA 5A6KA 2O92A 4PTWA 1JD9A 1CEOA 1TVNA 1GOKA 3N04A 1XSIA 1E3ZA 3ARQA 1QNPA 1GJWA 1I1WA 3UETA 1H4PA 4J3UA 3RM9A 1FHDA 5E6ZA 3RILA 4W7UA 3MUY1 5ABGA 4W8BA 2XFRA 2BY3A 3QHOA 3SIMA 3U5YA 1UYQA 3IJ8A 1GUVA 3DYOA 3AJ7A 2BVDA 3AMDA 1JZ5A 3WF4A 2CKSA 3SCOA 1VEOA 1LQ0A 1JDDA 4ATLA 3VMNA 2W61A 4AZ5A 1K9TA 4UFKA 3BCDA 3VIKA 1UA7A 3MO4A 3RM8A 4F9JA 1BYBA 2W63A 4GZJA 1CXIA 1EDQA 3ZJKA 2WM0A 5BRQA 2JIWA 1IV8A 2G3IA 2ZX8A 5E0CA 4W86A 2ZUWA 1OINA 1QI3A 1JZ2A 1CGYA 1FA2A 3SCVA 4M80A 1M03A
chains in the Genus database with same CATH superfamily
3N2BA 4PH6A 1BVZA 2VO5A 1M7OA 1Q6OA 2J9XA 2WMFA 4JIHA 3MKKA 2YZRA 4QS5A 2E5DA 2CBUA 4FOJA 3PZ9A 3KWSA 4WQ6A 4LXFA 3BV4A 2XWDA 5JBDA 4WOQA 3FFSA 3NSNA 1E1FA 1R85A 3QY8A 2PZNA 3PBVA 3EMCA 4QQ3A 2WHJA 4KQNA 1AD1A 1NQ6A 2XH7A 1NSJA 3S3GA 2ZC8A 2VTFA 4AU0A 4PUUA 4PTVA 3WD1A 1Y5WA 2F6XA 4UTMA 1PDYA 3BGJA 1GPWA 2C7FA 3JZUA 4C7GA 3NVDA 2OWCA 4JN6A 2WYSA 1FWHC 1JZ7A 5CPMA 1VFTA 2HS8A 4HCHA 5HJLA 3DC8A 1XC4A 1KM1A 4FXRA 5AZ0A 3SW6A 1LJYA 1EIXA 2D3LA 2DW6A 5D04C 3MSDA 3VDAA 5BOFA 1XYFA 4GH1A 4A8IA 4Q32A 3S2MA 1XYCA 2JIEA 5JXQA 3XIMA 4YYFA 1UA3A 4OHQA 1NVMA 4PTNA 2XGIA 3QKZA 5DQPA 3W1PA 1LF1A 4LB4A 1LYXA 4IMAA 1KFCA 3W7EA 1ZENA 3GR8A 1K02A 4U31A 5EU9A 2EPOA 4ATWA 2REQA 1HW6A 4B2DA 1FY6A 2PDLA 3RLGA 1WQ5A 4UNKA 4GOAA 3NQGA 4EXQA 1J0KA 2EKGA 4DO5A 3DI1A 3AXKA 4H7VA 3KCOA 4XBJA 2V5LA 2NW0A 4ZO9A 1X7FA 3GVRA 4MZYA 5BU9A 3P5ZA 1CDGA 1CXLA 2Q09A 3MHGA 1WBJA 3O16A 3BWWA 3NQFA 4DUWA 4O50A 5JMUA 3AWOA 5BMXA 1FWAC 1HNYA 1Q5MA 1K6WA 4HNUA 2Z7GA 4JFVA 2H8XA 1BF6A 1CPUA 1KQYA 3VDHA 2XYLA 3L67A 1TTJA 3PULA 5AHMA 3QEZA 4J3WA 5E09A 1ZAIA 3QVQA 2XIMA 3OLEA 1MQPA 1IF2A 5JU6A 3E38A 1CNVA 3VD4A 1CYGA 1A5MC 1C91A 2PDBA 3QYQA 3VNMA 1KCKA 4JIPA 1S2VA 3HF3A 2RDWA 1SJCA 3CQIA 4O1AA 1L2UA 1CLXA 3ZJ6A 3AJXA 3QM3A 4YVPA 4MSSA 5HQEA 3WBYA 3EA1A 1XLAA 3RDKA 5CSUA 4HYRA 4DVOA 4X3ZA 2PDKA 3NYZA 4E2VA 3H8AA 5JIWA 2JF7A 4WSKA 1G01A 1ITUA 3BARA 3PSWA 2GWGA 1RQBA 4QBXA 3BL3A 4G5DA 3EDFA 1XICA 4QM1A 1GTHA 1VB9A 3BMXA 1E4MM 1X1NA 4AD3A 1W17A 3FSUA 4FOUA 5I03A 3QSRA 3NXFA 4LEQA 1Y5XA 3MCMA 3D46A 1HF6A 3N3MA 1MNSA 4AY1A 4DNHA 4LC8A 1H51A 5FJUA 4S1FA 2F6UA 1JYWA 1Q66A 2QULA 1EHAA 4XK2A 2CBVA 2YYUA 3QY6A 4EP8C 3RN6A 1R46A 3IGHX 2P10A 1E9YB 3NZRA 3TYAA 1K9DA 3VU2A 2R1NA 3FYYA 1TA3A 5LIXX 1ADDA 1OHLA 1LOQA 1R3QA 4S3GA 1ECEA 6REQB 2QMKA 4ATDA 3S83A 3UZXA 2QJHA 2CLIA 2W0UA 4KRUA 4QEEA 2OELA 4RZ5A 2YPIA 3RJYA 2OPJA 3USZA 3GU1A 3GM8A 4ZOCA 4R7JA 1UR4A 5K4XA 3VIFA 2IPGA 3QGAC 5CAKA 3THQA 1H1NA 1VHNA 1ME7A 4MMWA 3CV1A 5D8WA 5ABEA 3OEXA 1FTXA 1UUOA 2QCNA 3ISIX 3QMSA 1ZFJA 1EYEA 4XVEA 5G2IA 4O8RA 4YTTA 3GK0A 4BK9A 1JRBA 4GX9A 3TZNA 4PMJA 4QRNA 2DV0A 4GI8A 2PCEA 1DYSA 4JIRA 1D3GA 1SZEA 5D9PA 3LHWA 3KS5A 2DZBA 1KM0A 3WK2A 3HGSA 4EPBC 2AGKA 3IS4A 3UG5A 3AIVA 1ENUA 5KZ6A 2XGZA 1C9DA 1WO2A 3GXPA 3WO8A 2AOSA 3BMVA 1TCMA 3CMFA 5D09A 3T7VA 2GVLA 3AWNA 3FSTA 3UZZA 4MKVA 4U33A 5F4XA 1ONRA 7CGTA 2NV9A 1CGWA 3ARWA 1W3LA 2F7FA 3CMGA 3N2OA 3C56A 3OGVA 4JNYA 4A35A 1OJXA 3KZPA 3DFSA 4GI6A 4HD5A 1R3VA 1HKIA 1UOKA 2QF8A 1XUUA 3L2MA 5LXEA 2FFIA 4JS3A 4PUNA 2FZ9A 4KFPA 1EPVA 3DHDA 1FFRA 2CHOA 3CIVA 4WVXA 3S42A 1M68A 3ZS4A 5JH1A 1SZFA 1BD0A 4L7ZA 2CHRA 2QUNA 2ZZ7A 3CYVA 1AL8A 4UOQA 4N9EA 2VZOA 4IFRA 5LNUA 3GNPA 4KW2A 4YHEA 1I6NA 5I78A 3E0LA 1NP2A 1TCDA 5BOEA 2WV8A 5LZLA 3HFTA 1F5ZA 3AHTA 3OZPA 3NWRA 4IPJA 3C52A 4MNKA 1XINA 3RU8X 4W8LA 1P6WA 2XJ7A 3XISA 4CD8A 4HU0A 4U4MA 3ALFA 3URQA 3WQ4A 3LI1A 1J8VA 3ENLA 2V0TA 4GIYA 1KC7A 1DJYA 4XB3A 2YBTA 4ROQA 3U0HA 4LB3A 3ZVHA 1EGMA 4C6IA 1E5JA 1UH2A 2DZSA 3R11A 3HQ1A 3DC0A 1YBQA 2OGJA 2YW4A 4ZXLA 3UNDA 1S2WA 7A3HA 3PB2A 3NQVA 1H11A 4R85A 2YSWA 2V63A 3W7CA 4L6HA 1NFPA 1M7JA 3RJXA 4KCTA 4PRRA 3D3AA 4GC4A 1JUBA 3PBYA 3XINA 3EEGA 4P8UA 1WAUA 2O4QA 3TJLA 1VBJA 4N6FA 1KD0A 1XLLA 1XBXA 2VI0A 3BQ6A 4P61A 1TJRA 2CLKA 3WQEA 2V5DA 1V6XA 5TAOA 1WA3A 3FYOA 4Q8NA 2HBXA 3M16A 3NZ1A 1OG6A 4WJ8A 3QR0A 5CZJA 5D37A 3AXHA 4UTJA 4AC7C 4JHMA 2V3DA 2IQ0A 1FXQA 1KR1A 3GG7A 2GOUA 1EOKA 3REQA 2RKXA 1Q2RA 1V08A 3GLCA 1EH9A 4C6CA 3DHUA 3GFYA 3C2RA 3SN0A 1CLVA 3D0CA 4DAFA 4H9MA 4UCFA 3F4CA 4W89A 3WNPA 3T0AA 1IEVA 3EDJA 3KM8A 5LNRA 4AQLA 4TXEA 3UP8A 5G4HC 1H5VA 4ORIA 1WDWA 5KITA 2Q3RA 5REQA 2G3NA 1EEXA 4DO7A 1DJIA 1K4GA 2PDUA 5HUOA 5EFFA 2DIEA 2VMFA 2C0AA 1V6UA 2GJLA 1K6AA 2REQB 3T6CA 4LJ3A 1SW7A 1NDZA 1PL9A 3KBMA 3T55A 5KSWA 3O2LA 5E9XA 3CZLA 2J7DA 5JVLA 4LOCA 4LAZA 4HCLA 2V6AA 3MHUA 3VABA 4GABA 2WQPA 5CZKA 1QWKA 1V0NA 4YNGA 4AMCA 4I7VA 4HOZA 3PR2A 2GJRA 4AHPA 1QOPA 4DYJA 3CT7A 2QCMA 3O07A 4OVXA 2XINA 3IK4A 3OA5A 2INEA 4A2SA 4NHVA 4XX6A 2UBPC 4UR9A 1KGWA 4D6HA 3W2NA 4DO4A 3C8FA 3MP4A 4YU1A 1KFWA 1QPNA 4XUYA 1KFBA 4F2BA 3ZSSA 2GK1A 3E5PA 1J79A 1BYDA 1X39A 4IICA 2VEFA 2YFNA 1ZP3A 3GNRA 3N2CA 3PAOA 1I8JA 4GZIA 1ZP4A 4ECLA 2XVKA 3GG1A 5F4WA 4Q8VA 5I06A 2ZCGA 4AIUA 1ZQ5A 1RXOB 2I7GA 2RJGA 3I3BA 3KRZA 3VZZA 1B1YA 4PMOA 3UXIA 4KKXA 4CQAA 3O7UA 2P5NA 1MYRA 3KW3A 3LCWA 3NSMA 5F7UA 1GQKA 4L4PA 2GGGA 4Y2WA 2PGEA 3GZAA 1MW0A 1XYLA 3EDKA 3VKAA 3AO0A 4M0XA 1CW2A 2D73A 1FWNA 4AXKA 4ZEPA 3KE0A 1CXHA 1GKPA 2WLYA 2VEPA 2NX1A 2CZ5A 3WD2A 3NQ6A 2QCEA 1AJZA 5BWFA 3JS3A 3PVFA 1A49A 5A6TC 4NZCA 1WDPA 3KOYA 4MY8A 5XINA 3NTYA 4UNIA 1LT7A 3IUHA 1ZRQA 6CGTA 4E0CA 4CU7A 2J6XA 1NY1A 2CZVA 3TN5A 4M6PA 7REQA 1CENA 3MTWA 1E71M 4QJ4B 3WF0A 1WZLA 4KCWA 3VNKA 2ZUUA 1KXQA 2X7WA 1KWKA 1CGUA 3PZGA 2EJ1A 3LX9A 1TA3B 2ABAA 1OY0A 3V75A 1UR0A 1TQJA 3M0VA 2VFHA 2Y7DA 2XH4A 1THFD 3H2MA 4OZOA 3STEA 4EPKA 3VCRA 4URIA 3K8LA 3O05A 1F7BA 1DHKA 3VE7A 3GDTA 4GQQA 2B31A 3VILA 3K46A 3SCRA 4Q4KA 1ALDA 4FSAA 4AD5A 4QSHA 3ZVIA 3CMJA 5A6BA 1A5CA 5ECVA 4ZQRA 1YXDA 2EBNA 2RGMA 1XPGA 9XIMA 4O1CA 4KEMA 3GYEA 3WN6A 1YRRA 3C61A 3ARZA 2XFWA 5CPQA 4DJEA 2ZFAA 3JUGA 4LRTA 3GDMA 1A53A 4KERA 3WEZA 4LNYA 1I1XA 1OCNA 4LAMA 1TIWA 3TOPA 1U1JA 3AMGA 4AD2A 2BZNA 1H1YA 1I2QA 1UR3M 4CU8A 5JBFA 4W5ZA 4PUEA 1BVWA 2V8ZA 4RE2A 3WQFA 3L5MA 4E2OA 1B0IA 4HTBA 4YJ5A 1A5SA 2C91A 3E0WA 5HAOA 2XU2A 2OOFA 4EKJA 3H2AA 4NU7A 1QHOA 4MPKA 2X1SA 4MIMA 4O52A 1CI1A 2O0TA 4V33A 4LYQA 4Y9NA 3LPPA 2V38A 4OJYA 4AG0A 3EX1A 4C7FA 3ECQA 1DV7A 1JNEA 5DBUA 1QR7A 4B3LA 4F48A 4KGJA 2E68A 3GDBA 3L7RA 1B4KA 1B57A 4NJGA 4Q7BA 1EJVC 4JBRA 3SAZA 2WJZA 2VEIA 3VNYA 3T07A 1Q85A 4K3ZA 1KM4A 3BAXA 2I17A 1BQGA 2CPUA 4FNUA 4D8AA 4GBUA 1GKQA 1M41A 1RD6A 5T26A 3P2VA 3ES7A 8CGTA 1OT2A 4XZBA 5IHSA 1XLKA 5BW6A 2LLEA 5E70A 4DJFA 1PYFA 1TKKA 1VRDA 5I6SA 2PDPA 4FEZA 2PMQA 2PF0A 4L6DA 5DXYA 4PTMA 2ATSA 1V03A 3TXVA 1BSLA 4F4RA 5A6MA 3BAIA 4C6MA 4Z1DA 1YXCA 4LAUA 4AX7A 3B0UX 1SYTA 1UPPA 3AIEA 2BVYA 3CL7A 5EJ1B 1EC8A 1ICPA 2Y8UA 1RVKA 3SN1A 2BNJA 3C4UA 3EYPA 4G9PA 3MUZ1 5F2LA 4HHLA 1O7AA 1O6IA 3ZVHB 3T0BA 1GVSA 1SR0A 1FWEC 4JTJA 1FWIC 5D33A 3BOXA 2YL8A 2R94A 1E1EA 3TJ4A 1YBQB 2NSXA 1ZTVA 2OYLA 3W86A 1VS1A 2GJXA 4UBPC 2FPTA 5AC4A 1A0DA 4IPPA 1OQFA 1J0JA 2PWFA 1SZGA 4FX8A 1UR9A 3PTQA 3TZFA 4LY8A 4ACZA 2CLMA 2CITA 4GUFA 2F6KA 4GIEA 1VJIA 5G1TA 4DB7A 3N15A 3SY1A 3VKBA 4DBUA 2A3CA 3EB2A 3VX0A 5XIAA 1OG0A 2OGYA 3QOKA 2HJPA 4LALA 3T4WA 1UIPA 1AL7A 4FR6A 4D6CA 3Q67A 3WCZA 2QXWA 2GFTA 3EMQA 4RPQA 1UC5A 2V5CA 2YZ5A 2PC8A 3NDZA 1NDWA 5GJPA 4YLWA 4GPNA 3UY8A 1CIUA 4EF9A 3WQ8A 4US6A 3W76A 2D0HA 2DVXA 2XN0A 2QGHA 5HNUA 4QNEA 3REQB 4NIRA 3CO4A 4S39A 3OQ8A 4E38A 2CESA 1OF8A 1PZ2A 3S1XA 1C8YA 1XIGA 2E3ZA 4ZQMA 4FNPA 4M1BA 1L6YA 2YW3A 3WLPA 1UR8A 5FEXA 2J7BA 2E25A 3KWXA 4S3DA 3WUEA 1EKOA 4JL1A 3W74A 3HB9A 4F79A 1E1CA 3NGJA 3NZGA 4DJEC 1MI3A 2W92A 2HWGA 3EOUA 1XQKA 4S3KA 5REQB 1UMYA 1L0PA 4IT1A 3UPBA 2WNZA 1G1YA 4I9TA 5HDRA 2A7RA 3VTRA 1YPFA 2QGYA 4JTCA 1FWFC 4O11A 2GQ9A 4D6EA 4E4PA 4F0RA 3UW6A 4WDUA 4WGHA 4FNSA 4MFDA 1RCXB 3G6MA 4HGXA 3IIPA 1JAKA 2PCQA 3M07A 1NOUA 4PMRA 4R34A 3S6DA 4HNOA 1EB3A 4WCJA 1OEPA 5BCAA 2GGJA 1UWTA 4QROA 4QTGA 1HKWA 3SRDA 4PUJA 2ICSA 3W27A 4XKYA 2OO0A 2INZA 3CLWA 3IAPA 2FZBA 3F03K 4PBGA 4XWUA 1BWKA 5LGZA 2YXOA 4J27A 2VEKA 2QJMA 1OC7A 2B7OA 1XH0A 3WBWA 1H0GA 1F3WA 3Q37A 2L5HA 4FOKA 2Y7GA 4LCQA 2FHCA 4QAIA 4FX6M 2GK1B 4JOMA 5CC3A 3WF1A 4NAFA 1E6SM 4JQ1A 1ZJAA 1TV7A 2Y89A 1MUMA 1YPXA 1RD5A 5L6UA 4H19A 5C8BB 2GGHA 1WDQA 1PS9A 5H2ZA 1SR9A 2X8RA 1FWTA 4H6RA 4DJFC 3LM3A 1SFLA 2E6DA 3EXRA 3TU9A 3VIGA 3V5CA 1EJRC 3ITYA 2X1TA 1YXYA 1I2OA 4MJ4A 2CU0A 1PBGA 3CUGA 4GYKA 1EJSC 3OG3A 2G3JA 3UF9A 3U2CA 1LQ2A 2HEJA 3GXFA 1UUQA 5JQ9A 3A24A 3EWZA 4GX8A 4ZA0A 4POCA 3SFWA 1P6CA 2EKCA 1K8XA 2QLYA 1XDMA 3K8KA 1UKPA 4HMDA 5D30A 1IT8A 4E4UA 2OYKA 3NG3A 7REQB 2GYIA 1TPC1 3H24A 3M6YA 1JI1A 3IJLA 2QNEA 4LUSA 3WQ6A 1V3LA 2D2OA 1D7FA 1EP2A 4B15A 1VKFA 1XRVA 3ZM8A 1YE4A 2OR2A 2XM1A 3EWWA 3N6JA 3W25A 1JULA 5FF3A 4QITA 2Z1BA 2FZNA 4HK6A 2JKEA 3LRMA 4AFYA 2PWVA 1DE6A 1GG0A 1SJBA 2YL5A 4GUJA 4O12A 4D72A 2WJEA 1JUEA 1PV8A 5EA9A 4AZCA 3GX9A 3WDIA 3WEOA 3UR7A 3PTKA 1OGSA 3FYPA 3MSRA 3P84A 3W28A 1MNZA 1C93A 2IQTA 1DKWA 4FS9A 1UW9A 3EKGA 3RF9A 3MQTA 4LVAA 1JXJA 3H22A 3I6TA 4HN8A 4IIEA 2X40A 2WNNA 1R7OA 4J2MA 3HPXA 3H21A 3WFAA 4G6CA 2IUZA 3EB3A 2PP3A 4C90A 1JCLA 1VFHA 5ABHA 3GSMA 1DE5A 3VKJA 3NURA 3QFEA 4H83A 3RK8A 3RPMA 3N18A 5E5CA 5HUPA 4L1WA 5C2CA 1TRIA 3BCFA 3QGVA 4M3PA 2VWSA 2C1GA 3V36A 4B16A 1SFSA 4UFLA 3CGTA 1XD0A 4M56A 2UV8G 1EGVA 1IGSA 3ITCA 1Z44A 2FB2A 3WUBA 3W7NA 2FVKA 1ZJBA 2B0MA 5FJTA 1EF3A 2GUBA 3MZNA 3LMYA 1DBTA 3PWGA 3WH7A 4CVWA 1S2UA 1S3HA 1XGDA 3MC5A 1OX6A 1JPIA 1WKFA 1UROA 2WKLA 4AMAA 1K03A 4RNJA 4U28A 2NQHA 2UZ9A 1OFDA 4WDTA 5HQMA 3BG5A 3YPIA 2PDHA 3RX4A 1RVGA 3URAA 4DPPA 2X2GA 4GK8A 3P5YA 2WHKA 4N4PA 3LG3A 3O6AA 2Z1XA 4NX5A 4TVDA 1OFQA 5AHIA 1Q45A 1OYAA 2FH8A 1SGJA 3OHIA 3SCUA 4JTTA 1TMQA 4IPLA 2HROA 4ICNA 3BC9A 3H7RA 3AC0A 1BSIA 1AMKA 4RE3A 4A8NA 1EHNA 3ITTA 4BQ4A 4RKAA 3ALGA 2AGTA 2ISFA 1SSDA 1UWAA 4TX8A 2Z0IA 3C0JA 4O10A 3WQOA 2EPNA 4X2RA 1WCGA 3HPFA 4K37A 1FWSA 1PTDA 1XIHA 1IXOA 1O68A 1GZ1A 5GPRA 3W2LA 1KTNA 2VQTA 4A3UA 4P8XA 2CEQA 2ZX5A 2GJXB 2Z27A 3TE9A 4EACA 2VFEA 4FZIA 5CGQA 4DEFA 4LCSA 3S1WA 1TWSA 3E1F1 3GWQA 1R86A 3W7RA 3AHVA 3WH6A 4ACZB 4MNMA 1QRQA 1RJPA 2NUYA 1T8XA 1W9DM 3L4VA 4PEKA 3VK5A 5G2HA 3W1NA 3MV11 3GNXA 4GCXA 1CXFA 5MHBA 9RUBA 4XAPA 3GBEA 1WXJA 5DO8A 2QCDA 3VGHA 4PN2A 3GDKA 3W24A 3CUFA 3S5SA 4PMQA 1Z6KA 3VCCA 3VOCA 2WCAA 2JKPA 5GJNA 2FZ8A 1US3A 3N34A 3V1PA 2YX0A 3TTEA 1KBBA 2Q8ZA 2ASHA 1KV5A 1ITCA 3AS1A 1W9BM 3M0YA 3VIIA 4GYJA 1G67A 3UJ2A 3IPWA 2CLLA 1W0MA 2QMJA 2VZTA 5BNKA 1OK4A 3PTMA 4QDMA 4GFSA 4HJWA 4TR9A 4ZE4A 4ZB5A 4ICMA 4GUGA 2ISDA 1YKWA 2O7QA 3IACA 5I3JA 1GOOA 3A5FA 2OWWA 1ZAJA 4DLMA 2R91A 3T2QA 2PD5A 3PFMA 1E1CB 3IGUA 3RIKA 5H1WA 3HN3A 2ZICA 2VR4A 1PZ0A 4AIBA 4B5TA 1G69A 1AA1B 4LUJA 3M0JA 4IGNA 1DIOA 2Y5EA 1F07A 2G41A 1OK6A 1K1DA 3AYRA 3C0LA 5HINA 5DF0A 4Z2LA 5A6KA 2O92A 3H2OA 4TV5A 3USBA 4JTSA 3MWCA 4JY8A 1JD9A 2HXUA 3RG6A 3BGGA 1EA0A 1G4PA 3G8RA 3EOSA 1Q7ZA 2PE4A 1KLZA 3PG8A 1I1WA 3TR2A 4XKYB 4OFCA 3W2MA 1FHDA 5E6ZA 1AUSL 4W7UA 1AZ2A 5ABGA 4HBKA 2AQWA 3UYIA 3EPNA 1I2NA 3U5YA 3HIJA 1R30A 3QTPA 1GUVA 3DYOA 2ZZ1A 1JZ5A 3WF4A 2CKSA 3SCOA 5EYWA 4AB4A 5HJXA 2IS7A 3UZWA 4UFKA 1LRQA 4DWDA 2H6RA 3VIKA 1UA7A 5C5YA 3S46A 1BYBA 1CXIA 3QQWA 3KTSA 3ZJKA 4NAFB 3CH0A 2WM0A 5BRQA 1R9ZA 2G3IA 5LNVA 5E0CA 2G50A 3WYZA 4AAJA 4FA3A 1W5NA 1QI3A 1JZ2A 1CGYA 3PBUA 3DFHA 3SSJA 3SCVA 1K3UA 1K7FA 3UA3A 2VX7A 4B91A 2WLZA 5I79A 4J9JA 1V6WA 1UMLA 2ONEA 2Q02A 3UPWA 4R5EA 4Z1CA 3RCYA 4E4FA 2EGZA 5A8MA 1UCWA 1PCWA 4J3SA 5AY7A 5IDIA 5J5DA 3WLOA 2AL1A 2PLCA 3VOHA 1RP9A 2A4AA 3EXTA 4FF7A 3AXXA 1UZ1A 2PDYA 2PTYA 4JAWA 4H6KA 2NV2A 2WC4A 3WH5A 3FY1A 4DBWA 3NEVA 4CNUA 3NOYA 4XO6A 3WQCA 1DWHM 1UD5A 3EOEA 2VDGA 3W4RA 4LUSB 4CN1A 1IIHA 1Q6LA 2QCGA 1GJPA 3E2QA 3IWPA 4AD1A 1MRAA 1E4NA 2NX9A 4C6DA 3D47A 3G1XA 1DPMA 3OIHA 4ZOAA 3B97A 1OFRA 2DSZA 4GGHA 1L2QA 2X1RA 4WLCA 1FH7A 3W02A 3WJSA 2C71A 3QW3A 4QG8A 1W3JA 3P61A 1F3XA 3PB0A 2IKGA 4AZCB 2VQUA 4CQ9A 1W1TA 3NIYA 4ENLA 1F05A 3LN3A 3SRHA 3ZT7A 1IXPA 2IPFA 1UD6A 2OQHA 4LS2A 2H3BA 3I3EA 1VH7A 1O5QA 1OX4A 3VD7A 2AQOA 3RITA 3QJAA 5T91A 3MI2A 2JQXA 3S9YA 4XD4A 3VO0A 4DQWA 2O9RA 3WH8A 3KVJA 3WDHA 1DL3A 3QPEA 1TWDA 3WX7A 2Y6ZA 3CL8A 1W2VA 4AIOA 4ACYA 5CJNA 1DJNA 3GC2A 3KP0A 1SQ7A 2F2KA 2F8QA 4Y9PA 3WLQA 4JTAA 3D6NA 1UZDA 3TQVA 5CAHA 5HATA 1HN1A 1J9YA 1POJA 1A0EA 1A5UA 4Q7IA 2H90A 1VIZA 4RNFA 4C6BA 1VENA 3EB4A 3NQ2A 1S39A 3LHUA 3CPGA 3MJYA 1OCJA 3M0LA 3PP7A 4JFWA 2X16A 2PLMA 3POHA 2WZMA 2D2GA 4ZQNA 2ZOXA 1UD4A 2YYTA 4TTGA 1N82A 1OT1A 1ZJIA 1JPKA 2J8GA 1JPMA 3L23A 2DVTA 3QZ6A 1EBGA 3UWVA 4GQRA 5BOOA 1CBGA 1RAKA 2DSWA 1E70M 2DGAA 2RH9A 1FCVA 1U5JA 1HTIA 5G2WA 4XBSA 2FFCA 3MI6A 4B4FA 2V2HA 2BTMA 4NSBA 3AIRA 3HV8A 3W7LA 3TP4A 4NNBA 3T1GA 5F1VA 1XCFA 3PJUA 3K13A 3DYPA 4DYEA 1RHCA 2FTWA 3TTSA 3N73A 1P1MA 3N14A 4TX9A 4R9XA 3AIUA 4KPLA 4ONVA 4Q8QA 4DF2A 5MF5A 4UXDA 3VKCA 3I7QA 3M4HA 3B3DA 5A3HA 4XO7A 2XVGA 3GQYA 4GVIA 1X6LA 1VJSA 1EP1A 3SUWA 1DIKA 2QPXA 3S5OA 3R79A 4YHGA 1REQA 1UD8A 1K4HA 3ABQA 5FF7A 3SO7A 2ABBA 3WMCA 3UXKA 3C6CA 4M24A 1G4SA 1HVQA 4BI5A 2J25A 2HVOA 5IFPA 2J74A 2Z2AA 2P53A 5CG0A 5AB3A 5LIUX 1CB7B 3O15A 4EXBA 4P5UA 4W7WA 1HO4A 4OGZA 3THDA 4QCEA 2PTZA 3A3HA 2RDTA 3L65A 2BGSA 3PANA 5K2ZA 3H4XA 2B7QA 4OUEA 2ZX9A 1RA5A 2BX7A 4ZTYA 1A5KC 3MB9A 3BICA 2ALRA 1XLEA 1V77A 3W6LA 1F6YA 3LCFA 2DH2A 3WK0A 2DZPA 3A4XA 3CXOA 5KINA 1UB3A 4Y9MA 4HNVA 3WMLA 1C7SA 1E0VA 4C91A 3CWNA 2F9RA 3V16A 3PZQA 4GUIA 2NZLA 4AISA 3HM7A 4MJ2A 1EC9A 3MKVA 4JTDA 2E9MA 4LRSA 4BI6A 2QCDB 2ACRA 4WEVX 4Z0JA 1V02E 1VBGA 2DQWA 2GOKA 1JQVA 1WDRA 4I6VA 3GS6A 4LVFA 1JDEA 3GD6A 3KZSA 4ADUA 4CQCA 2F61A 2NWRA 1Q6DA 1J6PA 4IWWA 3OZMA 3BTNA 3FLUA 3DBPA 3MYOA 1GVFA 3HQPA 2W5FA 4MJMA 1Z42A 1EXBA 1R3YA 2OXNA 4DUVA 2WWCA 3HPSA 5CZ0A 5F1UA 3OJGA 3PUEA 2ZUSA 1TV4A 2F84A 2VOMA 3ANVA 3VGGA 4V2XA 1J01A 1VLIA 2J9ZA 3D3FA 4I6KA 3CU2A 3QZAA 3WKZA 3K1DA 2DIKA 4P02B 3BO9A 3M46A 3B4UA 1JAEA 1ICSA 4YS1A 4PCTA 3NAVA 2YB4A 5CPTA 1YQ2A 4ZO6A 4OWGA 3ES8A 3U7BA 4NXKA 2CETA 2RJHA 1DEDA 1ZUAX 1R9XA 3Q2DA 3LDVA 4PL2A 2WVSA 2AAMA 3E6EA 3KOFA 2WCSA 1UP3A 1B31A 1HKJA 4JYFA 5KTLA 4AF0A 3UXDA 5DT5A 3OVRA 3M0ZA 4EX4A 1XC6A 4LV4A 2YR1A 1X8FA 2X42A 1ZGDA 4C6QA 4QCFA 5LA1A 1E9ZB 5A6JA 4XTDA 4RNIA 4NG3A 3M5ZA 2ZA2A 2BODX 4HP5A 4ERGA 1TX2A 4B9YA 4JPGA 2EXOA 3H55A 4WXYA 3I68A 1O1ZA 4FNRA 3OVQA 2CLHA 2WO5A 4QLJA 4ZODA 4IJBA 3QMTA 4KF1A 4WJEA 2WK2A 1K8CA 3UVAA 3VC5A 3WLHA 2PODA 3AS0A 2V2CA 2NT1A 2WBGA 3TK7A 2EJAA 5JUVA 3MVTA 4D6DA 1E51A 1TVPA 1KXTA 1W6TA 3R0KA 4L4LA 1VPQA 2G4FA 3WSUA 1UKQA 1Q63A 1GORA 4MUZA 4Q4SA 4DWSD 4HSHA 1PHWA 5HWJA 3VPLA 4IIHA 3PPCA 4KRZA 1XIFA 1EIBA 1IEXA 1KBLA 2BHZA 3OO2A 5CEWA 1W1B1 5BRPA 1KM3A 5M03A 3WQDA 1KKOA 1M6JA 2E5BA 1ME9A 3STPA 4ZSTA 3EMZA 2CZFA 2ZXAA 3AS3A 4GISA 4C6EA 4JN7A 4BHYA 3U2ZA 3ICJA 3A4JA 3G77A 2J7HA 1EX1A 4UFJA 2RAGA 2WZTA 3ITXA 3WENA 3TROA 1XIIA 4B5SA 4QDPA 3NQMA 2C1IA 4IP4A 2ZZ3A 2NUXA 1J0ZA 3RHGA 1P5BA 3TVAA 1HL9A 3AXIA 1PB0A 3A23A 1NH6A 2GVYA 3E12A 1XLCA 2BY2A 3LCIA 3DKJA 2DZVA 5AHEA 3V0TA 1WUEA 2CYGA 1OGGA 3CQ0A 1TUXA 4GO8A 2QW5A 3QGKC 3CEPA 4CEXC 1QBBA 1RY8A 3M64A 5GNZA 3IARA 2ZA1A 4A3YA 1RBOB 4AHQA 1XJBA 4JR5A 3PC0A 1S5TA 2PWUA 4O17A 3T78A 4Q4PA 3PAJA 4PMZA 4ZB2A 3SGGA 1TR1A 1O5XA 1UASA 1W3TA 4DM1A 3W73A 1SPQA 4O1BA 4KFOA 2E9LA 1GPFA 4MKSA 5HMEA 1PJ9A 1XXXA 4H2CA 4B5WA 1B3OA 1PDZA 3HPAA 2FPVA 4JKMA 1FP8A 2YCJA 1NF0A 4ZMGA 2E0PA 2V81A 2VGIA 2DSKA 4H7ZA 3LRLA 4I8DA 3JW7A 2WKGA 3B8SA 3CT2A 2ZTJA 1OM0A 1UOZA 3MBDA 5CSRA 1LRNA 3CO8A 3LGGA 2J8FA 1OX4B 2EPHA 2WVUA 2BP1A 1V79A 1VFUA 4LSBA 3WF3A 4YWIA 4IJCA 1P0NA 2O56A 4B90A 3CK5A 3KRSA 1MZHA 1AQMA 1W1VA 2WANA 2DT1A 3WQGA 2D0GA 4X2PA 4R7WA 4IF2A 1NARA 1OFOA 4NZ3A 4PCFA 2NQZA 3VZXA 5FESA 4YCPA 2GVGA 3MW7A 1MVYA 3TYUA 4BF5A 4MNJA 3QR3A 4UTWA 4HCDA 1YDVA 3OLDA 4N6EA 4I9MA 1NOFA 5A6AA 2WXDM 5JBEA 1GW1A 4OBTA 1G4EA 4S3FA 3BQ5A 1LL7A 3DX5A 1ITXA 2OTDA 1H49A 3GZ3A 5FJRA 2DSUA 1EDTA 4Z2JA 3AYVA 4JCLA 2R1KA 4ZQOA 3KX6A 3VE9A 3W00A 2GVJA 3F7JA 1XBZA 5EB8A 4W87A 3JR2A 1GEHA 4WXZA 4U2YA 1OYBA 3GIYA 2KZHA 4IX0A 3K2GA 4U3AA 1JCXA 3A22A 3MWAA 1DTUA 4ZR8A 1EBHA 2OOGA 4XZ9A 1HXJA 3AALA 3VI2A 3GTIA 3KRUA 3NDYA 3UZYA 4MAVA 3TWAA 1MZRA 4LV9A 2DZWA 4XUGA 4LWWA 1EF2A 4D8ZA 2FVMA 2J9YA 2JF6A 3HGRA 2X0YA 1B2YA 3WQVA 1WYIA 5ABFA 3CWHA 2X7VA 3CAKA 5HWNA 3ME3A 5BWAA 2QV4A 3O6DA 3DAQA 3W7PA 1WDDA 3ABSA 3FW6A 1ONXA 1A3WA 1R6WA 2OT0A 1C29A 2DY3A 2Z6IA 2ZWZA 3LRKA 2GSJA 4KGLA 3GR4A 4QG9A 2JEPA 4EOUA 1K9FA 3S1GA 1QMLA 1DIEA 5KMYA 2PUZA 3BLLA 3IJ6A 1PZ1A 1FXPA 2VGBA 2A3LA 1QTWA 1XIJA 2V3GA 3H12A 3PNUA 2W27A 4GG9A 2VFDA 2Z1SA 4TVUA 3WQ5A 3OPSA 3W84A 1XISA 4H41A 3KVMA 2NX3A 4PUMA 1O5KA 5PTDA 4FXJA 1CXKA 5LSMA 1S3TC 3R7MA 1GHSA 3PN8A 3OA3A 3BMWA 2FTPA 3OBEA 5C9RA 4BI7A 2DUZA 4QXIA 1K77A 2XSXA 1SZNA 3G3MA 4GUHA 4TQTA 3ZWSA 1QI5A 4WOZA 1RJQA 1V7AA 4DZAA 3BLPX 4CVUA 2A3EA 1W1YA 3FJ4A 3JZEA 4W4QA 4GWEA 5I3GA 1CGTA 1MXGA 3BPWA 3LLXA 3NQDA 2DH3A 2FPYA 2XIBA 2QIWA 4FPSA 2EAWA 1FWRA 4AW7A 4I5XA 4S2BA 4AEFA 5TIMA 4AZBA 3W6YA 2I5IA 3MVIA 2Y8KA 3GDRA 3DH7A 1T41A 3NVTA 4Z2KA 1SU5A 2E1DA 1PX4A 5AC5A 5JH2A 4V27A 4GYPC 3S47A 1YNYA 5T9CE 4QNWA 2YA0A 1MSSA 1UG6A 1J0IA 3ITLA 3EA3A 1RA0A 4RUBA 3ZIZA 4IMCA 3K1GA 5I77A 3LNMA 4AF0B 3SQSA 1CECA 4OE7A 2BV9A 4DHGA 1B54A 5I23A 4GY1A 3MDUA 3WJXA 4L4OA 4M7SA 1EO5A 4DUXA 1CT5A 4F2UA 1RUSA 3U48A 4CNSA 4JKKA 4UTWC 5DFAA 3VOFA 5FAJA 3Q94A 5A6SA 1WOAA 4LYRA 3L4TA 1FP9A 2J66A 1JXKA 1VBRA 3U2OA 1LLZA 4LF1A 4YCOA 3GIQA 2J7FA 2C0HA 1W37A 1V4YA 1U5VA 4G1NA 3EPOA 1OIMA 4YWSA 3NZPA 4BQ3A 3WQPA 2FJUB 3FN9A 1HJWA 3ELFA 1W8GA 4AIEA 3GVGA 1B9BA 3PUDA 4NL1A 4IXHA 1QPQA 3BLFA 1UKOA 3SN4A 3LM7A 1TE6A 1DWAM 1FFQA 1RH9A 4J40A 3BZJA 4X63A 2W79A 3W1TA 1K7XA 1RCQA 4PGLA 3LLDA 1KRCC 3LHVA 3WH9A 1Y8BA 3LQGA 4L80A 4QHRA 1VYRA 3PHAA 4IP7A 3MKCA 3WNLA 3A9BA 4UB9A 3R13A 3HA1A 1AZ1A 4H04A 3KTXA 4RE4A 2PWGA 3RLHA 2TPSA 1MUCA 4DI8A 1EL3A 1R0MA 2PTWA 3TW7A 4HPXA 3VIMA 4ZFMA 3C3NA 1FBAA 2P88A 3RLUA 4UC5A 1XRTA 2W66A 3M0IA 3GYCA 1YNQA 4R53A 1D8CA 1H7NA 4UFHA 1BWLA 4WD0A 1Q7QA 3T05A 1EX5A 4B5UA 3VX1A 4GMEA 4NZ1A 5AYYA 2BXZA 3H2NA 4LY4A 4CGTA 1WKDA 3TN6A 2PB1A 3M5XA 2ZDSA 1JF6A 4RPPA 3ATZA 4UTLA 3AZTA 1PEZA 3P60A 2WQDA 5FJOA 1AH3A 4Y8EA 4BQ2A 1VCFA 5LGXA 2WSPA 5AC8A 1SJDA 3IJDA 1MQQA 2CBIA 3E2VA 1QAPA 1QOXA 5T8GA 3R58A 4ZOEA 4JQ4A 4O54A 3OVPA 3OODA 4MTVA 4NJIA 2PD9A 1HGWA 2D69A 1AH0A 3VINA 2PLJA 4FB7A 5C2XA 3HTWA 4MWAE 1DJHA 2R8WA 1VYPX 2NQJA 3HBLA 4AWUA 4EF8A 4O4VA 1DWIM 4CLMA 1U22A 4A22A 2YLAA 1LWHA 4HA1A 4AXNA 4XD6A 3PY2A 4J1OA 3UZJA 1F76A 3OLIA 3TN3A 3WLJA 3ZSTA 2ALDA 3WMBA 1IYXA 2R24A 2WWDA 1YADA 3ATYA 1AW2A 2VM8A 4I9JA 4OKDA 2XZ9A 4I7WA 3VMPA 3S6OA 3BW2A 3TX9A 3TCSA 2JGYA 1XSJA 3BZGA 1BLIA 3B8UA 6PTDA 2P3EA 1O94A 1ZU8A 1ECQA 5A8GA 3LCXA 3FDGA 1H60A 3W29A 5C9ZA 2NT0A 5LKYA 2YDRA 5AECA 3OGSA 1KRMA 1XLBA 3GG0A 1SFJA 1WAWA 3E0VA 5H8PA 4ES4A 1RR2A 1KKRA 5F4SA 2HK0A 1B30A 3KLKA 1IEIA 3NR0A 1QJWA 2RFGA 1HJXA 4RXGA 5HANA 4A3RA 4C5ZA 1GQJA 1Q6QA 1UJPA 4N9DA 5G1YA 2F2HA 5AHNA 2C79A 4UR7A 4WJXA 3BW4A 2ZA3A 3AMLA 4PB3A 4W88A 1D8WA 2ZRWA 4GY7A 2PRMA 1HVXA 1QFEA 3S5NA 2HK1A 1TZ9A 3MPGA 1I9CB 1V6YA 4S3AA 3N2MA 4W9TA 3WLKX 1V6TA 1UC4A 2ADAA 1W32A 4O13A 2Y0FA 4HHMA 1VCGA 4LQ1A 1R2TA 4FNTA 3QTGA 3B9OA 2VCBA 1AQFA 4LUTB 2C13A 5ABFB 3ID7A 4OUIA 4D6FA 4O53A 3LXAA 4L1GA 5AHLA 4XZIA 3II1A 1J5SA 3WDQA 1S5MA 1YTDA 2DJXA 3V3WA 3ANUA 3UGVA 3BH4A 3VMOA 3TJXA 3VVGA 3W7MA 4F40A 4IM4A 3T08A 3AMKA 3MCOA 4O0KA 2NVDA 3PJXA 3HGJA 5TD4A 1KBJA 2NLYA 2X30A 5DT7A 1P7TA 2NWSA 3ITVA 4ICCX 4ZGYA 2Y24A 5FCZA 2QIIA 3G1YA 4AZGA 3LZ5A 4IFOA 2VVNA 1CZ1A 1PX8A 1UKTA 3EAUA 4J3XA 1YX1A 4X61A 1C90A 5LHEA 5HBFA 3E3HA 5C0QA 1PKLA 4GC3A 1H2JA 3K8MA 2WPBA 4PSRA 3WLIA 2CIPA 1OGBA 1KFKA 4O8AA 4Y96A 1BHGA 1G5AA 5DCEA 1TWIA 3CPRA 4XVDA 1UZHA 1JD7A 3UJSA 3C0QA 3UCQA 5D03A 5B7ZA 2V30A 2Y2WA 3TFCA 2DZTA 2B81A 1JIBA 5AOUA 3GRIA 4K39A 3R94A 2YBUA 1UWRA 1BG4A 3SBFA 3CV6A 1X7IA 1EUAA 3DFYA 1PHQA 4S3EA 3ONCA 3PZIA 5H91A 5EKYA 3TR9A 1Y65A 4ZSUA 3DFPA 1LQAA 2W62A 3CZJA 4J4KA 3LGDA 4IQJA 3MSGA 1U83A 3TWBA 1FWDC 1DJZA 2QDDA 2INFA 4H6QA 1FDZA 1GK8A 3G22A 4WSJA 1QO5A 3PZUA 3TW6A 2VDIA 3ORWA 3EGJA 1ZAHA 4O16A 1R47A 3VKKA 1BGGA 2Z2BA 1W3HA 2HE5A 3ZJ7A 2VC7A 4RZ4A 2HS6A 3CUZA 1QU4A 2DU2A 1AODA 3TTOA 1C8XA 5LIWX 2UWFA 1ISZA 2WVTA 1ZBWA 2Y70A 5HJYA 3BSHA 3LLFA 1VCVA 5FI8A 4FF5A 4HNNA 4XIMA 3J7HA 3QF0A 1GW9A 3RNDA 1IZCA 3HQOA 5CPLA 4XZWA 4NYYA 3CZEA 2ZVIA 4GVFA 3CHDA 2W4XA 1C8QA 1Z9AA 4XZHA 3TA6A 2I1OA 1FCBA 4D2JA 2DDXA 1XS2A 1VR6A 4P7QA 5DX7A 3CJPA 4C1LA 3L2IA 4EWJA 1MEIA 2NUWA 3PWAA 3ABRA 3ZWTA 3KOWA 4L9ZA 1V3KA 4YMZA 4JGDA 4A8LA 2ZVRA 4XD3A 4YTQA 4CD5A 1ONWA 3LXBA 3THUA 3LHTA 1RQEA 2YJQA 1GHRA 4K38A 3GNDA 5C9WA 1ISYA 4PMNA 1XP3A 4WKFA 3N9RA 2QQ6A 4JEJA 2AMXA 1O1HA 3N12A 4M82A 4NZFA 5TBOA 1XHGA 3B0XA 1R5YA 1LORA 1UWUA 3OLGA 3TTQA 3AROA 2A1YA 5DANA 1QASA 1XDJA 2QJGA 1BVNP 4NNAA 1XCWA 4JHZA 4EANA 3H54A 3P6LA 4ZFCA 3VGDA 3PBWA 4FAMA 3CLMA 3RUBL 1TG7A 5C7HA 3BOLA 3M0XA 5CBIA 2Q8XA 4OECA 4US5D 4MLJA 1K9EA 4REQA 2J77A 2G4JA 1JDAA 3MJMA 4IGSA 1LLOA 3LQLA 4PE8A 4F0MA 3UG8A 4KWSA 5A1AA 1TVLA 4FLRA 4AWEA 1WP6A 1W5PA 2OVLA 3AQUA 5B80A 3WDPP 2E40A 1ONEA 3GVVA 1H7WA 4GH3A 3LPOA 2PU0A 4UMCA 2PDNA 3OGRA 3UR2A 1SSGA 3M7WA 3B05A 1XYBA 1X38A 3B8TA 4LBRA 1QK2A 3G1DA 5J04A 2DIJA 2BSLA 1ZBCA 1VFMA 3CL6A 5FL1A 1HZYA 1GEQA 3QV6A 2CERA 4QSFA 3LCHA 2HSAA 3T40A 4O1EA 4NNCA 1I2RA 3VGEA 3FCPA 1L9WA 3AMCA 3W70A 4LU0A 4QFUA 3EWCA 5C2GA 1ESWA 1KA9F 1HJSA 4NVTA 2J7GA 1RLCL 4B92A 3M47A 2GGIA 2ZUVA 3T4CA 3KL0A 2W9MA 1O66A 3TQKA 3MMDA 1JGMA 4KFNA 4NI8A 2QPSA 2A7NA 4DWSA 4BWLA 3L68A 2P0IA 3U2EA 4I9AA 4E8GA 4FIRA 3R0UA 1TVNA 1XFCA 1ZJHA 1SM9A 3PUGA 1BKSA 4J2PA 1X98A 3AAMA 4J3UA 5AYZA 4HIBA 3DOPA 4MWAD 4KCUA 1YE6A 4JX5A 1XBYA 3SIMA 1RLDA 1K7EA 3W7JA 4ADSA 2P8CA 3N19B 1Z89A 1KM5A 3WBXA 3UWQA 2XIJA 3AJ7A 2IPJA 2NXGA 1MDLA 1XFBA 1VFSA 2P3ZA 3BCDA 3RM8A 4F9JA 4NT0A 4H7CA 4JIIX 3QLDA 2C14A 5G4WA 2ZX8A 5DY3A 1XIMA 4W86A 2ZUWA 3KLLA 2R1LA 1FA2A 2EHHA 3MHFA 3EWUA 2A0NA 3KBNA 4KBXA 1M03A 3MUCA 5HXMA 4PFMA 2V69A 3UWZA 4QJ1A 5F2GA 4AX6A 4UWMA 4DY1A 3QC3A 5D32A 2DFAA 1XI3A 4HZ7A 3DERA 2RDXA 3TC3A 3SUTA 1EDGA 1YDYA 3HO8A 4DF1A 3BDKA 1M53A 2QR6A 1TQXA 4FXFA 1JDFA 3CV7A 2BY0A 3E9AA 3IJ7A 4JTFA 4C6JA 4LFYA 4XAGA 4Q33A 3P93A 1GOXA 4LGXA 4S23A 3F5LA 4JTLA 3L4UA 3MP3A 2Y8VA 1GJUA 3VFLA 5JIPA 1FKXA 1UBSA 2ZIDA 1OIFA 2ZRXA 2UY4A 4BCEA 1JR1A 1Q65A 3DKLA 1O4UA 4EXAA 1QT1A 4M29A 3B9EA 2PGRA 1P7TB 4BEQA 4IUOA 4GE8A 5D05A 3AIBA 4LW7A 3B06A 1HL2A 2RGLA 1Y7VA 1E73M 2QV5A 3AU2A 5CKSA 4CN4A 7TAAA 3DZ1A 4LYKA 1IEWA 4CNTA 1IXQA 4OOUA 4OT7A 2IKJA 2YGYA 3IIXA 4CCZA 3TAKA 2WSRA 1EOMA 2Y63A 4TU1A 1U2YA 4IGHA 4FLQA 3VNIA 5HA7A 1F4HA 3QY7A 4C6NA 2G97A 3SUSA 4UQAA 3WUGA 4QDWA 1JPHA 2Y62A 1PUDA 3PFRA 1XLJA 1M7PA 4MGGA 2YOCA 1C9WA 5HMFA 1K70A 2FVLA 1M1BA 3TNOA 1AQHA 1FKWA 2PDQA 1RP8A 2I9UA 3LNPA 4HA0A 2XIIA 3TTYA 3W1QA 4OTKA 3LOTA 3DFOA 3LBMA 1LBLA 1QCWA 1N55A 2YXXA 3HPZA 3RX3A 2OEMA 1H63A 3NM1A 3EWYA 2AQVA 4HG6B 1ISXA 1Q2SA 1BRLA 3PUOA 5A2BA 3KXQA 1H41A 3NEHA 4C6OA 5AYIA 3OG2A 4C60A 4N4QA 5EMLA 5CBJA 1GOQA 1V0KA 3P14A 3F4WA 3MUIA 4JHOA 2ACSA 2E1WA 3H7UA 1W3KA 1IT7A 2NQ5A 1CX9A 1O95A 2OSYA 3UJRA 4GIAA 3WFZA 5EMUA 1XLIA 5HMDA 4KWVA 5EMJA 1XF0A 3GXNA 4YN5A 1JI2A 4DWSC 3MYPA 4BWLC 1V51A 4QGCA 5AZ1A 1QNOA 1ZHAA 5CGTA 3AHZA 4CU6A 3DIPA 4HMEA 5IBXA 2AL2A 4FLSA 5AVHA 3VDGA 2DP3A 2Z29A 1HJUA 3ZT5A 1V6VA 2WKJA 5H8MA 1EEPA 4YXGA 1FH9A 4TV6A 2ZQ0A 3PZTA 5LA0A 4XAYA 3VCNA 3PWIA 1XRSA 2ESCA 2J6VA 4YYCA 1OWQA 3AICA 3G1SA 4K36A 1FWGC 1W91A 2ZRUA 3R8RA 5D2VA 3RRAA 2OODA 3W53A 2V5BA 1BG9A 4GXWA 1JCYA 1Z69A 1AVAA 1WPCA 1J0YA 1EQPA 4MOZA 4Z2IA 3P74A 4EK7A 2QCHA 2O4MA 4E2DA 3TC7A 1X6UA 3AI0A 3WIJA 1A5BA 3EKZA 4GJ1A 4Y90A 3F5KA 2ZX6A 1RJRA 5CJ5A 3PJTA 4D6JA 5TQLA 2VOTA 4GVHA 4Z2HA 2QAPA 2QDGA 4RR4A 4F0HA 4RV8A 1W5MA 4CQ8A 4CEUC 2QHAA 5ECUA 4JX6A 4BS0A 2RDUA 2Z28A 3TNBA 1POKA 2OYMA 4IZGA 1G7UA 2QCCA 1AFSA 1ZY9A 4R7OA 5FF4A 4ZOBA 3U3HA 1W2PA 1HQTA 4A6GA 5IM51 4ZENA 2A5HA 3LV5A 2HRWA 1NJJA 5IFTA 2GJPA 1PIGA 1KFJA 1TTQA 2QAFA 3N4EA 4IISA 1OC5A 1ZNNA 3UG3A 4L5ZA 3L21A 4AVOA 2PF8A 3V5OA 2DT2A 4REQB 5IRPA 3ZMRA 5I24A 2VZVA 2WMIA 1V02A 3W7DA 3PBGA 3TYDA 3MT1A 4XZLX 4GVGA 2WW5A 5CGMA 2QEZA 3GAYA 2MNRA 2FQIA 3GU9A 4XSLA 2PSNA 1SW3A 4H9VA 3GTXA 3HOJA 4GNVA 1V3HA 4XISA 1T99A 1PKYA 4DF0A 5A94A 1VC4A 2O9PA 4MB3A 1B3VA 1RK5A 1PXGA 2HTMA 1BF2A 2QCLA 3TKFA 2RUSA 3PPHA 4O0QA 1DVJA 6XIMA 3GVWA 4N9CA 4UZSA 3MCNA 3N6QA 4DXXA 1I4NA 1EJWC 4JFUA 5EBUA 1A47A 5K9CA 1BQCA 5HNRA 3FJNA 1QOQA 1UWIA 3SEPA 4H8NA 3H7VA 2DZUA 3CPUA 4JIQA 3QLLA 1ZALA 4G56A 3IVUA 2QT3A 1YMYA 1BPLB 2FZMA 2J24A 1E3XA 3QPZA 5C55A 3P82A 1XX1A 4INFA 3T0TA 4W8AA 5IDZA 3GFZA 3IRDA 3C5QA 4MPQA 4DWSB 1MRQA 1GOWA 3KVKA 1OZMA 3R6IA 5EL1A 4HPJA 3N29A 2P76A 2WVVA 4QIUA 1NWRA 1EJ7L 1VP5A 3U6WA 4NZ5A 2DJLA 2OX1A 1BXBA 3L5LA 2Q8LA 5AHFA 2AAAA 5KETA 3T81A 1TZ7A 1EZWA 5FEWA 3CQHA 2FIQA 1J6OA 1V3MA 4HHPA 5KZDA 1PZ3A 3H2EA 4JN8A 2ANUA 4LT9A 4G1KA 3V35A 2V5JA 2Y7FA 4X22A 2VRKA 5DY2A 3FV9A 1PYMA 2PBGA 5I7GA 3VNLA 1FH8A 2HE8A 3Q58A 4XV0A 2CLPA 2E6AA 5IBXC 4K8EA 2ZYFA 3TYEA 1W5QA 4RJEA 3R2GA 3CQJA 3MMUA 5E9AA 1U1HA 4GA8A 2EEXA 3KCJA 1HFBA 2JE8A 1X96A 3ZQ9A 2BVTA 1E0WA 4AEEA 3WL1A 3VUSA 1U30A 3O0KA 4UOJA 5AN7A 1F6PA 5CC6A 1J96A 1OVDA 3A47A 1D9EA 1FCQA 2PDGA 2GDQA 1KTCA 3IUIA 4ZQCA 1I60A 5I3IA 3RAOA 2OEKA 4HZ6A 5FJPA 3KBSA 4UIOA 1JCJA 5CZTA 5IOBA 3U9IA 1L6GA 1PE1A 1RPKA 3PPFA 3LEPA 3LGEA 3RFAA 3UXLA 2IMRA 3MS8A 1F4AA 3B8DA 3L4YA 3NQ8A 4L1XA 4LF2A 3GY1A 3KVLA 3OOQA 2OCZA 4DI9A 1IT0A 3LY0A 4O28A 5C54A 4UTTA 2ISVA 1V0LA 2YFOA 2CKRA 1DJQA 3WMSA 3W1XA 1W9UA 1VBHA 4Q8TA 4IHCA 3HZ3A 4MG4A 3QR1A 3NUKA 4R27A 4FO4A 4PUWA 1XLMA 2E9BA 1XLFA 2J75A 2FZDA 3QMRA 4AY8A 5I02A 4KIEA 3W2JA 1RBLA 1MW1A 3KAOA 4HA4A 2ZXBA 5EGRA 5CSYA 1Q6GA 4C1NA 1XLHA 4KS0A 4ZZ9A 1R2RA 4K7VA 2VELA 2CXGA 2V3FA 3AHYA 2V68A 2Z7KA 3WLRA 1IR2A 3N1AA 1KW1A 4Q6JA 4AZ6A 3UWYA 4UFIA 3C3UA 2DVUA 3ZFHA 4PTDA 2I14A 5DMYA 2VP8A 4L4MA 1TV8A 3E2RA 3HURA 5C6MA 3W3OA 4DBEA 5K9XA 4E8CA 2FJKA 1T7LA 1HKVA 3RPDA 1GZGA 1VFLA 4F0KA 1ME8A 1UR1A 4KH2A 1R87A 4DBDA 4JQAA 2PZ0A 1N7KA 4I90A 1LL6A 3ERPA 3EEZA 1C8VA 1CGXA 3STGA 3ARUA 1BRLB 2ZBTA 4O18A 4IMGA 4I7UA 1J12A 2FHFA 4Q22A 1QW8A 3KHJA 3FA3A 4O15A 1GGOA 3T0CA 2XZ7A 3NQBA 1HJQA 3T09A 2TSYA 3NO3A 2J88A 4QX4A 5RUBA 2X1UA 5DRIA 2IKIA 1DQWA 4H3DA 3W23A 3S8HA 7ODCA 3U7VA 6ENLA 1I2PA 1JZ3A 4LNCA 3VIPA 2UY3A 1XV8A 3CAQA 2E28A 3DBNA 2AL2B 4RK8A 1OCQA 1A5NC 3WBEA 4ML4A 4PMYA 4PTXA 4UFMA 1VBUA 2WOQA 4ALDA 2YA1A 1VD6A 3LTSA 3A21A 4JDYA 4UTHA 3EX3A 4S2CA 1GQNA 2OQYA 3VXGA 4NZ4A 4A8RA 2YDSA 3BAWA 3E74A 1TV5A 3BUVA 5I0DA 1GNXA 2F38A 1JJKA 4UQDA 4UCGA 2IW0A 5KZEA 2FGBA 5A6LA 4HOXA 4HA3A 3H23A 2Y85A 4X0NA 1BTMA 3JVAA 4AC1X 1P4CA 4Q6XA 3R8GA 3IJ9A 5LNSA 3V4BA 4CQDA 4TMBA 1WDSA 2CFFA 3W07A 1FVPA 4FALA 2Y61A 3CWOX 3WJZA 1FDYA 2YCKX 3VYLA 3KEHA 2C1HA 3PTDA 4UQEA 4GGBA 2V9DA 3LBOA 2EPMX 1B3WA 2D23A 4W7VA 3SZ8A 3MV01 3R5EA 4PMXA 3CUIA 3B9DA 1E6ZA 3UGRA 5HNTA 1AMYA 4LUYA 3S5ZA 4GXPA 1JVNA 1XYMA 1K8YA 2HQAA 1F61A 4H8VA 4PR4A 1BXNA 3ARRA 2PDIA 5DMMA 2JBMA 1NDYA 3TDFA 1R3WA 2G0WA 4WSHA 3OP2A 3T2OA 1ODZA 5DMLA 3W1AA 4MY9A 4MLRA 2PDCA 4IG2A 1E0XA 3PZVA 2WMIB 3DN5A 1F8IA 4UTTC 3NL6A 4QJ5B 1KB3A 5G5IA 2XDFA 3M5YA 3BOFA 1R38A 1X97A 3W82A 2VCAA 6ALDA 3LA4A 2E5CA 2OZTA 4FI4A 1E4LA 4L64A 4LEFA 2OZ0A 4IOTA 1JDCA 1IE7C 3O1NA 1WZKA 4ILSA 2TODA 2XH2A 4P7LA 1C7TA 1QVBA 1EYWA 1CGVA 4KWOA 3ARPA 3BSMA 3OZYA 5KZMA 1JEZA 3NYDA 3PZNA 3ANYA 3E49A 1HP5A 4GINA 1OFBA 2HPMA 2Z1VA 1O5RA 2OEJA 4LVBA 2VGGA 1CTNA 3APTA 1S5NA 4U5IA 3G0XA 4ZQPA 2QZRA 2YLLA 3NO5A 4L65A 1MXSA 4QE1A 1T0OA 4BJHA 4JFTA 3LHZA 1CWYA 3SGZA 3IAQA 1XG4A 4GRSA 4K68A 2ZKMX 4E2BA 4AD4A 2Z1KA 3HQNA 1TPH1 1PSCA 1QATA 4FHAA 3BANA 3V0SA 3W1RA 1H7XA 1LM1A 3WNNA 1VAHA 2CXEA 2WVVB 3RR1A 3IANA 4H2HA 3N13A 5LIYX 3WLLA 1F3EA 1J2WA 5D2WA 3I7RA 3H4GA 5EFDA 3UWWA 3F5JA 1SJAA 5DEZA 3P80A 1R7AA 4HK7A 1WUFA 3GU2A 4M81A 3AIWA 4K8HA 4HNLA 1LDCA 4C5YA 1ADOA 5EJZB 2H8ZA 3FS2A 2YDAA 4AHOA 2WAGA 5FAGA 4FIQA 4YIWA 3TJIA 1XQLA 2I5GA 2PURA 4PYSA 2PGWA 2OO6A 4AVNA 5G4EA 4BF9A 1Y5VA 2CBJA 2V2DA 1EUNA 4US5A 1NFBA 1KR0A 1R9YA 4QE4A 1NP0A 1Q8AA 1XIDA 1Q13A 1X6NA 3E0FA 5M2FX 1KGUA 1TB3A 2OX4A 4UQ9A 1E9LA 5CSSA 4MDPA 3DYMA 4I8YA 1JQXA 1MXDA 5E6YA 3WG6A 5CC5A 3FJLA 2OMAA 2WJDA 3ITGA 3QSTA 1QW9A