3WMBA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with naphthalimide derivative q1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTLHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERFVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A crystal structure-guided rational design switching non-carbohydrate inhibitors' specificity between two beta-GlcNAcase homologs
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wmbA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3wmbA01
3PN8A 3G6LA 1GVYA 1MQQA 1VEPA 2FH8A 2ZUNA 2BHUA 5IFPA 1J0IA 1UD8A 2WKLA 3WD4A 1M04A 3CUJA 3UG4A 4MB4A 4UOJA 2BNJA 1J01A 3RJXA 5E0FA 3TTSA 4QAWA 4M29A 2ZE0A 4UFHA 5C71A 3F4VA 4CKQA 2E9MA 3AIQA 2CBVA 1JZ2A 1EXPA 4UR9A 4H8VA 4U2ZA 4CD5A 1G94A 3GNOA 2WCSA 1HJQA 1VBUA 2VT0A 4UZUA 1Q6DA 1V3LA 4WKFA 2VZUA 5JBEA 2GDVA 3FXYA 2Q8XA 2D23A 3B9EA 2WMKA 3IJ8A 1E6QM 4W93A 5A8PA 2Z1KA 4D6CA 1W9VA 1GPFA 3RM9A 1GHRA 1CDGA 4NSBA 4HZ8A 1SR0A 3OLIA 1JD9A 3AIWA 3ZQ9A 5AC4A 2VURA 2O92A 2CXGA 3CZGA 4OOZA 3EDDA 4DUVA 2WMIA 1H5VA 1UR8A 3GDBA 3PZTA 1OD0A 3A4AA 2EPLX 4HPHA 1QI4A 1XV8A 2FHCA 3II1A 1VRXA 3CMJA 3U7VA 3WELA 3WDRA 3MANA 4W8AA 3SCNA 3AXIA 2GDUA 3NCOA 1CXKA 1US2A 5LA0A 3W29A 4MNMA 1J0YA 4P7QA 1TR1A 5BWFA 4HOWA 1E6ZA 1VB9A 1GOMA 1JYXA 4L4OA 3WN6A 4Z2IA 2XGBA 4TUFA 4H41A 4AY1A 1GHSA 4HOXA 5GQBA 4JFUA 4DUXA 5GNYA 4C90A 2A3BA 2YKKA 1BFNA 2VCCA 4DM2A 2VJXA 3VM5A 1JZ5A 1GQJA 1TE1A 5I0DA 2DH3A 3CZKA 3QHMA 4A3HA 1PPIA 1U2YA 1BSIA 4P7NA 5KEZA 1V0MA 2OSXA 3EBVA 3WF0A 3RILA 2HVMA 1QNSA 3LPOA 5CLTA 1MVYA 1GOIA 3NSXA 4W85A 2G41A 4ACYA 3OZPA 4H8HA 1MW2A 1JDCA 4AIOA 5I24A 3L4WA 1MQRA 1QW8A 3TP4A 2EPMX 1K9TA 4PRWA 3RIKA 2O9RA 1JG9A 3F5KA 1ECEA 4PTWA 3QGVA 1WNOA 5F7UA 4HZ6A 1Q6FA 1V6WA 3VIJA 4U5KA 4AZIA 2GJXA 3GZAA 2UY5A 1RD6A 1L0PA 1VBRA 1MYRA 1JAKA 1DTUA 1F4AA 4W87A 1FH7A 1XD1A 1OCQA 3CO4A 1CWYA 3WL0A 4AZ7A 4J3TA 1FA2A 2VQUA 1QI5A 5FD0A 1BG4A 2XWDA 1UQZA 4E8DA 2VVSA 4BQ5A 2WCGA 3CZEA 1MW1A 3WDIA 2F61A 3MMWA 2DDXA 2E9LA 3F5LA 1DWIM 5CGTA 4UNIA 4NZCA 2FHFA 2BHYA 3WH7A 4Z2LA 3QHNA 3SCTA 2VZTA 4P8WA 4BZYA 2EPKX 1CGWA 4YPJA 1KBBA 1Q4NX 4GO8A 3L2LA 3WEMA 1GJUA 2F2HA 1UD3A 2WWCA 1LF1A 2ZOXA 1OWQA 4W84A 4S3JA 2WZIA 4U5IA 3EDJA 5GPRA 5EBAA 4PMUA 3MU7A 4V2XA 1CGTA 2XYLA 4ZXOA 3VU2A 4U2YA 1EQCA 4FMVA 1U33A 4AIUA 1EDTA 4DWSD 1VENA 4PUEA 3A47A 1QOXA 3SCQA 2CKRA 1D2KA 4PMXA 1BAGA 4LYRA 1QNPA 3ALGA 1XH1A 4FF5A 3JUGA 1XSJA 4CCCA 1TUXA 2WANA 3KZSA 5E6ZA 4M56A 3WNNA 1LL6A 1R87A 2PWDA 1JNDA 4PMRA 4RL3A 3VNZA 5I3DA 2J77A 1C7SA 4GI9A 3ARZA 3VM7A 3RCNA 4GPNA 4BQ3A 4AMCA 4XUYA 1GORA 4JL2A 3RMEA 2WC3A 3FHAA 4XB3A 1DHKA 3BLPX 3UESA 1WDQA 4FLRA 5CZKA 3AMCA 4H7VA 2OYKA 3CMGA 4MJ2A 1GQLA 1OT1A 3HJEA 1ZBWA 3WNLA 4UFIA 4QDMA 3RDKA 4ATLA 3GM8A 3ARRA 4B16A 3AOFA 4MNJA 1YQ2A 4CU6A 3FN9A 4MDOA 2V38A 4LYPA 4GINA 2WVTA 1H11A 3VIMA 2WPGA 1HJUA 2D24A 2F8QA 2J25A 4KMQA 4FLSA 1E4MM 3N15A 3WH9A 4W7VA 4YHEA 3VX0A 2XFRA 3L2MA 1I1WA 3WD3A 1XCXA 2ZXBA 2G8ZA 5BXRA 5BXPA 3WNOA 1HIZA 4URIA 3OLEA 3W28A 1ITCA 1HVQA 1MW3A 3ARSA 3N04A 2J7GA 1C91A 4AISA 2QHAA 1CGUA 2DIJA 2WHLA 1S46A 1A47A 1CXIA 4BCEA 6CGTA 2XJ7A 2Y4SA 1WP6A 1TVNA 2VR4A 2XIIA 3NJ3A 1JXKA 4HA1A 3IK2A 1IZKA 3CUIA 4C91A 1K9DA 1W1PA 1VEMA 2J8FA 3AXHA 5A94A 1QNRA 4RE4A 4BQ4A 1ODUA 2CEQA 4FK9A 3VGBA 4F9DA 3ZOAA 1C8XA 1GQIA 2D3LA 1V02E 1GOQA 4W7UA 2EXOA 1JGIA 4KRTA 2CIPA 3W82A 3OBAA 4PSRA 5IDIA 2QMJA 1CXHA 4P7OA 1WO2A 3CZJA 4UZSA 4AD4A 5JUVA 3RM8A 3BSHA 3GH4A 1KXVA 3W6LA 5CG0A 4BA0A 3GYCA 4W5UA 1P6WA 4BQ2A 2UY3A 5DEZA 3AHYA 4W88A 3WY1A 4CN6A 1JI2A 2XSAA 1B3WA 4CD7A 3PTQA 4UTFA 4TVCA 1D3CA 2A3CA 2XM2A 3ARUA 2X1IA 1ZJBA 4UCFA 2CYGA 1KWGA 2WKGA 1W91A 3EMZA 2VX5A 4WIWA 4W8LA 1LWHA 3N9KA 4AC1X 3S2CA 3WH8A 1Q6CA 2BXZA 4PTXA 2VR5A 2YBTA 5A2BA 1B9ZA 1X1NA 2GFTA 5ABGA 1H49A 2PBGA 3BXWA 5I77A 3BMVA 5BROA 2WBGA 2AAAA 1QHOA 2X09A 2CETA 4Q22A 1EA9C 4AWEA 3GTNA 1DWHM 5HDRA 2DSUA 3UERA 1HNYA 2JALA 6TAAA 2ZUTA 3VILA 1UR9A 1KGWA 1J0ZA 1HP4A 3WL1A 1GQKA 4N42A 4U33A 5A6BD 1CXLA 1JI1A 4M24A 5CXPA 5DFAA 2DT0A 3T08A 1X6NA 5BCAA 2NT1A 3ZIZA 3NSMA 1PJ9A 1M7XA 4KRUA 2C8NA 4Z2GA 2YL8A 3A6OA 3MV11 4JIEA 2WHJA 5A8OA 4GO9A 2BFGA 1BVZA 1V0NA 3QOMA 1Z32X 4CU8A 3WBAA 3I3DA 1V6YA 5C70A 5LYRA 1BGGA 1QVBA 2QMKA 3MUZ1 2BHZA 2G4FA 2WLYA 4CUCA 5ABFA 1JF6A 3VTRA 3WDHA 5ABFB 2E8YA 2UY4A 2YA1A 1C90A 3CPUA 1ZBKA 5HXMA 1IT0A 1NP0A 3LPFA 4AEEA 1NM9A 3LPPA 2DGAA 4LGXA 1UKPA 1ZS2A 1JD7A 1XD0A 2ZXQA 1XYFA 3W0KA 3WF2A 1PZ3A 2E9BA 4DWSC 1QNOA 4MADA 1GOOA 5A6BA 3TTOA 2C0HA 3IAPA 3L4ZA 5HOSA 3VIOA 2WXDM 3BAXA 5JBFA 1M03A 3WBEA 4E2OA 1LJYA 2W66A 1XH2A 4W7WA 3AIRA 3N1AA 4P8UA 2E0PA 2WLZA 3SEPA 3AROA 1UHVA 1KCLA 5LA2A 1CYGA 2J74A 1EOKA 2RGMA 2GJRA 3ZSSA 4UQCA 3MKKA 4P7RA 3BGAA 1CXEA 1DWAM 3UG5A 2PWEA 2ZX8A 4PSPA 1WDPA 3CZ8A 4D6GA 1OBAA 1CGYA 5A3HA 2CESA 2FHBA 4JFVA 1CZ1A 2JIWA 3M07A 2PWGA 4LXFA 2XVKA 1UOKA 3VX1A 1FOBA 1XGZA 1EGZA 2O9OA 4ZFMA 1CNVA 1M53A 1GVIA 1E4NA 2VOTA 4NRRA 4QCFA 2WBKA 4D6HA 3VINA 3AS2A 4HMEA 1UKOA 4JCMA 2ZX5A 5D9NA 3ZMRA 5BRPA 1HN1A 3FY1A 3MV01 3SIMA 1KQYA 5A6KA 5A8QA 3DYPA 2A3HA 3VIHA 3RM4A 4PMVA 4MAZA 3VIGA 2YL9A 4B15A 4OUEA 1QBAA 4Z2KA 4AZCA 1UWSA 1HX0A 3GBDA 3DC0A 4PMDA 3S6TA 3M7SA 4TX8A 3PZVA 1BYBA 4Q7NA 4PMZA 1ITXA 3OGSA 2YOCA 2YLLA 3OB8A 5A2CA 1MFUA 4CCEA 1RH9A 1ESWA 1SFSA 4CVUA 4OZOA 1QI0A 3W25A 2QF8A 3AZRA 4HPGA 1FFQA 2G3IA 1UKQA 4LX4A 2EEXA 3ZO9A 1UD5A 1OGSA 2IUZA 3AIUA 2ZWYA 1NARA 4CGTA 5GNXA 4DWSB 1JZ4A 4GI8A 1W9PA 1WAWA 2WMJA 5FIPA 1BLIA 1KR0A 4HZ7A 1VFOA 1RP8A 1E6XM 3SUVA 3D3AA 1FFRA 5I23A 1JXJA 3VO0A 1B1YA 1Q6GA 3CBWA 3HU7A 4R5EA 4UFMA 4UQEA 4XZWA 1QW9A 3SUWA 1QHPA 4M80A 1E3XA 3WF3A 5KZ6A 1GOWA 2WMFA 2PBOA 4J3XA 2Y8KA 1AQMA 3MUAA 2EBNA 3AMKA 3W4RA 1CECA 3FNDA 2J78A 3OG2A 3MSGA 1B3YA 5I5RA 3PZNA 4CD8A 4X0VA 2CHNA 3IJ7A 7A3HA 1VFMA 3POCA 3VKKA 2D1ZA 2VX7A 4FLQA 1UG6A 4DWSA 4AYSA 4TX6A 4CVWA 5M5DA 1CXFA 2VZSA 5FL1A 3J7HA 3ARPA 3K8LA 1WDSA 4NI3A 1UWIA 3VIPA 3HMCA 3O2LA 1E6PA 5AYBA 1CTNA 3AMLA 3AZSA 4MJ4A 3TTQA 2E40A 2D20A 1BF2A 2WMIB 1EH9A 2D0GA 4F79A 2YL5A 2JEPA 7CGTA 4MAVA 4HOZA 2CPUA 4M82A 2W91A 1PAMA 3SUTA 5D9MA 3WQ4A 3ZJKA 3K1DA 3K4AA 3UR7A 5EB8A 1UWUA 2CKSA 2GVYA 3WEZA 1VF8A 3WMBA 4JKMA 5FOOA 1KGXA 2W5FA 4C7FA 2WVVA 1C8YA 3N17A 2W92A 1NOWA 3AMGA 1UZ1A 4PMYA 2FDMA 2XVPA 3O6AA 1TMQA 3NDYA 3TA9A 3NIYA 2JE8A 3VOCA 1V6VA 3AQUA 4PYSA 4AIEA 1UD2A 2YDSA 5I79A 3SCRA 1W2VA 4U3CA 2WB5A 4ZXLA 3E1F1 4HMDA 2UY2A 1PEZA 2EQDA 2WM0A 3BSGA 3CH9A 1UWRA 3B8SA 4TXEA 1G5AA 1EOMA 1WZLA 2ZUVA 2OLHA 2YA0A 3DHPA 5CJ5A 5E9AA 2VZOA 3IJ9A 3SUSA 2VTFA 1WKYA 3UCQA 1UH3A 3MSDA 1LL7A 3IANA 3KWXA 1ISZA 3ARQA 1I75A 3OLDA 1E9LA 2W63A 1PIFA 4ATWA 1EQPA 2YJQA 3VDHA 3SCOA 1AQHA 4N0RA 1BYAA 3CIVA 3ZJ6A 3L4TA 1LG2A 2IXVA 3WDJA 3BCDA 1LLOA 2V5CA 1W1TA 4PN2A 4J7RA 1QNQA 2W61A 2O9PA 4WSKA 4UQDA 4RE2A 3WD0A 2G3MA 3LMYA 4E4PA 2PWHA 1ZU8A 4S3KA 2BVYA 3VD9A 1XC6A 3OZOA 1X6LA 4U31A 1UA7A 3LPGA 1GONA 3WH5A 4BF7A 1O6IA 1XHGA 4XV0A 1BYDA 3KL5A 3WF1A 1SMDA 1UUQA 1G9HA 1W3KA 3UEQA 5M03A 4IPNB 5A8NA 5HNNA 1E5NA 3WKZA 2WNWA 1W1VA 4CCDA 1NWRA 3AS1A 1QBBA 2J7HA 1JF5A 1JFHA 3W24A 3VD5A 5HPOA 1V3MA 5AY7A 5D9PA 1GUVA 5E0CA 3W6MA 4XX6A 4JKLA 3W37A 2ESCA 4D1JA 3ARXA 5E09A 2PWFA 3SCVA 2QPUA 3VIFA 1J0JA 4GQQA 4C7GA 5IXEA 2V5DA 2XVGA 2DH2A 2WW5A 4F66A 3O9NA 4W8BA 3AJ7A 2WC7A 3BC9A 1E56A 2PC8A 4J28A 4OJYA 3VD3A 1UWTA 2WC4A 1KQZA 4CU7A 5A6JA 1V6XA 2VCAA 4HU8A 4CD6A 5I6SA 8CGTA 3TOPA 3WUBA 2A3EA 2ZX7A 2J79A 1CIUA 3SCPA 3VD7A 1HVXA 1FP8A 1HKIA 1OIFA 2VQTA 1G01A 2XPKA 4E8CA 1J9YA 4D1IA 3FW6A 2XIBA 1K9FA 3EMQA 1V3HA 4MB3A 1OGGA 4EKJA 5E6YA 1V3JA 3WEOA 3L4VA 4AZCB 3U7BA 2VO5A 2YA2A 3AXXA 7TAAA 5A69A 2VC9A 3BH4A 3MMDA 4D6EA 3EDKA 3QHOA 1E15A 1XRVA 2EPOA 1OD8A 4WF7A 3EDEA 1K6AA 4UOQA 3WNPA 5I2UA 3EDFA 3PZ9A 1OIMA 5GNZA 2XHYA 5CSUA 3L4YA 2YDQA 2ZICA 1E40A 1XCWA 6A3HA 2GK1A 1EIBA 1MXGA 1ZJAA 1ZB5A 1G0CA 2WMHA 2J7DA 2ZXDA 1GW1A 1ZBVA 2Z1SA 4AD0A 5AYIA 4MNKA 2ZUUA 2CHOA 3POHA 2EO7A 1KB3A 3DYMA 5DMYA 2J7EA 2W4XA 1B30A 3VMNA 3NDZA 5IFTA 2J8GA 2ZXAA 5CPQA 3A4XA 3WUGA 3VDCA 1VJSA 1JNEA 2VMFA 1J12A 4J3WA 4JHZA 4F8XA 5C8BB 1XSKA 1OM0A 1TA3A 3QR3A 5CSYA 2FGZA 3PZOA 2EPNA 5DT5A 1L8NA 1VJZA 3AMDA 1BHGA 5A2AA 1GJWA 1K9EA 2CBIA 2BVDA 4HMCA 4AZGA 1EDQA 1R86A 2WSPA 2E8ZA 1R7AA 3AHZA 1G1YA 4PCTA 1E6NA 4PMNA 4IISA 4UOZA 2WYSA 1W9XA 1B3ZA 3MMUA 5M17A 8A3HA 1QHZA 4AXNA 4H8UA 1NOFA 1QPKA 2CITA 4JFTA 4JCLA 3VGHA 3TONA 4AEFA 3SUUA 1E71M 2GJXB 1TVPA 4GKLA 3KL0A 2VCBA 1ODZA 5CPSA 2TAAA 2NW0A 1DEDA 3MUY1 1OSEA 3WFZA 1W32A 2V3DA 2VX4A 1VAHA 1WB0A 2X0HA 4ZE5A 3T0BA 2ZUMA 1LG1A 2VI0A 3TTYA 1M01A 2D22A 1HJVA 2OSWA 1B90A 3T2QA 3AICA 4M81A 3D5HA 2DEPA 3BAYA 1FHLA 1HKJA 3M6DA 1Q6EA 2DSWA 3AHXA 3WQWA 2WWDA 5BXSA 3VMOA 2VRQA 3WQ8A 1CBGA 2WVVB 1JYVA 3CZLA 4D6JA 3K46A 3AYSA 2VL4A 3KE0A 4JFSA 1GOKA 1H09A 4MDPA 2XUCA 3FAXA 5IHSA 5ABEA 1KWKA 4P8VA 2VVNA 3ZT7A 4QLJA 1KFWA 3WD1A 2ZUWA 3ZT6A 4J3SA 1JZ7A 3ZR5A 4H2CA 1JL8A 3BCFA 4WKAA 5CQ1A 1CLVA 1MFVA 4EE9A 2DIEA 1IZJA 1F4HA 2DPEA 4KGLA 1AVAA 5DT7A 1KXQA 3FHQA 2X8RA 5CGMA 1H3GA 4LPCA 5FKYA 5HBFA 1DP0A 1CEOA 1V0LA 4YN5A 1C92A 2FH6A 3THCA 5AC5A 2ZX9A 1W2PA 5A6SA 1C7TA 1DWFM 4AZ6A 3WDPP 3GH7A 3AS0A 1R7OA 3AIEA 1UR4A 2J47A 1EDGA 1C3FA 5JBDA 2DT1A 3CUHA 3N13A 1BYCA 3GNPA 5EMYA 1DWGM 1V0KA 3WH6A 2X05A 2X2YA 4IUGA 1W9DM 2BY3A 2CBJA 2D0HA 4EAMA 4KGJA 3AI0A 3ARVA 4PCSA 1B3VA 2VNCA 1J0HA 1PX3A 3ZR6A 1KR1A 2G3NA 3N11A 1JYNA 1JIBA 5D8WA 1E70M 3BAIA 3B9DA 3A4WA 2V3GA 1V6UA 3EMCA 4ACZA 4Z2HA 4R27A 2YL6A 3BAWA 4HTYA 1KXTA 3APGA 1OT2A 1GNXA 4AD3A 2ZX6A 4OKDA 3ALFA 4OOUA 4CN1A 1TFVA 5CLWA 3RPMA 2OYLA 2W62A 4ML4A 3GXMA 4BS0A 2MANA 4JHOA 2J7FA 4OBRA 3VDAA 3MS8A 4D6FA 4A3YA 1VIWA 4UFLA 4PEEA 3VGFA 3ARWA 3W81A 3F5JA 4B9ZA 2VZVA 2W67A 4B9YA 4EANA 4M8UA 2Y2WA 4TVUA 3WQ5A 1NWTA 1JDAA 1UZ4A 1E0WA 3WDQA 1W9BM 3CUGA 1AMYA 2QV4A 3OLGA 2EJ1A 1HT6A 1W3LA 3MO4A 2JF7A 3IAQA 3I3BA 4GQRA 3ZT5A 4CD4A 1N82A 1UA3A 4OIFA 4B3KA 1XH0A 1RPKA 1BGAA 2WSKA 2J75A 1CLXA 1VEOA 1V3IA 5CPTA 5A6LA 4GI6A 2J7BA 5FL0A 1HKKA 2Y24A 2VRJA 2WVUA 4QFUA 4M1RA 2DSVA 4MB1A 3WFLA 4QCEA 1E73M 4GZIA 1NP2A 2JEQA 3NYDA 1E1FA 3GH5A 3MUIA 3AFBA 2Y5EA 1HJXA 1U30A 2JF6A 1UD4A 3CTTA 4PTVA 1V03A 1QI2A 4MTVA 1ISWA 1W1YA 4CN4A 1FP9A 5BRQA 1UD6A 4LYQA 4WJXA 1BQCA 3VGGA 3WMSA 2CNCA 1OINA 4AW7A 3PTMA 1R85A 3ARTA 3AZTA 4MPKA 4LQ1A 1JZ3A 4AZHA 1WZAA 1NH6A 1NQ6A 3U5UA 1B31A 2FGLA 4TVDA 1H0GA 2GUYA 3WD2A 4PBGA 1MW0A 2VRKA 4OBSA 4GZJA 1Y7VA 3M46A 3UR8A 1V3KA 1LWJA 2CERA 3WSUA 3WQVA 1B2YA 2BV9A 2BS9A 2CCRA 2BY1A 2WZEA 3AS3A 2O9TA 3CHEA 4UQAA 1TA3B 2ZWZA 1I1XA 5FCZA 1WE5A 1PIGA 1E55A 3AYRA 2JIEA 2YIHA 1A3HA 4MNLA 3AHTA 1E5JA 2Y8VA 1SYTA 3T2PA 3AIBA 3PTKA 1WPCA 2WMGA 2UWFA 3WQ6A 3NSNA 2YDRA 4J3UA 5TD4A 4W89A 1CENA 2J7CA 4UFJA 1BG9A 3SURA 1KCKA 2RGLA 5A1AA 5JIPA 1WZKA 3FAWA 3SCUA 4ZEPA 1TG7A 2NT0A 1WCGA 3ZJ7A 4X0NA 2ZIDA 4D6DA 2PI6A 3W38A 3BMWA 4AD5A 1IV8A 4GIAA 3U5YA 5A6AA 2B31A 1OB0A 3CLWA 3L4XA 3T0DA 3VVGA 3VD4A 1HXJA 1BVNP 4TTUA 5A6MA 3VGDA 3K8KA 4F9JA 5HPCA 2G3JA 4WK9A 3T0AA 1RP9A 2OYMA 4J27A 1E0XA 4XZBA 4Y7EA 3CUFA 1XYZA 2C7FA 5IHRA 2WHKA 5I78A 4UFKA 4B3LA 3AHVA 5E70A 3DYOA 4K68A 9CGTA 3PHAA 3AIVA 1C8QA 1PBGA 5EFDA 1US3A 1NOUA 1TZ7A 1ZL1A 1HKMA 3VGEA 4X9YA 3UG3A 3THDA 4D72A 1KBKA 3WUEA 1HJSA 3AISA 2A3AA 2WHMA 3N18A 3WENA 4J3VA 5JIWA 2WVSA 2GSJA 2X0YA 1E0VA 3GXDA 3PZIA 2VX6A 1PZ2A 1UH4A 3OGVA 4Z2JA 4P8XA 4D71A 2WK2A 4ACZB 4HU0A 4WSJA 3L4UA 1HL8A 1CGXA 2XVNA 1BPLB 4L4PA 4JKKA 1GZJA 3DHUA 3N12A 3WNMA 2XGIA 3BAJA 2BXYA 2OWXA 3VPLA 1UR2A 2BY0A 2YLAA 3KL3A 3W53A 1J0KA 1H41A 4DUWA 5D8ZA 4QLLA 3CHDA 3VIKA 2IXUA 1C93A 4W86A 1EO5A 1E72M 4W5ZA 1MXDA 1E43A 3PZQA 4ZE4A 3GXFA 1AQ0A 3NUKA 3BLKA 1O7AA 2VUYA 5M3WA 4KWUA 1NWSA 3RO8A 4H04A 2XSBA 1UYQA 1ISXA 4PMQA 1H0IA 1E4IA 1LL4A 1ISYA 1W3JA 2AOSA 2XFFA 3I3EA 5BYWA 3CHCA 3ECQA 3WUFA 1UR0A 2V3EA 1H1NA 3RJYA 1B3XA 3WIJA 2WAGA 3W27A 1E4LA 3W26A 1ISVA 2HISA 1TCMA 4P7LA 4C7DA 3VMPA 1UKTA 4WKHA 2J4GA 1GCYA 1EHAA 3SCWA 4DM1A 3CGTA 1JFXA 3PZGA 1UH2A 3PZUA 3PBGA 3HN3A 4JZ5A 2D3NA 3ZM8A 1UQYA 2PF0A 4NRSA 5LA1A 4JFWA 4D6IA 4ATDA 2D2OA 2OWWA 4A4AA 4GXPA 2DQXA 2PB1A 1WDRA 2DT3A 1SMAA 2XM1A 3ZSTA 4QP0A 4AZ5A 4PMOA 4JL1A 1VFUA 2E3ZA 3VNYA 1EO7A 1MQPA 4UQ9A 5DF0A 1D7FA 3WNKA 4AZBA 1V08A 1KGUA 4UQBA 3VDBA 1XSIA 2J62A 3WMCA 4TTGA 1UR1A 1HF6A 1J10A 1BTCA 2AMGA 5DO8A 5ECUA 4HP5A 3ARYA 4HA3A 1JAEA 1FH9A 1E6SM 4MB5A 2V3FA 1JDDA 1V02A 1NWUA 4KH2A 1JYWA 3SCSA 3K4DA 4HA4A 3VIIA 1E1EA 2GK1B 3OIHA 3G6MA 4AD1A 1FH8A 4AD2A 2XVLA 5A95A 1PX8A 3A3HA 3GXIA 4V28A 1MWOA 1W9UA 5D4YA 4PTMA 4JAWA 1FHDA 4YHGA 3KEHA 3T09A 1LQ0A 5D9OA 1EHNA 4NF7A 3QOKA 4RE3A 1VFFA 2ZUSA 1OGBA 4QLKA 3CHFA 3EYPA 1B0IA 5A8MA 1J18A 1W3HA 3WF4A 2D0FA 2QPSA 4WLCA 2GJPA 2XFYA 3OA5A 2WZHA 4GZEA 2BY2A 3UETA 1E6RA 4V27A 1H2JA 2QLYA 1QI3A 2XTKA 2YBUA 3U57A 4PUDA 2DSZA 3DECA 3VUPA 1JZ8A 1CPUA 4TOQA 1CGVA 4EK7A 3OGRA 1KXHA 3ZJ8A 5EFFA 2OSYA 1E3ZA 1YHTA 1HL9A 2BVTA 4U3AA 2E4TA 2WCAA 1DWJM 1UWQA 4IPLA 3BAKA 1HP5A 1WZMA 2XG9A 5ABHA 1J11A 4FLOA 3K8MA 1UKSA 3GBEA 2OWCA 4ZENA 1ZBCA 1JZ6A 1PX4A 5BXTA 2XWEA 4IM4A 2JFEX 2DT2A 3PZMA 2NSXA 1HJWA 2DSKA 1H4PA 2CBUA 3GNRA 3B9AA 1R8LA 3T2OA
chains in the Genus database with same CATH superfamily
3HGSA 2GWGA 1KNWA 2BHUA 3KOXA 5IFPA 1G4PA 3WD4A 4MY8A 3CUJA 2BNJA 4GACA 2V0TA 1ZAIA 2R94A 4AU0A 1RJQA 2ZE0A 5FF3A 1EXPA 4B3ZA 3PJTA 4RXGA 1UIOA 2VT0A 3LRLA 5JBEA 3F4WA 2Q8XA 1SFJA 3KBMA 1XLFA 3W88A 4C6CA 4Q8PA 3KOYA 2Z1KA 4PUKA 4O0KA 1SR9A 4ALDA 2NUYA 1X8CA 3D6NA 5AC4A 2VURA 4OOZA 4FO4A 3UJFA 2WMIA 1QJWA 4IOTA 5BOFA 1AJ0A 1PUDA 3ITGA 4UNKA 3F2DA 2G95A 3PPFA 1XV8A 5AHNA 3UZJA 1Q13A 2PDLA 3E38A 3MANA 1MRQA 3AXIA 1SGJA 3IIZA 2GDUA 3NCOA 1CXKA 1US2A 2VM8A 3ATZA 3P82A 1M7JA 1J0YA 1V6TA 4H4IA 1PTGA 2BB0A 1TR1A 1Q3NA 4YTTA 1FDZA 3AO0A 1S2WA 3DFSA 3G22A 3WN6A 1OFDA 4GRSA 2XGBA 4TUFA 3V1PA 1OG0A 3WQEA 1RBAA 1M1BA 1GHSA 5GQBA 3LCFA 4JFUA 5GNYA 2FJUB 2A3BA 4DY1A 3E74A 2GGGA 1XP3A 2E5DA 2VJXA 1ZRQA 1TE1A 2ZZ2A 4OECA 3QHMA 4IIDA 4NNBA 1PPIA 1U2YA 5KEZA 1VPYA 1MO0A 3WF0A 1S3HA 1K7XA 3R12A 1GOIA 4O0ZA 3OZPA 3R8GA 4BWLC 3TN5A 1MW2A 5D04C 4KWWA 3D47A 3WLIA 3L4WA 4WY0F 1RBOB 2EPMX 4J35A 4XTDA 1X97A 3PUEA 4S1FA 2YXGA 5SWUA 2IW0A 1RALA 4PTWA 1UW9A 4QROA 1UZDA 1V6WA 4U5KA 4AZIA 1RD6A 3T40A 4O17A 3WLRA 4HK5A 1VRDA 3NQ8A 4GX9A 1TV3A 4OFCA 4KCVA 3C86A 4Y9PA 3GU9A 7PTDA 3QRHA 4DZ5A 3CO4A 1CWYA 3EXRA 4AZ7A 3FKKA 4AF0A 1LBLA 4HA0A 1C9WA 1BG4A 2ISWA 4IF2A 4E8DA 3COTA 1EJWC 1NIUA 3U48A 1HQTA 3F4DA 1MW1A 1P43A 2EG8A 2F61A 2E9LA 1XDMA 4C6BA 4Z2LA 3QHNA 2HSAA 4ZSTA 2VFEA 4ICMA 1RPXA 1AW2A 2VZTA 1CGWA 3WQGA 2QV5A 3T4WA 4GO8A 1AA1B 3BV4A 1UJQA 4RX0A 1QPQA 3WLQA 4ORIA 3KWSA 4ZZ9A 4Z1YA 3P74A 4W84A 3OZYA 3VOFA 3V4BA 1WA3A 4XSMA 5AYZA 3IRSA 3GIYA 1EQCA 4FMVA 4AVFA 2ZTJA 2BTMA 2YW4A 3KS6A 3V0SA 4EOUA 3A47A 1NDWA 1D2KA 2JKPA 4PMXA 4WOZA 1FDYA 4TMCA 1FWIC 4LYRA 3P5ZA 1NDVA 1VIZA 3PBYA 2WANA 2VGIA 5E6ZA 1R87A 3GFXA 1JNDA 2OKTA 1G67A 4RL3A 4ZBCA 2J77A 4GI9A 3M5XA 3VM7A 4GPNA 1TKKA 3I7SA 4JL2A 1AD1A 4JTQA 1DHKA 3UESA 4FLRA 5CZKA 1E9ZB 3HJEA 1H7OA 3WNLA 3QVQA 4FR1A 4QITA 3MCNA 2Y62A 3FN9A 4MDOA 1SZFA 4US5A 4HQVA 1XW8A 3V18A 4GNVA 2WPGA 3U4AA 3DHDA 3AXMA 4MZ8A 2XH2A 1FRBA 3UFYA 3VKCA 4L4MA 4A22A 4UR8A 4B5VA 2EPHA 4FLSA 3TU9A 1XIMA 3N15A 5AKQA 3VX0A 2XFRA 3QMSA 4LVGA 4O52A 3NOYA 4EP8C 1GVSA 2G8ZA 5BXRA 2A3LA 4JYDA 2EJAA 4R7WA 2OEKA 2VP8A 4PEKA 1THFD 1HIZA 3OLEA 2HE5A 2ZQ0A 4Z1AA 3ARSA 5A6TC 1ZAHA 2QAPA 1E9YB 4LNYA 3B0XA 1CGUA 2DIJA 4JGDA 2E6FA 2J24A 1MSSA 1S46A 3NZQA 1XL9A 3N2CA 2GQ9A 4LS2A 1B9BA 3DAQA 1CXIA 3E6EA 2XJ7A 4HJWA 2VR4A 4XKYA 4DBSA 3H4GA 3LBOA 1JXKA 2GQAA 4K2SA 2J9ZA 1DQUA 1IZKA 1WUFA 1IR1A 3CUIA 1K9DA 1XF0A 4IP7A 3CASA 4PR4A 1O60A 4BQ4A 1ODUA 3GYEA 4JY9A 4AHOA 4F9DA 5G2IA 2F7FA 2D3LA 3M0IA 4W7UA 1Z69A 4LF2A 1KKRA 4KRTA 3S3GA 4PSRA 2QMJA 3MYPA 3QQ0A 5JUVA 4UZSA 4AD4A 3SZ8A 4JDYA 3RM8A 3KX6A 5AN7A 4IX0A 2QDDA 3TR2A 4BA0A 4E2VA 3GYCA 2AAMA 1P6WA 3S0CA 4BQ2A 1QATA 2UY3A 5DEZA 4CN6A 3OO2A 2V67A 3TUUA 1B3WA 1B3OA 1Z41A 2VGBA 4HSNA 4UTFA 4TVCA 2DUAA 2P53A 1M7PA 2J13A 5F4WA 1FKXA 1ZJBA 3NXFA 3ZLFA 3NQEA 4XISA 1NDYA 2VX5A 4WIWA 1YKWA 2E77A 2VGGA 2F6XA 4YCOA 1GTHA 2BXZA 2PAJA 1FBAA 4IMFA 4H9VA 2VWTA 1B9ZA 1OFOA 2GFTA 3G1FA 3EEZA 3MY9A 5I77A 2X41A 2E7FA 2VEFA 2YFOA 3BMVA 4RZ5A 2C15A 3W7QA 1XQLA 3DFTA 2WBGA 4P2VA 2PU0A 2AAAA 1R3WA 2X09A 1L6FA 1OK6A 1DWHM 1YXCA 5GJPA 5HINA 4DXVA 1ZLPA 2JALA 6TAAA 4MKNA 3SN4A 3YPIA 1KGWA 1D7KA 2EG6A 4L7ZA 3QQWA 2GJNA 2B0MA 1GQKA 4U33A 3IEBA 1M3UA 3V5OA 4QM1A 3P80A 1CXLA 1UP3A 4AX6A 1IEXA 2H3DA 3PANA 3NSMA 4Z2GA 4Q8QA 3UYCA 3SB0A 5D05A 2WHJA 4C6MA 3W7LA 3BW2A 2ZCGA 1IWPA 3T0CA 3I3DA 5C70A 1XYBA 3MUZ1 1RHCA 2G4FA 4CUCA 1XISA 1BWLA 3QC0A 1PWMA 3S5ZA 4QHRA 5HXMA 1IT0A 3RAOA 1NP0A 3C0JA 4AEEA 4LGXA 2INEA 1JD7A 1EZWA 1JCMP 4HPNA 2ZXQA 3G77A 2E9BA 1KD0A 4DWSC 4FNPA 2PTWA 3LEPA 4MADA 3S42A 1R6WA 5T9CE 3H23A 2C0HA 4HYVA 1N8IA 4P61A 3GR7A 3IGSA 4IQDA 1HUVA 2DZVA 1AL7A 2HXUA 5XIAA 3MHUA 2PDCA 1TPEA 1LJYA 1XIEA 1XH2A 3N1AA 3SQMA 3O7UA 2WLZA 3QLLA 3EXSA 4LB4A 1T96A 4RV8A 3AU2A 1UHVA 5LA2A 1CYGA 1XIHA 3ONBA 2RGMA 1S5NA 4M1BA 2GJRA 4MSSA 3KLKA 3ZSSA 1L6GA 3T44A 4B5WA 4P7RA 3GG7A 1A0CA 5F1UA 2OOGA 3UG5A 2PWEA 4PB3A 1W56A 5CSSA 2HTMA 4D6GA 1LQ2A 2OODA 5CJMA 2O56A 3PNZA 5A3HA 3LNMA 1CZ1A 2VEPA 1UOKA 2A79A 2C0AA 4LY4A 3VE9A 4DI8A 5LIXX 1EGZA 3JR2A 1G4SA 4J1OA 1GVIA 2QCDB 3PAOA 2ZRYA 1PL9A 3H4WA 2WBKA 4D6HA 1VBHA 4HMEA 4Z1CA 4JCMA 3H7UA 1J5SA 1C9DA 1HN1A 3FY1A 1TQJA 1E1CA 3PBMA 1T99A 3RM4A 4GYJA 1T8QA 1ITUA 1XLIA 3JU2A 2GYIA 4Q4QA 1EP3A 5LZLA 1LDCA 4OUEA 2CLKA 2BOGX 1OX4B 9RUBA 4K8HA 5G4HC 4DNHA 2H8ZA 3GBDA 3S6TA 2POZA 3M7SA 3LG3A 4Q7NA 2ADAA 4PMZA 4HT3A 3UY7A 3HPAA 3SGUA 1K4HA 3IGXA 4CCEA 3CH0A 1S5VA 2NV1A 1D3GA 2VWSA 5CBIA 4MY9A 3N2MA 3H2FA 4JTUA 4O50A 5EA9A 1OGSA 2OXNA 1NARA 4LCQA 4DWSB 4WJEA 1JZ4A 4DUOA 1WAWA 3R79A 5BW6A 1XLCA 3CB3A 4PODA 1A5MC 3NEVA 4XZNX 5T91A 1W5QA 4HSHA 1M7OA 1B1YA 3HU7A 3P81A 4UFMA 3RUBL 5T26A 2PLMA 3OPSA 1A50A 3FJLA 3WF3A 3W01A 3S9IA 3FX4A 2WMFA 4LH8A 4J3XA 2Y8KA 3MUAA 3DENA 2GGIA 3BK0A 3TSMA 3L2IA 4IFRA 2Q8ZA 3PZNA 3WMLA 2LLEA 3G8EA 3M0HA 1OX6A 1RQBA 1A0DA 1DQXA 1EJTC 4LUTB 5DCBA 3POCA 4C6JA 2D1ZA 4LS1A 3UXDA 2ZZ1A 3ARPA 3J7HA 3SRDA 4NI3A 3A12A 4QIUA 3GDKA 3OVQA 4L65A 3GAYA 1FWTA 4INFA 1HO4A 2ZBTA 5DMNA 2WMIB 4N2YA 4RNFA 2YL5A 4MAVA 4HOZA 2HZGA 3H7RA 3AYTA 2ASHA 4HMNA 4DN1A 3SUTA 3WQ4A 4P5UA 4DBWA 4FX6M 4C6OA 3L5AA 2GVYA 4JQ2A 1VF8A 3CT2A 1OCNA 4JXCA 3L68A 1GT8A 4OHQA 1Q6LA 1ONRA 4GHRA 1F3TA 1J96A 4NNCA 3NDYA 2JE8A 1V6VA 5DLCA 4AIEA 1D3HA 3FLUA 1KW1A 4ZXLA 4IQEA 2UY2A 2GZXA 3GWQA 4ONVA 3BSGA 1UWRA 3B8SA 4TXEA 1LP6A 1G7VA 1XFBA 1Z42A 1WZLA 2OLHA 2YA0A 3RR4A 3RO6A 1TTPA 4J2PA 3ARQA 5JVLA 2E5BA 3QY6A 4R34A 2NVDA 4GCAA 4ATWA 1AQHA 4XD6A 3URNA 2YZ5A 4N0RA 3L4TA 3BG9A 1R3YA 1OJXA 1SFTA 3WDJA 5K7JA 1LLOA 4DJED 2P0OA 3OVGA 5EBUA 1P1MA 1PDZA 4C5YA 2VEGA 5FSDC 4RE2A 3WD0A 3DI0A 2PWHA 1TV2A 4S3KA 1W17A 4NUWA 1X6LA 4J5NA 1BXNA 1GONA 2QCFA 3WH5A 4O1CA 1LWIA 3VOHA 1Q6RA 4JS3A 2J88A 3IVUA 4ORMA 1UUQA 1G9HA 3LHWA 4O53A 5A8NA 1O5QA 5LIUX 3AS1A 3WLMA 2PDFA 3NFUA 4NJIA 1KFKA 4GJIA 3VD5A 5EMKA 5HMDA 1S2UA 1IEIA 1LROA 3ZVHB 1AH0A 4NL1A 2ESCA 2PWVA 3ARXA 4JD4A 3SCVA 4UTTA 2QPUA 3VIFA 2FKPA 3FA3A 1SSDA 2HQAA 4KFOA 2WC7A 1E56A 4XBJA 2UZ9A 1UWTA 1V6XA 3HFYA 2BGNE 3AC0A 5I6SA 2YYUA 4PFMA 2ZX7A 3VD7A 1XINA 1HVXA 4E3TA 2VQTA 3VYLA 3ITYA 4I6VA 4A8NA 4CNTA 1YW1A 3BLFA 4D1IA 4H6RA 3TXVA 3S1WA 1ZPTA 3VC5A 3U7BA 1ZCCA 2VO5A 1QRQA 3BH4A 4US6A 2ZZ7A 4NAFA 3EDEA 4UOQA 3WNPA 5CZSA 3KW3A 3WQFA 1OIMA 3M0KA 2XHYA 5CSUA 4CNUA 3B03A 4RPPA 4ZB5A 4UTKA 3ENLA 4QG9A 3UY8A 4ZOCA 1ZB5A 4LNCA 2WMHA 1ZBVA 1X1OA 5EJZB 5EL1A 4JTRA 5AYIA 5EMJA 2CHOA 2EO7A 2GQ8A 3DYMA 3GHTA 5DMYA 4HJFA 2WOQA 3GSMA 5D2VA 4LAKA 4QISA 5IFTA 4UUIA 2ZXAA 1Z48A 3WUGA 5CC7A 1VJSA 3PS7A 5C8BB 3ZLGA 1XSKA 3TWAA 1PKNA 2FGZA 4FNSA 1IWAA 5DT5A 3PSWA 3LM3A 3VI2A 1MI3A 1AMKA 3AMDA 1BHGA 4AY8A 3L0KA 2BVDA 4HMCA 1IE7C 1EDQA 1K77A 2WSPA 3C56A 3W74A 2ICSA 3EWWA 2WYSA 4GZ7A 1TPH1 4HIBA 1WQ5A 3S4TA 5B80A 4JFTA 2NQ9A 2VFIA 2ONEA 5EKYA 3SUUA 2GJXB 3DN5A 4GYPA 1Q5MA 1ODZA 2RJGA 4NZ1A 3MUY1 1OSEA 3DFQA 1YNQA 1PZ1A 2V3DA 1VAHA 2QUTA 2VC5A 2TSYA 4XZLX 3T0BA 1KBJA 1LG1A 1ICPA 3TTYA 2D22A 4LALA 4RW5A 2OSWA 3RXZA 5I02A 1BRLB 3T2QA 4M81A 2HWGA 3D5HA 4YNGA 2ZVIA 3W1TA 1PTDA 1S5WA 4LVAA 3P0XA 3VMOA 1JDEA 3WQ8A 3PUDA 1CBGA 2WVVB 2WQDA 4ZB2A 4I8YA 3G1RA 5CPOA 3EKZA 4IJRA 5ABEA 1KWKA 3WD1A 1Q45A 4CLMA 3ZT6A 4LCRA 3ZR5A 4H2CA 1JL8A 3BCFA 1CLVA 3GU2A 1ZHAA 5K9CA 4PC8A 2ZFAA 4WY0A 1ITQA 3SQSA 2CC0A 3HF3A 3HTWA 5CGMA 3FVMA 1DP0A 1V4YA 2PZNA 3DBPA 3KOFA 2ZX9A 4EWJA 4R7JA 3D46A 3GY1A 1ZENA 2BDQA 1REQA 2G5WA 3I10A 1EC9A 1R7OA 1C3FA 1EX5A 5JBDA 3CUHA 1EFZA 1BYCA 5EMYA 4A2RA 1PO9A 1DWGM 4G2DA 5DCEA 3WH6A 4IUGA 2J66A 4AG0A 3HGJA 4MUPA 2AGTA 1B3VA 5BOOA 1XRFA 4L4LA 1JIBA 5D8WA 2OELA 1DVJA 2POTA 2C16A 3M0VA 3RG6A 1EP1A 3CL7A 1RR2A 4R27A 3QW4B 4JTKA 4AH7A 4ZL1A 4PUUA 4OOUA 3UCCA 3H70A 2OYLA 2W62A 3MI6A 3VAVA 3DIPA 3PPCA 1LT8A 4GK8A 3H2EA 4OBRA 3UXAA 3VDAA 3MS8A 2IPWA 5F1VA 4UFLA 3ARWA 1Q7QA 3W81A 2OEMA 1PSCA 4TVUA 2C3ZA 5HR6A 1JDAA 1F76A 3IJLA 3CU2A 4LS0A 3CUGA 1XIGA 4DJDD 5JQ9A 1HT6A 3MO4A 2JF7A 3P7YA 3ZT5A 1QK2A 3OP2A 3AU6A 3NVTA 4B3KA 1RPKA 2WSKA 4XG1A 1VEOA 1V3IA 1W3TA 2R1NA 5FL0A 5LNVA 3CNYA 1HKKA 2V82A 5CC6A 4KW2A 3C8NA 2ZA1A 3WFLA 4XBKA 4GZIA 2YFNA 3LDVA 3IUIA 3RITA 1S3TC 4QG6A 2Z6IA 3KM8A 1PHWA 3DUGA 3NZ1A 7REQB 3AFBA 2Y5EA 2PDKA 3THAA 1KTBA 4MOZA 4JEQA 1JRBA 3E3HA 1TCDA 1V79A 2WZTA 2YGYA 3CL8A 4PTVA 3BJTA 1V03A 3APTA 2NWSA 1FP9A 4O14A 5HULA 4HG6B 5HQMA 3WMSA 2CNCA 3VCRA 1Q7MA 3B9NA 1RAKA 4Z0JA 3LNPA 4NNAA 1FDJA 1R85A 4LQ1A 1JZ3A 2PMQA 4O8AA 2PP1A 4PB4A 4A8LA 3WD2A 5D09A 3W2KA 1MW0A 3SJNA 3KCJA 3EA1A 1V3KA 1LWJA 5D03A 2CERA 3WQVA 3UGVA 2BV9A 2WV8A 1DE5A 2WZEA 3AS3A 1PB0A 1TWIA 3R0KA 2ZWZA 5FCZA 4PULA 1XBVA 4XAYA 3AYRA 3NA8A 1A3HA 4RNHA 1E5JA 4GC3A 2Y8VA 2VGFA 3DCPA 1SYTA 3KBVA 3AIBA 3PTKA 2QCHA 2GOUA 3WQ6A 3HGOA 3MZNA 3S5NA 4FOKA 1RQEA 1KCXA 5A1AA 5JIPA 4QX4A 4MWAD 4ZEPA 1KM2A 1WCGA 5C5YA 4D6DA 5HATA 2PI6A 3IK4A 3L66A 2YSWA 4MPQA 1MUWA 3AJXA 3U5YA 1HGYA 4KPLA 1IIHA 3L4XA 1Q66A 1KFCA 3VD4A 1BVNP 3SQLA 4ZTXA 3FYYA 4BHYA 2QVNA 4F9JA 4O11A 3T0AA 4H83A 1UCWA 3AUOA 2OYMA 2RDTA 3B8WA 5I78A 4LVFA 1DORA 2TYSA 1F2JA 3C0QA 2ZKMX 1HKMA 1QPOA 3WUEA 1HJSA 5E5CA 3IUHA 3REQA 4UBPC 2GSJA 1KV8A 1R2RA 5D38A 1EJVC 4XAPA 1BWKA 3KDOA 4R33A 3C2EA 2VX6A 1PZ2A 2CZFA 1UH4A 2DP3A 4I7VA 5HNTA 4KEUA 1QAPA 4Z2JA 4IP5A 3L0NA 4P8XA 4D71A 4DHGA 1TTJA 4LB3A 1HL8A 3TTEA 3BSMA 4JKKA 3N12A 3DHUA 3HV9A 2HVOA 3VOIA 2BXYA 2VEMA 3KL3A 1J0KA 4XD4A 1KFBA 4WZHA 4JYFA 2X0SA 3DFHA 3NYZA 1XYLA 3BQ6A 4W86A 3M1ZA 1MXDA 3USBA 1MZHA 3W1AA 5DRCA 1AQ0A 3NUKA 5CG7A 4RDVA 4Q4RA 1ISYA 2NX3A 1U1JA 1V51A 3TC7A 1H1NA 3XIMA 3TJXA 3W26A 3WQOA 1TCMA 3SBFA 1ZP3A 3NQBA 3VMPA 1VCFA 4WKHA 1IEVA 3SGZA 4DM1A 4X9SA 3EWXA 4IHCA 3PBGA 3I6RA 3ZM8A 1UQYA 2OLAA 4I90A 2X1SA 4NRSA 1FWNA 5LNWA 4JFWA 5TNVA 2WO5A 1QMLA 1K1DA 1LOQA 2DQXA 4Q33A 3RCYA 2QT3A 3ONCA 3ZSTA 1SJCA 4JL1A 3MYOA 2E3ZA 2NZLA 2Z27A 2INFA 3CAQA 3W7KA 2RKXA 1BD0A 4ZO9A 7XIMA 1V08A 3LCXA 4TTGA 4L64A 4ZQCA 3QSTA 5DO8A 3THUA 3ABQA 5I7GA 4PRTA 1E6SM 1XUUA 3W1QA 2F9RA 1NWUA 2DZXA 4B5UA 1QU4A 2I7GA 2I9EA 5FJOA 3VIIA 3GK0A 3H8AA 1FH8A 1WKDA 3A3HA 2BP1A 4DVOA 4V28A 3QV7A 3HGRA 3GNXA 1TWDA 2V2DA 3SO7A 5D4YA 4PTMA 4MYXA 1M68A 1FHDA 4YHGA 2V9DA 3KEHA 1LQ0A 3KP1A 5H8PA 4NF7A 3V1HA 3QOKA 3FJ4A 2QZRA 3NQMA 1H1ZA 3VA8A 4QLKA 3CHFA 3CC1A 4QG8A 2QPSA 3V16A 3W02A 2WZHA 1YRRA 1K8XA 4V27A 3R0UA 1H2JA 3IVTA 2XTKA 1EZ2A 4FX8A 3DECA 1FWCC 4NIRA 4TOQA 3OGRA 3QFWA 3ZJ8A 4XIAA 1E3ZA 1YHTA 1LRQA 2BVTA 4DI9A 2EGZA 3P14A 3MCOA 1WZMA 4NZ4A 4MFDA 1FWDC 1IXOA 3K8MA 3KDNA 3GBEA 3KRBA 3EGJA 4PUNA 1VD6A 3LMZA 1BXCA 4ERIA 1KRMA 1Q65A 1UC5A 3VKAA 1HJWA 1H4PA 2CBUA 2NUXA 4F0RA 4PUWA 3S1UA 3PN8A 3G6LA 1GVYA 4CCZA 2FH8A 2ZUNA 4O12A 1XDLA 1AUSL 1KCZA 1J0IA 2W3ZA 3QR1A 1UD8A 2WKLA 1M04A 3UG4A 4MB4A 4UOJA 1O5RA 1J01A 2QULA 5E0FA 3TTSA 4UFHA 4CKQA 5KMYA 1JZ2A 3DXIA 4V1YA 2WJDA 4H8VA 2PRMA 4U2ZA 2VKZG 4REQB 4ASTA 3N2BA 5TBOA 4M3PA 3ATYA 1HJQA 3EOUA 4UZUA 4EF9A 1VLWA 1Q6DA 1V3LA 2BZNA 3GZ3A 3TH6A 3VOJA 2WMKA 3L67A 3RNDA 1E6QM 4W93A 3CT7A 5A8PA 3LLDA 1XLGA 7ENLA 1GPFA 3RM9A 4GIEA 1OFRA 4HNLA 1TJ1A 3CM4A 3CZGA 3LX9A 4GUIA 4HN4A 4KBXA 4LBUA 1XIFA 3GXTA 1OD0A 2EPLX 4RPQA 4M7SA 4PL2A 2W9MA 2FHCA 1VRXA 2DZPA 3KBWA 3MP5A 3U7VA 3WELA 3IACA 1X96A 2DZBA 3NL3A 3CLMA 1LCOA 3W7GA 4GG9A 5LA0A 4MNMA 3UJEA 4RE0A 3ZLHA 3ZYZA 2C79A 3RU8X 3W1UA 5C6MA 3GDLA 1PE1A 4HOWA 4I9TA 3PM6A 1VR6A 4L4OA 4XAZA 2ISVA 3D3FA 4AWUA 4AY1A 4HOXA 4DUXA 1KM3A 5D2TA 2QYGA 4DM2A 3KCOA 3MSYA 1G7UA 3VM5A 1JZ5A 1XWYA 3CZKA 1LZOA 1OX5A 1VS1A 2DFAA 3WJWA 5G4EA 1BSIA 3L23A 4HNUA 4ZR8A 3LPOA 3LGDA 1DXEA 3N6QA 1MVYA 2E6DA 3NSXA 4W85A 2F6KA 2G41A 4ACYA 2C91A 4FAMA 4H8HA 3XINA 5I24A 5G1YA 2EHHA 3TNBA 1K9TA 3RIKA 1JG9A 2ZYFA 3P5YA 1ECEA 4H2HA 3N4AA 3QBUA 1JCTA 2ABAA 4NAEB 2CLOA 1Z89A 1L0PA 4AVNA 2ZC1A 1LUCB 1JAKA 1DTUA 3IARA 1TSIA 4QE1A 1XD1A 1QO2A 2QUUA 4J3TA 4DYJA 2W27A 2TODA 4L5ZA 4JY8A 4M19A 1JCJA 1P0BA 1UQZA 1H7PA 4LWWA 2VVSA 3K13A 4NXSA 3TMQA 2CLEA 2WCGA 3CZEA 4FI4A 1RCXB 3ZS4A 3WDIA 3BZGA 2INZA 3F5LA 4UNIA 4NZCA 4E6MA 2W79A 3QH2A 2BHYA 3WH7A 3PTDA 3IIXA 3LLXA 4O4VA 3SCTA 4X60A 3RRAA 4BZYA 3T4CA 3TEVA 1Q4NX 1DJWA 3L2LA 1NFPA 4RZBA 1KRAC 4CNPA 1UD3A 2I17A 1F73A 2OT1A 4RK8A 1ZCOA 2QJNA 1OWQA 4XIMA 4V2XA 3FCPA 1REQB 4ZXOA 3L21A 2R1LA 1EDTA 4EPDC 4DWSD 1VENA 4PUEA 1QOXA 4JQ3A 3SCQA 3H21A 1BKHA 3BOFA 1BAGA 3B0VC 3ALGA 1XH1A 4FF5A 4JTAA 5E1QA 1EKOA 3R43A 3O63A 1VYRA 9XIMA 4KF1A 3B06A 3KZSA 3BGJA 3LZ3A 3CO8A 2PTDA 3S2NA 1L6YA 3MVIA 4WUIA 5I3DA 3ARZA 2OLSA 1V8EA 5EY5A 5KZDA 4UTIA 2WC3A 4FPSA 4GYPC 3BLPX 4H7VA 1F74A 3CMGA 1OT1A 1ZBWA 3K5XA 4MG4A 4QDMA 1SQ7A 1AW5A 3H12A 1PXGA 3ARRA 4DJEA 1R47A 2VDGA 4B16A 3AOFA 4MNJA 1YQ2A 4JEJA 2V38A 4YTRA 4LYPA 1QT1A 1HJUA 2D24A 1AL8A 3M4HA 1GG0A 4S3EA 1DIOA 4I5UA 2ATSA 1E4MM 3WH9A 4W7VA 1Y8BA 3L2MA 5A5WA 4NT0A 1XCXA 2PDBA 2V63A 3BV7A 3OYXA 2L5HA 2FMOA 3DH7A 2VC7A 1ONXA 3WNOA 4XWUA 1F3WA 5D2WA 4POCA 3FFSA 3TFXA 4EIVA 1TPC1 2QCEA 2J7GA 4AISA 4AQLA 3W7IA 4H19A 4H3DA 1P7TB 4FXSA 1NEYA 2VENA 1R3RA 1A47A 3IRDA 4DBDA 4AHQA 5LIWX 1KA9F 3IJ6A 3EA2A 3WK3A 1G4TA 4UTLA 2YW3A 3IK2A 1SO6A 3AYVA 4FXFA 4O8RA 2I57A 3GVQA 2ACQA 4GYKA 5C7HA 4M0XA 3MJYA 4HYRA 4Z42C 1VEMA 5A94A 2O4MA 3NQCA 3IV3A 4FK9A 3VGBA 4B92A 5FF7A 1C8XA 2CZEA 3VNDA 1GOQA 4HB7A 4HHPA 3MMTA 1MZRA 4YMZA 4P7OA 5H6HA 1FKWA 3B8TA 1KXVA 3W6LA 1GPWA 4O54A 2BGQA 1Y5XA 2WNZA 3P67A 2RUSA 1UC4A 3GC4A 1RXOB 3AHYA 3WY1A 1JI2A 1D8WA 3PTQA 4YU1A 1D3CA 3W1RA 2C6QA 5TQLA 5LXEA 2WSRA 3AWOA 4C5ZA 2PURA 3S5YA 2CYGA 2P50A 3WJZA 2WKGA 4C6LA 3LCGA 1W91A 3RLHA 4GXMA 5DY3A 3E02A 4W8LA 4RDZA 4QDWA 3NQ6A 2XH7A 4AVOA 2VR5A 2HNEA 4A8RA 1X1NA 3ZWSA 4GVIA 3E0LA 1WDDA 1AK5A 4BF5A 3BLDA 3KBNA 3HIJA 1LBFA 2YB1A 5BROA 1H5YA 5F2MA 2ZDRA 1VCGA 3EX3A 2CETA 2Z0IA 1EA9C 4TU1A 3RX4A 4O1AA 4WDXA 1AG1O 3VILA 3DI1A 4UTMA 3S8HA 1HP4A 5K4ZA 3E96A 1KKOA 8RUCA 1XLDA 1FUYA 4N42A 3JW7A 3U3HA 4F3HA 4M24A 2ACRA 3RR1A 5BCAA 5I03A 4XO6A 2NT1A 3ZIZA 4ZOEA 3V75A 1PJ9A 1M7XA 3S5OA 3P0WA 2Y5SA 4YWIA 3MV11 1DJXA 2B81A 2BFGA 4YIWA 3QOMA 2IQ0A 4ZFCA 3CHVA 4GJ1A 1V6YA 3HO8A 2QXWA 4BEQA 1NELA 4HN8A 1AQFA 1BGGA 3NQGA 1QVBA 1Z44A 3E5PA 4UXDA 2PTXA 5ABFA 1PDYA 2E8YA 2X1RA 2YA1A 3ABOA 2ZZ4A 1C90A 2H8XA 2QR6A 1ZBKA 2OGJA 3AALA 4Q6JA 2BWGA 2OZ0A 1NFGA 1NM9A 6TIMA 4GQGA 3MVTA 5M1TA 5H2ZA 3W0KA 3LHTA 3DERA 6XIAA 1QNOA 3KRZA 3L4ZA 5HOSA 2WXDM 4DELA 3WBEA 1NJJA 4E2OA 1OF6A 4W7WA 3AIRA 3FYOA 4P8UA 2NWRA 3KTXA 2E0PA 3OEXA 4HNOA 3AROA 3CQKA 4CNNA 1KCLA 4JIPA 1JPKA 2J74A 2I56A 3MKKA 1K02A 2QVHA 2FVKA 4PMJA 1XICA 4MKVA 2ZX8A 2Y7EA 1J5TA 7TIMA 2PUZA 1CGYA 2CESA 2FHBA 2AQWA 3STGA 2JIWA 3Q37A 4LXFA 2XVKA 2YDAA 1M65A 4GUHA 2XZ7A 1TPUA 1CNVA 5AYXA 1YTEA 2YCKX 4AIBA 4NRRA 1HZYA 3VINA 3TA6A 3W7NA 1P0EA 1HG3A 4DNMA 3IJIA 2ISDA 5BRPA 3MV01 1KQYA 5A6KA 3DYPA 6ALDA 2A3HA 4MAZA 4L9YA 3VIGA 4B15A 2GGHA 5EGRA 4AZCA 2BODX 2REQB 4JTJA 3AUJA 2X30A 3TR9A 1BYBA 1ITXA 3OGSA 1L6SA 3G1HA 2ZA2A 3SRFA 1C29A 3OB8A 1ESWA 3NPWA 3IJDA 4CVUA 4OZOA 1EF2A 1K6WA 4XK2A 1KRCC 4JTEA 3O1NA 4LUTA 4LTSA 3AZRA 1FFQA 2P8CA 1FTXA 5J5RA 3VFCA 4WXYA 2G0WA 3ZO9A 4WDWA 4Q7BA 1CCWB 2IUZA 1KM4A 5GNXA 1T40A 1XYAA 1TPDA 1LLWA 3N6HA 1BLIA 4HZ7A 1PCKA 1GYMA 1VFOA 3OZMA 2FGBA 3SUVA 3D3AA 4QXIA 3CBWA 4XZWA 3GW3A 3EWCA 1E3XA 1SZRA 2C14A 2ZTKA 1PKYA 1VFSA 3KHJA 3WG6A 3FDGA 3AMKA 3FNDA 1XR2A 3OG2A 3MSGA 5I5RA 2Q09A 1F5ZA 1N7KA 1IEWA 2VR2A 4FF7A 2CHNA 1R3TA 4FS9A 3IJ7A 4J3ZA 1VFMA 3VKKA 3VUSA 2ZZ6A 4DWSA 4AYSA 4CVWA 5FL1A 3N4FA 5FJTA 3SSJA 3S9YA 1PZ0A 1WDSA 4LV9A 4QEEA 1PKMA 1S5TA 3A5VA 1UBPC 3LUTA 4N9DA 3TYUA 1Q2RA 4F0HA 4IMEA 4IIBA 4MJ4A 4LANA 2E40A 3DG6A 3CK5A 1BF2A 4F79A 2JEPA 1O68A 5C2GA 2CPUA 4RCXA 4DLMA 1MXSA 1VPXA 2W91A 1PAMA 1IZCA 3ZR4A 1RCOB 4DJFD 5EB8A 4XD3A 1UWUA 3NWRA 2DW6A 3C5QA 3ZZ1A 4JKMA 2HROA 2IKIA 4JTIA 3LBMA 4C7FA 3EX4A 5CGQA 4YJ5A 6XIMA 2WVVA 1C8YA 4GBUA 1UZ1A 3N4EA 1TMQA 3MKVA 4N9CA 1LRNA 3NIYA 4OU1A 3VOCA 2VXNA 1S2AA 3RGTA 3QZ6A 1XIBA 3TJLA 3B04A 3E1F1 4EPKA 1L2QA 2WM0A 3B8VA 4XZHA 3GIPA 5K9XA 1LUCA 3DHPA 4C1NB 5E9AA 3IJ9A 3GXNA 2VTFA 1EUNA 3MSDA 4BEUA 1OYBA 5C9WA 1P0KA 4UB9A 2W63A 2KAUC 3FGCA 1Q6OA 1W5PA 3CIVA 2BSLA 2D69A 2Y63A 4MZ1A 1FWJC 2V5CA 2NQ5A 4AHPA 4RNJA 4PN2A 4QSHA 2HVNA 1SVDA 2O9PA 4WSKA 3LMYA 2NQHA 1RJPA 3VD9A 3OZOA 3UXKA 3RRXA 4BF7A 1XHGA 2E67A 3GVWA 1SMDA 4KESA 1JPHA 1JR1A 3UR5A 1GOXA 1W3KA 1ICQA 3UEQA 2DW7A 1E5NA 2CLFA 3RCMA 1W1VA 1NWRA 3ITVA 1ADDA 2J7HA 5I3KA 1JF5A 1DJZA 3QPEA 3IV8A 1V3MA 5FI8A 5I09A 1GUVA 2AKZA 5E0CA 3KVKA 4IQJA 3GC2A 3W6MA 4XX6A 2Q71A 4JKLA 2X1UA 3PNUA 4A3RA 2PWFA 4EPEC 1Q6QA 4A05A 4D8AA 2XVGA 4I9AA 3AJ7A 3EPOA 2E6AA 4I6KA 4S3BA 2PC8A 3S1VA 4OJYA 4NILA 4QJ3B 4CU7A 5A6JA 1WKEA 3NO3A 2VCAA 4UMAA 4FNQA 2QCDA 3NZPA 1FXQA 4JTLA 8CGTA 4R9OA 4H00A 2A3EA 1O1ZA 2OTDA 1VYPX 1HKIA 5IDZA 1EX1A 5F4SA 1K70A 3EMQA 3DBNA 1V3HA 1V3JA 3G0UA 2QJMA 3WEOA 2NQJA 7TAAA 2OX1A 5A69A 1RJRA 3MMDA 4D6EA 3QHOA 1XRVA 2VC6A 2Y61A 3LXCA 3LV5A 2B7NA 3MDWA 5CEWA 5EMUA 4HK6A 3LB0A 4I5RA 3BURA 4H9TA 4NI8A 3TMLA 2NQZA 2Y0FA 4GVGA 4C6IA 6A3HA 1U1HA 2GK1A 1MXGA 4PFHA 1TIMA 1WBJA 2C13A 2J7DA 1YE4A 4WHBA 2ZXDA 1GW1A 2DVTA 1YNPA 4AD0A 3NQAA 4IIGA 4MNKA 2OR2A 3QPZA 2QEZA 2GVLA 4J4KA 3U4FA 3VMNA 3NDZA 2J8GA 3GUWA 4J3WA 2R14A 4JHZA 3PP7A 2DQWA 2NXIA 4FXRA 1X7FA 1W5NA 4NU7A 3PZOA 1UMLA 2EPNA 2HE8A 1GVQA 4XKYB 1L8NA 4IIFA 3TX9A 2WM1A 3E9AA 1VJZA 2X1TA 1GJWA 3BE7A 3UW6A 2V68A 2E8ZA 1DOSA 2Y8UA 3NZRA 1WAUA 4PUMA 4R53A 1E6NA 2MNRA 3BJFA 3TYDA 3G5EA 3NAVA 5M17A 4WCJA 4FIRA 2ABBA 8A3HA 2CXEA 3W7RA 1XDJA 4AXNA 3TONA 1E71M 3GRIA 1PS9A 2VFDA 5CPSA 3FA5A 2P8BA 3WFZA 1MNSA 4JTGA 2PTZA 2X0HA 2HJPA 4C6KA 1CLKA 3MI2A 3W1NA 3HPZA 4QDPA 2DEPA 4YYCA 4K1GA 1K7FA 1FHLA 1DJYA 1HKJA 1K4GA 1Q6EA 2DSWA 1KLYA 2O0TA 2QIWA 2VDHA 2WWDA 3AHXA 5DELA 1NF7A 5BXSA 4S38A 1XLAA 2BXVA 4D6JA 1R3VA 1BSLA 3AYSA 3DX5A 3XISA 3KE0A 3LZ5A 4JFSA 1H09A 3REQB 2KX9A 4TX9A 3O6YX 2TPSA 2ODOA 4QLJA 4MUZA 5DRIA 2Z4GA 5CQ1A 2GOKA 4EE9A 1IZJA 1F4HA 1XUZA 2DPEA 3BCJA 8XIAA 5LKYA 1AVAA 4L56A 1F3XA 4LOCA 2X8RA 4LVBA 4L80A 2IPGA 2FTPA 3T0TA 2CLMA 1W37A 3EEGA 1OFBA 1C92A 2PD9A 1UPPA 4DZIA 5AC5A 1W2PA 1EJSC 4HCHA 4EAYA 3CQ0A 1C7TA 4EPBC 3OG3A 3T7VA 3AS0A 1F61A 5T9BG 5CKSA 3AWNA 2DORA 1EDGA 2DT1A 3N13A 1V0KA 4RW3A 2CBJA 1DTNA 3WLPA 3AI0A 5HNUA 5D02A 4GNJA 3ZR6A 3T78A 1KR1A 5M2FX 5AHEA 1YBQB 3NZGA 3HJZA 2PDHA 2C18A 3FSTA 3LQLA 4Q4PA 1GJPA 3SFWA 2PDQA 2VEIA 4S2CA 4WGHA 2AL2B 3B0YA 1KXTA 1PVNA 2YXOA 3MP3A 4O1EA 3TCSA 3UZ5A 1TFVA 4GABA 2OZ3A 4GVFA 3G3MA 3A21A 5CLWA 1R2SA 4ML4A 1S1RA 3GXMA 3RF9A 1VH7A 2MANA 3E5BA 3S5SA 5LNUA 3MWCA 5AYYA 4D6FA 3SDOA 4A3YA 4PEEA 1RQHA 3VGFA 4OQVA 2I14A 3QM3A 3F5JA 4B9ZA 4EWND 5GVJA 4B9YA 3GC5A 1W1ZA 2JQXA 1EB3A 1UZ4A 4ZOBA 3PFMA 3WDQA 1AMYA 3QMTA 3LCWA 5CSRA 3MTWA 3E12A 2E1DA 3CAKA 1W3LA 1XLKA 4DYEA 4F2UA 1N82A 1DIEA 2P5NA 4Q8UA 4S2BA 5CPTA 3GVVA 4CNOA 2ZRWA 1JPDX 1OFAA 2VRJA 5HJYA 4M1RA 2DSVA 3U2EA 4TV6A 4XVEA 3TW6A 1FHUA 1RSCA 3PF3A 3TSBA 1XIJA 3L65A 1XG3A 3NYDA 1E1FA 4KCTA 5FF0A 5K2ZA 4GIYA 3BG5A 1HJXA 1U30A 1VCVA 1XKYA 3CTTA 2AQVA 3IVSA 1QK0A 1P5BA 1QI2A 1ISWA 2PFHA 1ZY9A 2YB4A 5BRQA 3E0WA 3NNTA 2DVXA 4G7FA 1HTIA 2CLIA 1OINA 2GL5A 2NXGA 3CIWA 3ARTA 4MPKA 1ZZMA 4REQA 4AZHA 1WZAA 2W0UA 1VP5A 4UC5A 1I2QA 4Y96A 1VFTA 4UWMA 4HSOA 3SRHA 2VELA 1TE6A 3FVDA 1OK4A 6PTDA 4OBSA 2P88A 3WK2A 3M46A 4LUSB 3DG3A 1OCBA 1QPRA 3EX6A 1TIWA 3Q58A 1KM1A 1B2YA 1VBGA 4L6DA 4DZAA 4NP7A 1SJDA 2CCRA 1VFLA 4UQAA 2OZ8A 2DZAA 1DJHA 1PIGA 1WE5A 2JIEA 1BKSA 2R82A 3P62A 4ZMGA 1EL3A 2PDYA 1RLDA 5FJIA 5CZ0A 2J9XA 4H01A 1F7BA 2X16A 2YDRA 1BG9A 4PTDA 2RGLA 3H54A 4G9PA 4HZMA 1TG7A 4DZHA 2PD5A 4GVHA 4ICCX 3W1XA 3GE7A 3H26A 3LTYA 1ZNNA 3TAOA 3BMWA 1RK5A 1BXBA 3T1GA 3CLWA 3T0DA 3VVGA 5AHIA 3E0VA 5DXYA 4Q8OA 5LGXA 1QCWA 3K8KA 3CYJA 3TYCA 5HPCA 3BANA 4PZVA 3EWYA 3KRUA 2V5LA 1RP9A 3DHFA 3Q94A 4Y7EA 1XYZA 2C7FA 3WLLA 4B3LA 3AHVA 5E70A 3DYOA 2ZDSA 4I5XA 4IGSA 3OBKA 5DX7A 4IMAA 3PK7A 1C8QA 1HO1A 2VD8A 1AZ2A 2C1HA 2ANUA 5EFDA 1US3A 1ZL1A 3W2MA 1VYSX 4X9YA 3THDA 4JN6A 4E5TA 1WKFA 2G37A 1SFLA 4J3VA 1BVWA 2J27A 5HR7A 3FJ6A 5AHFA 2R1KA 2X0YA 3P8JA 4JIRA 1E0VA 1ELSA 4M6UA 4O0QA 5FSEC 2WK2A 1JCLA 3HG2A 4WSJA 3L4UA 3WBWA 4RNIA 1BPLB 3C0LA 1GZJA 1XIIA 3BAJA 1O5XA 1EEPA 2YLAA 3TN3A 3W53A 4Y9NA 3QTGA 3TLLA 4O19A 5MKGB 3I6TA 1H41A 5D2XA 1H60A 2QCNA 4K1WA 5BMWA 1OG6A 5D8ZA 2A1YA 3VIKA 4XQ6A 4JTCA 2PTYA 4ZQOA 1E72M 1E43A 3PZQA 5J5DA 3RU6A 2DZUA 4M6QA 3BLKA 2C71A 1VQTA 3RO8A 3GVGA 3KBJA 3V3WA 3O07A 1H0IA 3I3EA 5FEWA 2XFFA 1U5HA 1XBXA 4PUJA 5BYWA 5DCDA 3ECQA 3WUFA 3TKFA 1BEUA 4JN7A 3C3UA 4LCSA 1E4LA 1ISVA 3JVAA 2HISA 1OF8A 3IS4A 4P7LA 4JR5A 3NDOA 3FJNA 1EHAA 3W1PA 1EA0A 3GTXA 3CGTA 3PZGA 1TV5A 1UH2A 2NXHA 4K8EA 3HN3A 3SM0A 1H62A 1XYCA 3W73A 2PF0A 2BLEA 3NQVA 2D2OA 2OWWA 4A4AA 4PBEA 3LCLA 3JRKA 2Y88A 2DT3A 1K7EA 5EMLA 2AL1A 4RDYA 2YCIX 8XIMA 4LAMA 3KLLA 1X39A 3VNYA 1UWAA 1GGOA 1EO7A 3OODA 1TJPA 3EAUA 5HWJA 3WNKA 1KGUA 3PULA 1XSIA 3WMCA 1J10A 2H9AA 2PGWA 3SECA 4BI6A 1BTCA 3ARYA 4FEZA 1QWGA 4MB5A 1J2WA 4QR6A 1V02A 1V7YA 3NG3A 2PGEA 1EIXA 2OB3A 2O4QA 1CX9A 3PFRA 5BOEA 4AD1A 5H91A 1H1YA 2DU2A 1I0BA 1JCNA 5A95A 3M0ZA 3GXIA 1VHCA 4I7UA 2QJGA 3S6DA 1A5LC 2XFWA 4U10A 2JGYA 2X2GA 4RZ4A 5KSWA 2A21A 2FZ9A 5D9OA 4S39A 1EHNA 3OQEA 1VFFA 2ZUSA 4HYWA 1OGBA 1TO3A 1OABA 1B0IA 1A5AA 5A8MA 2Z2UA 2D0FA 5FACA 5H1WA 1GG1A 4A3QA 3C61A 4NVTA 1IHIA 4K39A 4JICA 4FB7A 2QLYA 3PVFA 2OQYA 4CQDA 2YPIA 5CPLA 2DSZA 1JZ8A 1SJAA 1PYFA 4EK7A 3NQFA 3TZFA 1KXHA 1JVNA 2OSYA 2WZMA 1Y5VA 4Y9AA 5CAHA 3BO9A 2WCAA 5BRBA 4UNLA 4IPLA 1HP5A 5CZJA 3OQ8A 3W23A 4AWTA 1J11A 1Q85A 4FLOA 3T42A 1UKSA 3VFLA 1QDSA 4LUSA 4S23A 5BXTA 1JZ6A 1O12A 1T5AA 4IM4A 2JFEX 1FWWA 3C4UA 3PZMA 1J8VA 2DSKA 4LAUA 1TWWA 3GNRA 3W86A 1S39A 1VEPA 1OYAA 5K9DA 4HHLA 4XZ9A 1SO4A 1QNVA 3SN0A 2IKGA 2CLPA 1F8IA 3A13A 2XU2A 3KAOA 8TIMA 4M29A 1U22A 3OU8A 5C71A 4AFYA 2CBVA 3OTRA 1QTWA 3QYSA 4CD5A 1FWGC 3TYBA 3GUGA 3EWBX 1VBUA 5KZMA 2VZUA 3R5EA 2VDIA 2D23A 3B9EA 2D2JA 3F1QA 3EWDA 3SY8A 4K38A 4D6CA 3UWQA 1S2VA 1CDGA 4NSBA 4KQNA 4HZ8A 3S2LA 1JD9A 3AIWA 3ZQ9A 4C1LA 3KOWA 1VPQA 1FWAC 1E9IA 4DUVA 2V69A 4KFNA 5DMMA 4ZGYA 1UR8A 5MHBA 1A4MA 5I3JA 3GDBA 3A4AA 4GMEA 3DFNA 1HGWA 2Y85A 3HQPA 3ABRA 2H6RA 5I00A 3II1A 3U2ZA 5LHEA 3WDRA 4W8AA 3SCNA 4GX8A 3Q67A 3W29A 4D9PA 4G6CA 1R9XA 4XUGA 4UTJA 1QXLA 3H53A 4E0CA 1CB7B 5HNRA 1E6ZA 1NSJA 2J6XA 4AY7A 1VB9A 3KTSA 1GOMA 4E4FA 1WYIA 3WLOA 1S1PA 1A49A 5B7ZA 4Z2IA 4H41A 5D33A 1X98A 4D8LA 4C90A 2YKKA 1BFNA 2PP3A 2VCCA 4DF0A 4ADUA 2FPYA 4HTBA 1GQJA 5FF2A 3S2MA 1UZHA 4ZQMA 4GUFA 4FNRA 4GY7A 3IIVA 2IS7A 3PG9A 3DZ1A 1V0MA 3EBVA 5D37A 3LI1A 3SADA 1QNSA 3NM1A 3TQPA 2Z2BA 1XPGA 1JDCA 3A22A 3L0GA 4AIOA 1PHQA 4YS1A 2Z6JA 3WLHA 1MQRA 1QW8A 5DQPA 3TP4A 3DKLA 3RX3A 1EUAA 1EGMA 2O9RA 1YX1A 3V5CA 3R2GA 2Y1HA 1RY0A 4AAJA 3QEZA 5HQEA 1WNOA 3EB4A 5F7UA 3BMXA 3VNKA 4B2DD 4HZ6A 2VFHA 2IPFA 2X7VA 4QSFA 3VIJA 2ZA3A 1S5MA 2GJXA 3CXOA 2UY5A 5U4NA 5FJUA 3SGGA 4S3CA 1XCFA 1VBRA 1SUXA 4OV4A 5C9UA 3UBPC 4W87A 1FH7A 2DVUA 3FSUA 1OCQA 3WL0A 1XLEA 4UTTC 2Z7GA 4MM1A 1DPMA 2PCQA 1MDRA 3P84A 2VQUA 4IG2A 2XWDA 1PV8A 1HW6A 4PA8A 4IQLA 1JUEA 3W70A 3FGCB 3T6CA 2XIQA 5CGTA 3KP0A 2FHFA 1JDFA 3TXZA 1VC4A 3BOXA 3ITXA 1NTHA 4MMWA 1XBYA 4ROPA 2PA6A 3HOJA 5I07A 1TVLA 3SSZA 4YPJA 1KBBA 3ABZA 3UD6A 1OHLA 3N2XA 3WEMA 4Q7IA 1LF1A 1X7IA 2ZOXA 4GA8A 4KCWA 3U2OA 2O7SA 4GXWA 1YMYA 1YIXA 3EDJA 3SAZA 4KWOA 5GPRA 1GEHA 5EBAA 1AJZA 3WQCA 4PMUA 3MU7A 2XYLA 5L6UA 3UGRA 3M0LA 4M5PA 1P0DA 4AIUA 1U33A 1UOZA 5DXXA 3UXIA 4A2SA 5L9FA 3GTIA 2GGJA 3EX2A 2A5HA 3QZEA 2CKRA 3M0YA 3LERA 2BX7A 3FOKA 1QNPA 3JUGA 3NXLA 1B54A 4FIQA 4PE8A 1TUXA 2V81A 4M56A 2PWDA 4A21A 4PMRA 3VNZA 1C7SA 1TB3A 1LORA 1EPVA 1PKLA 4BQ3A 4AMCA 1V7AA 3SFKA 3RMEA 3T8QA 3N2TA 3FHAA 4XB3A 4ERGA 1GKPA 4JTFA 2RDWA 3AMCA 2OYKA 3CAVA 3NPVA 3GDRA 1GYNA 4H1ZA 4UFIA 3N14A 3RDKA 3GM8A 1F6PA 3U8GA 4CU6A 1T6MA 3EOEA 2QCMA 4O28A 6REQA 3H55A 1OC5A 3JZUA 4DRSA 5HWMA 2Q02A 2F8QA 3ITCA 5A8GA 4KMQA 1KFLA 4YHEA 2WPBA 3CYVA 4QQ3A 4N7QA 3WD3A 3HPFA 3G1SA 2W6RA 2QKFA 1CI1A 3CTLA 5AFDA 2XZ9A 5CC5A 2Z26A 4OVXA 1OQFA 2WJFA 4JOMA 2Z24A 4GFIA 4URIA 1MW3A 4WY0B 4WX2A 4NX5A 2WHLA 2YCJA 1POKA 5J04A 4JTHA 2A7PA 3VC6A 1ZAJA 4BCEA 6CGTA 1G69A 3EPNA 1WP6A 1TVNA 2XIIA 3NJ3A 2ZRVA 2FFIA 5DANA 4HA1A 1H61A 1CB2A 5DY2A 2XN1A 1W1PA 4JTDA 2J8FA 3AXHA 2PF8A 3M7WA 1U1UA 3CPGA 3I7QA 2BMBA 3QGAC 1GQIA 1BWVA 3PWAA 2CIPA 1RZMA 3FEMA 3OBAA 1CXHA 2ZVRA 4S3AA 1WO2A 3CZJA 2OVLA 5FJJA 1XLHA 3GH4A 3ISIX 5CG0A 3TQVA 2TMDA 2B7OA 4C1KA 3NTYA 5DBUA 2HCVA 4W88A 3G0XA 1ME7A 2XSAA 4IXXA 3S47A 1R30A 4C6NA 2A3CA 2A0NA 2XM2A 3QGKC 2WQPA 2X1IA 2XGZA 4UCFA 1KWGA 1VZWA 3EMZA 3VOGA 1ENUA 3N9KA 4KFPA 4IPJA 2GPTA 1P1XA 4MWAB 4X2RA 2YBTA 4FX7A 3GXPA 5FF4A 2XH0A 4MWAE 5ABGA 1H49A 4N6EA 2PBGA 3BXWA 1LQAA 3F2CA 3O0KA 1QHOA 3VNJA 1DXIA 3M0JA 4JTTA 3PBUA 3ES8A 4WRHA 3UERA 3WO8A 1UR9A 1J0ZA 4B4HA 3STEA 3SN1A 1WOAA 5A6BD 3AAMA 4C1NA 1PWLA 5DFAA 5CXPA 2DT0A 3NGJA 1X6NA 4QQUA 1WV2A 4KRUA 4MJZA 3EZ4A 4JIEA 1DBTA 5JU6A 3QKEA 3G0SA 3HG4A 2GUUA 4CU8A 1U5VA 1XX1A 4DO6A 5BU9A 5LYRA 1T41A 3E2RA 2BHZA 5XINA 4X3ZA 2WLYA 3HPSA 1XJBA 3VTRA 5ABFB 3O05A 3ELFA 2UY4A 3W71A 3ME3A 3H2MA 2QF7A 1AODA 3WQPA 1UKPA 1ZS2A 3QR0A 4QE4A 1XD0A 3UZZA 3QSRA 3MHFA 3BL3A 3WF2A 4HKPA 3BDKA 3V0TA 4KERA 1GOOA 5A6BA 5FEPA 2DZWA 3TTOA 1W1A1 1FVPA 2QDGA 3QF0A 5JBFA 1M03A 2W66A 3LSBA 3WLNA 1V93A 3LXBA 3SY1A 3G1VA 2Q8LA 3SEPA 2A85A 3N9SA 2RJHA 4BR1A 2IKHA 1EOKA 1ALDA 1DE6A 4O16A 3ITOA 4UQCA 1DYSA 1DWAM 3S9ZA 4JDBA 4PSPA 3W76A 3CZ8A 1EYEA 1OBAA 4KRZA 1RY8A 4LBSA 4QJ4B 4JFVA 1ZQ5A 2V6AA 3M07A 4JX6A 4F40A 3IIPA 2FB2A 4TV5A 1XGZA 2O9OA 3FIGA 4QJ5B 2NVCA 4ZFMA 1M53A 3G18A 4XAGA 4QCFA 4GOAA 4R85A 3ITLA 4H9ZA 4QS5A 2ZX5A 1X1ZA 3H22A 3C3NA 1B4KA 4JIIX 1ZJIA 5C7VA 3OBEA 5G4WA 3VIHA 3MQTA 5DMLA 1A80A 2FTWA 4PMVA 4Q8TA 2D2GA 3N34A 2NUWA 2CHRA 1QBAA 4Z2KA 1IQ8A 3UWWA 1KM6A 1WX0A 1HX0A 1ONWA 4PMDA 1R3SA 4F0MA 5G2WA 2YOCA 1F05A 5E9XA 3WCZA 5A2CA 4TIMA 3PJWA 1RH9A 1AJ2A 3BVJA 1SFSA 2Q3RA 4N9EA 3KS5A 1QI0A 3UQNA 3LTPA 3VKJA 4HPGA 2G3IA 2AMXA 2EEXA 1UD5A 4IJCA 4JX4A 3B05A 2JKAA 3AIUA 2VUNA 4Q4OA 2ZWYA 4CGTA 4RV3A 1Y5WA 4GI8A 3P61A 2IKJA 2WMJA 4H7CA 4H6QA 2V30A 1PCWA 1ZGDA 4NXKA 1E51A 3BOLA 1E6XM 1FFRA 1KTNA 5I23A 2Z29A 1JXJA 3VO0A 2NLIA 4OGZA 1Q6GA 3VCCA 4UQEA 1QW9A 3Q2DA 5CBJA 4DO5A 5KZ6A 1B5TA 2E68A 1GOWA 2PBOA 3K1GA 4G7EB 3W9ZA 1XFCA 4K7VA 3GB6A 2GVGA 3O15A 2J78A 3RPDA 5HUPA 3GFYA 4TR9A 3W7EA 1B3YA 1TQXA 1JGMA 3LK6A 1MMFA 2VD9A 4KEMA 2V5JA 3QC3A 2Z25A 5KITA 1ZTVA 1GYLA 4IH3A 3TJ4A 3MKCA 1K8YA 2VX7A 2FLIA 4FLQA 1UG6A 1CXFA 2NVAA 3K8LA 3R7MA 4QE5A 2R91A 1UWIA 3HMCA 3T81A 4NG3A 3N6JA 1CTNA 3AMLA 2CWXA 3AZSA 3TTQA 2D20A 7CGTA 1EP2A 1RUSA 1JPIA 4IFOA 4GC4A 4M82A 3RLGA 2A7NA 5AOUA 2Y7DA 3ZJKA 3K1DA 3K4AA 3UR7A 2FQIA 2YZRA 3P6LA 5JH1A 3WMBA 1AFSA 2BGSA 5TF0A 2W5FA 4ZVJA 1Q8JA 2QNEA 4LUYA 3AMGA 5REQA 2OEJA 4PMYA 3CEPA 4OUIA 3C2VA 3O6AA 1T7LA 4AC7C 4LYKA 3TA9A 4XZMX 3W1MA 1HKWA 1R0MA 3O16A 4PYSA 4KWSA 1I45A 1RVKA 1EWDA 1Q7ZA 2BBFA 1A5KC 1W2VA 4U3CA 1DJNA 4HMDA 1VBJA 2EQDA 1MEWA 3QV8A 3CH9A 5I3GA 1G5AA 2ZUVA 2E6YA 5CJ5A 3S2JA 1WKYA 4K36A 3UCQA 1UH3A 3CL6A 1LL7A 3PJXA 4PGLA 3KWXA 1ISZA 1I75A 3TV8A 4HK7A 1OYCA 1EQPA 2I5QA 2YJQA 3VDHA 3SCOA 4Z17A 3H7VA 2OQLA 2B7QA 3ZJ6A 4YWSA 1LG2A 2IXVA 3HV8A 1TV4A 1OEPA 1W8GA 3TNOA 1UP0A 1OZQA 4J7RA 1QOQA 5U7SA 1WBHA 3A5FA 4UQDA 4E4PA 4XBSA 4UTWC 2BVYA 1SW7A 1GKRA 3WFAA 3LPGA 2RDUA 4E2DA 1O6IA 3RN6A 3RMJA 2QCGA 1BYDA 3KL5A 3WBYA 5DN1A 4UCGA 5M03A 1D8CA 2PDGA 2WNWA 4TMBA 9XIAA 1SM9A 1N2VA 3C0SA 2OFJA 3TYZA 5KZEA 3KBSA 5BNKA 3UG8A 4F0SA 3LHYA 3UWVA 3UNTA 4NAFB 3W37A 4D1JA 5E09A 3TK7A 1W0MA 1K03A 3R11A 3W75A 2QDEA 1O95A 5IXEA 2PGFA 2V5DA 4F66A 1ONEA 3S46A 1OZMA 2BOEX 1EWEA 1TMHA 5ENLA 3E2QA 3CWNA 1DIKA 2WC4A