3WMBA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with naphthalimide derivative q1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTLHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERFVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A crystal structure-guided rational design switching non-carbohydrate inhibitors' specificity between two beta-GlcNAcase homologs
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wmbA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3wmbA01
3S6TA 5M3WA 3FXYA 2WCSA 2BVDA 1XYZA 2PI6A 3EDFA 1JXJA 4PTWA 1TE1A 4C7GA 2FHFA 4AD4A 2JEPA 3FNDA 4ATWA 4D1IA 5M03A 1E6XM 1JNDA 2ZX5A 4HZ7A 1E0VA 1OBAA 1BG9A 1E40A 3MV11 4M80A 4CD4A 4MAZA 1UHVA 4HMDA 1QI0A 1MQRA 2OSYA 3HJEA 3VDHA 4UOJA 3ZQ9A 1M04A 3BAXA 4UOQA 4UCFA 3QHOA 2JALA 1WKYA 4QDMA 3WNLA 2AAAA 1NM9A 1HJWA 2V5CA 3PTKA 1WP6A 4KWUA 4B9ZA 1XYFA 1HT6A 1LG1A 3LMYA 2WNWA 4JCMA 2XVGA 3BLPX 1GOOA 3U7BA 4RE2A 2X2YA 3NIYA 3WDRA 4ZXOA 1E0WA 5KZ6A 1LLOA 4AC1X 3ZJ8A 1N82A 4CD6A 3VU2A 4AD3A 2BNJA 1KR0A 2PWGA 1ZBCA 1IZKA 1GCYA 2D3NA 3THDA 1LJYA 3AJ7A 3AHTA 3DC0A 2PBGA 1XHGA 4PYSA 1ZS2A 4W89A 4AZBA 3M07A 4KMQA 5BWFA 2PF0A 1V02E 5CPSA 2VZSA 4F8XA 5E6ZA 2VVNA 1UA7A 3RJXA 1YHTA 2CPUA 2JF7A 1DWIM 3WENA 4W87A 3NJ3A 1NWSA 3MO4A 3VIMA 2VRKA 3M7SA 4TVDA 3ARZA 4W7UA 3W37A 1GQKA 1BQCA 2GK1A 1RP9A 2DQXA 2GJXA 4GQRA 1R85A 3NSXA 3GH7A 5LYRA 5I0DA 2DT0A 1I75A 3CZLA 3ARRA 1UR9A 3K4DA 4AW7A 1OD0A 2XUCA 5CGMA 1GOWA 2GVYA 2UWFA 2VO5A 2VX5A 1BPLB 3CHEA 4P7OA 3WFLA 1BYDA 3VIPA 4KGLA 5JBDA 4MB4A 5DMYA 2QV4A 4HZ8A 2J7GA 2NT0A 2PWFA 1BLIA 4LQ1A 1GJUA 1DP0A 2D0HA 3II1A 1E55A 1E73M 4UOZA 1M01A 4LX4A 1MVYA 4H7VA 6CGTA 1EQPA 4J3TA 4TVCA 1Q6DA 2VCAA 3AHYA 2J78A 3CMJA 3ARWA 5E0CA 1K6AA 3K8LA 3N18A 3VD5A 1J0KA 5HXMA 3CBWA 1C92A 1H49A 3ZT6A 4OOZA 1CEOA 4KGJA 1HL8A 3VMOA 1OSEA 1VEOA 3VPLA 4L4PA 4JHZA 2ZUNA 3WMSA 5A6LA 2J25A 1FH8A 5I77A 4GKLA 1BGAA 3L4XA 5LA0A 2YDQA 1CNVA 1OGBA 1W3JA 1OGSA 3AOFA 4UNIA 1WZLA 1CZ1A 2XVKA 3WD1A 3T08A 2WVVA 5AC4A 2E9MA 2WYSA 3CZ8A 5D9NA 3S2CA 4HOXA 3PZ9A 5E6YA 1FFQA 3DYOA 2QPSA 1V02A 3WL0A 1VRXA 1UOKA 4PCSA 3OLGA 4D6EA 1LL4A 4WKHA 1KBBA 4HU0A 1V3JA 5A95A 3PZIA 3AIVA 4WKAA 1IV8A 1JZ4A 1RD6A 1C7SA 2G3NA 4NSBA 5E9AA 1TCMA 4V2XA 4X9YA 4E8CA 7TAAA 1KB3A 1W3KA 1ESWA 2CXGA 4ATDA 2XHYA 4OBSA 1EDGA 1LG2A 2WHJA 2FH8A 2G3JA 1CXEA 3FN9A 5A6KA 2WAGA 3BGAA 5EBAA 5DFAA 2WMFA 4JFUA 4M29A 1NQ6A 2D2OA 2OSXA 2Y8KA 1EIBA 3AIWA 2OSWA 1V0MA 4U2ZA 5CQ1A 1KQYA 3OB8A 1UD3A 2DT1A 3PZVA 2V3EA 3NUKA 1LWJA 3WEZA 4CUCA 4JCLA 2Y4SA 1VFFA 3WKZA 2Y2WA 2FHCA 5ABHA 1VB9A 1BVNP 1EXPA 2FH6A 2WWDA 2EQDA 1K9DA 3VX0A 4P8WA 3SUVA 3ZT5A 4JHOA 2XGIA 3BC9A 3TP4A 4CKQA 3AYRA 3WNPA 1TVPA 1ITXA 2W92A 1QI2A 4MJ4A 1HN1A 2YLLA 3CHDA 3AZTA 3WH9A 3N04A 2GUYA 2YDSA 1FP8A 1M03A 4FLQA 5BXPA 1JD9A 1E1FA 4ZEPA 1U33A 1KWKA 4A3YA 2WLZA 4PUDA 2O92A 3CZEA 1BGGA 3M6DA 3RILA 1VFUA 4U5KA 1W3HA 5IDIA 2W91A 3PHAA 4ACYA 1O7AA 3FAXA 2EEXA 4K68A 4M81A 2VR4A 4EANA 2CETA 2YA1A 4CU8A 4XV0A 2XIBA 4AD0A 2E8YA 5A8PA 1CXIA 1YQ2A 5I24A 1UD6A 3LPOA 3PZNA 1EDQA 4ZENA 3VNZA 3EMQA 5GNZA 1BG4A 4X0NA 1E4MM 1WE5A 2IUZA 5I78A 1H2JA 3GXFA 3AXXA 1CECA 2RGMA 1HJVA 2W62A 4P8UA 1SMAA 1Q6EA 2WSKA 1MXGA 4DWSB 1JZ7A 5HPCA 3VGEA 3ZJ6A 4GI9A 4CU7A 3AHXA 3AMDA 3EDDA 1CXKA 2CCRA 2EPMX 1E70M 1W9DM 2JIEA 3OGVA 4GZJA 1DWGM 1V03A 2CHOA 3VDAA 5BRQA 4CN6A 4PMRA 2ESCA 1UD4A 2VT0A 1HIZA 4D1JA 4EK7A 3A47A 2WW5A 4AWEA 2G3IA 1US2A 1WDSA 2EPKX 4ACZB 2YL9A 1C93A 1I1WA 3D3AA 1LF1A 1WDPA 3G6MA 4IISA 2OWWA 1XSJA 2D24A 3AHZA 5I2UA 1R8LA 4R27A 2E40A 2X0HA 4MADA 5DT5A 4QCEA 4UFJA 2G3MA 4LPCA 4DUVA 2ZXAA 5FD0A 1FP9A 3AXHA 2WANA 1VJZA 4UQDA 1L8NA 5E0FA 3WH7A 1JXKA 2BS9A 1B90A 2EPNA 5HBFA 2QHAA 4KRTA 3WUEA 4MNLA 2QMKA 3WQ5A 4MAVA 5HOSA 3GNRA 1KXVA 2VCBA 3N11A 1ODUA 2BY0A 4D6DA 4WSKA 1EHNA 3AMLA 5JUVA 1QBBA 4JFTA 4PMDA 1RH9A 1D2KA 4RE4A 1UH3A 1QNSA 1MYRA 2YIHA 3SCOA 2VOTA 1ZBKA 2PWDA 4UFLA 1Q6CA 1CYGA 5C70A 2WB5A 3SUWA 1XSIA 4D6FA 1HVXA 2YOCA 3BXWA 1UQYA 1W1PA 1RP8A 5CZKA 1XRVA 1CIUA 1DWFM 1W9VA 3GH4A 2VX4A 4MB1A 2RGLA 2WMHA 4MB3A 5FOOA 4BQ4A 3RJYA 4QLLA 2EO7A 2FGLA 4XZWA 4XB3A 2A3HA 1UR4A 1PEZA 1DTUA 1S46A 2YA2A 2YJQA 3WQ6A 2WKGA 4QP0A 2OYMA 4A4AA 1OB0A 1ZBWA 3JUGA 3SCNA 1BFNA 1J0JA 4CCCA 1OT2A 5GNXA 1A3HA 4MNJA 2OYKA 2E9LA 3VTRA 4ZE5A 1DWAM 4RE3A 1JAKA 2J7HA 5A6AA 5A69A 1GVIA 2DGAA 1AQ0A 4UQCA 3BSHA 1NWUA 1JI2A 1FHDA 2V3GA 1HXJA 1UKTA 4AD5A 2VZVA 4PMXA 3CUFA 1J0IA 1PJ9A 4IUGA 3D5HA 5GPRA 3WQVA 1JYVA 1OINA 1Y7VA 2PB1A 3NYDA 3WIJA 3VGHA 3ZIZA 4ATLA 3SUSA 1GQIA 1OIFA 4URIA 2A3CA 5IFTA 1GQLA 1H4PA 1NOWA 1OWQA 4AIEA 3WQ4A 3WQ8A 5ABFB 1IZJA 2G4FA 4UFKA 3SCTA 1TA3B 2VCCA 4L4OA 1JZ5A 3AS2A 3WD0A 3SCUA 2YDRA 3AIRA 2C0HA 3WDPP 4W85A 1JF5A 1J01A 4CD7A 1B3XA 3CMGA 1XSKA 2XWDA 4PMYA 1QW9A 3PTMA 4Y7EA 1BYBA 2WVUA 1MQQA 2OYLA 4AD2A 1XC6A 5CLWA 2BY1A 3BAYA 1CGVA 5A2CA 2AMGA 1E43A 1XD1A 3EBVA 3T2OA 1W3LA 1WCGA 1JFHA 1RPKA 4J27A 1V6WA 1B31A 5FCZA 2O9PA 2WXDM 2VRJA 3QOKA 5DT7A 4U33A 2J8FA 3EDKA 3I3DA 2F8QA 3ZSSA 4F66A 1UWUA 3ECQA 2JEQA 5GQBA 4CCEA 4H2CA 4JIEA 1J0YA 3THCA 4FMVA 4IPNB 2D0GA 2B31A 1UR8A 4W5UA 1NOUA 2JF6A 3W26A 1LWHA 1H11A 3W38A 2VL4A 2ZX6A 1VFMA 2DT2A 1JDAA 1CXLA 3UEQA 1JI1A 1E6PA 2VMFA 2VZUA 1WB0A 2WSPA 2VC9A 3ZMRA 1EGZA 2OWCA 1Z32X 4J3VA 5TD4A 2D22A 4CN4A 5I5RA 2ZXDA 2GDVA 3WN6A 1AQMA 3WQWA 3MSDA 3WF3A 2DIEA 3AS3A 4QCFA 4QFUA 1QW8A 3ZR6A 2ZUTA 2XGBA 5A6JA 3BAWA 5A2BA 1MQPA 3SCSA 2WKLA 1SYTA 3A3HA 3WD2A 2J7EA 3IAQA 3K46A 1VAHA 3VM5A 3T0BA 1R7AA 1B3VA 2QF8A 1E3XA 3VIGA 4NI3A 5JIWA 3VM7A 4AMCA 2V3DA 3WD3A 3WF4A 2BHZA 1JFXA 3AS0A 3PZQA 3CLWA 3VIHA 1F4AA 2GJRA 3WL1A 3W24A 1KXHA 2XIIA 1V6UA 2W66A 3A4XA 5FKYA 5ABGA 3W81A 1JZ6A 4MB5A 1E4IA 4JL1A 3F4VA 2J7DA 3K8KA 4LXFA 4P7QA 5AY7A 1VENA 5ABEA 5A1AA 2QLYA 4M1RA 4DWSC 2O9RA 2QPUA 2A3EA 2E8ZA 1X1NA 2ZUSA 5HPOA 2BHYA 2IXUA 1H0IA 1OIMA 8CGTA 4M8UA 3ARPA 3GZAA 4HA4A 4Q7NA 1GHRA 1WPCA 4D6IA 1KXTA 4CGTA 4GPNA 1R87A 3CZKA 4U3CA 5CXPA 4RL3A 4Z2GA 4C90A 2CIPA 3EMZA 4UQEA 6A3HA 1VEPA 2GDUA 4JZ5A 4Z2KA 4HA1A 2WCGA 4B3LA 4HOZA 1HJUA 3GYCA 1CWYA 1KCLA 3FW6A 4OOUA 3OZPA 3VDCA 2WVTA 4AD1A 1E15A 2X8RA 2D20A 5JIPA 3NDYA 3MV01 4AXNA 3SCRA 2UY5A 1HP5A 1V3IA 1W1VA 3K4AA 3OBAA 1JNEA 1E6QM 1NP0A 1OGGA 3VD4A 1OM0A 3DYPA 3W27A 1GZJA 2F61A 4D6HA 2DT3A 4AEFA 5M17A 2WZIA 4J3XA 2EXOA 1R7OA 3T0DA 2VX7A 2VQTA 1TZ7A 3AFBA 1H1NA 5IFPA 1GOIA 3WNOA 1E4NA 1H09A 4V27A 3UG4A 1J0ZA 1US3A 1W32A 3NCOA 4S3JA 3MMUA 5A8NA 3AXIA 3CHFA 1K9EA 4M24A 3GXIA 2WK2A 2BY3A 4CD8A 1UZ4A 4ZE4A 3MMDA 3M46A 2EPOA 1WZKA 1WO2A 1QVBA 2PBOA 4MDPA 3W82A 2D0FA 4FLRA 4TX8A 1BVZA 1GOMA 4D71A 1J18A 3IJ8A 3TTSA 3IJ9A 4D6GA 1E1EA 1EQCA 4W93A 1UYQA 2W63A 5DEZA 1QNRA 1IT0A 1G01A 3TTQA 1J0HA 4W84A 4DWSD 9CGTA 4HPHA 1KWGA 3BAKA 3AIBA 4S3KA 1H0GA 1TA3A 1BSIA 1E71M 1NARA 1XH1A 1PBGA 1KGUA 5CSYA 2FHBA 2WVVB 4H8UA 5BRPA 3TTYA 2E9BA 2WVSA 3L4ZA 2XVPA 1HJQA 2UY2A 3AQUA 4JKLA 1NH6A 1GNXA 3WH6A 4WKFA 1UG6A 4MNMA 4AY1A 1XD0A 1G0CA 4IPLA 3T2PA 4JKKA 4BA0A 1UH2A 2W5FA 4GO9A 3KWXA 1UR2A 2YL8A 1FHLA 4H8HA 4P8XA 3WDQA 1G94A 3VMPA 4PSRA 1TR1A 1Q4NX 4AZCB 4LGXA 7CGTA 1K9FA 4OIFA 4PMVA 3MUIA 5D8WA 3VX1A 3OZOA 4GINA 2J75A 1W9UA 3W0KA 4MTVA 2W61A 3BMVA 3UR7A 2J7FA 1R86A 3DECA 2V38A 5GNYA 1KR1A 1B9ZA 3CH9A 4W88A 5A6BD 4GXPA 4AISA 2VNCA 3B9EA 3CZGA 5JBEA 2X09A 1GONA 4AZHA 3CUHA 4Q22A 5CPTA 2ZE0A 1OD8A 4AZ7A 4H8VA 1CGWA 2XG9A 3WF2A 3GM8A 3L4TA 5A94A 4Z2HA 3GXMA 4QAWA 8A3HA 1GOQA 1HKKA 3MU7A 5KEZA 2WC4A 2DDXA 5A6MA 2CBUA 1E6SM 3K8MA 3SUTA 1P6WA 3RCNA 1ITCA 3T09A 1CDGA 4CVUA 1ZJAA 4P7RA 2DSVA 1JZ8A 1B3YA 4YHGA 3AIQA 1V3KA 4OBRA 1HL9A 1ECEA 3GNOA 2XFYA 4PMZA 1JDDA 1ZL1A 2D23A 2CBIA 2WCAA 1CBGA 4PSPA 1W9BM 1UKOA 4W8LA 1NWTA 1XH0A 2XYLA 3CO4A 1E4LA 3AMGA 1HJXA 1FA2A 1QI4A 4AIOA 1V3HA 2Y8VA 1EA9C 2DH3A 3AS1A 2WZEA 3A4AA 5F7UA 4LYPA 4UZSA 1W91A 1HNYA 1LL6A 3OGSA 2AOSA 3W4RA 2VVSA 4N42A 1DWJM 2Z1SA 3B9AA 1MFVA 3BAJA 1ISVA 1CLXA 1XV8A 1J9YA 1V3LA 2HVMA 2WWCA 1E0XA 4YN5A 4PTVA 2CBJA 4MJ2A 3WMBA 3VDBA 3AIUA 1F4HA 4W5ZA 4YPJA 3FAWA 3WEMA 4DWSA 3VIOA 3W6MA 4J3UA 4OZOA 4PBGA 4TXEA 2J62A 4HMCA 1VJSA 3RPMA 3W53A 1NWRA 4ZFMA 1VF8A 4BF7A 1B2YA 1UD2A 2DSWA 1E6ZA 1JZ2A 3VILA 3ZOAA 4DUXA 4ML4A 3I3EA 1UUQA 2PWEA 5JBFA 1DWHM 1KGWA 4WLCA 2DH2A 4UFHA 3APGA 4UTFA 1B30A 1JF6A 3OLIA 3RM4A 4AZGA 2F2HA 2EPLX 1NOFA 3N12A 2XSAA 5CG0A 1CPUA 3VO0A 4XUYA 3A4WA 5C71A 4BCEA 3AZSA 1WZMA 3VD7A 1VEMA 4UFIA 3PBGA 3WDHA 3F5JA 4ZXLA 2WBGA 3BH4A 5HDRA 1XH2A 4Z2IA 5EFDA 2Q8XA 3HN3A 3DHPA 5BXTA 1X6LA 1FH7A 5EB8A 3PZMA 5D4YA 1JDCA 1A47A 1QBAA 1DEDA 5LA1A 4JFVA 4D6CA 3SCVA 3FHAA 2WMGA 4H04A 4H41A 2CKRA 1EOMA 1PX4A 1KQZA 3LPGA 2CNCA 3GBDA 4AZCA 5DF0A 1BYAA 1DHKA 1ISWA 2ZIDA 1TFVA 2PWHA 3WDIA 2ZXBA 3UETA 2FGZA 3VOCA 1J12A 3CUIA 1CGXA 3CGTA 3J7HA 4GO8A 2XPKA 2W67A 3EMCA 3T2QA 4A3HA 2CBVA 2DEPA 4N0RA 1C91A 1B0IA 4GZIA 4UZUA 2BVTA 5CGTA 4TTUA 1GUVA 3BMWA 3AROA 1U2YA 2J4GA 1PZ2A 4GI8A 1HJSA 3WNKA 1UWQA 4NRSA 4UFMA 4FLOA 1L0PA 2Z1KA 2XVLA 1QNOA 3A6OA 5FL1A 1X6NA 3KL3A 2E3ZA 3SCPA 3CHCA 1TG7A 3RDKA 1JYWA 3PZTA 1CXFA 4JFSA 3UG3A 1BF2A 3AMCA 4BS0A 4EE9A 1MW3A 1I1XA 3VVGA 2CEQA 1WNOA 1G1YA 2C8NA 2ZWZA 2WHLA 4TOQA 2ZICA 3OG2A 5I6SA 3CTTA 1JIBA 1EOKA 2NW0A 1CGUA 1G5AA 3VIFA 2VZTA 3O9NA 2VUYA 2WLYA 1ISYA 1V0NA 5I79A 3DHUA 2CKSA 2CYGA 2X1IA 2DSZA 4HZ6A 4E4PA 3VGBA 3ARTA 3ARUA 3AYSA 3WELA 3L2MA 4JKMA 3KL0A 2Y5EA 1GJWA 5DO8A 1TVNA 5D9MA 3WMCA 2WHMA 1PZ3A 3B8SA 3QHNA 5A2AA 4W8AA 3ALGA 3VINA 1E5JA 3VIKA 2XFRA 1PPIA 2WMIA 2EBNA 3WUGA 2ZOXA 1K9TA 4AZIA 2ZUUA 3DYMA 4J7RA 4W8BA 5E09A 1GPFA 2G8ZA 1FOBA 1E3ZA 1UWTA 1HP4A 1UWRA 1BAGA 1UR1A 4F9JA 4TX6A 2V3FA 3ARSA 4CU6A 2WHKA 2X0YA 3W6LA 3OLEA 2YL6A 2GSJA 1U30A 1W1YA 3N17A 3LPPA 1PX8A 2VRQA 3L4WA 1CTNA 4FF5A 3WSUA 3VKKA 3WFZA 1UQZA 1VBUA 4BZYA 4PRWA 1C90A 3VNYA 4J3SA 1HVQA 2BHUA 4GQQA 4U3AA 1AMYA 1QNQA 3K1DA 3ZJKA 1H3GA 2JIWA 4X0VA 3GXDA 5EMYA 3W25A 3GDBA 2QMJA 1PX3A 5ABFA 1QHPA 1JG9A 3WH5A 1MWOA 3ZM8A 2WC7A 1GORA 4D6JA 4DM1A 1TMQA 1E6NA 1GQJA 2J47A 2CERA 3QOMA 1TUXA 2BFGA 4CCDA 1JAEA 1SR0A 2EJ1A 3GH5A 4GZEA 2J77A 5AYIA 3ZR5A 3PZOA 2YL5A 2J74A 1GHSA 1W2PA 4U2YA 3WF1A 3VUPA 4JL2A 4DUWA 1KXQA 4V28A 3MANA 5AC5A 4B15A 2ZX8A 2GJXB 1JYNA 3RO8A 1BTCA 1UKSA 1V6YA 1UR0A 1SMDA 3ALFA 2FDMA 1XCXA 4BQ5A 2XFFA 5BXSA 2O9TA 4P7LA 5M5DA 3L2LA 3AIEA 4NZCA 2G41A 3PZUA 3EDJA 4TUFA 5A6SA 3ARQA 5I23A 1MXDA 1UD5A 3OIHA 2DPEA 3N15A 4WIWA 3U5YA 1E5NA 2WC3A 4U31A 2CHNA 1M53A 4UR9A 3VGGA 1HKJA 1UWIA 1J11A 3QR3A 3VIIA 2VI0A 3BAIA 4J3WA 2PC8A 2VJXA 4CD5A 3MSGA 2ZUMA 4XX6A 3PTQA 4KH2A 4YHEA 4CN1A 1QHOA 4ACZA 1EH9A 3ARYA 4GIAA 1HKIA 3CIVA 3OGRA 4C7DA 1B3WA 2E4TA 3L4VA 2WM0A 2BV9A 1UZ1A 2XM2A 1MFUA 3CUGA 1ISXA 2TAAA 2Y24A 4R5EA 1UD8A 1PAMA 1CGTA 3RM9A 4QLJA 4AIUA 1E9LA 3OA5A 4AZ5A 4HMEA 5A8QA 4JFWA 3U7VA 1GW1A 3TA9A 5I3DA 4WK9A 4HPGA 3KL5A 5HNNA 1ZB5A 4PN2A 4WSJA 4HU8A 2E0PA 6TAAA 1G9HA 4HA3A 1WZAA 1CENA 3IAPA 4XZBA 4JAWA 1UH4A 4W7VA 1VBRA 3GNPA 4QLKA 4B9YA 1QPKA 4AEEA 2ZUWA 3O6AA 3RM8A 4WF7A 1QNPA 3GTNA 2ZXQA 4PTXA 7A3HA 3N1AA 3FY1A 1EDTA 3TONA 4OUEA 3AMKA 3UCQA 3NSMA 3IK2A 1E6RA 4LYRA 2JE8A 1GVYA 3ARVA 1NP2A 2YA0A 1ZJBA 1ZU8A 1KCKA 1XGZA 1J10A 2J79A 2D3LA 3QHMA 3SCQA 4E2OA 3BLKA 4OJYA 5CJ5A 2XJ7A 5FL0A 3U57A 4AZ6A 5BYWA 2XSBA 3N13A 4EAMA 3TOPA 1JZ3A 2GJPA 2JFEX 4P7NA 4Z2JA 4TTGA 4GI6A 3WF0A 3AZRA 3ZSTA 1D3CA 3PZGA 4FLSA 1SFSA 1WAWA 1CXHA 2A3AA 4PCTA 3AICA 5EFFA 1H5VA 2OWXA 1MW2A 3ZT7A 4LYQA 1V08A 4NRRA 2VZOA 4MDOA 5IHRA 3WD4A 4CVWA 1CLVA 1EO7A 2W4XA 5A3HA 1QI3A 2DSKA 3WNMA 3HU7A 2J7CA 2YLAA 1V6VA 2WMJA 3POHA 2GFTA 2UY3A 3HMCA 3T0AA 5AYBA 2BVYA 1QHZA 3SUUA 2NT1A 4UQBA 3SCWA 1VFOA 4W86A 3WY1A 4W7WA 3IANA 3F5LA 4F79A 3W29A 2J7BA 1FH9A 3MS8A 3WEOA 1UWSA 3VD9A 1MW1A 1E72M 3BCFA 4IM4A 2XWEA 1LL7A 3BCDA 3RMEA 1UKQA 1V0LA 5IHSA 4FK9A 1HF6A 1EO5A 3MUY1 3WBEA 3GBEA 1HX0A 3WNNA 5CSUA 3VGFA 5A8OA 3WUBA 2ZWYA 3RIKA 4M82A 4BQ2A 1PIFA 4B16A 1V3MA 4B3KA 2GK1B 1C8YA 5C8BB 3KEHA 4PUEA 2OLHA 1JYXA 2XTKA 3WDJA 3L4YA 2YBTA 3TTOA 5ECUA 3VD3A 3CZJA 1JL8A 5BROA 3ZO9A 1AQHA 2V5DA 3CPUA 3WBAA 1JGIA 3UR8A 1Q6FA 4P8VA 1V6XA 3UESA 5E70A 1C3FA 3MKKA 1H41A 1E56A 1UA3A 4D72A 1OT1A 1KBKA 3CUJA 4UQ9A 4PEEA 1CGYA 4PMNA 3MUAA 4E8DA 5A8MA 4EKJA 3ARXA 5D9PA 4F9DA 5FIPA 4KRUA 3POCA 2MANA 2VQUA 2WPGA 3UERA 4PMUA 3QGVA 5D9OA 1HKMA 3NDZA 4C91A 1ISZA 3B9DA 1QI5A 1W2VA 3EYPA 1EHAA 4NF7A 5CLTA 5CPQA 2UY4A 3AISA 2HISA 5D8ZA 5BCAA 5IXEA 2ZUVA 3NSNA 1B3ZA 2DIJA 4HP5A 2D1ZA 1VIWA 5BXRA 4Z2LA 2WBKA 1B1YA 1KFWA 4U5IA 2VTFA 4M56A 3G6LA 2C7FA 2BXYA 2O9OA 3F5KA 5LA2A 1XCWA 3O2LA 2A3BA 2YKKA 3AHVA 3I3BA 1W9XA 1AVAA 4C7FA 2XVNA 3KZSA 1QOXA 1WDRA 3WUFA 1FFRA 3L4UA 1W1TA 4AYSA 3UG5A 1UKPA 3VGDA 5A6BA 1C7TA 2VURA 3MMWA 2VR5A 1BHGA 2J8GA 3IJ7A 1C8XA 1KGXA 2BXZA 1WDQA 1Q6GA 4HTYA 4DM2A 3LPFA 3MUZ1 4MPKA 1ODZA 2WMKA 4PMQA 3SURA 2VX6A 4PMOA 3OLDA 4WJXA 3BSGA 3VMNA 4MNKA 2YBUA 3FHQA 1M7XA 2CESA 3W28A 4UQAA 1BYCA 1D7FA 1C8QA 1W9PA 2DSUA 4TVUA 1GOKA 3WH8A 3SIMA 3PN8A 2ZX9A 3EDEA 2BY2A 2X05A 2CITA 3KE0A 2NSXA 1V0KA 3U5UA 3VIJA 4J28A 4HOWA 4PTMA 3N9KA 2XM1A 2WMIB 1JD7A 3E1F1 3ZJ7A 2ZX7A 2WZHA 4BQ3A 1LQ0A 2IXVA 1O6IA 1PIGA 4OKDA 1OCQA 1ZBVA 3SEPA 1MW0A 3AI0A
chains in the Genus database with same CATH superfamily
3E2RA 3M1ZA 4S3EA 3FXYA 2BVDA 1XYZA 1FRBA 3PUOA 1Z6KA 3WZ0E 1OCNA 2FHFA 4AD4A 4NJIA 4D1IA 1YX1A 4HZ7A 1E0VA 1OBAA 1BG9A 3MV11 1JPMA 5DCEA 3TFCA 2KZHA 1AG1O 1XQKA 1VHCA 4HMDA 1CCWB 3HJEA 3ZQ9A 2X30A 2IPFA 1TIWA 1AW1A 5H8UA 3QKEA 4UOQA 3W2NA 3QHOA 2AQOA 3WNLA 1ME8A 4DUOA 2X1SA 1A5KC 4XIMA 1WP6A 1JPHA 1LRTA 3B0VC 1RJRA 3MB9A 3GQYA 2WNWA 4JX5A 3KOYA 1SO3A 4RE2A 2X2YA 4ZXOA 5KZ6A 2QCMA 4D8AA 3LOTA 1N82A 1P7TA 3RYSA 3VU2A 4AD3A 2BNJA 4EPDC 2PWGA 3D46A 2ODOA 1ZBCA 2E1WA 4YMZA 5PTDA 3ZLGA 4GFIA 1QRQA 1W3IA 3EX2A 2DZSA 2ZE3A 2NLYA 3W01A 5I3JA 1L2UA 4A05A 1H1ZA 4W89A 3M07A 4KMQA 4E4UA 5BWFA 5HUOA 5G2HA 2QJJA 5CPSA 2Y7GA 4Y8FA 3RJXA 2CPUA 3MQTA 1U5HA 1TJRA 2Z28A 3ZLHA 1I2QA 4GYPA 3WJYA 3VIMA 3M7SA 3STEA 3ARZA 5FJJA 3ZVHB 2DQXA 3NM1A 1R85A 2WV8A 1KBLA 2P3EA 5LYRA 2DT0A 1I75A 2Q02A 1Q2RA 5XIAA 4K8GA 4KKXA 4S3DA 4R33A 1L6SA 3ZFHA 3TC3A 4JTUA 1GOWA 4PA8A 4Y2WA 5CG7A 2VX5A 4H00A 2EF9A 4XD5A 4XZIA 2PUZA 2NVDA 3UCDA 3CHEA 3LENA 3UJRA 3VIPA 2QV4A 2QCGA 1EXBA 3N4FA 1GJUA 4QE5A 3K1GA 4PULA 5AHEA 1QK2A 3II1A 1M01A 2GYIA 2PEVA 1LQAA 2BVWA 1MVYA 1VJIA 4K38A 2HSAA 4TVCA 3HPXA 3ARWA 1PTGA 4Q6JA 2XZ7A 3VD5A 3MZNA 3DU0A 4DXXA 2C79A 1JR1A 1UASA 5HXMA 3R25A 1H49A 4XVEA 2VOMA 3VMOA 2RDUA 1XDJA 1EP2A 5T91A 3VPLA 2OPJA 4Y9AA 1FH8A 4RV3A 4GKLA 3Q67A 2HPIA 2QULA 1VFHA 4J35A 4B4FA 2PGEA 3RPTA 1ZRQA 3E38A 3CZ8A 4QITA 4JTLA 4OWGA 4ZQNA 2QZRA 4IH3A 3UA4A 3HJZA 4LV9A 2ONEA 4LV4A 1V51A 3OLGA 4ZO7A 3TYUA 5C9WA 3IUIA 4RNHA 1JZ4A 1UP0A 1AA1B 1C7SA 3T1GA 3BOXA 4ZQMA 4E6MA 3WLOA 1TCMA 4E8CA 4WJEA 1ESWA 1KFJA 3IRSA 2OCZA 1TTJA 2ACRA 2FFCA 2PDNA 3QF0A 3ANVA 2DU2A 1VGAA 3RLUA 4HNCA 3WK0A 5I07A 5A6KA 1LRNA 1ME9A 2FMNA 5DFAA 4PCPA 1TKKA 2HE8A 1L9WA 2OSWA 1GT8A 3ONBA 1BVWA 3UFYA 3PAJA 1K8ZA 2OXNA 2ZADA 2CW6A 2V5LA 1IT8A 1TPB1 4DLMA 4P61A 2Y4SA 3WKZA 1DJNA 2Y2WA 3W9ZA 5ABHA 4HG6B 4AVOA 1EXPA 1Q65A 2EQDA 4TR9A 1OX6A 3H23A 3TP4A 3UVAA 1TVPA 4DF1A 3C3UA 3OEXA 3ZZ1A 3H54A 1LT7A 4N9BA 5DX7A 3N04A 1PCKA 1M03A 4QQUA 1OX5A 5BXPA 3NPUA 4FX7A 1KWKA 3CT2A 1TO3A 3TROA 2OOGA 4PUDA 3ZYZA 3SM0A 3QFWA 5LNRA 4GUGA 1F05A 5KZDA 1Q8AA 5IDIA 2W91A 1K7XA 4B5SA 1O7AA 2CETA 2R94A 3W7RA 3M5ZA 2XIBA 2E8YA 1JCXA 4O18A 1YQ2A 5K2ZA 5I24A 1O5KA 4HYWA 1NU5A 1D8CA 3I10A 4PEKA 4ZENA 5GNZA 3QXBA 3TA6A 1XIIA 5I78A 2OEMA 2PDMA 4AB4A 3GXFA 3MVIA 2W62A 4P8UA 1YRRA 1SMAA 4QEEA 4DPQA 1JZ7A 3CS2A 1N2VA 3ZJ6A 3DFSA 2FLIA 2CCRA 3B0UX 3VKAA 4YU1A 2ALDA 2XINA 3OGVA 3UWYA 5D04C 3UXAA 6REQB 1M41A 4CN6A 4PMRA 3MSYA 3GR8A 3TW9A 3LMZA 3A47A 3LRLA 3LV5A 1MO0A 4AWEA 3GD6A 4MWAC 2OQHA 3B05A 1C93A 1I1WA 3D3AA 1LF1A 3WJXA 5LNUA 3W00A 3FYOA 1FHVA 1R38A 5I2UA 1R8LA 4R27A 2YDAA 3HBLA 4QCEA 3EPNA 3EPMA 5I3FA 3N73A 4DUVA 3W74A 3VZXA 1FP9A 3UA3A 4UQDA 3WH7A 2IS7A 3B8IA 2DUAA 1RVKA 4LU0A 2IKJA 1XBXA 1IHIA 4INFA 2RJGA 3WQ5A 1H63A 4XZ9A 1RV8A 6XIMA 4S38A 1KXVA 1R9YA 3N11A 4D6DA 4PFHA 4YTQA 3NFUA 4MLJA 5CEWA 1TZ9A 4PMDA 1TUFA 1I2PA 1QNSA 2YIHA 3QQ1A 3C52A 1ZBKA 5FF3A 3BJSA 3S1XA 2C16A 4HNVA 3QW3A 2YXXA 1R6WA 1HVXA 1RA5A 2JGQA 5AVHA 1T41A 4YNGA 4ICCX 1UIPA 3N3TA 3NVTA 3U4AA 2DIKA 4WX2A 3UWQA 2RGLA 4FAMA 4BQ4A 3RJYA 3S1UA 2X42A 3BTNA 1NVMA 3PBYA 3BJTA 2QF7A 3GTFA 3F1QA 4W4QA 3G0SA 2B7PA 1PEZA 2YA2A 4TX9A 2ANUA 5IM51 3JUGA 3CB8A 1BFNA 2NSOA 3AYTA 3UXDA 4YYCA 3LEPA 4A2RA 3H12A 3S47A 2V5BA 1YE4A 4DN1A 5GNXA 3B9NA 4DXVA 3O6DA 1PXGA 1POKA 3WLKX 3PSVA 4I8DA 2CZEA 5A69A 2BGSA 1AQ0A 4R7OA 2VC6A 4O10A 1UKTA 2VZVA 3BJFA 4Z1BA 6PTDA 4PUKA 5E0KA 3N29A 1R3VA 3M0JA 3CUFA 1GKQA 3UU0A 3EWYA 2DZBA 4HPXA 5GPRA 3VNJA 1OINA 1Y7VA 3ZIZA 4N2YA 3SUSA 4Q8UA 4Q33A 4URIA 6ALDA 5C5YA 5IFTA 4GNVA 1LOQA 8XIMA 3MJMA 3AU6A 3QC3A 3WQ4A 3WQ8A 1PSCA 3SY8A 4XK2A 1O12A 2TYSA 4L4OA 3AS2A 4GYKA 3RU8X 3PJTA 2YDRA 3EGJA 1H51A 1LUCB 1BTMA 1UPPA 3DGBA 3CQHA 1B3XA 5FF0A 1MEIA 3PTMA 1BYBA 2WVUA 2FB3A 4ZR8A 3L0GA 3W1QA 1EJSC 2XH2A 1XC6A 1RQBA 3NO5A 4DYJA 5CBBA 1E43A 1XD1A 3H22A 4DJEA 3UNDA 2OU4A 3KFTA 3T2OA 3VCCA 1JFHA 1V6WA 2VRJA 1GG0A 4IUOA 4S3AA 4YLWA 2F8QA 1I4NA 3N2MA 2JEQA 4CCEA 5JXQA 1ADDA 1J0YA 2PA6A 1RBOB 4IPNB 3R0KA 2J66A 3WLQA 1RCQA 1UR8A 2CU0A 1UIOA 1VYSX 1W1A1 3C2VA 3M6YA 2VMFA 1E6PA 3ME3A 1O95A 2NV2A 3LXAA 2VC9A 3PS7A 4US6A 1Z32X 4J3VA 3GHSA 3RITA 3HIJA 4CN4A 3TCSA 4S2CA 3WN6A 5I3IA 1F9CA 3MSDA 4LEFA 3W2LA 1RBLA 2PGRA 4QCFA 4K37A 3RR1A 1TWWA 2ZUTA 3FJLA 1XP3A 3CU2A 1FCBA 3SCSA 1DJQA 3A3HA 2DVTA 3S4TA 2QJNA 5K4XA 3TLLA 2OO0A 3N2OA 4FI4A 1H60A 1VFSA 2DZTA 3M47A 1HKVA 4NYUA 5DCDA 3VIGA 4NI3A 3T0TA 5JIWA 3WD3A 1Q6RA 3SQMA 2BHZA 1JFXA 3AS0A 3LCFA 4P5UA 1F4AA 3A9IA 1KXHA 4XD4A 2B4GA 3B0YA 4RCXA 3LI0A 4XIAA 2YX0A 4MWAA 5AKQA 5FKYA 1F61A 4C5ZA 1JZ6A 3KZPA 4MB5A 1XLKA 4P7QA 1GVFA 5AY7A 1H7XA 3AXMA 2NQJA 2R91A 2A3EA 5HPOA 1FWGC 4JY8A 4XAYA 3UJEA 1OADA 1V8EA 4HA4A 4IFRA 3NQBA 4G1NA 4Q7NA 4QS6A 4YTSA 1HG3A 3S6DA 1QT1A 4GPNA 4JICA 1VCFA 1YE6A 3DFPA 2W6RA 3W72A 5G1TA 4NIRA 3LYEA 3VNIA 1AJ2A 4NNCA 2CIPA 1OX4B 3EMZA 1AH0A 3HGRA 2GDUA 4JZ5A 1YBQB 3GDRA 3R0UA 4HHLA 4DJEC 4IX2A 4PMJA 1EIXA 1HJUA 1KCLA 2V63A 1UZHA 3VDCA 2X8RA 5TAOA 3UW6A 1NSJA 3TDFA 5T26A 4AXNA 2R9RA 2GDQA 2UY5A 4B3ZA 4GCAA 1OGGA 3DYPA 3W27A 3H70A 5BOFA 1XX1A 2PRHA 4D6HA 1YNPA 2VWSA 4J3XA 4GC3A 1Z3NA 2VQTA 1TZ7A 5A5WA 3L0NA 5IFPA 3WNOA 3LRMA 1W32A 3L2IA 4PRRA 4CEXC 4IT1A 4UTIA 2A3LA 1WA3A 4US5D 3GXIA 4CD8A 4ZE4A 5CZ0A 3O0FA 1QVBA 4MDPA 4NILA 2PBOA 2QCDB 2V6AA 1WYIA 2POZA 2V81A 3QY8A 3HTWA 4ALDA 4TX8A 3KBVA 1Z7AA 4Z08A 1J18A 1W6TA 4D71A 1LBLA 3W73A 4K6AA 3THUA 5LHEA 3TTQA 5F2IA 4EOUA 1J0HA 3M16A 1MEWA 2HVOA 4W84A 3RHGA 2QVHA 1PL9A 3O63A 5CKSA 5CC3A 1TJ2A 4NAEA 1AL8A 3NQ2A 4H6QA 4HPHA 3LLDA 3AIBA 4S3KA 4IMDA 4FNSA 1E71M 2NV1A 4QROA 1NARA 1DIEA 1KGUA 4PCFA 4AF0A 3E12A 2WVSA 3KTCA 2XVPA 3JZEA 3PVFA 4L61A 2CLKA 3HG5A 3CQKA 3WH6A 5HUPA 1FWHC 1OK6A 2PWVA 1UG6A 1VPQA 1KBIA 4BFAA 3QFEA 1KFEA 1G0CA 4LCQA 2DW7A 4JKKA 3VKBA 2E6YA 1NJJA 4GO9A 3LRKA 3OYZA 3L21A 1DJHA 4P8XA 1TR1A 3UXKA 1Q4NX 4QEHA 5H1WA 4O4WA 5C9ZA 1WBJA 4PMVA 3N34A 5BU9A 5TBOA 3NL5A 1D7KA 4GINA 1W9UA 2PTDA 3BMVA 4JTQA 3UR7A 4KCUA 4HK5A 1PYFA 4KWOA 4YWIA 2ZC8A 3F4CA 5MKGB 4BI5A 1KFKA 4G6CA 2Y85A 5GNYA 1KR1A 3CH9A 4W88A 4I6VA 4LNYA 1RJQA 3CWNA 4GXPA 3B9EA 3M0HA 4FNUA 5KZEA 4RPQA 4LVAA 3B9OA 3CUHA 1OFRA 4Q22A 4AZ7A 1W8GA 3NL3A 1Y8BA 1S3TC 2KAUC 3NO1A 4Z2HA 3DFOA 2C18A 4QAWA 2DY3A 4LUJA 1HKKA 5KEZA 2DDXA 1EJWC 3NOEA 5GJPA 5K9CA 1ITCA 2R8WA 3BW4A 1ZJAA 4X63A 1XIMA 3DFTA 3NPVA 3SJNA 4UXDA 3G22A 1OFAA 1ZP3A 4EPBC 4GUJA 1W3NA 1W9BM 3W1AA 5J5RA 3ITGA 3AMGA 1HJXA 1IEWA 4O0KA 1Q63A 2W79A 2ZQ0A 4LOCA 3G0XA 5C6MA 4GABA 2C14A 2AOSA 2Q3OA 4L4LA 2GVJA 3B9AA 1CLXA 1EC8A 3MZ2A 1MZHA 5TNVA 4ZMGA 3BANA 5IOBA 4HSOA 1XIHA 4YN5A 3WMBA 2VKZG 4C6KA 2YCKX 3NQCA 3AIUA 1F4HA 4W5ZA 2OB3A 3TIMA 3W6MA 2QGYA 4X2PA 4HPNA 4TXEA 5AB3A 1DIKA 1OK4A 1RAKA 1NFGA 4JTHA 3TEVA 1E6ZA 2WNZA 4NAEB 2PWEA 4O11A 3TYDA 5JBFA 1DWHM 4JTAA 3KCOA 2ZDRA 1KGWA 4UTHA 4NX5A 3OLIA 3RM4A 3TQPA 3DOPA 3LHWA 5JH2A 1OG0A 2XSAA 3I7RA 4E38A 3VO0A 3RPDA 1TX2A 1Z41A 4DIAA 1HW6A 4AAJA 5C71A 4BCEA 1MRAA 2D2HA 3W7LA 3S5ZA 2E6FA 1WZMA 3VD7A 2BBFA 4UFIA 3MYPA 3F5JA 2ALRA 3QYSA 1XH2A 1ZAIA 2DV0A 4ZOEA 1RY0A 3XISA 5T9BG 1E1CB 1A5UA 2PDWA 3FA3A 3FHAA 3KCJA 4H41A 3LHVA 1A4MA 1EOMA 5F4XA 1DXFA 3PJUA 3LPGA 3GBDA 3P5YA 5HQLA 1PIIA 1ISWA 1XDLA 3Q4DA 4AHPA 3QLLA 3VOCA 3UETA 2FGZA 4MMWA 4S1FA 4TV6A 4XTDA 2XPKA 3J7HA 2CBVA 1C91A 2QCLA 3BSMA 4GZIA 1P1MA 3S2MA 1UC4A 1U2YA 2J4GA 9XIAA 1W1ZA 3O3RA 4NRSA 3C2FA 3UP8A 3UJFA 1PCWA 1X6NA 3RDKA 1FWTA 1CXFA 3O7UA 4EE9A 3NQFA 3VKJA 3GFYA 3V7PA 4ZQRA 2C8NA 2WHLA 2EG7A 4TOQA 2PFHA 5I6SA 1EOKA 3MA8A 4HMNA 1WXYA 1HL2A 2WLYA 2CKSA 2CYGA 3M7WA 2DSZA 4E4PA 5G2IA 3SO7A 1JVNA 1M1BA 1TVNA 2WHMA 3DHDA 2R1MA 3I6EA 4K8HA 3GWQA 3O1NA 1Q6LA 5D38A 3WLPA 1H7WA 2XFRA 1PPIA 2EBNA 1VBHA 1AW5A 1K9TA 2ZUUA 4W8BA 3DYMA 4LANA 1QJWA 2G8ZA 2X1UA 1E3ZA 4GYFA 1HP4A 1GVEA 1VHNA 4NY2A 5FJOA 2V3FA 3CV1A 1BEUA 4AQLA 3IIPA 3RG6A 2QR6A 4B5XA 3L4WA 1US0A 3Q94A 2BZNA 5DN1A 3KOWA 4PRWA 4HB7A 1C90A 1UJPA 3W83A 1VFLA 2BHUA 4GQQA 4U3AA 3K1DA 3O6CA 5EMYA 3GDBA 4M7SA 4R7WA 3USBA 1XLCA 5KTLA 2CWNA 1GQJA 2I1OA 3QOMA 2Z25A 2R6OA 3LD5A 2X41A 4NNAA 4AVFA 1N8FA 3GH5A 2J77A 5AYIA 3PZOA 4ZOBA 1TV8A 2YL5A 4TO8A 3T9PA 4JEQA 2Y8UA 4BY3A 1R3WA 1FWBC 4JL2A 3PBWA 4V28A 3MANA 3R7MA 2AGKA 4WOQA 3P62A 3RRAA 4MY8A 2FJUB 4XSLA 3WLRA 1O5XA 1QNVA 1TVLA 3ALFA 4DELA 2CLPA 4GLEA 4P7LA 3UBPC 2Y7EA 2PDHA 4O1CA 3ATZA 1NEYA 4NZCA 4DJED 3E74A 1XLBA 2G41A 3NQ7A 3P81A 1WV2A 3OIHA 2DPEA 3KUMA 1HGYA 3WQEA 1YXCA 1HKJA 4MFDA 3L7RA 3R5EA 3SY5A 3VIIA 3PULA 2VI0A 1A5NC 4O0ZA 4QSFA 5MKGA 4GJ1A 2EG6A 2VJXA 4CD5A 2OKTA 4CQDA 3S1VA 3UZZA 3LA4A 4XX6A 3PTQA 1G4SA 3S9ZA 4GK8A 4GIAA 2B81A 4I8YA 4CNOA 4JGDA 2IQDA 2WM0A 3E96A 4UWMA 1J5TA 3EX1A 1O4UA 1ISXA 4FXJA 1PAMA 2I57A 4QLJA 5HNRA 3Q65A 3P14A 2WKJA 3MVTA 5A8QA 2E68A 5I3DA 3WQDA 4F0HA 4HPGA 3WLNA 4FF7A 3CASA 1RQEA 2DUXA 2E0PA 2ACQA 5CC5A 3ANUA 4CNNA 1T8XA 2VGFA 2VFFA 3LX9A 4M5PA 2CWXA 2ZUWA 4HPJA 1EJTC 4PTXA 1K1DA 1D9EA 3FY1A 3ABQA 3T05A 2DFAA 1F76A 4FXSA 1A50A 1XF0A 4ORMA 3ARVA 2V2HA 1ZJBA 2NXGA 1XCFA 1XGZA 1J10A 2EAWA 4EP8C 3QHMA 4OJYA 4GOAA 4Q7IA 4YL2A 3U57A 4AZ6A 5IDZA 4C6OA 3QZAA 4FXRA 3LXCA 4GI6A 3WF0A 4NASA 3PZGA 5DLCA 4FLSA 4QJ1A 1WAWA 1CXHA 1DV7A 1TV4A 3PWIA 3AICA 2ZVIA 1EZ2A 3LY0A 3BZGA 2YFOA 1OX4A 1QOPA 1EX1A 2GFTA 2IQ0A 5L6UA 1F3TA 1UMLA 3DG6A 2BVYA 4OECA 3NQ8A 3W7CA 1DJGA 3TSDA 1SGJA 4ORIA 3F5LA 2G5WA 3BL3A 2J7BA 1W5OA 3WEOA 3VKDA 1E72M 3V5CA 1EGVA 4UTKA 1LL7A 3RMEA 2Z26A 4IF2A 5G4WA 3MUY1 1R3TA 5AHFA 5T8GA 3GBEA 1DQXA 3LCWA 2HS8A 3S6OA 4BR1A 4X2RA 2AL2B 3PANA 1PIFA 3TYBA 4GBUA 4B3KA 1C8YA 4ADTA 2UZ9A 4PUEA 3QTGA 1G7VA 2XTKA 2ZDSA 2YBTA 4LVFA 3PWGA 4FO4A 3B04A 3CZJA 2AKZA 4A22A 2HV5A 1VCGA 3NQMA 5EGRA 4M7TA 4N9CA 3MKKA 1E56A 1GQNA 3TJ4A 4D72A 1OT1A 1KBKA 1F6KA 3BV7A 4KS0A 2E1DA 5A8MA 3ARXA 3M5YA 3DEQA 4IPPA 4KRUA 2YXGA 1YBQA 3ZWSA 3L12A 3BLFA 2GOUA 4RJEA 4HQVA 5CZJA 1VYRA 4MZYA 5D9OA 1HKMA 4GQ0A 3OA3A 2OEJA 1ISZA 3M0XA 4K39A 1IE7C 2QDGA 3GKAA 1LROA 3TQ0A 1ZCOA 3NSNA 1B3ZA 3AC0A 5M2FX 4WGXA 1SZGA 4IIDA 1A3WA 4WGHA 3BG9A 2R1NA 1RVGA 1KFWA 2VTFA 3PP7A 4TV5A 2O9OA 1XISA 4PL2A 1XGDA 1I0DA 1BXBA 1XCWA 1JRBA 2A3BA 2X7VA 1UBPC 3W7EA 2YKKA 3AHVA 4P00B 1W9XA 1AVAA 4C7FA 1U5JA 3G1AA 4H7ZA 1QOXA 3WUFA 3UG5A 2OT0A 2ZA3A 5I3HA 5A6BA 3MMWA 4DJFC 3IJ7A 1GK8A 1C8XA 4LCSA 1ENUA 2BXZA 1WDQA 2Y89A 1ONEA 1VQTA 2RDTA 3MUZ1 4MPKA 3R2GA 4IGSA 3G77A 3SURA 4RZ6A 3W1TA 4PMOA 5CBIA 2PDLA 2YCLA 4NZ5A 2ICSA 1BYCA 3STPA 1TWSA 3KLKA 2DSUA 3BQ5A 3BARA 2ZX9A 3EDEA 4RZ4A 2ZZ3A 3KE0A 2NSXA 2HXTA 3IWPA 3U5UA 4N9DA 2R1PA 1S1RA 4YTRA 3GRIA 3NQGA 4CCZA 2XM1A 1R2SA 1SZRA 1FKXA 4O0QA 4X22A 2FZMA 4B92A 3ZJ7A 1BWKA 4BQ3A 1R3QA 2ABAA 1I2NA 2VD8A 4IG2B 4I7WA 1PIGA 4OKDA 3SEPA 3SBFA 3TXZA 3URBA 4F0RA 5C2GA 4CQCA 3M41A 1A5AA 1NIUA 4RPPA 3N2BA 1TE1A 5E93A 1ICPA 3EWDA 1JNDA 4RV8A 2H90A 5F2LA 4M80A 4CD4A 1UHVA 4QDWA 1V93A 1UJQA 5DBTA 4UOJA 1OFPA 3BAXA 2IQTA 1GVQA 1GKRA 3T42A 2JALA 2YCJA 1WKYA 4QDMA 3LLFA 4XBKA 2G96A 2OTDA 4H2HA 2OGYA 1NM9A 3VOGA 4KWUA 1Q8JA 2PODA 4B9ZA 1HT6A 3LMYA 4KW2A 4AX7A 2LLEA 3BLPX 1EYWA 2PD5A 3U7BA 4V1XA 3IJIA 3B06A 3NIYA 3E5PA 1E0WA 1LLOA 4LC6A 2PDIA 3H24A 1KR0A 1OCJA 1IZKA 1GCYA 1P0KA 2HBXA 3CLMA 4NZFA 1LJYA 3AJ7A 1EL3A 1FWCC 1Q7ZA 1G4PA 3D6NA 1ZS2A 3DG7A 4AU0A 5EMUA 3W22A 1EC9A 1V02E 4CNUA 5I02A 1S2UA 3WQPA 4F8XA 1RK5A 1F7BA 1V77A 1JDFA 3MO4A 4X3ZA 2VRKA 4TVDA 1T5AA 4W7UA 1GQKA 1BQCA 3FVMA 1OYCA 2ZBTA 4WEVX 2A7NA 3U0HA 4AYGA 4C60A 4F48A 3CZLA 3HQOA 3ARRA 5REQB 3LGDA 2GLKA 1XLFA 1DOSA 1RZMA 3RR4A 4AW7A 3S83A 1Q45A 3BK0A 5CGMA 4H3DA 5F4WA 2VO5A 3A64A 3EXTA 1K03A 4NX0A 2J24A 2OO6A 2ZA2A 4CQAA 1Z48A 1KTCA 4BEQA 4WXZA 3Q37A 4Z0SA 4XSMA 5JBDA 4MOZA 5DMYA 2C6QA 1PS9A 5JMUA 3SDOA 2PWFA 1NDZA 4KIEA 4XQ6A 1MMFA 1SFTA 1Q5MA 1EA0A 1E55A 1E73M 3B8DA 3HG4A 2QJGA 5GJNA 4RDWA 1E51A 4J3TA 3S0CA 2J78A 3CMJA 3M0MA 3E49A 5HAOA 1K6AA 1HTIA 3K8LA 1P0BA 2WO5A 4HNTA 3N18A 2VD9A 5D09A 3VZZA 4REQA 1R30A 4DBUA 1AJZA 3CBWA 1SJBA 4LAOA 4OOZA 1FWNA 4KGJA 4J9JA 3UJ2A 4JHZA 3DC8A 3WMSA 5A6LA 4NZ4A 5I77A 3KDNA 1BGAA 3RAOA 1OGBA 3GKFA 4Q4KA 1J93A 2PDKA 2XVKA 2WVVA 4LT9A 3WBWA 5D9NA 3T40A 4C6EA 2QPSA 1V02A 3WL0A 3W7PA 4AIBA 4HU0A 3AIVA 4AWUA 4O8RA 1RD6A 2G3NA 1QPRA 5E9AA 5DXYA 4X9YA 1WKFA 3WLJA 3SFKA 3F2DA 3NGFA 1KB3A 2QJIA 4WD0A 3EAUA 3U48A 2CXGA 4ATDA 2XHYA 4RNJA 4QX4A 4ICNA 4OBSA 1LG2A 3JVAA 3LBOA 2FH8A 1U1HA 4DRSA 5BU6A 2XISA 1FWSA 4M29A 4ENLA 1NQ6A 1PKYA 2Y8KA 4RZ5A 3AIWA 3CC1A 5BMWA 4NJJA 4U2ZA 3OB8A 3TN5A 1ZENA 1UD3A 3PZVA 4S3GA 4JCLA 5AYXA 1FHUA 1JDEA 1ONXA 3FEMA 3PSWA 5LNSA 2C13A 1I6NA 4BI7A 5CC7A 1EKOA 2Z1VA 4P8WA 2PDXA 4JHOA 4CKQA 3L5MA 3WNPA 1ZY9A 3F4WA 3N6JA 2OJPA 3UWVA 2H3BA 2ZZ6A 1ELSA 2OLAA 5C7VA 4UTUA 2GPTA 2GUYA 1JD9A 4ZEPA 3FA4A 2ISDA 3PK7A 1AH3A 2Z29A 4IJRA 4JNZA 1BGGA 3FLUA 3ITOA 3CL6A 1W3HA 2OVLA 1GVRA 4GVHA 1F8IA 3FAXA 3U2CA 2EEXA 2VYOA 2HNEA 4K68A 2A21A 1XKYA 1RPXA 3IGXA 1TX0A 2Z00A 4XV0A 4AD0A 5A8PA 3GHTA 4WRHA 2Y7DA 4JD4A 1UD6A 1I45A 3PZNA 1AH4A 1TV2A 1E4MM 1WE5A 2BGNE 1Y5VA 2R1LA 1CECA 3BLLA 4KWSA 4JYFA 5G1MA 2IW0A 3A24A 1Q6EA 2AKMA 3DHFA 3KBNA 5HPCA 3VGEA 4IMAA 2PU0A 1ZHAA 4GI9A 4CU7A 1PTDA 1KM4A 1I8JA 3EDDA 1CXKA 2EPMX 1E70M 4R9OA 4GZJA 2YXOA 1V03A 4IFKB 2CHOA 4C6NA 2VT0A 2BDQA 3PPFA 1DQWA 3KRZA 4O52A 2PRLA 2F6XA 1WDSA 1B3OA 2EPKX 4NKCA 4ACZB 1WDPA 2OWWA 4P02B 1XSJA 3AHZA 2NX9A 1ZLPA 3V0UA 4JTKA 1YNYA 4HGXA 2VEIA 3AXHA 1VJZA 5E0FA 1XLLA 4GY7A 2EPNA 1XLIA 1VPXA 2RKXA 5H2ZA 4LNCA 3PBMA 3WUEA 3LK6A 3I7SA 4LEQA 4C6DA 2PS2A 2QJHA 4AHOA 2VCBA 1ODUA 2HCVA 1VC4A 4Z1DA 1RHCA 3CM4A 4RR4A 3BQ6A 3G1DA 2HK0A 4MKNA 4RNFA 3QN3A 5JUVA 3ABZA 4PFMA 2YW4A 1QBBA 4LTSA 1RH9A 3QJAA 2OZ8A 2A7RA 3GR4A 1Q6CA 4DJDD 1CYGA 2O4QA 2WB5A 3SUWA 4ZB2A 5CPOA 3FKRA 3QSTA 3GS6A 4EXBA 1H7PA 2FZBA 1RP8A 4LBRA 1XRVA 4OHQA 3GH4A 1EPXA 3VNMA 3P8IA 1K8XA 3GNNA 4QLLA 3FYYA 2FGLA 4RW5A 1UR4A 3FVDA 1S46A 2YJQA 5LXEA 2WKGA 4S3CA 2BX7A 1OB0A 5IBXA 4QG8A 1J0JA 4CCCA 1OT2A 3O16A 4MYAA 1A3HA 4MNJA 4S3FA 3CAWA 1QWKA 2E9LA 3EOUA 4RE3A 5F2MA 1VZWA 3WYZA 2G97A 1X97A 2J7HA 5A6AA 3HQ1A 1GVIA 2DGAA 4DPPA 1GWJA 1FHDA 1HXJA 4H9XA 1VKFA 4B5TA 2ZRXA 3BE7A 3VAVA 4O1EA 3E0IA 3D5HA 3HA1A 4O16A 2PB1A 3WIJA 3VGHA 2XH4A 3VOHA 1LDCA 3PAOA 1OIFA 2A3CA 1H4PA 3FSUA 2V8ZA 1OWQA 4N6FA 4AIEA 4ROPA 3FS2A 4LVBA 1X8CA 1IZJA 2G4FA 4UFKA 2Z1WA 1JZ5A 3EX6A 4Y96A 1NDYA 2OX1A 3V18A 3WD0A 4XISA 2ZKMX 3S9IA 3AIRA 4IFOA 1W17A 1Q2SA 3QV7A 3WDPP 4JTCA 3CEUA 4W85A 1JF5A 2TRSA 3HURA 4PMYA 1YLVA 4Y7EA 1QTWA 2OYLA 2CLOA 4AD2A 3RXZA 2Z24A 3BAYA 1ZJHA 1CGVA 1ICSA 3PNUA 4E8GA 3B8UA 3BW2A 3KOXA 1B31A 1K7EA 2J8FA 4GY1A 4F66A 3QY7A 4H2CA 1F3WA 3FYPA 4RLIA 3THCA 3P2VA 5ABTA 5HWMA 1UP2A 3WFAA 3GG7A 3SIZA 4KPLA 3IVUA 3BLDA 1XBYA 1NOUA 1LWHA 2P0IA 3RN6A 1PHQA 2ZX6A 3DIPA 4ERGA 3ICJA 2CLFA 4JS3A 4LUTA 2DZXA 4J1OA 2CZFA 3ZMRA 2WSPA 3BDKA 4H9UA 4GG9A 2OWCA 4WQ6A 3LU2A 5BRBA 4ILSA 4JNMA 1JUBA 4R3UA 3GW0A 4GQGA 4PUWA 5K9DA 3H4WA 2YB1A 4JTRA 1WX0A 3CNYA 1T7LA 2DIEA 4L9ZA 2GVEA 4DJDC 3W07A 4MG4A 1QW8A 5IBXC 5I7GA 4JX6A 1DIDA 3NQ6A 4I3GA 4LF2A 1A0CA 3MW7A 5A2BA 1MQPA 1QDSA 2NX3A 4LBSA 3WD2A 3QTPA 2J7EA 5CCZA 3MWAA 4I5UA 3LXBA 3ITTA 1ZFJA 4Q7BA 1KM1A 3WK3A 1W0MA 2BG5A 3VM7A 2V3DA 3SN1A 2WSYA 3DFNA 1X1ZA 3VIHA 1CLKA 3MP3A 2GJRA 3WL1A 3W24A 3H2OA 4M6PA 4B5NA 3OVQA 3NVDA 3T4WA 1V6UA 1E1CA 2GGHA 3DENA 3T8LA 1I0BA 3A4XA 3MHGA 3UGRA 2Z7KA 3GXNA 4KERA 1E4IA 3F4VA 2J7DA 3K8KA 3NZ1A 3N4AA 1REQA 5ABEA 1RA0A 4NUWA 4XKMA 5A1AA 4DWSC 2O9RA 2QPUA 1X1NA 1M65A 2H3DA 4LS2A 3HOJA 2ZFAA 3UZXA 2BHYA 4FP1A 3WQGA 3WLLA 2QKFA 3H7UA 5I03A 5EMJA 2C1HA 3GZAA 2QVNA 1GHRA 3BPWA 5LGXA 1KXTA 4CGTA 3EB3A 1EBHA 4Z2GA 1ME7A 4GC4A 4C90A 1G67A 3TWBA 1VEPA 3CB3A 5XINA 4QTGA 1XGEA 1QPNA 2QV5A 1CWYA 4ZCWA 4IICA 3T0CA 3FJNA 5HMEA 2WVTA 2Z1BA 1E15A 1VYPX 5JIPA 3BLEA 3NDYA 1F73A 3MV01 3RMJA 1DXIA 2V2DA 4PUMA 4JTIA 5H91A 4WDWA 1NP0A 1OM0A 1H62A 2O55A 4WY0A 3MTWA 2EXOA 3UNTA 1R7OA 3T0DA 4R88A 4ZBCA 1W3TA 1TWDA 1H1NA 2WQPA 1SW7A 4V27A 3UG4A 1UC5A 4QE4A 3W1UA 1J0ZA 4NZJA 1A5SA 1V79A 3QRHA 4LAMA 3CHFA 3T07A 4HN8A 2WK2A 4PTNA 2BY3A 2NXHA 4MJZA 3M46A 5FESA 3W82A 1A4LA 3GZ3A 1DPMA 4CNTA 1BVZA 3MYOA 3UG8A 4EXAA 1OY0A 2P1FA 2X16A 2Y0FA 3HF3A 3TCEA 4D6GA 4PTDA 2INZA 3L67A 4ZQCA 3SY1A 3GLCA 1QNRA 1G01A 1UOZA 2C1GA 3B03A 4K7YA 4JPGA 2VFHA 9CGTA 4XUGA 1H0GA 4GVGA 3QVQA 2GSHA 4H9ZA 2L5HA 3SJ3A 3OQEA 4OFCA 3STCA 1AMKA 3I6RA 2E9BA 3L4ZA 3W7IA 4D8ZA 2UY2A 1Z69A 3SGZA 3AQUA 1XW8A 3L65A 3CXOA 3MHUA 4B5WA 1GNXA 3QLDA 4PRTA 4BWLA 4AY1A 4MNMA 2DZWA 1XD0A 2XIJA 4IPLA 3LQGA 1IXPA 1Y0EA 1WBHA 1UH2A 4QSHA 2O0TA 2W5FA 3KWXA 2QT3A 4LF1A 2YL8A 1FHLA 1OHLA 3WDQA 1G94A 3EOSA 1SVDA 3VMPA 3FIGA 4ZGYA 4AZCB 4N4PA 1SW0A 2DJXA 1K9FA 4OIFA 5CZTA 1YPIA 3MUIA 1XDMA 1AZ2A 2VGIA 3OZOA 2R14A 2J75A 2VEKA 3W86A 3DDMA 2W61A 3C2OA 2J7FA 3DECA 1KO0A 3FDGA 3W7GA 2V38A 2ISWA 2NLIA 1X98A 1SR9A 2AL1A 4I9JA 4AEOA 5LNVA 2VNCA 3GO2A 3VFLA 2X09A 4AZHA 3GTHA 3GAYA 3A9BA 5CPTA 2PTZA 2FZNA 2QGHA 2ZE0A 3REQB 1P48A 1CGWA 4QG9A 4Q4OA 3BLIA 1EFZA 1W37A 1ZUAX 4HU4A 4MHBA 2CC0A 8A3HA 4IIFA 5A6MA 2CBUA 5BWAA 3TQKA 1EX5A 1TPWA 1P6WA 3LI1A 3RCNA 1CDGA 4CVUA 2PDUA 3G1FA 3NYZA 4P7RA 3FGCA 3E9AA 3LV6A 1JZ8A 2V69A 1V3KA 4OBRA 1ECEA 3GDTA 2C1IA 3O07A 3GNOA 1GKPA 1WXZA 1JDDA 2XDFA 2CBIA 1OFOA 1VPYA 4FIQA 5G4EA 4IFKA 5HNUA 4M1BA 3DCPA 1NWTA 2G4JA 2A2IA 2VENA 1HGWA 2YYUA 3UXIA 1EA9C 3MCNA 3A5FA 3UR2A 5C54A 5FEZA 2V30A 4LYPA 4UZSA 1TTIA 1TV7A 5ECVA 1LL6A 2VVSA 1DWJM 1H61A 2Z1SA 1MFVA 1WXJA 1ISVA 5AC7A 1RD5A 1J9YA 2NUYA 1LUCA 1XM3A 2HVMA 3OIXA 3APYA 1E0XA 4M0XA 4PTVA 3PFRA 2PLCA 1XQLA 1TR9A 1SU5A 1MUMA 3KHJA 4YPJA 4A29A 1XR2A 3WEMA 4DWSA 4LAKA 4J3UA 2XIQA 3T81A 3SB0A 4FR6A 5GJMA 1VJSA 2G50A 3W53A 1NWRA 3KX6A 4ZFMA 4FOKA 1YTKA 3WQCA 5FJIA 1TMHA 1UUQA 5KZMA 2CHRA 2CLLA 4MFEA 5CSRA 2DH2A 4UFHA 4LAUA 4PBEA 2QIIA 1B30A 4UTFA 2F2HA 3N12A 5CG0A 1S5TA 2DVUA 3GY1A 1M7OA 4XUYA 1TYGA 1XIEA 4IXHA 2PTXA 2FGBA 4C1LA 1VEMA 3FV9A 4G1KA 3WDHA 3W6YA 2WBGA 3BH4A 4LY4A 4B91A 1EPVA 1X6LA 3PZMA 5D4YA 2VGGA 5LA1A 1A47A 4D6CA 5LIWX 3QV9A 4H04A 4AH7A 5C2XA 1KM0A 1IF2A 2CKRA 4L7ZA 4DY1A 3GHUA 3CAQA 5HJLA 1TFVA 3WDIA 2E28A 4ZO9A 3H2FA 3RX2A 4YJ5A 3BCJA 1J12A 3CUIA 4C6PA 3EMCA 2W67A 4A3HA 2DEPA 2Z4GA 3ABRA 2PDGA 2E6AA 4UZUA 1DJZA 1EP3A 1YIXA 3AROA 5EJ1B 1XFCA 1PZ2A 2NX1A 4GI8A 3BG3A 5D30A 1HJSA 4UMAA 1UWQA 3GG0A 2WZMA 4FLOA 1GGOA 2XVLA 3CEPA 4DZIA 1QNOA 5FL1A 1DJXA 3KL3A 3EKLA 3MUXA 3LSCA 1TG7A 3PZTA 1T8QA 7TIMA 2X2GA 3UG3A 1BF2A 1EF3A 3AMCA 3UZWA 1TQJA 3U8GA 1XYAA 3VVGA 3E2VA 5AFDA 4NU7A 4LY8A 2ZICA 1KFLA 1JIBA 6TIMA 1CGUA 1G5AA 5DY2A 3U4FA 1A5BA 2ZA1A 4CNPA 3CIXA 3O9NA 3TX9A 1V0NA 2AMXA 5I79A 2BOGX 1ZNNA 2VHLA 3M9YA 1O66A 3BWWA 4GUFA 2Z0IA 2X1IA 2ATSA 4QDPA 3UD6A 3VGBA 3ARTA 3WELA 2H8XA 3L2MA 4JKMA 4H9MA 3KL0A 1KRBC 1GJWA 5DO8A 2H8ZA 5D9MA 2P0OA 2F2KA 1OC7A 3SR7A 1PZ3A 3FEQA 5A2AA 4W8AA 1S2AA 1QUMA 3ALGA 1F74A 1E5JA 2ZZ5A 3F2BA 2QIWA 2ZOXA 1TSIA 1UCWA 2FVMA 4J7RA 1GPFA 3IIVA 1UWTA 1BAGA 1UR1A 4L56A 2F9RA 1C29A 2HBVA 4J2PA 4CU6A 2WHKA 1CT5A 2YL6A 2GSJA 1HO4A 1U30A 3LPPA 3EXSA 1CTNA 4FF5A 1UQZA 4X9SA 3W7NA 2XH7A 1S5NA 4BZYA 1AUSL 1HVQA 1NAL1 2QAFA 2AQVA 3IV3A 4OT7A 1QNQA 3G1XA 3ZJKA 4X0VA 3GXDA 4DI8A 3BGJA 1PX3A 3UXLA 3VC5A 4IMEA 1JG9A 3M5XA 4I9TA 4ADSA 7REQB 2HWGA 2CERA 2VC7A 3LCHA 2PE4A 4K1WA 2QDDA 3MWCA 4QISA 4CCDA 2EJ1A 4GZEA 3ZR5A 2WJDA 1W2PA 5FAJA 2DJLA 1MEHA 3JRKA 3WK1A 2WPBA 5AC5A 5AHLA 2WZTA 3GUWA 4JIQA 2FVKA 3W75A 5CPMA 1H5YA 3RO8A 4EIVA 4X60A 5REQA 1XCXA 3HQPA 3AUJA 3L2LA 4GH3A 3EDJA 2QQ6A 2P10A 5A6SA 3P5ZA 3O0KA 3ARQA 2BWGA 1XFBA 1TPC1 2QUVA 1UD5A 4WIWA 2WC3A 2DQWA 4U31A 4XAFA 1M53A 3VGGA 1OYBA 4JN6A 5IRPA 3QR3A 1M7PA 3GU1A 2PC8A 2P53A 2P3ZA 3MSGA 2UV8G 3W2JA 4YHEA 3GHRA 3QBUA 5FSEC 4F0SA 3NOYA 3M4HA 1SFLA 1JPIA 1H7OA 4UIOA 2VFEA 1WOAA 4O54A 3U3HA 1V6TA 1S38A 2QCHA 3ELFA 2INEA 1SZFA 1U1JA 1SJCA 3QKZA 3W1LA 4PB4A 3EWUA 3TNOA 3EB4A 2FPVA 4DZHA 3TA9A 5D02A 4WK9A 5HQEA 1JCJA 1PDZA 1KM5A 4WSJA 4R34A 1G9HA 2W27A 4YS1A 1CENA 3CIWA 3IAPA 4N6EA 2WNQA 4XZBA 5BOEA 1VBRA 4QLKA 3AWNA 1QPKA 3O6AA 3RM8A 1QNPA 4XO6A 2I5IA 3GTNA 5HATA 3N1AA 3IIOA 1F6PA 4G56A 2EHHA 3R0DA 3AMKA 4OUEA 3UCQA 5FF2A 4C65A 3KW3A 3CAKA 3QGAC 3T6CA 3PWAA 3UZYA 3IK2A 4LYRA 3COTA 1NP2A 3IARA 2J79A 5G5IA 2D3LA 4HCLA 4E2OA 4KCVA 3A4JA 4BJHA 1THFD 2XSBA 3N13A 4EAMA 3TOPA 1JUEA 1GZGA 3KRUA 1JRCA 3AZRA 3GC5A 3S1GA 2PDPA 2R1KA 1CW2A 2OWXA 1MW2A 4L64A 1QOQA 2C0AA 3ZT7A 3UJSA 4LYQA 1V08A 4XBJA 1FWWA 1Z42A 1L6YA 2IPJA 4NRRA 3USZA 4ZFCA 5HR6A 5IHRA 3WD4A 4CVWA 2FPYA 2HJPA 2W4XA 1OCBA 5A3HA 2DSKA 3WNMA 2G3FA 2YLAA 4I9MA 1GZ1A 4BF9A 3BO9A 4WR3A 3OBEA 3EZ4A 3OW1A 1D8WA 1RSCA 3SSJA 5LIYX 1ITUA 1VFOA 4W86A 3TJIA 3TUUA 3GVRA 5AVNA 4HD5A 1OG6A 1UWSA 4HCHA 1KCXA 3IJ6A 4Q4MA 5D2XA 4MWAB 2A7PA 4IIHA 1TRIA 3WNNA 5CSUA 1L8PA 2E6DA 3WK2A 5A8OA 2ZWYA 2C71A 4QBXA 2G95A 3W7QA 5C8BB 1KM3A 3IJLA 2OLHA 3NQDA 3WX7A 3WDJA 4RKAA 3DI1A 3L4YA 1SJAA 5EIYB 3TTOA 1P4CA 5ECUA 5D03A 1JL8A 4JXCA 1AQHA 3CPUA 3WBAA 4DZAA 1Q6FA 5E70A 4WY0F 3TMQA 4UQ9A 3IUHA 1Z89A 1CGYA 5D9PA 5FIPA 4EF9A 4ZZ9A 1KKOA 3POCA 2MANA 1MUWA 2VQUA 1X6UA 3ERPA 4HTBA 1KTBA 4ICMA 2A85A 3QGVA 3I4EA 1GYNA 3S2JA 1FWIC 5H8MA 5I06A 3GNXA 3CWOX 3NDZA 4GVIA 4O8AA 4V33A 2J9XA 1SZEA 1J4EA 1LTDA 1W2VA 5CPQA 1KRAC 3AISA 4F2TA 5DY3A 4QG6A 3BUVA 3RX3A 2GGEA 3LHTA 1FBAA 3GR7A 4A8IA 2ZRWA 3LSBA 3MP4A 5K3VA 3LTSA 4ML9A 1VH7A 4Y9MA 3L68A 3CV6A 1VBJA 1SFJA 1ADSA 3A22A 4Q4RA 5L9FA 2YCIX 3I3BA 3EWXA 4DO5A 4JN8A 3H2NA 1LP6A 3DX5A 4AYSA 1W1TA 1UKPA 3LCGA 2HNHA 3VZYA 1QWGA 4I5RA 5I3KA 2Z2BA 1GPWA 3H2AA 5MF5A 3EWWA 1ODZA 2WMKA 4PMQA 1GG1A 4B5VA 3OLDA 1UR3M 3BSGA 2YBUA 1U1UA 1M7XA 4H4IA 4UQAA 1C8QA 2A4AA 4KCWA 4Q4PA 4NYYA 3W7JA 3WH8A 2GQ3A 3IIZA 3SIMA 4JHMA 3KTXA 5HA7A 1G6CA 1PTAA 4CQ8A 2CITA 4GNKB 1W5MA 3FX4A 4ERIA 4PTMA 1TE6A 2PDBA 4HHMA 4HIBA 5CAKA 2VUNA 2GGJA 3E1F1 3T7VA 1TWZA 1LQ0A 2JK2A 3C0LA 2INFA 3SECA 3N25A 3RGTA 3I7QA 1ZBVA 2F84A 4DF0A 3S6TA 3TSBA 2QUUA 5KINA 2VP8A 1MDLA 1JXJA 4DAIA 3E0FA 4PTWA 4AWSA 2JEPA 4IX0A 2GZXA 2DORA 3QMRA 1J79A 1FWFC 2GUUA 1E6XM 2ZX5A 1ZAJA 1E40A 1PYMA 4MAZA 5H8PA 4W9TA 1QI0A 2QXWA 4O28A 1M04A 4JDBA 4QAIA 4UCFA 2GVLA 2AAAA 1HJWA 2YZ5A 2PPGA 1F3EA 1XYFA 3CV2A 3PB2A 4KWWA 2GWGA 1LG1A 3ZVHA 1GOOA 4QGCA 4NHVA 3GIPA 3WDRA 2HDJA 3OHIA 3BOFA 3ZJ8A 3ITVA 2NQLA 4CD6A 1S5WA 4E2VA 1A0EA 2V2CA 2Q6ZA 1UPMB 4FOUA 3YPIA 3AHTA 3B3DA 3MCOA 2PBGA 4S2BA 3BG5A 3TYCA 1XUZA 1X39A 2ZRUA 4Z1AA 5FAGA 2PF0A 1I60A 1QO5A 3GFZA 2VZSA 5E6ZA 2VVNA 3MSRA 1YHTA 2JF7A 4C6QA 1BWVA 1NWSA 2ISFA 2QCEA 4GA8A 4G9PA 4PCNA 5CPLA 3S3GA 4OV9A 4GD0A 2GK1A 1RK6A 2YFNA 2ZCGA 2CZVA 3NSXA 3UR5A 3GH7A 1E9YB 5I0DA 3DXIA 1K4HA 1QW7A 3TR9A 4EXQA 1UR9A 4XZNX 1P7TB 1OD0A 2QUNA 4Q8NA 3FFSA 5BNKA 5EMLA 3LG3A 3R94A 5FJRA 1BPLB 1YYAA 1GTHA 1JCYA 3G1HA 3ANYA 3GW3A 3REQA 4KGLA 2Y7FA 3R89A 1XIDA 3ENLA 2NT0A 1P0EA 1TPVA 4LQ1A 4NL1A 1T40A 4M6VA 4GX9A 3E5BA 3EOEA 1R9XA 1SO4A 3QQWA 2D0HA 3RF9A 4EVZA 2ZZ2A 3VOFA 3MDUA 4LX4A 2Y6ZA 1LYXA 3P82A 4H7VA 2Y88A 3GU2A 4MY9A 3F2CA 5DMMA 3UPMA 3PUEA 4LUYA 3PB0A 4OUIA 1J0KA 3O6YX 3VCNA 4DJFD 1TREA 1C92A 1SO6A 1EWEA 1CEOA 5DBUA 1HL8A 1RR2A 2W0UA 2GOKA 1OSEA 1FTXA 1PV8A 1OFDA 3IJQA 2J25A 4YVPA 4KEZA 2GWNA 4DAFA 3L4XA 1CNVA 1W3JA 3W2KA 1OGSA 1FDZA 4Q8PA 4JBRA 1WZLA 3T08A 5AC4A 1Y5WA 3S2CA 3PZ9A 5E6YA 1S39A 1FFQA 2PGFA 4F3HA 1VRXA 4IIEA 1UOKA 3PUGA 3W02A 4R7JA 4PCSA 2B7OA 3W88A 4WKHA 1V3JA 5A95A 1YXDA 4YVXA 1LT8A 1KLZA 8TIMA 4HK6A 4NSBA 1IEXA 4GIEA 2MNRA 7TAAA 5J8LA 4DWDA 3L66A 1W3KA 4Q3MA 2GVGA 3AALA 4JDYA 5GVJA 1CXEA 2V5JA 3FN9A 4K2SA 1PKLA 2WAGA 3BGAA 2VDHA 4HJFA 3W76A 2WMFA 3IRDA 4JOMA 4JFUA 4KF1A 1ZP4A 2OSXA 3OO2A 1EIBA 1V0MA 3LBCA 3TN4A 1XIJA 1P6CA 1IIGA 1ML1A 4O13A 5CQ1A 1TTPA 1XBZA 4R53A 2DT1A 4DJDA 3QY6A 3NUKA 1LWJA 4GH1A 3WEZA 4CUCA 1VFFA 3NL6A 4LB3A 5LHFA 1NF7A 4O15A 1BVNP 1K8CA 2FH6A 3WMLA 1KFBA 1K9DA 3VX0A 2XGIA 3AYRA 1W31A 5AHNA 2MUCA 1ITXA 4E5TA 3O8AA 2W92A 3RO6A 1QI2A 4MJ4A 1HN1A 5EA9A 3TFXA 4ES4A 3WH9A 3MI2A 4K36A 2YDSA 2NQHA 1FP8A 3KBJA 1KCZA 3HGJA 4FLQA 4WY0B 1A5OC 2VEPA 1E1FA 1F2JA 3H21A 1U33A 4EWND 3E0LA 3URNA 1A5LC 3ZLFA 3GFXA 2O92A 3CZEA 3M6DA 4H1ZA 5EMMA 4U5KA 4ACYA 1JGMA 4M81A 4EANA 4L4MA 4DHGA 1U5VA 2REQB 4CU8A 1PWLA 3MPGA 3V75A 2QCNA 3QR1A 3S46A 2PP3A 2VEFA 1P0DA 2ZRVA 4PUNA 1B9BA 1EDQA 2QS8A 1FWEC 3NO3A 4X0NA 3VE9A 2IUZA 4LCRA 1IXNA 3UZJA 1EC7A 4E3VA 3G18A 4EWJA 3AXXA 1DJWA 4C1NA 4M6UA 4JTEA 3EOLA 1HJVA 5AHIA 2D2JA 3DBPA 3LM3A 2QCCA 3V35A 2WSKA 1MXGA 1RBAA 3UT0A 4DWSB 2C15A 3TN6A 3GDMA 4O57A 2JGYA 1IWBA 2YR1A 3AHXA 3IGUA 2R82A 2PSNA 2JIEA 4DZ5A 1CB2A 1GOXA 4M51A 4ERAA 2DUZA 5BRQA 1EUNA 2QCDA 3W1XA 2ESCA 1HIZA 4MKSA 4I9AA 4WDUA 4D1JA 3ES8A 2WW5A 1GEQA 3K5XA 1US2A 1N55A 5HINA 4IISA 5FEXA 5AC8A 3PC0A 2GQ8A 4XG1A 1DIOA 1J8VA 1Q66A 2X0HA 4UFJA 3ORWA 2PLKA 3NG3A 1LOLA 3NZQA 1BF6A 1XYCA 1JEZA 2BS9A 4FPSA 1XYBA 5HBFA 3UWEA 2ZZ7A 4KRTA 1TRDA 2QMKA 1QXLA 3RUBL 3GNRA 5LSMA 3OVRA 1EHNA 2OLSA 2WJFA 2YSWA 4DBSA 4UC5A 4Q8OA 2Z2AA 3U9IA 1D2KA 4GCXA 3TV8A 1UH3A 4E2DA 3HPAA 3MP5A 1MYRA 2GL5A 3SCOA 3DG3A 1VR6A 4IQJA 4UFLA 1O1ZA 1JCMP 1ADOA 1BXNA 2YOCA 1UQYA 1W1PA 4HNLA 3IEBA 3I68A 2VX4A 5FEPA 1DE6A 3A21A 2E7FA 1V7AA 3ITCA 2WNNA 2EO7A 3V36A 1DHPA 1M68A 4XB3A 2A3HA 9RUBA 1DTUA 2FDSA 3WQ6A 3LNPA 4QP0A 4RXGA 4QXIA 4H9VA 4X61A 3L5LA 4CNSA 4HNOA 3VC6A 1JULA 3VTRA 1DWAM 1JAKA 4F2BA 4HJWA 3S5YA 3U2OA 4Y8EA 4HNUA 4ZQOA 3BSHA 3MUCA 3CAVA 3UWZA 1JI2A 2V3GA 4BI6A 4QJ5B 1XI3A 5F2GA 4PZVA 4A35A 3G8RA 4JQAA 1WKDA 3VKCA 2PWUA 3KS5A 1ZAHA 1V4YA 2BP1A 4ZTYA 3JU2A 3T8QA 3DFQA 3WQVA 1AK5A 3NYDA 4GX8A 4H7CA 2X1RA 4ATLA 4JQ3A 4H6KA 1XYLA 4ZTXA 5BMXA 4EX4A 5ABFB 5EPDA 1S3HA 4AVNA 2VCCA 4AX6A 1S1PA 2ACUA 4DF2A 2QDEA 1QPQA 4LUIA 4H01A 1FKWA 1J01A 3GX9A 1KD0A 4JTFA 1R9ZA 3CMGA 4IP5A 1QW9A 4C6MA 4RW3A 2QAPA 4FNRA 2CLEA 3P3BA 2AMGA 3TK7A 1F3XA 3HV8A 1WCGA 4J27A 3I3DA 2IKGA 5C2CA 2W9MA 1HO1A 2HROA 5HNTA 4FMVA 1D3HA 3NDOA 1B54A 2B31A 3CPGA 3MO7A 5E1QA 2JF6A 3W26A 1H11A 3W38A 3P7YA 3TW6A 3V5OA 2VR2A 3UEQA 3HMJG 1JI1A 5DMNA 4IGHA 1EGZA 4IL0A 2V67A 3A23A 4MWAD 2Q71A 3F4NA 3T55A 4DNMA 4O4VA 3IJDA 5I5RA 2PC4A 2GDVA 2YGYA 3WF3A 4KRZA 5LXXA 4QFUA 3ZR6A 2NUXA 4KESA 3D47A 4GGHA 2XGBA 4RUBA 1SYTA 1WDWA 3K46A 3P61A 1VAHA 3T0BA 4DYKA 4JY9A 4K3ZA 3EX4A 4F4RA 4DLFA 1NQKA 3GIQA 4AMCA 3CTLA 4JIHA 3WF4A 3CLWA 3L0KA 2X1TA 1OF8A 3B97A 1EP1A 3WJZA 2XIIA 3QPZA 1AJ0A 2W66A 5ABGA 4GYPC 3S5NA 4JL1A 4A3UA 3RLVA 4V1YA 1R46A 1VENA 1XLDA 4M1RA 4JYDA 2E8ZA 1GYMA 5HJYA 1YPFA 1H0IA 5F4SA 1K3UA 2OEKA 3ARPA 1O94A 1IXOA 1UP3A 1MDRA 1WPCA 4MF4A 4D6IA 4U4MA 4MM1A 4OE7A 3MMTA 1R87A 1LWIA 5CXPA 4RL3A 2Y1HA 4UB9A 3PY2A 1OC6A 5CC6A 3LCIA 6A3HA 3QV6A 5D2VA 1NDWA 3GYCA 3RCMA 3FW6A 4OOUA 3GYEA 3OZPA 2D20A 2C19A 1QPOA 4L65A 1XINA 2O4MA 1GVOA 5G4HC 3SCRA 1UMYA 3IACA 3GVGA 1V3IA 1W1VA 3GE7A 2PD9A 1JNEA 1E6QM 2PTYA 4WDTA 5CJNA 4GGBA 1GZJA 4AEFA 3M0KA 1QU4A 3E3HA 3O06A 3BURA 2PGWA 2VX7A 5D05A 4QM1A 1NFPA 1PDYA 5F1VA 2WOQA 3KRSA 3NQEA 1WKEA 4S3JA 6REQA 3MMUA 3NAVA 1KC7A 3B8VA 5A8NA 3KVJA 3KHDA 4OGZA 3SSZA 1K9EA 3G1VA 1UZ4A 4AHQA 3MMDA 1WZKA 5LIKX 3CQ0A 4IP4A 2D0FA 1JQVA 1TPUA 1P5BA 1GOMA 2PLJA 4LVDA 3OJGA 3P0XA 3TTSA 3IJ9A 1EEPA 3L5AA 1Q13A 1N8IA 2VEGA 1UYQA 2W63A 1JPKA 1IT0A 3FSTA 5LIXX 3N2XA 5A8GA 4DWSD 4I6KA 3W7MA 1G4TA 3BAKA 3GK0A 4YWSA 1W5PA 2X40A 4Z1CA 5ENLA 2Q09A 1XH1A 1PBGA 3OTRA 3TNBA 4WUIA 3N14A 2WVVB 3KBMA 1QR7A 3N6HA 3GVQA 3TTYA 1EJUC 1KV8A 1XJBA 2QUMA 1C8VA 4ZA0A 2P50A 4JKLA 1E0TA 4WKFA 2H9AB 3OBKA 4M6QA 1DTNA 2J8TA 1FY6A 2D73A 5KMYA 4XAPA 3QC0A 4BA0A 4GACA 5HULA 1UR2A 5FEWA 3AJXA 4JQ4A 2PZ0A 3C5QA 4G5DA 4PSRA 4Y90A 5F1UA 3DI0A 4LGXA 3HQNA 3W2UA 1OFEA 3K30A 3VX1A 4GZ7A 3W0KA 1F5ZA 4IL2A 3S1WA 3DN5A 3LTPA 2REQA 1PB0A 5CPNA 2NV9A 3Q2DA 1GONA 4B5UA 4HHHA 3R8RA 4H8VA 3VFCA