3WMBA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with naphthalimide derivative q1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTLHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERFVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A crystal structure-guided rational design switching non-carbohydrate inhibitors' specificity between two beta-GlcNAcase homologs
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wmbA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3wmbA01
4WK9A 1GCYA 3MU7A 3N12A 1C8QA 3K8LA 3CLWA 1QI5A 4PMOA 4CD4A 1QNPA 3BAYA 2AOSA 2DT2A 4P7NA 1AQ0A 2VRQA 1FA2A 2XFRA 3VTRA 1TR1A 3EDFA 1TE1A 3PHAA 5DT5A 1MW2A 1HN1A 5BROA 4J3WA 1MW3A 1U33A 2NSXA 2BV9A 1UH4A 1F4AA 1AVAA 1WE5A 1MWOA 3VGBA 3VGGA 1ECEA 2EJ1A 3NCOA 3OA5A 3FHQA 2DIEA 3OLIA 1XCXA 3ZT5A 5IXEA 2XM1A 1CNVA 1HJQA 1KBKA 4OKDA 5A1AA 2CBJA 2DPEA 4LYQA 1GORA 3SCWA 3CUJA 2OYMA 1R87A 3HN3A 1MYRA 4QFUA 5EMYA 3U7BA 4JFUA 1GW1A 4D6CA 1H49A 1Q4NX 1ZBKA 4MTVA 3G6LA 4EKJA 4DWSA 4AZ5A 2ZWZA 1O6IA 5JIPA 4GZIA 3G6MA 1OGBA 1V0LA 2J7GA 4KMQA 2VQUA 5I77A 3WMBA 3VIMA 4X0NA 1UA3A 2JIEA 4H8VA 1BTCA 3K1DA 2YA0A 1E55A 4HOXA 1G0CA 1UQZA 4W93A 2WMFA 3AZRA 4UZUA 4DWSB 5FL0A 3POHA 1TA3A 5HXMA 3BGAA 1B3ZA 4PCTA 1CPUA 2WMJA 1GQJA 2DIJA 1QNRA 4F66A 1LJYA 3A3HA 4K68A 1BHGA 3VDCA 4JAWA 1NARA 3L4UA 2YDSA 1C7SA 1LG2A 4QCEA 1GOIA 2W4XA 3FY1A 1UYQA 1VAHA 3AIVA 2WYSA 3TP4A 4XV0A 1PX8A 1NH6A 4BQ2A 1LL4A 2VO5A 1J0ZA 3PN8A 4U3AA 3F5KA 1IT0A 2DH2A 3UG5A 1VJZA 4P7QA 3W25A 5I23A 1KCKA 2ZX5A 2E4TA 5BXPA 3GNOA 2AAAA 2DEPA 4DWSC 2VX7A 5AY7A 2EBNA 5E0FA 3AS0A 3ZSSA 2YIHA 4AZCA 3OGRA 4UOJA 4MAZA 4D6GA 4PMRA 3ARQA 3OB8A 2HISA 2VMFA 3L4TA 3K8MA 1B9ZA 3L4XA 3WD1A 2XM2A 1EQCA 5M5DA 5IDIA 4NSBA 4UFHA 4RE4A 3ECQA 3WN6A 1CLXA 4A3YA 2BVTA 3W38A 4AZGA 2PWHA 2EO7A 3CZJA 2RGMA 3WUBA 1QW8A 4OUEA 4C7FA 1IZKA 5ABFA 1PBGA 1DWJM 3AI0A 5DO8A 4J3UA 3VKKA 3VNZA 3CZEA 2RGLA 4JL2A 3QHOA 4Z2LA 1HJSA 4PUEA 3VIPA 2G3JA 1FFRA 3WFZA 1EH9A 1HKIA 1GOMA 1JF5A 4BCEA 3HJEA 1BVZA 3ALFA 2ZWYA 2J7EA 4R5EA 4M29A 2G3IA 3MSDA 2D22A 3LPGA 2X8RA 1V3KA 1XRVA 3CZGA 3U7VA 1DWHM 1BPLB 1E3ZA 3EDJA 3FN9A 1H0GA 1OBAA 1V0KA 3MMWA 3CUIA 1Q6CA 3VILA 2PB1A 1RD6A 2Y24A 2WHJA 4E4PA 1V3HA 1VIWA 4U2ZA 1MXDA 2WMGA 1BF2A 4WLCA 1CXHA 4PMZA 1WNOA 1UZ4A 4ACZB 3CHDA 3NDYA 1E1FA 2CEQA 1I1XA 4AWEA 1AQHA 4AD5A 2J8FA 4IISA 2VX6A 4FMVA 1H0IA 4QCFA 2AMGA 3VUPA 1BGGA 2A3AA 2BXZA 3MO4A 4QLJA 1W9BM 5FL1A 4EANA 5A6AA 5HOSA 4AZ6A 4CU8A 4HU0A 3PTKA 4UNIA 2XWEA 3QHMA 2A3CA 2BHZA 3KE0A 3THCA 3WDJA 1JAKA 1V3MA 4UOZA 1WDRA 3TTQA 3N9KA 2XSBA 4UQDA 3DHUA 2JFEX 4PBGA 3W29A 4TX8A 5DF0A 2VCBA 1ODUA 3A4AA 1E4MM 2VC9A 5EFFA 2VRJA 4HMDA 1W3JA 3SUTA 2DSWA 1BG4A 1J0KA 4KH2A 1WZLA 3NUKA 1L8NA 2A3HA 1KQYA 3F5JA 2D0GA 1RH9A 3MMDA 1GHSA 4PYSA 2OWCA 3A4WA 4ACYA 3GH4A 5CGTA 1VFMA 2CBVA 3W26A 1UD4A 2XIBA 1CGXA 4WKAA 1VEOA 3D3AA 4QP0A 3PZOA 2XVLA 4DWSD 1V3LA 3WF0A 1OSEA 4D71A 1K9FA 5ECUA 1KXQA 1QNOA 3OZOA 1JAEA 4V28A 5AYBA 3RCNA 4CCDA 2WMHA 1KR0A 2ZXDA 4W5UA 3ZJ7A 2D0FA 1JZ4A 4N0RA 2VZOA 1D7FA 5I6SA 1PJ9A 5CPQA 2Y5EA 3A4XA 1E40A 3WDRA 2D0HA 2J78A 1CEOA 1QI3A 4A4AA 2FHBA 4RE2A 1XC6A 1C8YA 5GQBA 3CHCA 3VIGA 1E5NA 3AMDA 4V2XA 5FD0A 2WPGA 2F8QA 3S2CA 1HP4A 5A2CA 5KZ6A 1EO5A 3ZJKA 4UQ9A 1UKOA 3VO0A 1IV8A 3T2QA 1E0XA 4RL3A 1E71M 4LYPA 3N18A 1TMQA 2W62A 1V03A 3UR8A 4BQ4A 2VX4A 3U5UA 1WDPA 1WZMA 1CYGA 5I0DA 1K6AA 1W91A 2XVPA 5E0CA 1E15A 1GJWA 1UR0A 1LWJA 3WELA 4J28A 1NQ6A 3AS2A 3WMCA 5D4YA 1UOKA 1ZL1A 1CGUA 4M80A 5C70A 2WVTA 1HVQA 3WDPP 5CPTA 2G41A 2V3DA 3GXDA 1OIMA 4ZXLA 2WCSA 3RM4A 1FFQA 2J8GA 2XJ7A 3ZJ6A 4HA1A 1Q6DA 4AW7A 1CLVA 7TAAA 1U2YA 3AXXA 4PMXA 1JIBA 3RDKA 2WVVA 4OBSA 3B9AA 1UD5A 5M3WA 2YA1A 3VVGA 3ZT7A 3W0KA 1AQMA 4CVWA 3IJ8A 2WSKA 1NOFA 4F79A 1N82A 4TVUA 2BS9A 4HMEA 3WD3A 1UWIA 4AZCB 3UR7A 3ZQ9A 2XWDA 1GOWA 2QLYA 3VM5A 2YLAA 2D1ZA 3W82A 3APGA 1VJSA 3FHAA 2ZUUA 3VDHA 1KQZA 1ZS2A 3CBWA 1CGVA 2WHLA 1FHDA 4ACZA 1U30A 1E4IA 1HVXA 3CH9A 3PZNA 4FLRA 3GXFA 3L2LA 2GVYA 3N04A 1GVYA 4Z2HA 3II1A 1CIUA 1B3XA 1H1NA 1GQLA 3D5HA 1KB3A 4P8XA 3PZMA 1UQYA 1J0YA 4NRSA 1PX4A 5FKYA 5IFPA 1J0IA 2J62A 3WF2A 4EAMA 3PZVA 1JGIA 3MUZ1 1E6QM 3AYRA 4GQRA 3VIJA 1S46A 1PZ3A 1SYTA 2UY5A 1E5JA 5CSYA 3WDHA 1GONA 4AZIA 1US2A 1DWFM 4HU8A 3EDEA 2J7BA 1CGTA 1M04A 1E72M 1KWGA 3RJXA 3VGEA 5JUVA 1EDTA 4OOUA 4P7LA 4H7VA 2WWDA 3DC0A 1ISXA 1UWQA 4D6JA 4LPCA 4XUYA 5I3DA 3SIMA 3WDIA 1KR1A 3LPFA 1E73M 1K9DA 3E1F1 4PCSA 3THDA 1WCGA 2DSUA 3N15A 2PWFA 2XG9A 1JYNA 5E6ZA 1AMYA 4QLLA 2IUZA 2ZXBA 4D72A 1ZU8A 3EYPA 1E6PA 1Q6EA 1B90A 4F8XA 1JNEA 1WZAA 2Y2WA 1HIZA 2QMJA 3VIIA 2WCGA 4CN6A 3MSGA 1QOXA 2V3FA 3EDKA 1FH8A 1CZ1A 1UH2A 2WC3A 1E1EA 1C93A 1V3IA 3WIJA 4B3KA 1EGZA 2WK2A 1W3LA 4ATWA 2EXOA 3A47A 1EOMA 1ITCA 5AYIA 1ZJAA 3MMUA 1D2KA 4HA3A 5D9MA 4CN1A 1FH9A 4BS0A 3DYPA 2DSKA 4E2OA 5ABHA 2CYGA 3BH4A 3MS8A 3PZQA 4EK7A 1RP8A 2JEQA 1HXJA 1E0VA 1HL9A 3ZR6A 4CU7A 5BWFA 3SCOA 3N11A 3FNDA 3CTTA 4U5KA 3KZSA 2BY0A 4PMDA 2BXYA 3VGHA 4HPGA 4JKLA 3IK2A 4PMQA 4CU6A 2GJXB 3WMSA 4WIWA 3VU2A 3VIOA 3O6AA 2IXUA 4HP5A 5A6SA 3LPOA 1PX3A 4PMUA 1E4NA 4S3JA 2EEXA 1EO7A 1VB9A 1WAWA 3VM7A 2EPOA 4W88A 3AJ7A 2D3NA 3SUWA 2CXGA 4D6EA 3B9EA 2YL5A 2X0HA 3SCSA 1KXVA 1WB0A 3WDQA 1TZ7A 3WEZA 1OWQA 2EQDA 1TFVA 5LA2A 2J7HA 1V02E 2C7FA 4NRRA 4HMCA 4ZENA 5E70A 2W67A 3UEQA 5D9PA 1W9PA 3GDBA 5F7UA 3W24A 5D9OA 4UFMA 1EHNA 1J01A 4HPHA 4AZBA 4JHZA 1TG7A 3WQVA 1JZ7A 1ITXA 2WSPA 4FF5A 4XZWA 1E6SM 4JFTA 4D6FA 1QBAA 3GM8A 2ZIDA 2A3BA 5A6JA 1UA7A 3WF1A 3GH5A 5GPRA 1UR1A 1X1NA 5BRQA 1JZ2A 5A6BD 2PWEA 4MB3A 2OLHA 3VINA 3WH6A 4CD6A 2J75A 3VD5A 3EMCA 3PZUA 1HF6A 3SCRA 4B9ZA 5JIWA 2C8NA 1CENA 3BMVA 3L4VA 3ZJ8A 4Z2IA 1J18A 2PWDA 1HKKA 3UERA 1JZ3A 1BQCA 4NZCA 1W1PA 2QPUA 2WZIA 3AHTA 4TXEA 1FH7A 1ZJBA 5JBEA 3W28A 5A8MA 3VMPA 4AY1A 2MANA 4Z2GA 3IJ7A 4Z2JA 3UCQA 1XD0A 2VZUA 2ZICA 2WC7A 3VIHA 2OYLA 4AISA 3AIQA 3WBEA 3AS1A 2ZX9A 2XSAA 2DT1A 1HX0A 2DT0A 1E70M 1QHPA 2QPSA 3BAWA 2VR4A 4CD7A 1UD3A 1C8XA 4CUCA 4KWUA 4Q22A 2XFFA 4UQAA 1W1VA 4JFSA 4P8WA 4KRTA 1XGZA 2GJPA 3M7SA 3AIBA 3QGVA 1CXIA 4M81A 5A8PA 1MQRA 3AROA 1K9EA 4N42A 2FH8A 1JXJA 3U57A 5I2UA 1D3CA 3WEOA 4B16A 3QOKA 5A3HA 1BG9A 3VD7A 1RP9A 1VFFA 1V0MA 3B8SA 1OIFA 3CMJA 3TTOA 2VCAA 3EMZA 4MDPA 2E8YA 2VT0A 1EHAA 2OWXA 4MNLA 1QHOA 3CGTA 3M6DA 3SCVA 2ZUWA 1X6LA 4RE3A 1QI2A 2D2OA 1XCWA 1JFHA 1JG9A 2VURA 4W7VA 4AZHA 4U2YA 5BYWA 2CKRA 2UWFA 4OZOA 3WKZA 3PZ9A 1GOOA 1NWTA 1VEPA 2F2HA 1M7XA 1XV8A 2WVUA 2BVYA 2VVSA 4GIAA 1J0HA 2VZVA 1CTNA 2PWGA 1QPKA 1QHZA 1R86A 4S3KA 3ZIZA 4CKQA 3FW6A 4FLOA 5CJ5A 2WHKA 2CHNA 2O92A 4PTXA 4JKMA 1DWIM 3SUUA 1UKTA 1CXFA 1UZ1A 2DDXA 1JZ8A 3CUFA 1FP9A 2IXVA 4PEEA 4WKFA 2WANA 2PC8A 2BVDA 3WNOA 2W63A 3W6MA 1DTUA 2QHAA 1UWUA 1R7OA 1O7AA 5DFAA 1JDCA 1SR0A 1LL7A 2ZUMA 1MW1A 4GINA 4UFJA 1GHRA 1W1YA 1SMDA 3AISA 4WKHA 2E40A 4B3LA 1DEDA 1OT1A 1CECA 3I3DA 3VIKA 1JYVA 2NW0A 4JCLA 3T0AA 1PAMA 5BCAA 4GO8A 4E8DA 4PTVA 2YOCA 4AIOA 1GJUA 1TVNA 3ARWA 3RPMA 4PMYA 3DHPA 4QLKA 5JBFA 2G4FA 5IHSA 3GBEA 1MVYA 3WUEA 2W5FA 4JFWA 3MKKA 1V02A 4M24A 2ZUSA 4ZEPA 4W87A 1QNQA 1W9XA 3BCDA 2W91A 3SURA 1VEMA 1MQQA 1UUQA 3S6TA 1EIBA 2WNWA 3WSUA 2GK1B 4E8CA 1NM9A 1HKJA 1UD6A 3A6OA 3O2LA 1GVIA 4HZ7A 3SUVA 4W85A 1CGWA 4MPKA 1H2JA 5FIPA 1HP5A 3FAXA 1BYCA 3ZSTA 2J79A 2WKGA 1NOUA 3EDDA 3WF3A 5C71A 3VGFA 4URIA 2YBTA 2DSVA 3VIFA 1LL6A 3PBGA 3BAKA 1V6XA 4AD4A 4JHOA 4J3TA 3KWXA 1Q6GA 1TUXA 2E9LA 4D1IA 4C91A 1V6UA 2WBGA 4UFLA 1EA9C 1NP2A 1TVPA 2UY2A 4ZE5A 6TAAA 1LLOA 1HNYA 1MFVA 1QVBA 4WJXA 5E9AA 1PEZA 1BLIA 1J0JA 1J12A 1OD0A 1C3FA 2DT3A 2BHYA 1SFSA 2FHFA 1EDGA 1SMAA 3L2MA 2WM0A 2BY1A 3EBVA 3VGDA 5A94A 1PIFA 2XVGA 1OT2A 1CBGA 2WZHA 1JF6A 3BMWA 2VZTA 4B9YA 4ZFMA 3GTNA 5LA0A 3M46A 5CZKA 4A3HA 3AZTA 2XHYA 4M56A 3BCFA 3WNPA 5A2AA 4AZ7A 1HT6A 3AICA 3MANA 5A8NA 4H04A 1KWKA 3WD0A 2X1IA 3DYOA 3ARUA 4ML4A 2YKKA 4C90A 3GXMA 3UG4A 1CXEA 4JIEA 3UESA 1VFOA 1W1TA 5ABGA 4D6HA 2WMIB 1G1YA 1ESWA 4GO9A 5CQ1A 1QW9A 3GH7A 5BXSA 1W32A 2NT0A 2VUYA 3NDZA 2WZEA 1E9LA 1B1YA 3VX1A 1QNSA 4JFVA 1C92A 3ARYA 2YL9A 4BA0A 5JBDA 2V3GA 4B15A 5E09A 1H5VA 3W81A 2ZUTA 1LWHA 3ARZA 4J27A 1UD8A 5DMYA 3N1AA 4L4OA 1B3VA 1G5AA 3SCPA 4LQ1A 1E0WA 2EPLX 4PSPA 2VCCA 3SCTA 3OIHA 4W7WA 2E9MA 3IAQA 3SCQA 1MXGA 2G3MA 1QI0A 3B9DA 4L4PA 3LMYA 1MFUA 1TCMA 4YPJA 4W8LA 1OD8A 4JCMA 1GNXA 3N13A 5D8ZA 1C90A 3OLDA 4PN2A 1UR2A 3WNKA 3SCNA 3KL0A 3AMKA 1E3XA 1WKYA 1DWAM 5IFTA 1JXKA 2WW5A 2V5DA 3I3BA 3ARRA 3ZMRA 3BXWA 1K9TA 3T2PA 1E43A 2X05A 2F61A 2PBOA 3OZPA 1E6ZA 4GPNA 3ZM8A 3PTQA 1VRXA 3RM8A 3KL3A 3W6LA 4QDMA 4JL1A 5A6KA 2YL6A 1W3KA 1B30A 5CG0A 7CGTA 1ISYA 1M53A 3W4RA 1HJXA 3RILA 3AIEA 1PPIA 2V5CA 4OBRA 4AMCA 5A95A 3ARSA 2DH3A 5LYRA 1WDQA 2ZX7A 2CHOA 1VF8A 1BAGA 3SUSA 3MV01 1JD7A 4ATDA 1JL8A 5A8QA 3HMCA 4WSJA 1H4PA 2DGAA 1W2VA 3WL1A 4HOWA 1B31A 1ISWA 4UOQA 3WD2A 4MJ2A 3U5YA 3OG2A 4ZE4A 4J3VA 2DQXA 3WENA 2VNCA 1HJVA 3AHXA 3RMEA 5C8BB 3WFLA 3UG3A 4W86A 4D1JA 1GQKA 2WMKA 9CGTA 3BC9A 2QV4A 4PMVA 2ZX6A 1OCQA 8A3HA 2VZSA 1GUVA 2OSWA 1JZ6A 3KL5A 4MB5A 1YQ2A 1G9HA 5BXRA 5A2BA 1KGXA 3OGVA 2J77A 3VD3A 2YJQA 2XUCA 1KBBA 4AIUA 1WP6A 1H3GA 2GK1A 2G3NA 2JE8A 2WKLA 1KFWA 4U5IA 4F9JA 2G8ZA 3RM9A 1PIGA 3OLGA 1NP0A 1YHTA 4X9YA 4IM4A 4NI3A 2OSYA 2CKSA 2BY2A 3AFBA 3WY1A 2VI0A 1Q6FA 1HKMA 4ZXOA 5HBFA 2VL4A 3BAIA 2WVSA 4CCCA 4MDOA 2JF7A 4GI9A 1ODZA 2FHCA 1G94A 1X6NA 1KGUA 3CMGA 3AHVA 1ZBCA 4OOZA 2YBUA 2FGZA 2WVVB 4MNMA 4XB3A 4PSRA 1UD2A 5CSUA 1UKQA 2B31A 2OSXA 1TA3B 1VBUA 3K46A 5EB8A 4CGTA 3GNPA 2TAAA 1OGSA 3WH8A 1B3YA 3CUHA 2YDQA 5A69A 4GQQA 3QR3A 2Y8VA 4HZ8A 3GXIA 3I3EA 5AC4A 4PMNA 2GFTA 3QHNA 1V3JA 3OGSA 4DUWA 5KEZA 4H2CA 2V3EA 2WBKA 2WMIA 5ABEA 3AQUA 3CHFA 7A3HA 4TTGA 2XGBA 4AD3A 3QOMA 2JIWA 4CN4A 3W27A 3WEMA 2Z1SA 1DHKA 1W9DM 1B0IA 4GZEA 3T0DA 3BSHA 4NF7A 3T08A 2EPMX 2J47A 2BFGA 3EMQA 1J11A 1F4HA 2W92A 2WC4A 2X2YA 1Y7VA 1JFXA 3CIVA 2ZOXA 4GI6A 3POCA 1JYXA 2J7CA 3WH9A 4LGXA 2VOTA 1ISVA 3K4AA 2J4GA 2WAGA 4W7UA 3AMGA 3NSNA 5HNNA 1W9VA 4DUVA 2CESA 3AOFA 3WNLA 1W2PA 4V27A 1EDQA 4KGLA 3VNYA 2ZUNA 4D6IA 4BQ5A 4BQ3A 5A6BA 2WCAA 4CD5A 4CCEA 5CGMA 4GKLA 1R85A 3PZIA 1UR4A 2XIIA 1H09A 5I5RA 3LPPA 4AD1A 2WWCA 1UR8A 3VDAA 1C7TA 3TTSA 2J25A 1H41A 1BVNP 1P6WA 4MB1A 1OINA 3CPUA 2VVNA 2XPKA 3ZT6A 3AS3A 3WQ8A 1UWTA 3BLKA 2CPUA 2PF0A 4H8UA 3RJYA 1BYDA 3WQ4A 2WLZA 4M82A 4DUXA 3VD9A 5BRPA 5I78A 1JNDA 4IUGA 1V0NA 4H41A 4MAVA 3RIKA 2JALA 4FK9A 1E56A 2OWWA 1V08A 1JYWA 2VRKA 4C7DA 2X09A 3K8KA 2NT1A 3OLEA 5IHRA 5M17A 4OIFA 3MUIA 2CBIA 1CGYA 2HVMA 1EQPA 1I75A 1VFUA 3VD4A 2YLLA 4IPNB 3BSGA 4J7RA 4DM2A 3PTMA 5GNXA 2CERA 4TUFA 1HJUA 3ARVA 1E4LA 3T2OA 2O9OA 4KRUA 1JDAA 3VMNA 2D24A 4W8BA 4UQBA 5FOOA 2CCRA 4PUDA 3TOPA 3CHEA 2BY3A 3WQWA 2J7FA 1JI2A 1J10A 3WD4A 3VPLA 2BHUA 4R27A 3AXIA 4IPLA 5ABFB 3WNNA 4AEFA 2XGIA 4UQEA 4MJ4A 4AXNA 3ALGA 2XTKA 3VMOA 1ZB5A 4WSKA 4AYSA 3GZAA 5DT7A 3TA9A 2XFYA 3CO4A 3NJ3A 1E6RA 2YL8A 3CZLA 3M07A 1E6XM 1WDSA 1JDDA 3WBAA 1MQPA 3AHZA 3AXHA 2GSJA 1L0PA 1IZJA 1KCLA 4MNKA 3GYCA 1XD1A 3GBDA 3WNMA 4LXFA 3W37A 2J7DA 4UQCA 3FAWA 4U3CA 3PZGA 1UKSA 4XX6A 2Q8XA 5A8OA 1DP0A 3BLPX 4TVCA 2XVNA 2GUYA 3CZKA 3AIRA 2FDMA 2E0PA 1Z32X 2CBUA 2ZUVA 4BF7A 3AIUA 1KXHA 1DWGM 4UZSA 3JUGA 3F5LA 3AHYA 4M1RA 1BFNA 1C91A 2O9PA 1NWUA 4EE9A 4WF7A 1V6WA 3ZR5A 4MADA 1VBRA 2YA2A 3BAJA 4LYRA 5HPOA 2FH6A 3J7HA 3AZSA 3RO8A 2UY4A 2VR5A 4TOQA 5LA1A 4YHGA 3CZ8A 3O9NA 3WUFA 1UG6A 1NOWA 2D3LA 3AMCA 3WUGA 4QAWA 4D6DA 2VJXA 6A3HA 3W53A 2V38A 5EFDA 3WH7A 4OJYA 2W61A 1KGWA 8CGTA 1BSIA 5CPSA 1UWSA 4F9DA 1BGAA 1XH2A 2CNCA 1B2YA 1OB0A 3ARXA 2Y8KA 5A6LA 2JF6A 3NSXA 1H11A 1GQIA 1RPKA 2CITA 1JI1A 3MUAA 1EOKA 3IAPA 1QI4A 4J3SA 4AD0A 2WLYA 1NWRA 1UKPA 1PZ2A 3NSMA 1FHLA 4M8UA 4HA4A 3AMLA 3VX0A 2EPKX 1CXLA 1VENA 1W3HA 3K4DA 1UH3A 3L4ZA 4YHEA 1B3WA 4UFKA 1GOQA 4YN5A 1ZBWA 3ZO9A 1G01A 3F4VA 1GOKA 1KXTA 4TX6A 3FXYA 1MW0A 3ARTA 4AIEA 5D8WA 4UFIA 4GI8A 4UTFA 2A3EA 5I79A 2Z1KA 4P7OA 3HU7A 5BXTA 1M01A 4UCFA 3WH5A 4X0VA 3ZOAA 2DSZA 4H8HA 1XH0A 3WL0A 3L4YA 1UHVA 5FCZA 2PI6A 2GJRA 2EPNA 5CLTA 4PTWA 3SEPA 4U31A 3DECA 4UR9A 5HPCA 2O9RA 3GNRA 3AIWA 2CETA 2XVKA 2E3ZA 2ZX8A 1QBBA 3IANA 4MB4A 3OBAA 1M03A 5GNYA 2WXDM 2GJXA 4PRWA 3WQ5A 4MNJA 1XSJA 1ISZA 2D23A 5CXPA 4C7GA 1UR9A 3VOCA 5CLWA 1OGGA 1US3A 2E9BA 1E6NA 1EXPA 2GDVA 4TTUA 4AC1X 2J74A 4AEEA 4P8VA 4PTMA 1XSIA 4KGJA 5GNZA 1XYFA 4TVDA 2XYLA 1LQ0A 1GZJA 2FGLA 1A3HA 1HL8A 4Q7NA 4GXPA 1CXKA 3N17A 5TD4A 1ZBVA 2ZXAA 3SCUA 3BAXA 5E6YA 5M03A 2VTFA 2JEPA 1XHGA 3T0BA 5DEZA 2W66A 1R8LA 1W9UA 3MV11 4P8UA 2Y4SA 4FLQA 1XSKA 5I24A 1V6VA 4XZBA 4Y7EA 2ZE0A 6CGTA 2WHMA 3TONA 1CWYA 1I1WA 1V6YA 1HJWA 1WO2A 4CVUA 1XH1A 3NYDA 4DM1A 2O9TA 3VDBA 1R7AA 2C0HA 2QMKA 2QF8A 4W5ZA 1JZ5A 2GDUA 2BNJA 4HZ6A 5D9NA 1BYBA 3IJ9A 3DYMA 4FLSA 1UWRA 4GZJA 3WQ6A 2YDRA 4W84A 1A47A 2ESCA 2X0YA 3ARPA 3MUY1 1OM0A 1FP8A 3L4WA 1LG1A 3T09A 1BYAA 1FOBA 1JD9A 2OYKA 4U33A 2UY3A 2E8ZA 5A6MA 4JKKA 5HDRA 4LX4A 4HOZA 2PBGA 3KEHA 4HTYA 3PZTA 4Z2KA 4CD8A 1LF1A 1WPCA 2VX5A 4W8AA 3WF4A 3TTYA 4JZ5A 4AD2A 4ATLA 3CUGA 3UETA 2ZXQA 1NWSA 5AC5A 1XYZA 1CDGA 2D20A 2WB5A 5EBAA 4W89A 2CIPA 1J9YA 3AYSA 4P7RA 1WZKA 2VQTA 3NIYA 4BZYA 4J3XA 1GPFA
chains in the Genus database with same CATH superfamily
1GCYA 4LSBA 1E51A 4V15A 3RO6A 1V5XA 2TRSA 3PUGA 2AL2A 3B0UX 2AOSA 3S3GA 2DT2A 1XJBA 4LALA 4P7NA 2ACRA 1S38A 1TV8A 3VTRA 3GK0A 1SJBA 4F48A 3HQPA 1TR1A 1TE1A 4GVFA 1ZUAX 4CQAA 3FSTA 1MW3A 4LU0A 1I4NA 1B9BA 1UH4A 3KFTA 3VGGA 2EJ1A 4K39A 2DIEA 2VP8A 6XIAA 3IRDA 1GG1A 2XM1A 5HULA 3MUXA 1HJQA 1YX1A 5A1AA 4JDBA 3GY1A 4ROPA 3TMLA 3GVQA 1R87A 3ZVIA 4ZODA 4JFUA 4Q4SA 4Z1CA 1LORA 5A5WA 2NLIA 3G1SA 3P60A 4D6CA 3W88A 1Q4NX 2P0IA 3DX5A 3G6LA 1MO0A 1O6IA 3N9SA 3UF9A 3WQPA 1G4TA 2VQUA 1G4EA 5I77A 5E0KA 1PKLA 4GIEA 4PL1A 1TV3A 3TAKA 3K1DA 3QPEA 5GJNA 1FWIC 5SWUA 4FS9A 4IMCA 3AZRA 1BKSA 4J40A 4ZZ9A 3FOKA 2Y8UA 4ORIA 1RUSA 4YYCA 2RDXA 4E2DA 1VC4A 5HXMA 3BGAA 4AIBA 4PCTA 2WMJA 1GQJA 1QNRA 4PRTA 1JGMA 4K68A 3E3HA 3VDCA 1X96A 1NARA 2JKEA 3E2QA 4LNCA 4YCPA 4FXJA 1W0MA 1VAHA 2AL1A 2QULA 2VO5A 1P4CA 1XL9A 4NQ1A 1KM4A 4QE5A 3GU1A 4HYWA 3TYZA 5I23A 1KCKA 3RX4A 4PMJA 4DWSC 4QJ5B 1O5QA 2EBNA 5DRIA 1EPVA 2YIHA 3P7YA 4AZCA 3FS2A 4MYAA 1DJYA 4PMRA 3SJNA 3ARQA 3MA8A 3S6DA 4S1FA 2HISA 5D30A 2VMFA 3L4TA 1DKWA 3WD1A 1EQCA 5IDIA 3GHUA 4AX7A 3BGGA 3ECQA 1CLXA 1RSCA 1LQAA 4AZGA 1YNYA 5G2IA 1QW8A 2HS8A 1TPDA 4C7FA 1IZKA 5ABFA 1H51A 3F4CA 1XLFA 4GUGA 5HMFA 4E6MA 4J3UA 3VKKA 2RGLA 2C79A 3SGUA 5FF0A 1GOMA 3TA6A 1XIJA 4BCEA 3HJEA 4XBKA 1X38A 4DO4A 4KEVA 4L6OA 1ADSA 2XIMA 3M1ZA 4Q8MA 4GXWA 3BSMA 5AECA 5LIWX 2NQHA 3HQOA 1DWHM 1KTCA 5H2ZA 2X1UA 1RLCL 1OBAA 3U6WA 1OFQA 3TYBA 7TIMA 3MMWA 3GDKA 3WLOA 2NXGA 2Y24A 1RJRA 1EJTC 2WHJA 4E4PA 1E1CA 1W17A 3IEBA 4MLJA 4WLCA 4E2BA 1CXHA 2YZRA 1SO6A 2FIQA 1GGOA 1WNOA 2EKGA 1TSIA 2FJUB 3CXOA 3N3MA 3B8TA 3HMJG 3GXTA 4LEQA 2OKOA 3FV9A 3H2NA 1AQHA 2J8FA 4IISA 2O4MA 5G1YA 3EX4A 4OGZA 1UUMA 1DTNA 2ZA1A 1BGGA 4AH7A 3MO4A 1SR9A 5FL1A 4EANA 5A6AA 3SR7A 1FWDC 5HOSA 3BW4A 4DF1A 1Q7MA 1KM3A 1EFZA 1TB3A 5REQB 4UNIA 2A3CA 2BHZA 3THCA 1JAKA 1EP3A 3GG0A 4H7ZA 3W7NA 4UQDA 3DHUA 1TREA 2JFEX 4PBGA 4FXSA 2A5HA 3A4AA 5HUPA 2Q02A 2VRJA 1LZOA 3CUZA 3C2OA 1BG4A 1J0KA 1L8NA 2HZGA 3F5JA 4ZQPA 3HQNA 3FDKA 3W7JA 3P82A 2H8ZA 2FZ8A 4ACYA 3W7DA 5CGTA 1OYAA 1VFMA 2Z1WA 3BTNA 4GBDA 3KOXA 4AXKA 1EP1A 3T7VA 1R9ZA 2R94A 4WKAA 5HQMA 3O16A 2XVLA 1Z9AA 4JQAA 3CHVA 2PP0A 1K9FA 3UGRA 1PV8A 2O7SA 5I3HA 2UZ9A 1JAEA 1EGMA 4N02A 4YL2A 2PP1A 2WJDA 4IG2B 4LANA 5D38A 1RCXB 1K1DA 3I68A 1D7FA 4H00A 4JD4A 1PJ9A 4X3ZA 2Y5EA 3BMXA 1E40A 4DZIA 1KFLA 2D0HA 4CEXC 1CEOA 4V33A 4UMCA 3GXPA 1C8YA 4H19A 4TV5A 2ZVIA 4DJEC 1KM5A 2Z28A 3VIGA 1DBTA 1T0OA 4XAZA 1XC4A 2HBVA 5FD0A 4PCFA 4RPQA 3W23A 1ONWA 5CZTA 5KZ6A 4NI8A 3HGOA 4EPDC 6PTDA 1E71M 5JXQA 1ONXA 4ZTYA 2VX4A 3U5UA 1WDPA 3FCPA 2G0WA 4P02B 3CEUA 3B8DA 4IIDA 4QXIA 3TYEA 3HM7A 3DZ1A 2PDNA 3R43A 3GIPA 1CGUA 5J8LA 1TO3A 5FSEC 1TWDA 3ABXA 3GXDA 4ZXLA 2WCSA 2OO6A 3IACA 5FJUA 2J8GA 3QW3A 1IEWA 4F0HA 5DBUA 4RXFA 1CLVA 2HPMA 5D2XA 3AXXA 4PMXA 3T78A 4MLRA 2C3ZA 3BCJA 3BK0A 3FIGA 1GZ1A 3AYTA 4HB7A 1AQMA 3DG7A 3PFMA 2PDBA 3IJIA 3SRDA 4AZCB 1G4SA 3UR7A 3ZQ9A 2XWDA 2ZC8A 2YLAA 2D1ZA 1BSLA 1J96A 3VDHA 3CBWA 1CGVA 2WHLA 4ACZA 4XSMA 1E4IA 1FWGC 1FWHC 2YCKX 2PU1A 1KLYA 5LIXX 2V81A 3N04A 4DHGA 2RKXA 2QIIA 3A24A 1H1NA 3HV8A 1GQLA 4MOZA 4NRSA 1WUFA 5IFPA 3TN4A 2ADAA 4REQB 1YADA 3WF2A 3CQ0A 1RY8A 1E6QM 3R1ZA 4EPKA 3TYAA 3VIJA 1MZRA 4MM1A 2FMNA 2UY5A 2VFIA 5CSYA 2OZTA 3WDHA 1GONA 3IIZA 4Q4OA 3R8HA 1M65A 1KWGA 2Q09A 3N73A 1GEQA 3XINA 4H7VA 3JU2A 3MO7A 3DC0A 4K38A 4JNYA 1KR1A 3LPFA 2G4JA 4PCSA 2VGGA 1QXLA 2PWFA 1AMYA 3ABRA 3KBWA 3ZYZA 3CAVA 3U2ZA 3NGJA 4ORMA 1MI3A 4C1KA 1GKQA 5HWNA 4C6JA 1K4HA 2ZRVA 4A8IA 1WZAA 2Y2WA 2YXGA 1K7XA 3VIIA 2WCGA 1IGWA 3LV6A 3TROA 2VXNA 1CZ1A 4DJEA 1UH2A 3STPA 1E1EA 2FVLA 4OTKA 3T55A 2IPWA 1EGZA 2WK2A 2X1TA 3UXKA 3S47A 2QCDA 2QR6A 4GWEA 3A3XA 4O15A 2G50A 1ITCA 5AYIA 3MMUA 3M5ZA 3LBCA 4US5A 5D9MA 3EPNA 1GTHA 5K3VA 2ISSA 2CZDA 4QBXA 5ABHA 2QUNA 4EK7A 2FVMA 1RP8A 3HPAA 3ZR6A 4CU7A 1LROA 1DHPA 2WPBA 3FNDA 3CTTA 4LV9A 1RA5A 4QJ4B 3PPCA 8XIAA 2P3EA 4PMDA 3VGHA 4GJJA 4YTTA 2Z29A 3M0JA 3T6CA 1NEYA 4JKLA 3G8EA 3WMSA 3LOTA 2BODX 2IXUA 4AVFA 3OYZA 1E4NA 3QV9A 3KBMA 2QS8A 1RAKA 3LX9A 3VNLA 3BOXA 1EJXC 2CXGA 2C6QA 4IIGA 3G1FA 2X0HA 1KXVA 1O60A 4RDVA 5ABTA 1MUMA 1OWQA 1TFVA 4WDXA 4ZENA 1LLZA 2HE5A 5D9PA 2XN0A 3DCPA 3AJXA 3KHDA 1TJPA 1OZQA 5D9OA 1K70A 4AZBA 1F74A 2OZ0A 4MF4A 5D2WA 3IV8A 4RW5A 3S42A 3L5MA 1TG7A 2C91A 3CS2A 4Z0SA 1LQ2A 4JTSA 1VR6A 4LBSA 2PWUA 1N55A 2PZ0A 2WSPA 4XZWA 1E6SM 4JFTA 4D6FA 1QBAA 4ZOBA 3GM8A 4MZ1A 3N2BA 3L68A 5K9DA 3A5FA 5GPRA 1UR1A 3LI1A 4GJ1A 3MY9A 5JH2A 3LM7A 5A6BD 4QDPA 4MB3A 3WH6A 3PAJA 4QG9A 5BW6A 3I6EA 4B9ZA 5JIWA 2C8NA 5AKQA 3LD5A 4Q33A 4IF2A 1EC9A 1P0EA 2INFA 4TIMA 1HKKA 3BG3A 1I2NA 1KBJA 1XWYA 3RR4A 4AEOA 1I2PA 2WZIA 4TXEA 1EZWA 5A8MA 3UVIA 4Z2GA 2AGKA 1XD0A 2VZUA 2WC7A 3N4EA 4FX8A 2OYLA 4AISA 3AIQA 5CC5A 3AS1A 2XSAA 2DT1A 3CQKA 4HN4A 1LYXA 3LLFA 3BAWA 2VR4A 4CD7A 2OCZA 4KWUA 4JFSA 2B7NA 1WBHA 4KT2A 2J24A 3AIBA 2GUBA 4IIEA 3VK5A 5FSDC 1SU5A 3E0LA 1MQRA 1H5YA 4UNLA 5DXYA 1A80A 2BVWA 2XISA 1M68A 2G96A 3S9YA 3VI2A 2RJHA 4MDPA 2OWXA 1TMHA 5MKGA 1XQKA 3CGTA 3M6DA 4UCGA 4YTQA 2H90A 1F73A 1JG9A 4AZHA 1S1RA 3TR9A 2CKRA 3TLLA 3QVQA 3WLSA 4OVXA 3AUOA 1XIIA 1RBAA 1VEPA 2F2HA 2WVUA 3DG3A 2XINA 1UC4A 3WLPA 3QEZA 1CTNA 3BJTA 3DIPA 5FESA 2OPJA 4CKQA 4EACA 4BI6A 2INEA 5AHEA 1XKJA 2VC5A 3T0TA 1SZRA 1OEPA 3LHUA 3LB0A 4LVGA 1UKTA 5HATA 4FNPA 4PEEA 1XIBA 2ATMA 2WANA 5F4XA 2PC8A 4JOMA 3IUIA 3LS9A 4O13A 1BD0A 4HPNA 3NEHA 1XYCA 1Q8JA 2X2GA 2W63A 1R3VA 3E9AA 1UWUA 1XW8A 3SW6A 4XG1A 1JDCA 1SR0A 1E9YB 2NQLA 1ALDA 3BOLA 4NL1A 1TIWA 3AISA 5LXXA 2DU2A 4O18A 1KFKA 3NQAA 3NZRA 3I3DA 1JYVA 2YFNA 3EOLA 4FX7A 4DXXA 4A3RA 5D32A 1G4PA 3F2BA 1T6MA 5EL1A 2YOCA 1XYLA 3RHGA 1GJUA 1SFJA 3RPMA 3W7PA 4YU1A 4ILSA 1RQBA 2DJXA 3S6OA 3WUEA 1GK8A 3RR1A 3GTHA 3UA3A 4KCWA 4IICA 2VYOA 4DJDC 1QNQA 4O4WA 3RCMA 3DERA 3KX6A 2HVNA 1NELA 4QRNA 1W3IA 3N2OA 4C6FA 4IX0A 1YPFA 2YCLA 3O2LA 1GVIA 2X7VA 2P3ZA 3HA1A 4MYXA 4RR4A 3N19B 1BYCA 2Q8LA 2OOGA 2WKGA 2Y61A 3ICJA 1TMLA 2P50A 3VIFA 2FKPA 1LL6A 3XISA 4J3TA 1Q6GA 3HJZA 3P6LA 3LUTA 3TE9A 3QV6A 2UY2A 4ZE5A 6TAAA 4G9PA 1WDDA 5K2ZA 1KNWA 4GMEA 5E9AA 3MDUA 1DJNA 4O0KA 1EDGA 4ERIA 3L2MA 2WM0A 1FUYA 1PIFA 3LCLA 3NXLA 4AG0A 2WZHA 1KV5A 3NL6A 4DXKA 3G18A 4IIBA 5I09A 5D37A 3TNOA 1FDJA 4M56A 3VKCA 1X97A 2VEPA 2PD9A 1HT6A 4QSFA 1KWKA 3DYOA 5MHBA 4ML4A 3ARUA 1WOAA 1CXEA 1NU5A 2HNHA 5BOFA 4GO9A 3NQ8A 4PODA 1W32A 2WZEA 1S1PA 5G1TA 3VX1A 4PUNA 3VOFA 1QNSA 1FCVA 4ZQNA 4AVOA 3VA8A 1ICPA 1XIFA 1C92A 2YL9A 3LA4A 4C65A 5E09A 4PFMA 2ZUTA 3ARZA 4HU3A 3G5EA 2NV9A 2QF7A 1S5NA 4HIBA 2QUTA 4GACA 4L4OA 4PSPA 4UR7A 5C9WA 2E9MA 3IAQA 3SCQA 2VD9A 1QI0A 3B9DA 1UIPA 4L4PA 2RH9A 4ICMA 5HQEA 1OD8A 3UZYA 3A3WA 1C90A 5HR6A 3SCNA 5E9XA 1V93A 1DIOA 1JXKA 5IFTA 2WW5A 3LTSA 3ZMRA 4G1NA 1MZHA 1QOQA 2WKJA 2PBOA 3T42A 4R3UA 1ICSA 1FXQA 1CB2A 4DQWA 1VRXA 3GVGA 3H12A 4ASTA 4KWOA 4X2PA 2EJAA 3UNDA 1TZZA 5H91A 1ISYA 1QUMA 4EXQA 1LOSA 4YVXA 3CH0A 3RITA 3GDLA 4Q7IA 3ZFHA 4AMCA 5A95A 2IW0A 5I06A 1H7OA 2DH3A 2QCCA 3H2CA 1VF8A 3SUSA 1P6CA 4ATDA 1JL8A 5A8QA 4XBSA 1EBGA 3BLIA 3QZEA 2DGAA 4HNVA 3WL1A 4QQ3A 2E28A 3WK2A 3WD2A 5KITA 3V75A 4E3VA 6ALDA 4J3VA 3MJYA 2DUZA 2DQXA 3QTPA 2VNCA 4WVXA 4LAKA 2B7QA 3WFLA 4W9TA 3UG3A 4W86A 3V5FA 4D1JA 1GQKA 5EY5A 3BC9A 1NF0A 2ZX6A 2VZSA 2WNZA 4IQJA 3WBYA 1NQKA 3P80A 3E2RA 4MB5A 3TH6A 5BXRA 1KGXA 3VD3A 1L6YA 2YJQA 3R7MA 3UFYA 5AZ1A 3TWAA 5TQLA 2G8ZA 2DW7A 1X7IA 4S3FA 3OLGA 1AZ2A 2F6KA 3LGGA 2CKSA 3AFBA 4FZIA 1Q6FA 2WSQA 3I7RA 5HBFA 4JYDA 4CCCA 3USBA 3U4AA 1ODZA 2A6LA 4FF7A 1G94A 1X6NA 2POTA 1WBJA 4Y96A 1VHCA 2WVVB 3CV2A 3CNYA 5AOUA 3IK4A 1UKQA 2B31A 1TA3B 1A0CA 1VBUA 4B92A 1OGSA 3BZJA 1UP0A 4PB3A 3WH8A 3D47A 3CQJA 4JQ2A 1I8JA 3QR3A 2Y8VA 5CJNA 4I8YA 4JQ3A 2GGGA 3TJIA 3BLOA 1QWKA 2Y7FA 1W1B1 2R1KA 5KEZA 1A5UA 4LFYA 2WM1A 5C7VA 4PH6A 5LXEA 4POCA 1M3UA 3W1AA 1SFLA 1KM2A 1T40A 2WMIA 3RYSA 5AFDA 2B81A 5ABEA 3AQUA 3CHFA 4WOZA 4TTGA 2OMAA 4AD3A 4CN4A 3LN3A 3T0CA 4O1DA 1Q6QA 1TQXA 2PPGA 4GZEA 3T0DA 5D2TA 4NF7A 6TIMA 1CW2A 5J5DA 1F61A 2VFDA 2HTMA 4IP7A 2ZTKA 1GVRA 1J11A 4TMCA 1AJZA 4B5TA 4Q8PA 1Y5WA 1A5NC 4JTFA 4IIFA 3M4HA 3H70A 1JYXA 2PDFA 4LGXA 1NY1A 4DIAA 3K4AA 3R5EA 4Z1BA 3GUGA 3BURA 3AMGA 1R3QA 2A1YA 4ALDA 4WRHA 1PHWA 3QJAA 3WNLA 4GIRA 1EDQA 4KGLA 5BMWA 3VNYA 3L0KA 3M0XA 4NXKA 1ENUA 5A6BA 3CLMA 4BWLA 4RE0A 5T26A 3RK8A 2OQHA 3UY7A 1ELSA 2XIQA 3E0VA 2R24A 4OT7A 4QS5A 1GVSA 4AD1A 3HG3A 2J25A 1BVNP 1P6WA 2V68A 4IJBA 5HNTA 1TV4A 2OGYA 1UWTA 5FEWA 4JQ4A 4N9BA 3WQCA 2PD5A 2CPUA 1OCJA 1ICQA 1RCQA 3VD9A 1K8CA 2EG7A 4Y9OA 5JQ9A 4H41A 3SY8A 1EZ2A 4FK9A 4BHYA 1JYWA 3K8KA 1FY6A 3F4WA 1XISA 3ITTA 3THUA 1I75A 2GSEA 5AYXA 5E93A 4ERGA 4DM2A 1F3XA 3HFYA 5HWMA 1O94A 5GNXA 3PTMA 1A5LC 4PBEA 1VCGA 4TUFA 5F2GA 3ARVA 1HZYA 3W1UA 4IPIA 4KRUA 4H83A 4IQDA 3ZZ1A 4UQBA 5HMEA 3M5VA 4AQLA 3BVJA 3WQWA 2J9XA 3K1GA 1KRMA 4ROQA 2BHUA 3CAQA 3C0LA 3MPGA 1R0MA 4GVGA 1O1ZA 4MJ4A 2XTKA 1WA3A 2IQ0A 4KETA 3DFNA 3P84A 1UP3A 5G4HC 1JPIA 1KFCA 1E6RA 3UWVA 2QXWA 1U5HA 1BRLB 1WDSA 1IEIA 4K8EA 4N9DA 2INZA 3MHFA 5L6UA 4LW7A 1RVKA 3GYCA 1B5TA 4K3ZA 2R1MA 3WNMA 1B4KA 1WX0A 4LC6A 3S5ZA 3B05A 4NAFB 4X63A 4RNFA 3E2VA 3VCRA 5A8OA 3FA4A 1Q6LA 3BLPX 3W72A 3ATYA 4MJZA 4WY0B 2GUYA 3CZKA 1Z32X 4B5WA 3AIUA 1C8VA 4NZ3A 1DWGM 3IGSA 5BOEA 1BWVA 3F5LA 3AHYA 1BFNA 3E74A 3BL3A 5IBXC 3BAJA 5J5RA 2FH6A 3P62A 2UY4A 2VR5A 3L9CA 3AMCA 4P5UA 1HQTA 4I8DA 1AODA 6A3HA 4XK2A 4B4FA 2TODA 4OJYA 3F4DA 1KGWA 1OFRA 4WOQA 1Z89A 1XH2A 2CNCA 3ARXA 2Y8KA 3NSXA 2C71A 2R1NA 5CGQA 2JGYA 3OW1A 4AY7A 3U48A 1NSJA 2Z2UA 3NSMA 4M8UA 3GIYA 4TU1A 4FAMA 3UJEA 4IFRA 3ES7A 5HNUA 3SFWA 5GJPA 1GVOA 2W6RA 1W3HA 2CLIA 1UH3A 4YHEA 3SGGA 5FJOA 4Q32A 4ZO6A 1A5MC 3ITGA 2E6AA 3S1VA 1GOKA 5LHEA 4TX6A 1MW0A 3ARTA 4FOKA 5D8WA 1EGVA 1NFPA 1ONRA 4UFIA 4GI8A 4UTFA 4BY3A 1TZ9A 3SO7A 2PURA 4GZ7A 1M01A 3RUBL 3T05A 4FIRA 3HPZA 1EL3A 4FIQA 2DSZA 4HYRA 3M44A 1I6NA 1PCKA 3L4YA 1UHVA 2EPNA 3SEPA 4U31A 3TEVA 4UR9A 1TYGA 5HPCA 2O9RA 3LCWA 5JU6A 4JTJA 1EEPA 3V5OA 1D3HA 2ZX8A 3INPA 3IANA 1MEIA 5GNYA 3L67A 2GJXA 4PRWA 3R0KA 2YXOA 4MNJA 3CPRA 4A35A 1VLIA 2D23A 4H6QA 2ISVA 2UV8G 3NXFA 4L1WA 1TPEA 2J74A 4IOTA 4PTMA 1A5SA 1UW9A 3KBJA 2Z1VA 3IIXA 1XYFA 3NM1A 2XYLA 4LB4A 3S0CA 3PBUA 4H6EA 2FGLA 2ZRXA 4Q7NA 1CXKA 5TD4A 2WOQA 2ASHA 3MP5A 3OBEA 1X98A 2ZXAA 4QG6A 3BAXA 3P74A 4WXYA 3EB2A 2VTFA 2P10A 3CIXA 2REQB 4LVFA 4XZ9A 4RDWA 3T0BA 1R8LA 2WJFA 2YYUA 3NO3A 1HKVA 4Y8EA 3AXKA 4XZBA 2ALRA 4Y7EA 1ZCOA 4PCNA 2I5IA 3TW9A 5DY2A 3H2MA 4AYGA 3NYDA 4DM1A 1NF7A 5LNWA 1JZ5A 4REQA 3U9IA 3AUJA 4YWIA 2HDJA 4HZ6A 4ENLA 2GQAA 5TBOA 5LHFA 3RLUA 4O16A 1U1JA 1P0NA 2ESCA 3EXTA 4GE8A 1P6BA 4JIHA 1FP8A 1MEHA 4LAMA 1FOBA 1EJWC 3GFYA 5A6MA 4GABA 4HK5A 2NXHA 2PDKA 3UY8A 3KEHA 4CD8A 3LMZA 3EWYA 1C9DA 4BK9A 2QCLA 2XIJA 3TTYA 4I5XA 2VELA 3UETA 2ZXQA 4ZR8A 4XWUA 1ZSXA 1CB7B 4UTKA 4W89A 2ISFA 4FHAA 1J9YA 2GL5A 5C6MA 3RRXA 4YWSA 1R47A 4WK9A 4DZAA 1OADA 1ZAJA 3CLWA 4CD4A 3B4YA 1P0KA 4DZHA 5K7JA 1VFLA 1XLAA 2DJLA 1FA2A 2XFRA 3FGCA 4H7CA 1PWMA 1XPYA 4TR9A 2QGYA 3PHAA 3E0WA 5U4NA 4NNAA 3GVRA 1EYEA 5BROA 4J3WA 3BJSA 2IQDA 3CWNA 3WJWA 1WE5A 1MWOA 4HQVA 3NCOA 3OA5A 3DUGA 1PXGA 4H6RA 4BKNA 3G8RA 2BSLA 3GSMA 4NAEB 3RLVA 3QV7A 4K6AA 3QGKC 1KBKA 1MUCA 2V5BA 5HJLA 5C5YA 3ELFA 4CNNA 2OYMA 1G6CA 3HN3A 1MYRA 4M6UA 2QT3A 3U7BA 3EB4A 3ZVHA 1EWDA 5F1VA 4DWSA 4AZ5A 3R10A 3G6MA 3PB0A 3URQA 5CPNA 3TN6A 3WMBA 3VIMA 4A8RA 4D2JA 4X0NA 1BTCA 2SFPA 1H7XA 1GTEA 4US6A 4WEVX 1RCOB 1HGWA 5FL0A 3TJLA 2VENA 3ZWTA 4Q8UA 3UPMA 1F9CA 1QNVA 3GDMA 1CPUA 1Q3NA 3GVVA 3A3HA 3TAOA 3L4UA 4KFOA 4JIIX 1LRTA 1O68A 3PUOA 1IIGA 1ME9A 4UXDA 4Q8VA 3U2EA 1UYQA 3ID7A 3G1DA 2WYSA 1ZZMA 1VRDA 1XPGA 4MKNA 1NH6A 4BQ2A 1LL4A 5FEZA 4JTDA 2FZNA 4AWSA 1A5KC 2DH2A 1XICA 3DFHA 3UG5A 1VJZA 4Z0JA 4AHQA 2ZX5A 5BXPA 2X16A 3M0HA 2OODA 3MW7A 3FYOA 1LBFA 3C4UA 3ZSSA 5KZEA 5AZ0A 4UOJA 4D6GA 2FB2A 4Q8QA 4HG6B 3B8VA 5M5DA 4R9OA 4NSBA 1SW3A 3H7RA 3TSMA 3WN6A 3BICA 3EAUA 5JVLA 2EO7A 3CZJA 2RGMA 1S2UA 3GRIA 4FXRA 3CASA 3AI0A 3RU8X 3VNZA 1DQWA 4JL2A 1P1XA 1RV8A 1BXNA 3VZYA 3VIPA 1FFRA 2CLPA 1EH9A 4NZJA 4P61A 3R89A 1ONEA 2TYSA 1PTGA 3ALFA 2CXEA 2GWNA 5HQLA 2G3IA 2R91A 3BV7A 3SRKA 3C86A 2E1DA 2X8RA 1RQHA 1E3ZA 3N4FA 1H0GA 2CZEA 1S2WA 2V69A 4HVXA 3CUIA 1FXPA 3VILA 1RD6A 3QMSA 3QH2A 2QDHA 3T40A 3OG3A 1V3HA 8TIMA 4U2ZA 2J66A 1S5WA 1FX6A 4PMZA 2PTYA 4O8AA 4AAJA 3C56A 3JRKA 3PBMA 4ACZB 3WO8A 1ZJIA 1ECQA 1I1XA 1MNZA 1IGSA 1NAL1 3D0CA 3B0YA 3B9OA 4B2DA 4FMVA 1H0IA 2QJNA 2V2DA 4QCFA 4PEKA 3GC5A 2AMGA 3VUPA 1JCJA 2CZFA 4QLJA 1W9BM 1POKA 3W7IA 4RDYA 2I5QA 4HCHA 4HU0A 3PTKA 2PWVA 2XWEA 3QZAA 4LBRA 3S2MA 4UOZA 5HJXA 1IE7C 1T96A 3I4EA 1Z7AA 1OC6A 5EBUA 2RJGA 3KVLA 3W29A 1XBVA 4PR4A 2P1FA 2C1IA 4JTQA 2VC9A 2UBPC 4HMDA 4HSOA 4KH2A 1WZLA 4M6VA 5DN1A 2E68A 2A3HA 5AHNA 1X8FA 2D0GA 5FAJA 1RH9A 3MMDA 1GHSA 1TX2A 2W79A 4O4VA 3SQLA 3A4WA 4M51A 3VAVA 4K7VA 3W26A 1XLLA 5G4WA 1UD4A 1DJHA 3VE9A 3CV6A 2XIBA 4KWVA 1VYSX 1VEOA 4L1XA 3PZOA 4XTIA 4S38A 1IIHA 4E3TA 1W54A 1OYBA 3JS3A 3L66A 4D71A 5ECUA 5LNSA 1KXQA 1XM3A 2J13A 3Q37A 3RCNA 1AH3A 3CWOX 4GHRA 4I5UA 4DYJA 2WMHA 1H1YA 1Y5XA 4EAYA 1JZ4A 5C2XA 2VZOA 5H8UA 3VCNA 4RPPA 1GYNA 2W0UA 4NP7A 1DXEA 5CPQA 1TV2A 3WDRA 3SJ3A 1X8CA 3D46A 1QI3A 3H7UA 2E5DA 5TAOA 3GKFA 3APTA 5GQBA 2IPGA 2NQJA 3EPMA 4FR1A 1WOBA 3M0VA 2WPGA 4V2XA 1UP2A 3S2CA 5A2CA 1EO5A 2C14A 3ZJKA 4UQ9A 3QR0A 2ANUA 2EAWA 3VO0A 1IV8A 3T2QA 1W6TA 2W62A 5DBTA 1CYGA 2ZZ7A 1W91A 2XVPA 5E0CA 2TMDA 2J9ZA 2YGYA 2HE8A 1GJWA 4F2UA 1NTHA 4L6HA 1NQ6A 3BGJA 1PKMA 4JEQA 3V5CA 1PUDA 1QO5A 5FEPA 1L2QA 1YDYA 4M80A 3L65A 1YKWA 5CCZA 5CPTA 3DI0A 1FFQA 4GXMA 3MJMA 3ZJ6A 4E2VA 2ZRUA 4O50A 7TAAA 1W31A 3OHMB 2WVVA 4LY4A 3L0NA 2IPJA 2B4GA 3PF3A 4YNGA 3ZT7A 5CBIA 3B9NA 1PSCA 3NL2A 4KF1A 3QQWA 1JUKA 1F6PA 1N82A 2BX7A 4XIAA 4ZTXA 2YB4A 4GKTA 1GOWA 4BI7A 2GGJA 2PS2A 1TV5A 1VJSA 3LRKA 1ZS2A 4HNLA 3L5AA 5D02A 1OFEA 1FHDA 3MT1A 4FLRA 4M1BA 2BZNA 3UW6A 3U2CA 5BRBA 3SBFA 5CC6A 1P0DA 3VCCA 3D5HA 3BWWA 4P8XA 3W70A 3IGUA 5FKYA 1ZNNA 2ABAA 3DENA 3AWOA 3VOIA 3BLEA 4C5YA 4EAMA 3FGCB 3MUZ1 3AYRA 1TTIA 3A9IA 4NILA 3LERA 4YIWA 5DQPA 1S46A 1PZ3A 1SYTA 1US2A 1Z6KA 3UZJA 1ZLPA 1V8EA 3VGEA 3V0TA 5JUVA 4UTUA 5I07A 6REQA 1YNPA 3W2UA 1AJ0A 4LPCA 2POZA 3B8UA 3WDIA 1AJ2A 3PUEA 3OVRA 1K9DA 3WLHA 1WCGA 2X41A 3N3TA 1JYNA 2IUZA 1FDYA 2ZXBA 3EKGA 4D72A 3ERPA 3RAOA 4EVZA 3EYPA 3WLKX 3AC0A 4A8NA 4F8XA 1FWNA 1JCXA 2ZC1A 2GSHA 4C6LA 2QMJA 4CN6A 2GGEA 8RUCA 4RZ6A 4GYJA 4YCOA 3IS4A 4NJKA 3TZNA 3MP4A 4PRRA 2OEJA 4IMGA 3RF9A 3VZZA 3EXSA 2EXOA 3A47A 3MBFA 1ZJAA 2AQOA 1D2KA 3WBWA 1Q85A 1WV2A 4CN1A 5HNRA 3W87A 4E2OA 1TPUA 2CYGA 4DY1A 3BH4A 3PZQA 1XUUA 5CZ0A 1HXJA 2G97A 3SFKA 2VEKA 5BWFA 4B5NA 2HK0A 3ME3A 4KIEA 3E6EA 3H23A 4U5KA 3KZSA 4F0RA 3GNXA 4BF9A 2BY0A 3IK2A 1K7EA 3LHVA 2RDWA 3VU2A 4UB9A 5A6SA 5PTDA 3FKKA 2QJMA 2H3BA 4IJRA 2O7QA 4DEFA 2PCEA 1Z48A 2EEXA 3EWZA 3B04A 1OC7A 1X1ZA 3U0HA 3SY1A 3MHGA 5XINA 1OHLA 3UXIA 4S3DA 2YL5A 3IIVA 2V5JA 1OF6A 2G3FA 5D2YA 1HW6A 2C7FA 3OQ8A 4NRRA 1MUWA 1RR2A 4HMCA 5CC3A 1TWWA 3DKJA 3GDBA 5F7UA 3W24A 3DHDA 1SUXA 4UFMA 1EHNA 3FLUA 1J01A 4HPHA 1XKYA 2WJEA 4H1ZA 1J6PA 3MSRA 6REQB 3VC6A 3QC0A 4A6GA 1ITXA 5MKGB 1IEVA 2BLEA 2ZIDA 2ZZ1A 3SI9A 3UZ5A 3NQBA 2GVGA 4M7TA 1UA7A 5A6JA 3WF1A 1X39A 2BDQA 1TR9A 5BRQA 3CMFA 3VD5A 1XDLA 3EMCA 4H2HA 1GT8A 1VFTA 2B7OA 3SCRA 4ZO8A 3BG9A 2NV2A 2DP3A 2PWDA 1O1HA 3VFCA 1T99A 1EJVC 4O52A 1W1PA 3RNDA 3AHTA 1T41A 2PDLA 3DFYA 7ODCA 3W28A 1DQXA 3WX7A 1ITQA 3VMPA 3EX3A 4WHBA 2H9AA 2Z7GA 2ZICA 2YW4A 4I6KA 2HQAA 3VIHA 1DJQA 2ZX9A 4M19A 4DRSA 4P00B 2DUAA 1QHPA 1XYAA 4DYEA 1RXOB 2X7WA 2XFFA 4P8WA 3NO1A 2EG6A 1UZHA 4I9JA 3E2SA 3TTEA 1XGZA 2GJPA 1AFSA 1CXIA 3W1QA 4GH3A 1SPQA 5CEWA 3AROA 4XSLA 3S5YA 4IXHA 3CU2A 1EX5A 1JXJA 5I2UA 1D3CA 2OT1A 4ONVA 5DANA 4GYFA 1YPIA 3VNMA 1Z41A 1LCOA 4B3ZA 1RP9A 3KOFA 1XFBA 4JS3A 3WFAA 1KC7A 3EMZA 2QQ6A 3NG3A 2VT0A 1AQFA 4MNLA 5M2FX 1QHOA 1XYBA 3SCVA 1X6LA 4JR5A 3LCGA 4RE3A 1QI2A 4L9ZA 3W7GA 3QY6A 4G2DA 1IYXA 2PDUA 4GFSA 4Y6GA 1XCWA 5BYWA 1RJPA 3IVTA 2X1SA 2P53A 2FZDA 1VKFA 2ON3A 2UWFA 3O06A 3TNBA 3PZ9A 4E4UA 5ECVA 1M7XA 3RX3A 4GIAA 4GNKB 1R3RA 2PWGA 1QPKA 1QHZA 3UJFA 4UTIA 1R86A 4S3KA 3UWQA 7ENLA 1SQ7A 3ZIZA 4G8TA 2H6RA 3WLQA 4RNJA 1K8ZA 4FOJA 1V7AA 3LNMA 3SECA 3DFPA 2WHKA 2CHNA 2O92A 1QATA 1JPDX 4LVDA 1AL7A 4RV8A 4PZVA 3HGJA 3O07A 2YBVA 4D8AA 2BVDA 1J2WA 4H9UA 5AC6A 5C2CA 2FDSA 1T8XA 1DTUA 4Z1DA 5DFAA 5EMUA 1FWSA 3WYZA 1W8SA 1G7UA 1LL7A 3SN1A 4GINA 1MW1A 1SMDA 3L5LA 3LRLA 2E40A 1L9WA 4DJDA 4B3LA 1DEDA 1CECA 2AL2B 3VIKA 3W71A 3MI6A 4JCLA 2F6UA 5KINA 3T0AA 4GO8A 3NA8A 3S5NA 2IQTA 4AIOA 4LVBA 3DHPA 4XZMX 4XBJA 1MVYA 4YTSA 3LEPA 2GVJA 2DW6A 2ZZ2A 3W2NA 1JDEA 1DJGA 4WX2A 4JPGA 3LENA 5J04A 1QPNA 3T81A 1KFEA 2HK1A 4QTGA 1W9XA 2DZBA 3U2OA 2W91A 2V6AA 1UUQA 3GUWA 3S6TA 3TYDA 1EIBA 3UPWA 1XS2A 4ZQOA 2WNWA 1VPYA 1UD6A 4W85A 4MPKA 1F07A 3DBPA 1HP5A 4CQ8A 1F05A 2GVLA 1IEXA 1X7FA 2VC7A 3M0IA 5C71A 4URIA 2DSVA 4HPJA 1S5VA 4GNVA 4KEZA 3PBGA 3BAKA 3SN0A 1V6XA 3PBVA 2GOUA 4GYKA 4JHOA 2A7RA 3KWXA 2E9LA 4D1IA 4JTLA 5F2MA 2BTMA 1JPMA 4DXVA 2WBGA 4UFLA 2Y7DA 1KRCC 4JX5A 3LHTA 3CEPA 1PEZA 2OB3A 4JHMA 3KBVA 1J12A 1OD0A 3PUDA 1C3FA 2R82A 1XP3A 2BHYA 3OYXA 2J9YA 2BY1A 3EBVA 5AYZA 2X0SA 1JF6A 4QHRA 4B9YA 3GTNA 1IEQA 3NZGA 4A3HA 3AZTA 3MZNA 1E1CB 1JEZA 3WNPA 2EG8A 3CAKA 3MANA 5A8NA 1EUAA 1S3HA 3WD0A 2PTDA 2YKKA 1C29A 2P8BA 3GXMA 3UG4A 2QCHA 4D6HA 1VFOA 1JCTA 3CQIA 1G1YA 4A2SA 4PE8A 3CM4A 4EF9A 1SGJA 1QW9A 4M5PA 3GH7A 3VDGA 4N7QA 4GJIA 4PGLA 2NT0A 3K13A 1E9LA 5DCEA 2QCNA 4K37A 4RZ4A 4JFVA 3ARYA 4S2CA 3BLDA 5FA5A 1VFSA 2YCJA 1H5VA 1LWHA 1UBSA 1BKHA 4MUPA 2E1WA 5HUOA 1TQJA 1AW1A 2Q8ZA 1XBXA 4JN8A 1EC8A 1UMYA 3SCPA 3H53A 3B97A 2EPLX 2OVLA 3W7EA 2QJJA 3W07A 4EPEC 4R7OA 4W7WA 4MFEA 2G3MA 3KRUA 4JTTA 3NOEA 1MFUA 1FCBA 1TCMA 4W8LA 5FJJA 4R7WA 3NQDA 4PN2A 3VC5A 4IMEA 3WNKA 3KL0A 3WLMA 1E3XA 1WKYA 1HO1A 5G2HA 2NVCA 1ZTVA 3OA3A 2C19A 3P3BA 5HANA 2V5DA 5I3FA 1QPQA 3ARRA 2IKIA 1Q2SA 3BXWA 1K9TA 1E43A 2X05A 5HWJA 2BMBA 2PSNA 1OFAA 1XFCA 4GPNA 4XZHA 4IUOA 2HS6A 1OX6A 3STGA 4JL1A 5A6KA 1B30A 2QGHA 3MCMA 4PUKA 4ZFCA 3AIEA 3SDOA 2V5CA 2NXIA 3S46A 1WDQA 3BE7A 1PZ1A 4Y9MA 1E0TA 3HMCA 3F03K 4HOWA 1B31A 4F0SA 1HG3A 3N2XA 4UOQA 1P0BA 1R2RA 4MJ2A 5AB3A 4UC5A 3OG2A 1ZAIA 4MZ8A 5K9XA 1KFBA 2BASA 3EWWA 1HJVA 1W3TA 4GGHA 4JTKA 1K8XA 1OCQA 2WZMA 1JZ6A 3DFOA 2OKTA 3PNUA 4UTJA 4B2DD 3TOYA 1XR2A 3TN3A 3KL5A 1IXPA 5A2BA 4EOUA 3WQEA 5HR7A 1M1BA 1O5RA 4AIUA 4DBSA 1H3GA 4ZO7A 2HRWA 2G3NA 3SAZA 1KFWA 4U5IA 2CLMA 1A0EA 3QFEA 3RM9A 1PIGA 3W7OA 2OSYA 3DGBA 1PIIA 3B4UA 1OCNA 1HKMA 1FWAC 2WVSA 4MDOA 1J2BA 3OZYA 4WXZA 1U5JA 2HSAA 3MHUA 4GQBA 3PY2A 2YYTA 4XD5A 2OQYA 4MNMA 3OVPA 5CSUA 4PSRA 2GVEA 3K46A 4CGTA 1RD5A 3GNPA 1DORA 3CUHA 4DAFA 1TPC1 3KTCA 3THAA 1SSDA 3GXIA 2NLYA 3QHNA 3GG1A 3OGSA 1OG6A 4DUWA 3UZZA 1ZY9A 1W37A 3ITOA 1PKNA 4LOCA 1AD4A 3WLLA 5F1UA 1OC5A 3LXAA 1A3WA 3G1XA 3QOMA 3IJQA 3IVSA 2Z1SA 9XIMA 1JCNA 3IWPA 3GAYA 1W9DM 1B0IA 4JN7A 3T08A 4UTLA 3OQEA 2C18A 2X2YA 4HD5A 3TMQA 3CIVA 4GI6A 1ZALA 3PAOA 3POCA 4FI4A 3WH9A 3W6YA 3GWQA 3E5BA 3QR1A 4LUSB 3DU0A 4I9TA 1A50A 4XZNX 2QUMA 1W9VA 4DUVA 2CESA 1NDVA 3WK3A 5H8MA 1HKWA 3PBYA 3MCNA 1IXQA 4BQ3A 4C6IA 4CD5A 3B03A 3PNZA 2VEFA 4N4QA 1M6JA 2EHHA 5CPOA 5AHLA 1QRQA 2VFGA 1JDFA 2VKZG 2ZZ6A 3TVAA 3LPPA 2VD8A 1UR8A 4Z08A 3VDAA 3RXZA 2DQWA 2Y6ZA 1H41A 4HT3A 3SADA 2IKJA 4FX6M 1EJUC 4HBKA 3AS3A 2P88A 2HROA 4H8UA 2WLZA 3M5XA 1R3YA 5BRPA 1JUEA 1FWJC 1VCFA 1V0NA 4IUGA 4MAVA 3V35A 1E56A 1EF3A 1V08A 1MMFA 2X09A 3JR2A 4AB4A 5M17A 4ADUA 3MUIA 1X6UA 3W74A 2CBIA 1CGYA 2HVMA 1EQPA 3VKAA 4O53A 4AU0A 3CV7A 1PTAA 3TQVA 5M1TA 2ACSA 1ME8A 5XIMA 1HJUA 3VKDA 1E4LA 2MUCA 5EU9A 3P0WA 5E5CA 3SSZA 4NZ1A 3CT2A 3VMNA 1JQVA 4GLEA 3TXVA 2B0MA 2BY3A 3OHIA 1M7JA 1JI2A 4IT1A 2CLKA 3WD4A 1M7PA 2BBFA 4CNOA 3WNNA 3K4WA 3KOWA 4NXSA 4QG8A 3ALGA 3VMOA 1ZB5A 4WSKA 3U8GA 3GZAA 4PUJA 4R53A 3CO4A 2EF9A 4LS1A 3W02A 2YL8A 1FWWA 3M07A 4B5SA 1JDDA 1MQPA 3AHZA 3QYSA 3IJ6A 2E6YA 4NX5A 1KCLA 1XIGA 3VZXA 5MF5A 1XDMA 3QTGA 4GUJA 4C1LA 3L23A 2J7DA 4B4HA 2A7NA 4IHCA 4UQCA 2P5NA 1QT1A 4XX6A 2D73A 2F9RA 3QPYA 1EPXA 3R11A 1DP0A 1XF0A 3M0YA 4GNJA 3NNTA 4L1GA 1SVDA 3AIRA 2E0PA 2ZUVA 4GRSA 2DZSA 4IP5A 4UZSA 3JUGA 2RDUA 3D6NA 5KTLA 4DUOA 3KVMA 1C91A 3TYCA 1V6WA 2ZTJA 1AK5A 3U3HA 2F7FA 4MADA 4LYRA 4UTMA 1OK6A 1SO3A 3J7HA 3AZSA 2PGWA 3RO8A 2JGQA 1NDZA 3P14A 4TOQA 4HSHA 2O0TA 3V18A 2CLLA 2V38A 4I3GA 1ZP3A 1OK4A 2W61A 3PPFA 1LM1A 4BR1A 1UWSA 2XDFA 4F9DA 4A3UA 1B2YA 3VOGA 2JF6A 4GC4A 2Y88A 4BI5A 1VS1A 3ANVA 4PFHA 2CITA 3MUAA 1OYCA 2BGNE 4R7JA 2QNEA 4DYKA 3IAPA 1QI4A 3FSUA 1TV7A 4I9AA 1XLKA 3QV8A 4NT0A 1UKPA 3VX0A 2ZQ0A 3N14A 4XTDA 3O3RA 1U1HA 1GOQA 1ZBWA 3O15A 4GYPA 4N4PA 2VR2A 2HXUA 3FXYA 4K2SA 1I45A 3UWZA 1GKRA 2RHGA 4X2RA 1AW2A 3B40A 2E25A 3HU7A 3LTPA 4X0VA 1A5AA 1V6TA 4H8HA 1XH0A 2CU0A 3TC6A 4XVEA 3R79A 4E4FA 5FCZA 1WXZA 5CLTA 3DECA 1LOLA 1EF2A 4PUUA 3LXBA 1UC5A 4O1EA 2ACQA 2CETA 2PTWA 3C5QA 1QBBA 3GXNA 4MG4A 4O19A 3T8QA 2NUXA 5CXPA 3H4XA 3WK0A 2VEIA 3VOCA 5CLWA 2BXVA 2GDVA 4A3QA 4AEEA 4DNMA 3O0KA 3EEZA 4ZOCA 1LQ0A 4GY0A 1A3HA 3OVGA 1HL8A 1TUFA 4IGMA 5E6YA 2OEKA 1H7PA 3G0XA 3LHZA 2BP1A 1W9UA 3IVUA 2OO0A 4P8UA 1XSKA 5I24A 3CV1A 6CGTA 2WHMA 3TONA 2HPIA 1I1WA 2GWGA 1MSSA 2GQ8A 1V7YA 2C0HA 1VBHA 2QMKA 2QF8A 1JVNA 2GDUA 1RBLA 2BNJA 5EMLA 1FWCC 1Z3NA 3IJ9A 3DYMA 4FLSA 2C1HA 4Q6JA 4TQTA 4OECA 4DO5A 2PLKA 4RLIA 1TCDA 3TU9A 1A47A 3HIJA 4XD4A 4GCAA 3CL6A 1LG1A 2F38A 1BYAA 2E8ZA 2OQLA 1GVQA 8XIMA 1UPMB 4JKKA 4MWAC 2BOGX 4HOZA 4RJEA 4C6QA 3APYA 4Z2KA 1LF1A 1WPCA 2VX5A 4W8AA 1LP6A 3WF4A 2ZA3A 4DLMA 4O57A 3KAOA 4V1XA 3CUGA 4RV3A 1GG0A 4O54A 3EPOA 1SSGA 4IP4A 1NWSA 4B5XA 5EBAA 2MNRA 2VFHA 2XN1A 3TN5A 4V1YA 1WZKA 3DAQA 4BZYA 4J3XA 1YIXA 1GPFA 1JJKA 1TELA 3MU7A 3WMLA 3WJYA 1JR1A 2G95A 1EWEA 4C6EA 1QNPA 2GGIA 5EA9A 1KKRA 5EMJA 3OODA 4EXBA 2D2JA 4CNTA 4S3EA 1KA9F 2A7PA 5HK4A 2A85A 3EDFA 5DT5A 1MW2A 1HN1A 1U33A 2NSXA 3C0SA 1DE5A 3F2CA 4WR3A 1F4AA 4GI4A 1AVAA 3QRHA 1FWTA 4JEJA 3VGBA 5DX7A 1ECEA 1NFBA 3FHQA 4KIRA 4NZFA 2FPVA 1VCVA 3BG5A 3STCA 5C9UA 4KEMA 3OLIA 1XCXA 1LWIA 1F76A 5IXEA 4GFIA 1CNVA 5F2LA 1ME7A 1BVWA 2CBJA 4LYQA 5K4XA 4EF8A 1YPXA 3SCWA 1ZHAA 5AVHA 5AC7A 5T91A 4LF2A 3HTWA 4QFUA 3DKLA 4XIMA 4GD0A 2RAGA 2J88A 3QC3A 1SW7A 3LI0A 1T7LA 3KOZA 1ZBKA 4MTVA 3VKBA 5JIPA 4GZIA 1Q6OA 1V0LA 4KMQA 2FZMA 2HXTA 2JIEA 1W5MA 3R8GA 4CEUC 2YA0A 3PP7A 3FVMA 1P1MA 1G0CA 1ZCCA 3LXCA 3WLTA 3MP3A 3KTXA 3UCDA 4MZYA 2HEJA 2PODA 3POHA 3TK7A 4FNSA 1R46A 2DIJA 3B0XA 4S23A 1BHGA 2GYIA 3DH7A 4K36A 4JAWA 4B5VA 3EOUA 2VC6A 4E8GA 3GG7A 4JTRA 3S5OA 3FY1A 2V82A 1A4LA 3AO0A 3GNDA 2Z26A 2V63A 5DMMA 2PA6A 6XIMA 5D2VA 1YBQA 4XV0A 4ECLA 1J0ZA 3PN8A 3R8RA 4U3AA 1R9XA 5F4SA 4D8ZA 3W25A 1A5CA 3CTLA 2E4TA 4XAYA 3GNOA 2AAAA 4Z42C 1OX5A 5AY7A 4Q4QA 3URNA 2Z6JA 3OGRA 1TPFA 4TMBA 3OB8A 2QUVA 3KVKA 3C8FA 3SRHA 3KCJA 3K8MA 1B9ZA 1W3NA 3KRSA 3WK1A 3V1PA 4RE4A 1R38A 4O1BA 3VFLA 3O7UA 3W38A 1N8IA 3GC2A 3W1PA 2PWHA 3T1GA 3A21A 3QLDA 3T44A 2VGBA 4OUEA 1XDJA 2WZTA 3OEXA 3W7KA 5DO8A 1L8PA 1VQTA 3QHOA 4Z2LA 1ZJHA 3GDRA 3FJ4A 2G3JA 3WFZA 3TKFA 3GFXA 1JF5A 1BVZA 2Z0IA 3MI3A 2XZ9A 2CZ5A 2ZWYA 1XBZA 2J7EA 4R5EA 4M29A 4HCDA 2NQ5A 2D22A 5EJ1B 1NFGA 2AQVA 1OFBA 4XISA 1V3KA 3EDJA 1BPLB 1XG3A 3T4WA 1DV7A 5DRCA 3P5ZA 1SZEA 2R9RA 1Q6CA 2DZWA 2Y5SA 1QPOA 3USZA 4O17A 1RALA 1VIWA 3NPVA 2BGSA 1MXDA 2WMGA 1FDZA 2FJKA 1GQNA 3H22A 2QAFA 1ZPTA 2HCVA 5HMDA 1UZ4A 2R14A 3CHDA 3NDYA 4AWEA 1Q45A 3IJDA 3DGRA 4NVTA 4HHLA 3KUMA 3SZ8A 2BXZA 1K02A 1DPMA 2CFFA 1VJIA 2E67A 3DBNA 5BZAA 3QHMA 4HHMA 4IL2A 3KE0A 5CKSA 1FWBC 3PM6A 1V3MA 1XLBA 3TTQA 3N9KA 4RNIA 3O6DA 3NOYA 1Q5MA 1DL3A 3W2KA 2HVOA 4QEEA 2QJHA 4KEUA 4ERAA 2VCBA 1ODUA 1KTNA 3L2IA 3VKJA 1VD6A 3ONBA 2DSWA 2FYMA 4I9MA 3NUKA 2DUXA 1DJXA 3W9ZA 2PDQA 3CJPA 2OWCA 3NM3A 3SQSA 3NPXA 1EXBA 3PK7A 3MBDA 3HFTA 2Z2BA 1F6KA 1MRQA 2CW6A 3GYEA 1Q7QA 3D3AA 2Z2AA 1V3LA 3ONCA 1FWEC 3WF0A 4JXCA 1OSEA 4GQ0A 3K30A 1DIDA 1RJQA 4Q4MA 4IFKA 1QNOA 4E38A 3OZOA 3ZR4A 1I2QA 5AYBA 3TSBA 4CCDA 1BTMA 4S3BA 4E5TA 3M0KA 2ZXDA 2OU4A 4RXGA 3ZJ7A 1VP5A 1WDWA 2D0FA 3RG6A 1QW7A 5CBJA 3Q67A 2YZ5A 5I6SA 3MUCA 4KESA 1V77A 3A4XA 3MMTA 2VFEA 2IKHA 4A4AA 2FHBA 4J9JA 4RE2A 1XC6A 2QV5A 3PJWA 4J4KA 1DJWA 3CHCA 5L9FA 4H9TA 3QMTA 3AMDA 3EOSA 1LBMA 1J6OA 1HP4A 4XAPA 5HINA 2C16A 2OFJA 3M47A 1VBGA 4Y9PA 3CYJA 1H7NA 3OO2A 1E0XA 1HFBA 3UR8A 1TMQA 2O4QA 4BQ4A 4KRZA 3SRFA 3TUUA 4F0LA 3UJSA 3E0FA 4JTUA 2YW3A 1K6AA 3MKVA 2NVDA 1E15A 1LWJA 1GJPA 4OV4A 4J28A 3AS2A 5D4YA 1UOKA 1ZL1A 2E6FA 4IPPA 4ZVJA 2WVTA 1WXYA 4QNEA 3S1WA 2G41A 4RCXA 2ZDSA 1UASA 5LZLA 1OIMA 3MWCA 4AHOA 1TPVA 2XJ7A 3BV4A 4HA1A 1Q6DA 4M0XA 3VOJA 1TTJA 1U2YA 4FNQA 1JIBA 3RDKA 3DOPA 4LUYA 4LH8A 4OBSA 1UD5A 5M3WA 4YXGA 3M43A 2YA1A 3VVGA 3KLLA 3UVAA 2QKFA 1OX4A 5AC8A 4DBUA 3NWRA 4CVWA 4QJ3B 2WSKA 3KBSA 4QGCA 1GYLA 4HNOA 4M3PA 5CZJA 4TVUA 2BS9A 4HMEA 1FCQA 4B5UA 1Q4WA 1VYPX 5DELA 2P76A 1D8CA 3W82A 3APGA 4ICNA 2BGQA 1AL8A 1RK5A 2ZUUA 4LV4A 3T9PA 2H3DA 3NL3A 3C2FA 1AH4A 4R85A 3O0FA 1HVXA 3CH9A 3PZNA 5D09A 3GXFA 2GVYA 1GVYA 4H9ZA 3II1A 3CWHA 3BO9A 4C6CA 1B3XA 3NURA 1KB3A 1J0YA 3N6JA 1PX4A 3CB8A 3LLDA 1ADDA 1J0IA 2IS7A 4O11A 2J62A 2AGTA 4DF2A 5C7HA 4GQRA 3LG3A 3S1XA 1LRQA 1DVJA 2WSRA 1E5JA 4JTCA 4AZIA 5I3KA 1QOPA 4DNHA 1QMLA 4IL0A 2QDEA 5LGZA 3DC8A 1CLKA 1M04A 4O8RA 5HA7A 4P7LA 1X1OA 5LKYA 2WWDA 3UWUA 1UWQA 4GVIA 4XUYA 5I3DA 3SIMA 1E73M 3E1F1 2ZFAA 4ZMGA 2XG9A 4QLLA 3AXMA 1ZU8A 1OVDA 3HO8A 3UYIA 4Y8FA 4QR6A 3SM0A 3TJ4A 1W56A 4PUWA 4O1FA 3KRBA 4YYFA 3MSGA 4OUIA 5FF2A 2V3FA 2WC3A 1C93A 1V3IA 3WIJA 2I16A 4B3KA 3G0UA 2V2HA 1EBHA 2V5KA 4ATWA 1UB3A 1ZAHA 3R4IA 1YDNA 1Q6RA 1YE6A 4HA3A 4JY9A 3FKRA 1FTXA 3GVWA 2PLCA 3W2MA 3MS8A 2JEQA 4RW3A 2DZXA 1E0VA 4I5RA 3N11A 3VNIA 4HN8A 3H21A 2BXYA 1LT7A 4S3AA 4IJCA 4PMQA 4CU6A 1W8GA 2GJXB 4WIWA 4C6DA 3TCEA 3TR2A 3VIOA 3F1QA 3GFZA 2PCQA 4L4LA 1QO2A 1Y65A 2ONEA 1YTKA 1SO4A 3RCYA 1Y0EA 4S3JA 3NVTA 1WAWA 3OOQA 5ENLA 3H2FA 2D3NA 3SUWA 1K7FA 1DJIA 3M64A 4IFKB 3KBNA 3B9EA 3EA1A 3SCSA 3BLFA 3WDQA 1TZ7A 4YVPA 1G69A 2EQDA 5LA2A 2J7HA 1V02E 3TSDA 3UEQA 4EWJA 1W9PA 1I0DA 1XLIA 3H2OA 5DCDA 3R12A 2OGJA 1VIZA 4JHZA 1QCWA 3VNKA 1LUCA 3WQVA 1JZ7A 5BU6A 4WGHA 3SY5A 3PFRA 4FF5A 5FJIA 3AU6A 3ZLGA 3K5XA 4UNKA 1X1NA 3R2GA 4NG3A 1JZ2A 3TLQA 4JGDA 2PWEA 2OLHA 3VINA 4CD6A 2NWSA 3CIWA 5LNVA 1SJDA 1HF6A 1EJ7L 3M9YA 1CENA 3BMVA 4RK8A 3ZJ8A 4I7UA 3E12A 1JZ3A 1BQCA 2PP3A 4NZCA 1V4YA 1FH7A 2YR1A 1ZJBA 3ABZA 5JBEA 1QK0A 1QK2A 2QJIA 4AY1A 4L65A 3IJ7A 3MTWA 4Z2JA 2QCGA 3UCQA 2GJNA 3TW6A 3WBEA 5JMUA 3LHYA 3GW3A 2DT0A 1E70M 4Q7BA 4EP8C 3V4BA 2OG9A 9XIAA 2QPSA 1UD3A 2Z27A 3NQ6A 2J27A 1W1VA 3RLGA 2PUZA 3I7SA 3DN5A 3KDOA 3GZ3A 3N34A 3M7SA 3QGVA 4M81A 2BWGA 1AH0A 4DJFC 4LB3A 3WLRA 3KM8A 4N42A 2FH8A 3PBWA 3EA3A 4B16A 3QOKA 5A3HA 1BG9A 1OCBA 3VD7A 2VDIA 1VFFA 3B8SA 2ZZ4A 3WLIA 3CMJA 3WCZA 2YFOA 4GBUA 1EHAA 1LBLA 3GTXA 3ORWA 3C61A 1YXDA 4O10A 3LQGA 4PB5A 2D2OA 3RGTA 1JFHA 2FQIA 4U2YA 4LUTB 3FJLA 3H55A 3A13A 3WKZA 2ISDA 2I1OA 1GOOA 5I3JA 1NWTA 1XQLA 3RLHA 2BVYA 1YE4A 2A0NA 3TCSA 3LCIA 1J0HA 2VZVA 3PVFA 3HGRA 3FW6A 1H62A 5CJ5A 3QY8A 1IWAA 4JKMA 1UZ1A 1V51A 2IXVA 4HHHA 4LBUA 3KZPA 2J8TA 3CYVA 2QHAA 2Y62A 3A5VA 3HG5A 2XH7A 1T8QA 3B0PA 3LK6A 1GHRA 1W1YA 3PSWA 4WKHA 3WJSA 1THFD 5G4EA 3HOJA 4LRTA 1O4UA 3COTA 4QX4A 5DXXA 4X61A 1ZFJA 1TVNA 3ARWA 4AUBA 2CLEA 4LCQA 2G4FA 2PRLA 5IHSA 3AALA 5IM51 4GY7A 2XU2A 1Z69A 3MKKA 1V02A 4AMAA 2B7PA 3LTYA 3EWDA 4W87A 4ZEPA 1R9YA 1VPQA 2WSYA 2BG5A 3W83A 4XZLX 4E0CA 5FACA 4K8HA 3SURA 1VEMA 1F8IA 1EYWA 1IXNA 1HKJA 2VEGA 1E9ZB 4WCJA 3CAWA 5CH9A 5FIPA 2OZ8A 3FAXA 2Y89A 3ZSTA 2J79A 1EX1A 3EDDA 3VGFA 2R1PA 5F4WA 4OHQA 3AWNA 5I02A 2FMOA 1TUXA 4H01A 4HMNA 4KCTA 3C0JA 4CQCA 1EA9C 1NP2A 1TVPA 3O1NA