3WMM0

Crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
40
structure length
40
Chain Sequence
TGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosynthetic reaction center C subunit
total genus 16
structure length 40
sequence length 40
chains with identical sequence 2, 4, 6, 8, B, E, G, J, N, P, R, T, V, X, Z
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00556 LHC Antenna complex alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3wmm000
1KZUB 1JMMA 2FKWB 3WMM0 1JO5A 1LGHB 1NKZB 1DX7A 1WRGA 1IJDB
chains in the Genus database with same CATH superfamily
5CCHC 1E79H 2MKVA 2WPSA 3PJSK 4HH2A 5AW5B 3D6ZA 1HJBA 3TSIA 1JUNA 2QJYC 2FXOA 2C9LY 2QVAA 1MV8A 4KT0J 1NTZG 2ZYDA 2XV5A 4H44B 5E79E 4GODA 4U3FJ 1LT9B 1N7SA 4JBZA 2ZFCA 2WPQA 5AW1B 2WT7B 2WSFJ 3CX5I 3MZWB 3E1IA 4PV1C 2QJYB 4W7YA 4DOJA 3JC22 3P8MC 3SWFA 1BSHA 2N1TD 1SQBD 3AEBC 2HODB 1S5LX 2JO1A 2LXBA 2YXQB 4AYCA 2V7QJ 1RF0C 2OYIA 1KZUB 3KZIE 3CWBG 3P7KA 1FJPA 1W5CE 2HG5D 2MJZA 2GUVA 3H1HE 4H0LC 4XA4A 1K8AQ 1NTMD 3U59A 3V2QA 1PP9G 1U7JA 1NKNA 1ZN5A 4OWFA 3BRTB 1S9KD 3L36A 3L74G 1T2KD 2E42A 3B5NB 1EZVG 1PP9D 4YXDC 1NTME 1R5SA 1N7SD 3S4RA 3Q5PA 3RGUA 1L0LD 2FYUG 3L73J 5KJ7D 3VOPA 2E74C 2J59M 2K1AA 5C39A 5CJ4A 3OAKA 1LTIC 1LTJA 1PGOA 4IFFA 4EOTA 4NPEA 1SQBG 2YKOA 2K37A 1UIIA 1YI2P 1H89A 1FU1A 3TNUB 1QL2A 3BCCJ 3L71E 3B5NC 2B87B 1IC2A 4A7PA 1QVGO 3MD0A 1OW7A 4LC1A 4B86A 3HE4B 4GT1A 5KAFH 1SQQE 1JTHA 5DJTB 1WMKA 3L75G 2N1TB 2NRGA 1U57A 4I7ZC 1YJ9P 3TGUG 1USDA 4EYYQ 1SQQD 1FZBA 1GL2D 2FFDC 3L4FA 1SS1A 1G2CA 1GTWA 1ZRTE 1S4XA 3M9QA 3NFQA 5AVXB 4PJ0H 1QEXA 3BCCD 3VMXA 1EZVE 2Q5UA 2ZT9D 1DEEG 1QVFO 2NPSC 1IO4A 2QE7H 1M1JB 4CPGA 3FX0A 1IFPA 1SQXK 3CWBD 4H13B 3JSVC 1H8AA 2H7HA 1MFZA 1NTKD 1SP4A 1QLED 4IL6X 2ZVNB 2AEMA 2UWJE 2ZYGA 3AE6C 4XFJA 2ZJSE 3TGUJ 2A45G 3SWKA 2QJKB 1BE3G 2FYUK 1X22A 3CX5H 2KSEA 2C9NY 2H88C 2K9JB 3M06A 2PFXA 3L70J 3USSA 1QGKB 4IFMA 5APYA 2HR3A 1NTZD 1LTSC 1URQB 1JOCA 1P84H 1JY3N 2LKMA 3G3ZA 2C0WA 2E5TA 2K3RA 3BCCE 4GIFA 1YBKA 3BRVB 5AW8B 4DT0A 5BVZA 1YHQP 4JPZB 1X79B 1VL2A 2BCCE 3W68A 2R5DA 3CCRP 2QSIA 1EQ7A 2D2CC 2L91A 1LTAC 5AVTB 1KB9E 2KK7A 2WSCJ 1M7LA 1IZNB 4L75A 2AXTE 2W6BA 2BCCJ 2GM4A 1HBWA 3CXHH 2Y0CA 2WWWA 3FXDA 1DD4A 1RF0A 3GW6A 4N6JA 1GK6A 1Z56A 5KLVD 1L0NG 1OFCX 3L70E 1J2JB 2IZ1A 3PP5A 3F5HA 4IL6H 1NU1D 4WWIA 1PZQA 2N1TC 1FDMA 3V6IA 1FZAA 1SQXJ 2B87A 2W6JH 1PGPA 1LTTC 1QX8A 3AE2C 5KLIB 4PV1D 5DJUB 1VQOP 3PTZA 3GLMA 3CWBJ 1OXZA 1SQBE 3H1HG 3RL0B 1T6AA 1FS0E 2D2CD 3AE7C 2I1JA 3QWOC 1CW5A 1KN7A 3HE5A 2E76C 1J1EC 3V4WA 1DH3A 1P84I 3CL3D 2FYUJ 3L73G 3O8ZA 3KPEA 3AE8C 2OYHA 2BCCG 2A06G 3A0BE 3B71A 4GOEA 5AW4B 4ZKUA 3AE4C 5AW0B 5BU8B 5CCHA 1BGYE 1FJKA 2KS1B 3H1IG 3RK2B 3TF5A 2FYUE 3RK3C 1JCCA 1VQ9P 2E74D 5KJ7C 1KQGB 2VRSA 1NTZJ 1M90Q 4EI2A 1N7SC 1IK7A 5TISH 1VPCA 3I5CA 5APXA 2HLOA 2ZT9B 1L0NE 3HUSB 2QJPC 2C0XA 2HYNA 3WUUA 1VDFA 5CBOA 2FFDA 1KYOI 2XZRA 4U3FE 3HD7A 2PRRA 3H1IE 2KZIA 2O01J 4IL6E 2N9BA 2LXCB 2KOGA 1RY3A 2IZ0A 2YMKA 1N73B 1G1JA 4PJ0E 1PP9E 3H1JJ 1U7MA 1OVVA 5CHXA 2BCCD 3JCUH 3PLNA 4ZNCA 1YTZI 2GUSA 2WT7A 3M9HA 2SPZA 3WU2H 2WTYA 4L74A 3H32A 1FAVA 1IFJA 3M91A 4Y28J 4D6TD 2FXMA 2D2CB 2AXCA 3A0BH 3L73E 4LGDE 1M1JC 1NYHA 3AEDC 3CLQA 3FWLA 3GF3A 4H0LB 1SQVD 1BGYD 3H1KE 1M1JA 4BRYA 1QL1A 1IFNA 5CCGC 5APTA 4WY4A 1S5LH 3OA7A 1PL5A 3VMYA 1SQVK 4XE5B 2E75C 3H25A 4ASVA 5K5GB 4PD4I 3D71A 3HD7C 3RK2D 1Q7YQ 1CSBA 2E5YA 2IYPA 1NOHA 1VQLP 1SQBK 2E74B 1RQUA 1G2CB 3KDPB 1AVYA 3R4YA 2Y0DA 2ZYAA 1LGHB 4MN4C 1JO5A 2YO3A 5AVYB 3UIAA 2BASA 3IF4A 1OVRA 3IN6A 2ZVOB 4Y99C 2PP6A 4ZMDA 2FBWC 5BU5A 3TGUE 4M3LA 4AQRD 1RF1B 4N78E 1LWUA 1NU1E 2XKMA 2J58A 2W83C 3CCLP 5AVUB 4DZOA 3D6YA 1MUUA 2H89C 1S3JA 2QIWA 5KAIE 1KB9H 1EXJA 1NJIQ 2OTLP 2Z5HA 3K5BA 4JYCA 2KSJA 1JY3O 3EFGA 3M0DC 4Y99B 3S9OA 4HKZH 3VYIA 1TU3F 5H2FE 2KZJA 2KP8A 3N4XA 1SQXD 2ZXXA 4JYBA 2Y9ZA 3CC2P 5CBNA 1OW8A 1JY2P 1SQVG 4H0LD 1FBMA 1L0LK 1BE3D 1PFIA 4QMAA 2NPSD 2WSEJ 4HB1A 2O3JA 2W8ZA 3P8CD 4H13C 2Q7CA 1GU5A 1GL2B 2IFNA 2I8DA 2R44A 3BASA 4R4LA 5AVQB 1J1DB 4UB6H 1GL2A 1AV1A 2Q6QA 1OMIA 1S2EA 1G1IA 3V2NA 1NWQA 3QH9A 1GW3A 1T8ZA 3EQ2A 4JQ0D 4H44C 1FOSF 1HF9A 3KYQA 1Q90D 1SQVJ 2N9YB 1OVUA 1FZEA 1GD2E 2JEEA 3C1LA 2WZ7A 3PHLA 1LJ2A 1S5LE 3KHUA 3D70A 1BSNA 1H0TB 4H13D 3CCUP 2YMYA 3CXHD 1N7LA 1SQPJ 2QJKC 3CCMP 5AVZB 5B5EH 2XDJA 1IK9A 1RE3A 3RL0g 2JWAA 5EFWB 1EDJA 1GW4A 1LWUB 1Y47A 3MTUE 3H1LD 2A06E 2KB7P 2WSEH 4W7ZA 1L2PA 1URQC 3H32B 3L75D 3KQGA 4JF7A 3RBZA 3VMAA 4OGQC 2RKLA 3I56P 1YITP 2A06D 1HTLC 2KLUA 2L5GB 1SFCC 2YO2A 5KLVK 4W80A 1VQ4P 3FGAD 1NU1K 1FE6A 3IFMA 2M3BA 4WB4A 2M5AB 4IFDK 3TYYA 1NTKK 1YYCA 1URQD 1KQSO 3KZIH 2HODA 3RK3D 4BXLA 3AEFC 3MIWA 2J5UA 2WVRA 1AJYA 1NO4A 1PGJA 4OGQB 1FZGA 1KILC 5APVA 1RF1C 3L71D 3A0HH 4WVZA 2V4HA 1FDIA 3CCQP 2AXTH 3GMAA 1K9MQ 2E43A 1S72P 3L74D 5KLIC 1OX3A 2KNCA 3L35A 3H6PA 3CMAP 2YKPA 3C8VA 3IAOA 4UB6E 1YJNP 1X9VA 3MGNA 5E79H 1PPJG 1GZLA 2IBZE 2Y9YA 3HTKB 1S1CX 1K05A 1NAFA 3AE9C 1FC2C 2FXPA 2E76B 1RE4C 5AVSB 1Q81Q 1H0TA 1VQ7P 1GK4A 1W2EA 2CPBA 1ZXGA 3H1JD 3CCSP 1NGMB 1N86A 2FFDB 2WMMA 3V2RA 1KTMA 1BCCE 2QM8A 4PV1B 3GHGA 2K88A 1HVVA 5H2FH 1Q86Q 2YIUB 1KMIZ 1SQPD 3CX5E 3H1LJ 1HGZA 3SFDC 4IOIH 2W90A 2ZT9C 3AE5C 5CCGA 4KHXA 3AEAC 1NTMK 1USEA 4RO0A 5KLVJ 2B88A 1RHZB 4EIJA 4O9BA 1KQLA 3O6QB 1SQPG 5AVRB 1DIPA 2YIUC 1NAYA 3LIDA 4OGQD 2GA1A 3HE5B 5KAFE 1L4AD 1ZV8A 3A0HE 4D6TE 1NTKG 3AE1C 4R4MA 4ASWA 4TLFA 1K73Q 2RN0A 3H1JG 3NMDA 4U7JA 5TISE 2IBZG 2YXRB 2RMZA 3CCVP 4U3FG 3P32A 1RE3C 1WT6A 1N8RQ 1D7MA 2Y0EA 1LP1B 1VQPP 1JY2O 1PPJD 4DCKA 1SQVE 2E76D 3H1HJ 3HD7D 3RK2C 3RK3E 4EDFA 4OVNF 3AEGC 1ZR4A 1Y9BA 1AFOA 3F89A 3T97B 3Q2YA 1JY2N 2ITAA 3L71G 5B66H 1RE4A 3AE3C 3L75J 3Q5RA 3WU2E 1JEKA 1GMJA 1KFMA 2E75B 3G71P 3M0DA 1ZR2A 1SQQG 2NPSA 2K9YA 3JCUE 2G8YA 3WUTA 3TGUD 2FYNC 3V2PA 2JKVA 2CK3H 3B8EB 1NU1J 3MUDA 4GOFA 2YKQA 4PD4E 3EWKA 4Z1MH 5KJ7A 4YXWH 4WY4B 1KQFB 1ZP0C 2POHA 2FYZA 1VQKP 1KYOD 2IFMA 1HJ0A 4HJGH 1L0NK 1VF5B 2OYOA 2OARA 3M0AA 1L4AB 3BATA 3CWBE 1LTBC 3ITKA 4L73A 2FYNB 3L71J 4N78D 1L0LG 1OWAA 2FYUD 3H1LG 3LW5J 3S1KA 2QEXP 3CC4P 2HPCA 3L37A 2OGUA 2OQQA 2FKWB 1EZVD 2Q3IA 2Z4EA 2KXPB 2IYOA 1CZQA 1NH4A 4I7ZB 3L74E 5GTHH 1LTJC 3GG2A 5AW9B 3HD7B 1KYOE 1X0TA 1BE3J 1A02F 2JP3A 3HE4A 1NTMG 1KILB 2KI7B 1L4AC 3LW5H 3HUSA 2CPSA 1LP1A 2KUBA 4I1LA 1CI6B 1P84E 3VP8A 4PD4D 1M56D 1NTKJ 2OTKE 3H1KJ 4NPDA 1OZHA 4BWNA 1GU4A 1RH5B 2KLVA 2WQYC 2AEFA 2B89A 3RBXA 2Q3EA 1EZVI 1LTJB 2P7JA 2P10A 3H1IJ 1T2KC 2JDIH 2YNYA 1HH0A 1JNMA 1MKMA 5KTBA 4LLHA 2XNDH 1AQTA 2NPSB 1EDLA 2R3SA 5GTIE 4NPFX 2XU6A 2RH0A 1NTMJ 3O6QA 1MFTA 5GTHE 1HWTC 5AW2B 4HYTB 3ZDMA 2OYHB 1PP9J 4C46A 3OW2O 1VF5D 3H1KG 1VQ6P 4RKUJ 3SFEC 1SQXG 3L74J 1P84D 1X8YA 3PRJA 1Q82Q 5B5EE 1M8OB 2M3EA 2O01H 2M0BA 3R2PA 4N3YB 1JY3P 1MZ9A 1SQPE 1YJWP 1L0NJ 3CMEP 3U1AA 1LT9C 1NVOA 2P67A 1NTZK 3HRNA 1NTKE 2M8RA 1HUCA 1S9KE 3CPWO 1BCCJ 2HFED 1FZCA 1GL2C 2R5BA 2WSSH 5KAIH 3H1JE 2QA4P 1SQQK 2OYHC 5AW3B 2KS1A 2NZ2A 1WRGA 4OH8B 1KYOH 3NXSA 1SLQA 4ZKPA 1GDTA 3CC7P 1KILD 2V7QH 3II6A 3TDKA 3B5ND 3L70D 5L8RJ 3PH0A 2G3AA 2O01N 2KNCB 1OW6A 3AECC 1LT9A 1N7SB 5KKZB 3L72E 1VQNP 1SVFA 1FDOA 1HGVA 2WSCH 3C9IA 1M1KQ 3MP7B 1BCCD 3U1CA 3FWNA 2Q1KA 1FZCB 1EDKA 1PIXA 2P58A 1ZMEC 1XTCC 1BGYG 1LT1A 4C7RA 1CI6A 3RK3B 1SQXE 2Z5IA 3WMM0 1URQA 1BCCG 1IFMA 1KILA 1NKZB 2DW3A 5KKZC 1RF1A 1ZW0A 1DEBA 1BDCA 1EDIA 1Y8AA 2A45I 2O1JA 1E5WA 2R32A 3ABVC 3L72G 2K9JA 2ZAEB 2O1KA 3P8CE 4UB8E 3VP9A 4C7NA 1JMMA 1ZRTD 3Q1MA 1SQBJ 4I2LC 3OJAB 5AVVB 2IDBA 1R8EA 1KC8Q 2HPCB 3AEEC 3G4SP 1N73C 3RL0C 1RQVA 2H43A 5TJHA 1L4AA 1VF5C 1SFCA 2AEJA 1UIXA 3MHVA 3TK1A 1KFNA 1AA0A 1J1DC 2WITA 3A5TA 2IPPA 4WBAA 3VMZA 1EXIA 3VTPC 3Q5SA 4KJMA 1NTZE 4TT3H 2BEZF 2M5AA 3B4SA 3E7KA 3EFFK 2KIKA 3H1KD 5CJ0A 5M1BA 3GHGC 1YTZT 1AVOA 2PAJA 2WPVB 3M9BA 2OYIC 2PGDA 1NHLA 3LIEA 4YPCA 2QRXA 1L0LJ 3A2AA 3L73D 2W27A 2QJPB 3CX5D 2KYVA 3T97A 1XTGB 2FY8A 4D6TG 4YTPC 2JR8A 1JTHB 2Q9IA 1K04A 3GF7A 2JWDA 1EC5A 1IFIA 3CI9A 3N7NA 4GKGA 1JMBA 3CD6P 4RJTA 1IFDA 1SFCD 1LWUC 1OIPA 3Q3DA 1T3UA 1KB9D 1A02J 2LR2A 1H88A 3A7OA 1NU1G 3NTNA 5AVWB 2I1KA 1KD1Q 3VN0A 3I55P 1L0ND 2IX7C 5KLVG 1VQ5P 3KXDA 1SQQJ 3SWYA 1JM0A 4RESB 1YIJP 1KV4A 1FZCC 2H8PD 3L75E 1PPJE 3L72J 5APSA 1KORA 1L0LE 5B66E 2BEQD 1DD3A 3B5NA 3H1ID 2N1TA 4UB8H 1VQ8P 1M57D 1T3JA 1YQ3C 1KB9I 2E75D 3MUDC 4WY4C 1DX7A 4K35A 2P2UA 5CCGD 5CMZA 3BVHA 3G6EP 3TNUA 2P1JA 1Q2NA 4H44D 4K3AA 4DJGA 1PGQA 3L72D 2OTJP 5APUA 4WY4D 1BDDA 3G9RA 3V4QA 1FOSE 2QG4A 3H1HD 3A3YB 3W67A 1LNQA 3IR9A 3RL0D 3CCEP 1LTGC 1KILE 1R5LA 1ZOYC 2JJLA 2QM7A 4BRYB 1VQMP 3H1LE 1N2DC 1JB0J 1YQ4C 2IBZI 1JCDA 2R3CA 2A45H 1ZLLA 3HTKA 2B9BA 4PD4H 1SFCB 5APWA 5CCHD 4AUWA 3HUSC 3SSUA 1W2BO 5KLVE 2WSFH 3CXHE 3FXEA 2ZXEB 1BE3E 5GTIH 2W6AA 3L70G 5AW7B 5AW6B 1IJDB 1AQ5A 3E1RA 4C7NB 3CXHI 4GDOA 3V5BA 4D6TJ 1PV3A 5APQA 1FZFA 4U3FD 3GHGB 1N73A 1BGYJ 2WPRA 2IBZD 2XNXA 3WUVA 2OYIB 4I6MC 1J1EB 3BCCG 1SQPK 3CCJP 4L76A
chains in the Genus database with same CATH topology
5CCHC 1HJBA 2WPSA 4HH2A 5AW5B 1JUNA 3TSIA 2C9LY 1MV8A 2XV5A 1LT9B 1N7SA 2ZFCA 2WPQA 5AW1B 2WT7B 3E1IA 4W7YA 4DOJA 3P8MC 3SWFA 2N1TD 2HODB 4AYCA 2OYIA 1RF0C 1KZUB 3P7KA 1FJPA 2HG5D 2MJZA 2GUVA 4XA4A 3U59A 3V2QA 1NKNA 1ZN5A 3BRTB 1S9KD 3L36A 1T2KD 3B5NB 1N7SD 5KJ7D 3VOPA 2J59M 5CJ4A 3OAKA 1LTIC 1LTJA 4IFFA 4EOTA 2YKOA 1H89A 1FU1A 3TNUB 1QL2A 3B5NC 1IC2A 3MD0A 4LC1A 4B86A 3HE4B 4GT1A 1JTHA 2N1TB 1FZBA 1GL2D 2FFDC 3L4FA 1G2CA 1GTWA 3M9QA 3NFQA 5AVXB 3VMXA 2Q5UA 2NPSC 1IO4A 1M1JB 1SQXK 1H8AA 2H7HA 1MFZA 1SP4A 2A45G 2FYUK 2C9NY 3M06A 4IFMA 5APYA 1LTSC 1URQB 1JOCA 2LKMA 1JY3N 3G3ZA 5AW8B 2C0WA 2E42A 5BVZA 4GIFA 3BRVB 1X79B 2R5DA 1EQ7A 1LTAC 5AVTB 1M7LA 2W6BA 1HBWA 2WWWA 1RF0A 4N6JA 1GK6A 1Z56A 1J2JB 3PP5A 2N1TC 1FDMA 1FZAA 1LTTC 1OXZA 3RL0B 1CW5A 2I1JA 3HE5A 1J1EC 3V4WA 1DH3A 3CL3D 3O8ZA 3KPEA 2OYHA 5AW4B 5BU8B 4ZKUA 5CCHA 5AW0B 1FJKA 3RK2B 3RK3C 1JCCA 5KJ7C 2VRSA 1N7SC 1VPCA 3I5CA 5APXA 2HLOA 3HUSB 2C0XA 2HYNA 1VDFA 2FFDA 2XZRA 3HD7A 2N9BA 1N73B 2KOGA 1RY3A 1G1JA 5CHXA 2WT7A 1YTZI 2GUSA 2WTYA 3M9HA 3H32A 1FAVA 1IFJA 3M91A 2FXMA 4LGDE 1M1JC 3CLQA 1M1JA 1QL1A 1IFNA 5CCGC 5APTA 4WY4A 3OA7A 3VMYA 1SQVK 4XE5B 3HD7C 3RK2D 1CSBA 1NOHA 1SQBK 3KDPB 1G2CB 1JO5A 1LGHB 2YO3A 5AVYB 3UIAA 2BASA 4Y99C 2PP6A 5BU5A 4M3LA 4AQRD 4N78E 1LWUA 2XKMA 2J58A 5AVUB 4DZOA 1MUUA 2Z5HA 4JYCA 2KSJA 1JY3O 3EFGA 3M0DC 4Y99B 2KP8A 3N4XA 4JYBA 1JY2P 1FBMA 1L0LK 1PFIA 2NPSD 2Q7CA 3P8CD 1GU5A 1GL2B 2IFNA 5AVQB 3BASA 1J1DB 3V2NA 1GL2A 1NWQA 1G1IA 1GW3A 1T8ZA 3EQ2A 1FOSF 3KYQA 1FZEA 1GD2E 2JEEA 2WZ7A 2YMYA 1N7LA 5AVZB 2XDJA 1IK9A 1RE3A 1GW4A 1LWUB 3MTUE 2KB7P 2WSEH 4W7ZA 1URQC 3H32B 3KQGA 4JF7A 1HTLC 2L5GB 2YO2A 1SFCC 5KLVK 4W80A 1NU1K 3IFMA 4WB4A 2M3BA 4IFDK 3TYYA 1NTKK 1YYCA 1URQD 2HODA 3RK3D 3MIWA 1NO4A 1FZGA 1KILC 5APVA 1RF1C 2E43A 3L35A 3H6PA 2YKPA 1X9VA 3MGNA 1GZLA 3HTKB 1NAFA 5AVSB 1RE4C 1GK4A 1W2EA 2CPBA 2FFDB 1N86A 3V2RA 2QM8A 3GHGA 1HVVA 1HGZA 5CCGA 4KHXA 1NTMK 4EIJA 4O9BA 1KQLA 5AVRB 3LIDA 3HE5B 1L4AD 1ZV8A 3NMDA 3P32A 1RE3C 1WT6A 1JY2O 1ZR4A 3HD7D 3RK2C 1AFOA 1JY2N 1RE4A 1ZR2A 1KFMA 2GM4A 3M0DA 2NPSA 3V2PA 3B8EB 3MUDA 2YKQA 5KJ7A 4WY4B 2POHA 2FYZA 2IFMA 1L0NK 2OARA 3M0AA 1L4AB 3BATA 1LTBC 4N78D 1OWAA 2HPCA 3L37A 2FKWB 2Q3IA 2Z4EA 1CZQA 1NH4A 1LTJC 5AW9B 3HD7B 1A02F 3HE4A 1KILB 1RF1B 3LW5H 1L4AC 3HUSA 2CPSA 4I1LA 1CI6B 3VP8A 1GU4A 2KLVA 2P7JA 1LTJB 1T2KC 1JNMA 2YNYA 1HH0A 5KTBA 4LLHA 2NPSB 2XU6A 1HWTC 5AW2B 4HYTB 2OYHB 4C46A 1X8YA 2O01H 4N3YB 3R2PA 1JY3P 1MZ9A 3U1AA 3HRNA 2P67A 1LT9C 1NTZK 1FZCA 2M8RA 1HUCA 1S9KE 2HFED 1GL2C 2R5BA 2OYHC 1SQQK 5AW3B 1WRGA 4OH8B 3NXSA 4ZKPA 1SLQA 1GDTA 1KILD 3II6A 3B5ND 1LT9A 1N7SB 1SVFA 1HGVA 2WSCH 3C9IA 3U1CA 1FZCB 1XTCC 4C7RA 1CI6A 3RK3B 2Z5IA 3WMM0 1URQA 1KILA 1IFMA 1RF1A 1NKZB 1DEBA 2A45I 2O1JA 1E5WA 2R32A 3VP9A 2O1KA 3P8CE 4C7NA 1JMMA 4I2LC 3OJAB 5AVVB 2HPCB 1N73C 3RL0C 2H43A 1L4AA 1SFCA 3TK1A 1KFNA 1J1DC 2WITA 3A5TA 2IPPA 4WBAA 3VMZA 3VTPC 5CJ0A 3GHGC 1YTZT 2PAJA 3M9BA 2OYIC 1NHLA 3LIEA 3A2AA 2W27A 2KYVA 3T97A 1XTGB 1JTHB 2Q9IA 1IFIA 3CI9A 3N7NA 4GKGA 1IFDA 1SFCD 1LWUC 1A02J 1T3UA 1H88A 3A7OA 3NTNA 5AVWB 2I1KA 3VN0A 2IX7C 3SWYA 4RESB 1FZCC 2H8PD 5APSA 3B5NA 2N1TA 1T3JA 4WY4C 1DX7A 2P2UA 5CCGD 5CMZA 3BVHA 3TNUA 2P1JA 5APUA 4WY4D 3V4QA 1FOSE 3A3YB 3IR9A 3RL0D 1LTGC 2QM7A 2JJLA 1N2DC 3VYIA 3HTKA 1JCDA 2R3CA 2A45H 1ZLLA 5APWA 5CCHD 1SFCB 4AUWA 3HUSC 2WSFH 2ZXEB 2W6AA 5AW7B 5AW6B 1IJDB 1AQ5A 4C7NB 3V5BA 5APQA 1FZFA 1N73A 3GHGB 2XNXA 2WPRA 2OYIB 4I6MC 1J1EB 1SQPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZU B;  1JMM A;  2FKW B;  3WMM 0;  1JO5 A;  1LGH B;  1NKZ B;  1DX7 A;  1WRG A;  1IJD B; 
#chains in the Genus database with same CATH topology
 5CCH C;  1E79 H;  2MKV A;  2WPS A;  3PJS K;  4HH2 A;  5AW5 B;  3D6Z A;  1HJB A;  3TSI A;  1JUN A;  2QJY C;  2FXO A;  2C9L Y;  2QVA A;  1MV8 A;  4KT0 J;  1NTZ G;  2ZYD A;  2XV5 A;  4H44 B;  5E79 E;  4GOD A;  4U3F J;  1LT9 B;  1N7S A;  4JBZ A;  2ZFC A;  2WPQ A;  5AW1 B;  2WT7 B;  2WSF J;  3CX5 I;  3MZW B;  3E1I A;  4PV1 C;  2QJY B;  4W7Y A;  4DOJ A;  3JC2 2;  3P8M C;  3SWF A;  1BSH A;  2N1T D;  1SQB D;  3AEB C;  2HOD B;  1S5L X;  2JO1 A;  2LXB A;  2YXQ B;  4AYC A;  2V7Q J;  1RF0 C;  2OYI A;  1KZU B;  3KZI E;  3CWB G;  3P7K A;  1FJP A;  1W5C E;  2HG5 D;  2MJZ A;  2GUV A;  3H1H E;  4H0L C;  4XA4 A;  1K8A Q;  1NTM D;  3U59 A;  3V2Q A;  1PP9 G;  1U7J A;  1NKN A;  1ZN5 A;  4OWF A;  3BRT B;  1S9K D;  3L36 A;  3L74 G;  1T2K D;  2E42 A;  3B5N B;  1EZV G;  1PP9 D;  4YXD C;  1NTM E;  1R5S A;  1N7S D;  3S4R A;  3Q5P A;  3RGU A;  1L0L D;  2FYU G;  3L73 J;  5KJ7 D;  3VOP A;  2E74 C;  2J59 M;  2K1A A;  5C39 A;  5CJ4 A;  3OAK A;  1LTI C;  1LTJ A;  1PGO A;  4IFF A;  4EOT A;  4NPE A;  1SQB G;  2YKO A;  2K37 A;  1UII A;  1YI2 P;  1H89 A;  1FU1 A;  3TNU B;  1QL2 A;  3BCC J;  3L71 E;  3B5N C;  2B87 B;  1IC2 A;  4A7P A;  1QVG O;  3MD0 A;  1OW7 A;  4LC1 A;  4B86 A;  3HE4 B;  4GT1 A;  5KAF H;  1SQQ E;  1JTH A;  5DJT B;  1WMK A;  3L75 G;  2N1T B;  2NRG A;  1U57 A;  4I7Z C;  1YJ9 P;  3TGU G;  1USD A;  4EYY Q;  1SQQ D;  1FZB A;  1GL2 D;  2FFD C;  3L4F A;  1SS1 A;  1G2C A;  1GTW A;  1ZRT E;  1S4X A;  3M9Q A;  3NFQ A;  5AVX B;  4PJ0 H;  1QEX A;  3BCC D;  3VMX A;  1EZV E;  2Q5U A;  2ZT9 D;  1DEE G;  1QVF O;  2NPS C;  1IO4 A;  2QE7 H;  1M1J B;  4CPG A;  3FX0 A;  1IFP A;  1SQX K;  3CWB D;  4H13 B;  3JSV C;  1H8A A;  2H7H A;  1MFZ A;  1NTK D;  1SP4 A;  1QLE D;  4IL6 X;  2ZVN B;  2AEM A;  2UWJ E;  2ZYG A;  3AE6 C;  4XFJ A;  2ZJS E;  3TGU J;  2A45 G;  3SWK A;  2QJK B;  1BE3 G;  2FYU K;  1X22 A;  3CX5 H;  2KSE A;  2C9N Y;  2H88 C;  2K9J B;  3M06 A;  2PFX A;  3L70 J;  3USS A;  1QGK B;  4IFM A;  5APY A;  2HR3 A;  1NTZ D;  1LTS C;  1URQ B;  1JOC A;  1P84 H;  1JY3 N;  2LKM A;  3G3Z A;  2C0W A;  2E5T A;  2K3R A;  3BCC E;  4GIF A;  1YBK A;  3BRV B;  5AW8 B;  4DT0 A;  5BVZ A;  1YHQ P;  4JPZ B;  1X79 B;  1VL2 A;  2BCC E;  3W68 A;  2R5D A;  3CCR P;  2QSI A;  1EQ7 A;  2D2C C;  2L91 A;  1LTA C;  5AVT B;  1KB9 E;  2KK7 A;  2WSC J;  1M7L A;  1IZN B;  4L75 A;  2AXT E;  2W6B A;  2BCC J;  2GM4 A;  1HBW A;  3CXH H;  2Y0C A;  2WWW A;  3FXD A;  1DD4 A;  1RF0 A;  3GW6 A;  4N6J A;  1GK6 A;  1Z56 A;  5KLV D;  1L0N G;  1OFC X;  3L70 E;  1J2J B;  2IZ1 A;  3PP5 A;  3F5H A;  4IL6 H;  1NU1 D;  4WWI A;  1PZQ A;  2N1T C;  1FDM A;  3V6I A;  1FZA A;  1SQX J;  2B87 A;  2W6J H;  1PGP A;  1LTT C;  1QX8 A;  3AE2 C;  5KLI B;  4PV1 D;  5DJU B;  1VQO P;  3PTZ A;  3GLM A;  3CWB J;  1OXZ A;  1SQB E;  3H1H G;  3RL0 B;  1T6A A;  1FS0 E;  2D2C D;  3AE7 C;  2I1J A;  3QWO C;  1CW5 A;  1KN7 A;  3HE5 A;  2E76 C;  1J1E C;  3V4W A;  1DH3 A;  1P84 I;  3CL3 D;  2FYU J;  3L73 G;  3O8Z A;  3KPE A;  3AE8 C;  2OYH A;  2BCC G;  2A06 G;  3A0B E;  3B71 A;  4GOE A;  5AW4 B;  4ZKU A;  3AE4 C;  5AW0 B;  5BU8 B;  5CCH A;  1BGY E;  1FJK A;  2KS1 B;  3H1I G;  3RK2 B;  3TF5 A;  2FYU E;  3RK3 C;  1JCC A;  1VQ9 P;  2E74 D;  5KJ7 C;  1KQG B;  2VRS A;  1NTZ J;  1M90 Q;  4EI2 A;  1N7S C;  1IK7 A;  5TIS H;  1VPC A;  3I5C A;  5APX A;  2HLO A;  2ZT9 B;  1L0N E;  3HUS B;  2QJP C;  2C0X A;  2HYN A;  3WUU A;  1VDF A;  5CBO A;  2FFD A;  1KYO I;  2XZR A;  4U3F E;  3HD7 A;  2PRR A;  3H1I E;  2KZI A;  2O01 J;  4IL6 E;  2N9B A;  2LXC B;  2KOG A;  1RY3 A;  2IZ0 A;  2YMK A;  1N73 B;  1G1J A;  4PJ0 E;  1PP9 E;  3H1J J;  1U7M A;  1OVV A;  5CHX A;  2BCC D;  3JCU H;  3PLN A;  4ZNC A;  1YTZ I;  2GUS A;  2WT7 A;  3M9H A;  2SPZ A;  3WU2 H;  2WTY A;  4L74 A;  3H32 A;  1FAV A;  1IFJ A;  3M91 A;  4Y28 J;  4D6T D;  2FXM A;  2D2C B;  2AXC A;  3A0B H;  3L73 E;  4LGD E;  1M1J C;  1NYH A;  3AED C;  3CLQ A;  3FWL A;  3GF3 A;  4H0L B;  1SQV D;  1BGY D;  3H1K E;  1M1J A;  4BRY A;  1QL1 A;  1IFN A;  5CCG C;  5APT A;  4WY4 A;  1S5L H;  3OA7 A;  1PL5 A;  3VMY A;  1SQV K;  4XE5 B;  2E75 C;  3H25 A;  4ASV A;  5K5G B;  4PD4 I;  3D71 A;  3HD7 C;  3RK2 D;  1Q7Y Q;  1CSB A;  2E5Y A;  2IYP A;  1NOH A;  1VQL P;  1SQB K;  2E74 B;  1RQU A;  1G2C B;  3KDP B;  1AVY A;  3R4Y A;  2Y0D A;  2ZYA A;  1LGH B;  4MN4 C;  1JO5 A;  2YO3 A;  5AVY B;  3UIA A;  2BAS A;  3IF4 A;  1OVR A;  3IN6 A;  2ZVO B;  4Y99 C;  2PP6 A;  4ZMD A;  2FBW C;  5BU5 A;  3TGU E;  4M3L A;  4AQR D;  1RF1 B;  4N78 E;  1LWU A;  1NU1 E;  2XKM A;  2J58 A;  2W83 C;  3CCL P;  5AVU B;  4DZO A;  3D6Y A;  1MUU A;  2H89 C;  1S3J A;  2QIW A;  5KAI E;  1KB9 H;  1EXJ A;  1NJI Q;  2OTL P;  2Z5H A;  3K5B A;  4JYC A;  2KSJ A;  1JY3 O;  3EFG A;  3M0D C;  4Y99 B;  3S9O A;  4HKZ H;  3VYI A;  1TU3 F;  5H2F E;  2KZJ A;  2KP8 A;  3N4X A;  1SQX D;  2ZXX A;  4JYB A;  2Y9Z A;  3CC2 P;  5CBN A;  1OW8 A;  1JY2 P;  1SQV G;  4H0L D;  1FBM A;  1L0L K;  1BE3 D;  1PFI A;  4QMA A;  2NPS D;  2WSE J;  4HB1 A;  2O3J A;  2W8Z A;  3P8C D;  4H13 C;  2Q7C A;  1GU5 A;  1GL2 B;  2IFN A;  2I8D A;  2R44 A;  3BAS A;  4R4L A;  5AVQ B;  1J1D B;  4UB6 H;  1GL2 A;  1AV1 A;  2Q6Q A;  1OMI A;  1S2E A;  1G1I A;  3V2N A;  1NWQ A;  3QH9 A;  1GW3 A;  1T8Z A;  3EQ2 A;  4JQ0 D;  4H44 C;  1FOS F;  1HF9 A;  3KYQ A;  1Q90 D;  1SQV J;  2N9Y B;  1OVU A;  1FZE A;  1GD2 E;  2JEE A;  3C1L A;  2WZ7 A;  3PHL A;  1LJ2 A;  1S5L E;  3KHU A;  3D70 A;  1BSN A;  1H0T B;  4H13 D;  3CCU P;  2YMY A;  3CXH D;  1N7L A;  1SQP J;  2QJK C;  3CCM P;  5AVZ B;  5B5E H;  2XDJ A;  1IK9 A;  1RE3 A;  3RL0 g;  2JWA A;  5EFW B;  1EDJ A;  1GW4 A;  1LWU B;  1Y47 A;  3MTU E;  3H1L D;  2A06 E;  2KB7 P;  2WSE H;  4W7Z A;  1L2P A;  1URQ C;  3H32 B;  3L75 D;  3KQG A;  4JF7 A;  3RBZ A;  3VMA A;  4OGQ C;  2RKL A;  3I56 P;  1YIT P;  2A06 D;  1HTL C;  2KLU A;  2L5G B;  1SFC C;  2YO2 A;  5KLV K;  4W80 A;  1VQ4 P;  3FGA D;  1NU1 K;  1FE6 A;  3IFM A;  2M3B A;  4WB4 A;  2M5A B;  4IFD K;  3TYY A;  1NTK K;  1YYC A;  1URQ D;  1KQS O;  3KZI H;  2HOD A;  3RK3 D;  4BXL A;  3AEF C;  3MIW A;  2J5U A;  2WVR A;  1AJY A;  1NO4 A;  1PGJ A;  4OGQ B;  1FZG A;  1KIL C;  5APV A;  1RF1 C;  3L71 D;  3A0H H;  4WVZ A;  2V4H A;  1FDI A;  3CCQ P;  2AXT H;  3GMA A;  1K9M Q;  2E43 A;  1S72 P;  3L74 D;  5KLI C;  1OX3 A;  2KNC A;  3L35 A;  3H6P A;  3CMA P;  2YKP A;  3C8V A;  3IAO A;  4UB6 E;  1YJN P;  1X9V A;  3MGN A;  5E79 H;  1PPJ G;  1GZL A;  2IBZ E;  2Y9Y A;  3HTK B;  1S1C X;  1K05 A;  1NAF A;  3AE9 C;  1FC2 C;  2FXP A;  2E76 B;  1RE4 C;  5AVS B;  1Q81 Q;  1H0T A;  1VQ7 P;  1GK4 A;  1W2E A;  2CPB A;  1ZXG A;  3H1J D;  3CCS P;  1NGM B;  1N86 A;  2FFD B;  2WMM A;  3V2R A;  1KTM A;  1BCC E;  2QM8 A;  4PV1 B;  3GHG A;  2K88 A;  1HVV A;  5H2F H;  1Q86 Q;  2YIU B;  1KMI Z;  1SQP D;  3CX5 E;  3H1L J;  1HGZ A;  3SFD C;  4IOI H;  2W90 A;  2ZT9 C;  3AE5 C;  5CCG A;  4KHX A;  3AEA C;  1NTM K;  1USE A;  4RO0 A;  5KLV J;  2B88 A;  1RHZ B;  4EIJ A;  4O9B A;  1KQL A;  3O6Q B;  1SQP G;  5AVR B;  1DIP A;  2YIU C;  1NAY A;  3LID A;  4OGQ D;  2GA1 A;  3HE5 B;  5KAF E;  1L4A D;  1ZV8 A;  3A0H E;  4D6T E;  1NTK G;  3AE1 C;  4R4M A;  4ASW A;  4TLF A;  1K73 Q;  2RN0 A;  3H1J G;  3NMD A;  4U7J A;  5TIS E;  2IBZ G;  2YXR B;  2RMZ A;  3CCV P;  4U3F G;  3P32 A;  1RE3 C;  1WT6 A;  1N8R Q;  1D7M A;  2Y0E A;  1LP1 B;  1VQP P;  1JY2 O;  1PPJ D;  4DCK A;  1SQV E;  2E76 D;  3H1H J;  3HD7 D;  3RK2 C;  3RK3 E;  4EDF A;  4OVN F;  3AEG C;  1ZR4 A;  1Y9B A;  1AFO A;  3F89 A;  3T97 B;  3Q2Y A;  1JY2 N;  2ITA A;  3L71 G;  5B66 H;  1RE4 A;  3AE3 C;  3L75 J;  3Q5R A;  3WU2 E;  1JEK A;  1GMJ A;  1KFM A;  2E75 B;  3G71 P;  3M0D A;  1ZR2 A;  1SQQ G;  2NPS A;  2K9Y A;  3JCU E;  2G8Y A;  3WUT A;  3TGU D;  2FYN C;  3V2P A;  2JKV A;  2CK3 H;  3B8E B;  1NU1 J;  3MUD A;  4GOF A;  2YKQ A;  4PD4 E;  3EWK A;  4Z1M H;  5KJ7 A;  4YXW H;  4WY4 B;  1KQF B;  1ZP0 C;  2POH A;  2FYZ A;  1VQK P;  1KYO D;  2IFM A;  1HJ0 A;  4HJG H;  1L0N K;  1VF5 B;  2OYO A;  2OAR A;  3M0A A;  1L4A B;  3BAT A;  3CWB E;  1LTB C;  3ITK A;  4L73 A;  2FYN B;  3L71 J;  4N78 D;  1L0L G;  1OWA A;  2FYU D;  3H1L G;  3LW5 J;  3S1K A;  2QEX P;  3CC4 P;  2HPC A;  3L37 A;  2OGU A;  2OQQ A;  2FKW B;  1EZV D;  2Q3I A;  2Z4E A;  2KXP B;  2IYO A;  1CZQ A;  1NH4 A;  4I7Z B;  3L74 E;  5GTH H;  1LTJ C;  3GG2 A;  5AW9 B;  3HD7 B;  1KYO E;  1X0T A;  1BE3 J;  1A02 F;  2JP3 A;  3HE4 A;  1NTM G;  1KIL B;  2KI7 B;  1L4A C;  3LW5 H;  3HUS A;  2CPS A;  1LP1 A;  2KUB A;  4I1L A;  1CI6 B;  1P84 E;  3VP8 A;  4PD4 D;  1M56 D;  1NTK J;  2OTK E;  3H1K J;  4NPD A;  1OZH A;  4BWN A;  1GU4 A;  1RH5 B;  2KLV A;  2WQY C;  2AEF A;  2B89 A;  3RBX A;  2Q3E A;  1EZV I;  1LTJ B;  2P7J A;  2P10 A;  3H1I J;  1T2K C;  2JDI H;  2YNY A;  1HH0 A;  1JNM A;  1MKM A;  5KTB A;  4LLH A;  2XND H;  1AQT A;  2NPS B;  1EDL A;  2R3S A;  5GTI E;  4NPF X;  2XU6 A;  2RH0 A;  1NTM J;  3O6Q A;  1MFT A;  5GTH E;  1HWT C;  5AW2 B;  4HYT B;  3ZDM A;  2OYH B;  1PP9 J;  4C46 A;  3OW2 O;  1VF5 D;  3H1K G;  1VQ6 P;  4RKU J;  3SFE C;  1SQX G;  3L74 J;  1P84 D;  1X8Y A;  3PRJ A;  1Q82 Q;  5B5E E;  1M8O B;  2M3E A;  2O01 H;  2M0B A;  3R2P A;  4N3Y B;  1JY3 P;  1MZ9 A;  1SQP E;  1YJW P;  1L0N J;  3CME P;  3U1A A;  1LT9 C;  1NVO A;  2P67 A;  1NTZ K;  3HRN A;  1NTK E;  2M8R A;  1HUC A;  1S9K E;  3CPW O;  1BCC J;  2HFE D;  1FZC A;  1GL2 C;  2R5B A;  2WSS H;  5KAI H;  3H1J E;  2QA4 P;  1SQQ K;  2OYH C;  5AW3 B;  2KS1 A;  2NZ2 A;  1WRG A;  4OH8 B;  1KYO H;  3NXS A;  1SLQ A;  4ZKP A;  1GDT A;  3CC7 P;  1KIL D;  2V7Q H;  3II6 A;  3TDK A;  3B5N D;  3L70 D;  5L8R J;  3PH0 A;  2G3A A;  2O01 N;  2KNC B;  1OW6 A;  3AEC C;  1LT9 A;  1N7S B;  5KKZ B;  3L72 E;  1VQN P;  1SVF A;  1FDO A;  1HGV A;  2WSC H;  3C9I A;  1M1K Q;  3MP7 B;  1BCC D;  3U1C A;  3FWN A;  2Q1K A;  1FZC B;  1EDK A;  1PIX A;  2P58 A;  1ZME C;  1XTC C;  1BGY G;  1LT1 A;  4C7R A;  1CI6 A;  3RK3 B;  1SQX E;  2Z5I A;  3WMM 0;  1URQ A;  1BCC G;  1IFM A;  1KIL A;  1NKZ B;  2DW3 A;  5KKZ C;  1RF1 A;  1ZW0 A;  1DEB A;  1BDC A;  1EDI A;  1Y8A A;  2A45 I;  2O1J A;  1E5W A;  2R32 A;  3ABV C;  3L72 G;  2K9J A;  2ZAE B;  2O1K A;  3P8C E;  4UB8 E;  3VP9 A;  4C7N A;  1JMM A;  1ZRT D;  3Q1M A;  1SQB J;  4I2L C;  3OJA B;  5AVV B;  2IDB A;  1R8E A;  1KC8 Q;  2HPC B;  3AEE C;  3G4S P;  1N73 C;  3RL0 C;  1RQV A;  2H43 A;  5TJH A;  1L4A A;  1VF5 C;  1SFC A;  2AEJ A;  1UIX A;  3MHV A;  3TK1 A;  1KFN A;  1AA0 A;  1J1D C;  2WIT A;  3A5T A;  2IPP A;  4WBA A;  3VMZ A;  1EXI A;  3VTP C;  3Q5S A;  4KJM A;  1NTZ E;  4TT3 H;  2BEZ F;  2M5A A;  3B4S A;  3E7K A;  3EFF K;  2KIK A;  3H1K D;  5CJ0 A;  5M1B A;  3GHG C;  1YTZ T;  1AVO A;  2PAJ A;  2WPV B;  3M9B A;  2OYI C;  2PGD A;  1NHL A;  3LIE A;  4YPC A;  2QRX A;  1L0L J;  3A2A A;  3L73 D;  2W27 A;  2QJP B;  3CX5 D;  2KYV A;  3T97 A;  1XTG B;  2FY8 A;  4D6T G;  4YTP C;  2JR8 A;  1JTH B;  2Q9I A;  1K04 A;  3GF7 A;  2JWD A;  1EC5 A;  1IFI A;  3CI9 A;  3N7N A;  4GKG A;  1JMB A;  3CD6 P;  4RJT A;  1IFD A;  1SFC D;  1LWU C;  1OIP A;  3Q3D A;  1T3U A;  1KB9 D;  1A02 J;  2LR2 A;  1H88 A;  3A7O A;  1NU1 G;  3NTN A;  5AVW B;  2I1K A;  1KD1 Q;  3VN0 A;  3I55 P;  1L0N D;  2IX7 C;  5KLV G;  1VQ5 P;  3KXD A;  1SQQ J;  3SWY A;  1JM0 A;  4RES B;  1YIJ P;  1KV4 A;  1FZC C;  2H8P D;  3L75 E;  1PPJ E;  3L72 J;  5APS A;  1KOR A;  1L0L E;  5B66 E;  2BEQ D;  1DD3 A;  3B5N A;  3H1I D;  2N1T A;  4UB8 H;  1VQ8 P;  1M57 D;  1T3J A;  1YQ3 C;  1KB9 I;  2E75 D;  3MUD C;  4WY4 C;  1DX7 A;  4K35 A;  2P2U A;  5CCG D;  5CMZ A;  3BVH A;  3G6E P;  3TNU A;  2P1J A;  1Q2N A;  4H44 D;  4K3A A;  4DJG A;  1PGQ A;  3L72 D;  2OTJ P;  5APU A;  4WY4 D;  1BDD A;  3G9R A;  3V4Q A;  1FOS E;  2QG4 A;  3H1H D;  3A3Y B;  3W67 A;  1LNQ A;  3IR9 A;  3RL0 D;  3CCE P;  1LTG C;  1KIL E;  1R5L A;  1ZOY C;  2JJL A;  2QM7 A;  4BRY B;  1VQM P;  3H1L E;  1N2D C;  1JB0 J;  1YQ4 C;  2IBZ I;  1JCD A;  2R3C A;  2A45 H;  1ZLL A;  3HTK A;  2B9B A;  4PD4 H;  1SFC B;  5APW A;  5CCH D;  4AUW A;  3HUS C;  3SSU A;  1W2B O;  5KLV E;  2WSF H;  3CXH E;  3FXE A;  2ZXE B;  1BE3 E;  5GTI H;  2W6A A;  3L70 G;  5AW7 B;  5AW6 B;  1IJD B;  1AQ5 A;  3E1R A;  4C7N B;  3CXH I;  4GDO A;  3V5B A;  4D6T J;  1PV3 A;  5APQ A;  1FZF A;  4U3F D;  3GHG B;  1N73 A;  1BGY J;  2WPR A;  2IBZ D;  2XNX A;  3WUV A;  2OYI B;  4I6M C;  1J1E B;  3BCC G;  1SQP K;  3CCJ P;  4L76 A; 
#chains in the Genus database with same CATH homology
 5CCH C;  1HJB A;  2WPS A;  4HH2 A;  5AW5 B;  1JUN A;  3TSI A;  2C9L Y;  1MV8 A;  2XV5 A;  1LT9 B;  1N7S A;  2ZFC A;  2WPQ A;  5AW1 B;  2WT7 B;  3E1I A;  4W7Y A;  4DOJ A;  3P8M C;  3SWF A;  2N1T D;  2HOD B;  4AYC A;  2OYI A;  1RF0 C;  1KZU B;  3P7K A;  1FJP A;  2HG5 D;  2MJZ A;  2GUV A;  4XA4 A;  3U59 A;  3V2Q A;  1NKN A;  1ZN5 A;  3BRT B;  1S9K D;  3L36 A;  1T2K D;  3B5N B;  1N7S D;  5KJ7 D;  3VOP A;  2J59 M;  5CJ4 A;  3OAK A;  1LTI C;  1LTJ A;  4IFF A;  4EOT A;  2YKO A;  1H89 A;  1FU1 A;  3TNU B;  1QL2 A;  3B5N C;  1IC2 A;  3MD0 A;  4LC1 A;  4B86 A;  3HE4 B;  4GT1 A;  1JTH A;  2N1T B;  1FZB A;  1GL2 D;  2FFD C;  3L4F A;  1G2C A;  1GTW A;  3M9Q A;  3NFQ A;  5AVX B;  3VMX A;  2Q5U A;  2NPS C;  1IO4 A;  1M1J B;  1SQX K;  1H8A A;  2H7H A;  1MFZ A;  1SP4 A;  2A45 G;  2FYU K;  2C9N Y;  3M06 A;  4IFM A;  5APY A;  1LTS C;  1URQ B;  1JOC A;  2LKM A;  1JY3 N;  3G3Z A;  5AW8 B;  2C0W A;  2E42 A;  5BVZ A;  4GIF A;  3BRV B;  1X79 B;  2R5D A;  1EQ7 A;  1LTA C;  5AVT B;  1M7L A;  2W6B A;  1HBW A;  2WWW A;  1RF0 A;  4N6J A;  1GK6 A;  1Z56 A;  1J2J B;  3PP5 A;  2N1T C;  1FDM A;  1FZA A;  1LTT C;  1OXZ A;  3RL0 B;  1CW5 A;  2I1J A;  3HE5 A;  1J1E C;  3V4W A;  1DH3 A;  3CL3 D;  3O8Z A;  3KPE A;  2OYH A;  5AW4 B;  5BU8 B;  4ZKU A;  5CCH A;  5AW0 B;  1FJK A;  3RK2 B;  3RK3 C;  1JCC A;  5KJ7 C;  2VRS A;  1N7S C;  1VPC A;  3I5C A;  5APX A;  2HLO A;  3HUS B;  2C0X A;  2HYN A;  1VDF A;  2FFD A;  2XZR A;  3HD7 A;  2N9B A;  1N73 B;  2KOG A;  1RY3 A;  1G1J A;  5CHX A;  2WT7 A;  1YTZ I;  2GUS A;  2WTY A;  3M9H A;  3H32 A;  1FAV A;  1IFJ A;  3M91 A;  2FXM A;  4LGD E;  1M1J C;  3CLQ A;  1M1J A;  1QL1 A;  1IFN A;  5CCG C;  5APT A;  4WY4 A;  3OA7 A;  3VMY A;  1SQV K;  4XE5 B;  3HD7 C;  3RK2 D;  1CSB A;  1NOH A;  1SQB K;  3KDP B;  1G2C B;  1JO5 A;  1LGH B;  2YO3 A;  5AVY B;  3UIA A;  2BAS A;  4Y99 C;  2PP6 A;  5BU5 A;  4M3L A;  4AQR D;  4N78 E;  1LWU A;  2XKM A;  2J58 A;  5AVU B;  4DZO A;  1MUU A;  2Z5H A;  4JYC A;  2KSJ A;  1JY3 O;  3EFG A;  3M0D C;  4Y99 B;  2KP8 A;  3N4X A;  4JYB A;  1JY2 P;  1FBM A;  1L0L K;  1PFI A;  2NPS D;  2Q7C A;  3P8C D;  1GU5 A;  1GL2 B;  2IFN A;  5AVQ B;  3BAS A;  1J1D B;  3V2N A;  1GL2 A;  1NWQ A;  1G1I A;  1GW3 A;  1T8Z A;  3EQ2 A;  1FOS F;  3KYQ A;  1FZE A;  1GD2 E;  2JEE A;  2WZ7 A;  2YMY A;  1N7L A;  5AVZ B;  2XDJ A;  1IK9 A;  1RE3 A;  1GW4 A;  1LWU B;  3MTU E;  2KB7 P;  2WSE H;  4W7Z A;  1URQ C;  3H32 B;  3KQG A;  4JF7 A;  1HTL C;  2L5G B;  2YO2 A;  1SFC C;  5KLV K;  4W80 A;  1NU1 K;  3IFM A;  4WB4 A;  2M3B A;  4IFD K;  3TYY A;  1NTK K;  1YYC A;  1URQ D;  2HOD A;  3RK3 D;  3MIW A;  1NO4 A;  1FZG A;  1KIL C;  5APV A;  1RF1 C;  2E43 A;  3L35 A;  3H6P A;  2YKP A;  1X9V A;  3MGN A;  1GZL A;  3HTK B;  1NAF A;  5AVS B;  1RE4 C;  1GK4 A;  1W2E A;  2CPB A;  2FFD B;  1N86 A;  3V2R A;  2QM8 A;  3GHG A;  1HVV A;  1HGZ A;  5CCG A;  4KHX A;  1NTM K;  4EIJ A;  4O9B A;  1KQL A;  5AVR B;  3LID A;  3HE5 B;  1L4A D;  1ZV8 A;  3NMD A;  3P32 A;  1RE3 C;  1WT6 A;  1JY2 O;  1ZR4 A;  3HD7 D;  3RK2 C;  1AFO A;  1JY2 N;  1RE4 A;  1ZR2 A;  1KFM A;  2GM4 A;  3M0D A;  2NPS A;  3V2P A;  3B8E B;  3MUD A;  2YKQ A;  5KJ7 A;  4WY4 B;  2POH A;  2FYZ A;  2IFM A;  1L0N K;  2OAR A;  3M0A A;  1L4A B;  3BAT A;  1LTB C;  4N78 D;  1OWA A;  2HPC A;  3L37 A;  2FKW B;  2Q3I A;  2Z4E A;  1CZQ A;  1NH4 A;  1LTJ C;  5AW9 B;  3HD7 B;  1A02 F;  3HE4 A;  1KIL B;  1RF1 B;  3LW5 H;  1L4A C;  3HUS A;  2CPS A;  4I1L A;  1CI6 B;  3VP8 A;  1GU4 A;  2KLV A;  2P7J A;  1LTJ B;  1T2K C;  1JNM A;  2YNY A;  1HH0 A;  5KTB A;  4LLH A;  2NPS B;  2XU6 A;  1HWT C;  5AW2 B;  4HYT B;  2OYH B;  4C46 A;  1X8Y A;  2O01 H;  4N3Y B;  3R2P A;  1JY3 P;  1MZ9 A;  3U1A A;  3HRN A;  2P67 A;  1LT9 C;  1NTZ K;  1FZC A;  2M8R A;  1HUC A;  1S9K E;  2HFE D;  1GL2 C;  2R5B A;  2OYH C;  1SQQ K;  5AW3 B;  1WRG A;  4OH8 B;  3NXS A;  4ZKP A;  1SLQ A;  1GDT A;  1KIL D;  3II6 A;  3B5N D;  1LT9 A;  1N7S B;  1SVF A;  1HGV A;  2WSC H;  3C9I A;  3U1C A;  1FZC B;  1XTC C;  4C7R A;  1CI6 A;  3RK3 B;  2Z5I A;  3WMM 0;  1URQ A;  1KIL A;  1IFM A;  1RF1 A;  1NKZ B;  1DEB A;  2A45 I;  2O1J A;  1E5W A;  2R32 A;  3VP9 A;  2O1K A;  3P8C E;  4C7N A;  1JMM A;  4I2L C;  3OJA B;  5AVV B;  2HPC B;  1N73 C;  3RL0 C;  2H43 A;  1L4A A;  1SFC A;  3TK1 A;  1KFN A;  1J1D C;  2WIT A;  3A5T A;  2IPP A;  4WBA A;  3VMZ A;  3VTP C;  5CJ0 A;  3GHG C;  1YTZ T;  2PAJ A;  3M9B A;  2OYI C;  1NHL A;  3LIE A;  3A2A A;  2W27 A;  2KYV A;  3T97 A;  1XTG B;  1JTH B;  2Q9I A;  1IFI A;  3CI9 A;  3N7N A;  4GKG A;  1IFD A;  1SFC D;  1LWU C;  1A02 J;  1T3U A;  1H88 A;  3A7O A;  3NTN A;  5AVW B;  2I1K A;  3VN0 A;  2IX7 C;  3SWY A;  4RES B;  1FZC C;  2H8P D;  5APS A;  3B5N A;  2N1T A;  1T3J A;  4WY4 C;  1DX7 A;  2P2U A;  5CCG D;  5CMZ A;  3BVH A;  3TNU A;  2P1J A;  5APU A;  4WY4 D;  3V4Q A;  1FOS E;  3A3Y B;  3IR9 A;  3RL0 D;  1LTG C;  2QM7 A;  2JJL A;  1N2D C;  3VYI A;  3HTK A;  1JCD A;  2R3C A;  2A45 H;  1ZLL A;  5APW A;  5CCH D;  1SFC B;  4AUW A;  3HUS C;  2WSF H;  2ZXE B;  2W6A A;  5AW7 B;  5AW6 B;  1IJD B;  1AQ5 A;  4C7N B;  3V5B A;  5APQ A;  1FZF A;  1N73 A;  3GHG B;  2XNX A;  2WPR A;  2OYI B;  4I6M C;  1J1E B;  1SQP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...