3WMM0

Crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
40
structure length
40
Chain Sequence
TGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosynthetic reaction center C subunit
publication title Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
pubmed doi rcsb
molecule tags Photosynthesis
total genus 16
structure length 40
sequence length 40
chains with identical sequence 2, 4, 6, 8, B, E, G, J, N, P, R, T, V, X, Z
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00556 LHC Antenna complex alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3wmm000
1NKZB 1WRGA 1DX7A 1JO5A 1JMMA 1LGHB 1KZUB 1IJDB 2FKWB 3WMM0
chains in the Genus database with same CATH superfamily
3ABVC 1X79B 3VMZA 4TLFA 2Q7CA 1X0TA 1T2KC 3FWLA 4LLHA 2QG4A 3L35A 1AA0A 2YKQA 2RMZA 3C9IA 1LTTC 2P2UA 2OYHC 2QJKC 2FYUJ 1EXIA 1IFNA 1NO4A 2E76D 1SQXD 1L4AB 1NU1J 3VTPC 3MUDA 1VQLP 3AECC 3IFMA 2W90A 3L72E 2I1KA 2WPRA 1EDLA 4Y99C 2YO3A 1LTIC 2Q3EA 3A0HE 2Q9IA 1L0LK 5APQA 4IL6E 3RGUA 1ZP0C 1M1KQ 1NYHA 1N7SD 2IBZD 1YBKA 2OYHB 1NKZB 2QJKB 3H1HE 1N8RQ 1URQA 3TF5A 1VQNP 2KLUA 2HR3A 2FYNC 3H1LG 2Y0CA 3CX5E 4Y99B 2UWJE 1SQVG 1QLED 2WVRA 4PD4E 1FZCC 1LTJA 2KZIA 5CCGC 1M1JA 3H1HD 1ZOYC 3FX0A 3CWBJ 1LTAC 4R4MA 1BE3G 1U57A 3A2AA 3L72J 2FYNB 1FAVA 1QEXA 3CX5D 3CXHE 2Y9YA 1X9VA 2E42A 1M8OB 3L71D 2KSEA 1NWQA 3B5NC 4CPGA 4IL6H 1FZCB 2E76C 1U7MA 3CD6P 1KQFB 4JPZB 3GG2A 5KTBA 4PV1D 1NH4A 2FYUG 1QVGO 1Q90D 1NU1G 2OTJP 1P84H 2R5BA 1GK4A 1AV1A 2YKPA 4PD4H 2FYZA 3PTZA 1N7SC 3TNUA 5B5EE 2E76B 2P1JA 5AW5B 2LXCB 1NTZG 2HPCB 3GF7A 3R4YA 1VQ5P 1AVYA 3CI9A 3NXSA 1ZMEC 1M1JB 1H0TB 5KAFE 1L0NE 4EOTA 2Z5HA 3CXHH 1MFZA 2ITAA 3AEAC 3BRTB 2J5UA 2H43A 1N7SB 4HH2A 1YTZI 3L70E 2JWDA 3CCRP 4H44C 5KLIC 3T97B 1BSNA 2R32A 5CMZA 3D6ZA 1T3JA 2YIUC 4Y28J 3TGUE 1E5WA 2OTKE 2IZ0A 1BGYJ 2BCCJ 2ZYAA 3L72G 5BU8B 3HUSC 4JBZA 5KJ7D 1PP9D 2K1AA 5B5EH 2ZT9B 5KLIB 1WT6A 3SFEC 2K88A 1Q82Q 1N86A 3TGUD 2KI7B 1AJYA 2YIUB 1SS1A 3H1HG 2PAJA 2Z4EA 3JCUE 3E1RA 4UB8E 2O1KA 2SPZA 3CCEP 1HWTC 1L0NJ 3RK3E 2G8YA 2P10A 1KYOH 1OVVA 2XKMA 2QEXP 1SVFA 1SQXK 2K3RA 2AEMA 2DW3A 2A06D 1YTZT 1QVFO 2D2CD 3L70J 2KOGA 2WTYA 3I55P 1LT9A 3MZWB 4L76A 1SQPJ 3USSA 3CC4P 1QL1A 4PV1B 1L2PA 3LW5H 5BU5A 1N7LA 4ZNCA 4K3AA 1QX8A 3RK3D 1SFCC 1KILA 4WVZA 1VQPP 1OX3A 4U3FE 1IK7A 1JO5A 4WY4D 4JF7A 1IZNB 3KDPB 1PV3A 1J1EB 4HJGH 1NVOA 2WSSH 2ZFCA 1N73C 2WZ7A 2M3BA 3PRJA 5GTIH 4GODA 3JCUH 1S5LE 3AEFC 2HYNA 1LTBC 1S3JA 2YKOA 1S2EA 1JTHA 1GMJA 5APUA 5KJ7C 4RESB 1NGMB 3BVHA 3AE5C 5AW3B 1ZRTE 3AE8C 3HRNA 2JWAA 1NTMJ 1LTGC 1K9MQ 1ZR4A 4JYCA 1RQVA 3U1CA 4U3FJ 1SQQK 2D2CC 1L0NG 3QWOC 1KFMA 1N2DC 1OVUA 1KQLA 3PLNA 3VMXA 1ZRTD 3L70G 4A7PA 4C7NA 3AE7C 3M06A 1S9KD 3TGUG 1RF0A 2M5AA 3AE6C 2D2CB 1IFPA 3E7KA 1Q7YQ 1FZAA 1FDIA 2LKMA 4OGQD 3D70A 1FDOA 5KAIE 1YJNP 1FDMA 3GHGC 4DJGA 2P67A 4YTPC 2HG5D 1JTHB 3H32A 3H1KJ 3II6A 2FFDA 3RK3B 2B9BA 4EYYQ 1OMIA 4O9BA 3IAOA 4W7YA 2QJYC 4WY4B 2FXOA 4ASWA 4UB6E 3CL3D 1FC2C 1KC8Q 1IFDA 2IFMA 1P84I 3RBXA 1S1CX 1PPJE 1GL2C 3L75E 4PD4I 2N1TD 1EDKA 3MHVA 4JYBA 4EDFA 5CCHD 2E5YA 1RE4A 3Q5SA 2GUVA 2QJYB 1GU4A 2FBWC 1NAFA 2IPPA 2OTLP 1DH3A 1FZBA 3OA7A 4U3FG 3CXHI 3ITKA 3L75D 1RE3C 4D6TJ 2IYOA 3L36A 1PGOA 2AXTE 2N1TA 2K37A 3H1LD 1SQVD 4UB6H 3V6IA 3FGAD 2KB7P 2JJLA 1KMIZ 3N4XA 3IN6A 3N7NA 3F5HA 3H1KG 5KLVK 4OVNF 4TT3H 1Y9BA 2IFNA 1K73Q 1GK6A 2QSIA 4OGQB 1DEEG 1KYOI 1K04A 1DD3A 1NTKK 2H7HA 1JM0A 1KFNA 5APVA 5CCHC 1S4XA 1Q2NA 3WMM0 1RF1C 1KD1Q 2W8ZA 1M90Q 2HLOA 2FYUD 1M56D 5AVWB 1L4AC 3B4SA 1LP1A 1NU1D 2B88A 4N6JA 1KQGB 3Q2YA 3M9BA 2J59M 3C8VA 1NJIQ 1G2CA 2C9LY 2I1JA 2W6AA 2N1TB 1URQD 4BXLA 3U59A 1RF1B 1NTZD 5APYA 2B87A 3EFGA 2GA1A 1YQ4C 3CWBE 2E74D 3A7OA 2OGUA 2YNYA 3BATA 1M57D 2LR2A 2H8PD 4I2LC 2WT7A 1PPJG 3L75G 3CWBD 1JY2O 4K35A 3H25A 2BASA 1Y8AA 1WMKA 3WUVA 2Y0EA 1ZN5A 3L72D 5CHXA 2QVAA 2OYIA 4PJ0H 1P84E 2H88C 1FE6A 4DCKA 1UIXA 3L73J 1LP1B 3KQGA 3MUDC 3NMDA 3M0DA 4B86A 3R2PA 2ZT9D 2FXMA 2IDBA 1YYCA 1A02F 1EDJA 1P84D 1K05A 3A5TA 3BCCJ 4PD4D 1OXZA 1URQC 5DJTB 1JY2N 5H2FH 3GW6A 1VQ8P 4YXWH 5AVVB 2E74C 4I1LA 3M9QA 2WT7B 3H1JE 1LTJC 3LIDA 2PRRA 1M1JC 3CXHD 2N9YB 2QJPC 1BGYE 2BCCE 3HTKA 1URQB 3M91A 1SQVK 2C0XA 3AE1C 1ZR2A 2NZ2A 5AW6B 1J1DB 2OYIB 5AVZB 2E74B 3VN0A 1VF5D 1HBWA 5C39A 4AYCA 5BVZA 3AE4C 1LTJB 2KS1A 1IFMA 1BGYD 1KYOE 2BCCD 4HYTB 3CCVP 2POHA 2QJPB 3G9RA 4YPCA 3VP9A 3D71A 1OVRA 1SQQJ 2ZT9C 2NPSD 2W6JH 1JY2P 3KHUA 1SQPE 3Q1MA 2IX7C 2WWWA 2MKVA 3QH9A 3H1JJ 1JY3O 3O8ZA 1KILE 3CWBG 1KYOD 1LWUA 1L0ND 2FYUK 4IFFA 3WUUA 1NU1K 1R8EA 1GTWA 2OYOA 1KZUB 3L70D 1HGVA 1RQUA 1JB0J 1NOHA 1WRGA 4PV1C 3L4FA 2Y9ZA 1CSBA 1VQMP 1KILD 3HTKB 5GTIE 3RL0D 1NTZK 2NPSA 1EQ7A 2WSCJ 3TNUB 2XZRA 4WBAA 2WSCH 1VQKP 1RH5B 1VL2A 2NRGA 3Q5RA 2R3SA 5AW1B 1SQBE 3U1AA 3ZDMA 2W83C 1J1EC 1PGQA 4DZOA 4OWFA 3VYIA 2R44A 1VDFA 2V7QJ 1N73A 2V7QH 2ZJSE 1JEKA 1NTME 2H89C 1PP9J 4Z1MH 3A0BH 1BSHA 1LWUB 1VF5B 4IOIH 3I56P 1BCCE 3MD0A 1FOSE 2KK7A 1YJ9P 1LGHB 1NTMD 3NTNA 2WMMA 1LT9C 5DJUB 3H1JG 4I7ZB 4U3FD 2A45H 1J2JB 1FZEA 2I8DA 1Q86Q 1SQBJ 1BGYG 2BCCG 2NPSB 2N9BA 1EZVI 3Q3DA 2Q1KA 3VMYA 3IF4A 1OW8A 3CCQP 3C1LA 1NKNA 1KILC 2BEQD 1ZW0A 3RL0C 4N78E 1JY3P 3W68A 3H1KE 1GDTA 3H1IJ 5EFWB 4BRYA 3VP8A 5CBNA 1LT9B 2WPVB 2ZVOB 3L74J 3V2QA 3B71A 4RJTA 5KLVJ 1KB9H 1EDIA 1BCCJ 2JKVA 4I6MC 3PHLA 3MGNA 1KILB 3A3YB 3GHGA 2G3AA 2Q5UA 4N78D 3RL0B 3H1KD 3KYQA 1JMBA 1QGKB 3RK3C 1SQPG 1NTKJ 2XU6A 4KHXA 5AW7B 1USDA 1L0LE 2QM7A 2ZYGA 4WY4C 4KT0J 4XFJA 1FJPA 2KYVA 2E75D 4HB1A 2IZ1A 2IBZI 3GLMA 4D6TE 2FXPA 3KXDA 4WWIA 1DIPA 3TDKA 4NPDA 1JUNA 4LGDE 2OARA 1L0NK 1VPCA 3NFQA 4D6TD 5APSA 3HD7A 1RF0C 1SQBG 1CZQA 5K5GB 2HFED 2Y0DA 1UIIA 4KJMA 3CCUP 1XTCC 1L0LJ 1PGJA 1S72P 1FBMA 1AQTA 1NTMG 2M0BA 3PJSK 2M3EA 3OW2O 2ZAEB 2FFDC 4C7NB 2XNXA 4DT0A 2RH0A 2PP6A 1PPJD 1K8AQ 1KTMA 2M5AB 2OQQA 1MKMA 2AEJA 1DD4A 4IL6X 1BCCG 1YQ3C 1T3UA 5APXA 3S4RA 1HJ0A 1T2KD 2CK3H 3CMAP 1M7LA 3MIWA 3H32B 2QIWA 4OGQC 2XV5A 2E75C 2FFDB 1VQ7P 4GOEA 1RE4C 3VOPA 2P58A 2XDJA 2KP8A 5APWA 1AVOA 1YI2P 5CJ0A 3TYYA 1CW5A 4AQRD 3CC2P 3OJAB 4IFDK 3HD7B 1XTGB 2QE7H 3HE5A 1L4AA 1FU1A 1GU5A 2E75B 3WU2E 2CPSA 5AW9B 3EWKA 1JNMA 1EZVE 5AVSB 1HUCA 2N1TC 1YHQP 4EIJA 1CI6A 2YXQB 4W80A 2M8RA 3AE3C 2OYHA 1R5LA 5GTHE 1MV8A 1L0LG 2BEZF 2K9YA 1AFOA 1EZVD 3GF3A 4XA4A 4PJ0E 1BE3J 5AVRB 2KXPB 4OH8B 3L73E 1SQXE 4D6TG 3D6YA 1IFJA 1ZLLA 2FKWB 2AEFA 3MP7B 1HTLC 1FZFA 1OZHA 5B66H 2JDIH 3WU2H 5AVXB 3CCMP 2C0WA 2QRXA 1NHLA 3B5ND 2RKLA 3IR9A 2A45I 3BCCE 2IBZE 3L73D 1D7MA 3HE5B 5H2FE 3AEGC 3WUTA 1FZCA 5CBOA 5CCGA 2JR8A 1MUUA 5GTHH 3FWNA 2YO2A 1YJWP 1PIXA 1H8AA 5AVQB 3F89A 2GM4A 1CI6B 3UIAA 1NTZJ 2JP3A 3BCCD 1QL2A 4ZMDA 1KB9I 3GMAA 1SQXJ 4RO0A 4ASVA 3B5NA 3JSVC 1G2CB 1R5SA 4ZKUA 2PGDA 3CPWO 4WB4A 2HPCA 1KN7A 3L71E 2B87B 1X8YA 1T8ZA 4RKUJ 4U7JA 1H0TA 3G6EP 4H44D 2ZXEB 2KNCA 5AW4B 1J1DC 3SWYA 1FS0E 2OYIC 1N7SA 5M1BA 1SQQE 2FY8A 2VRSA 1YITP 3CCLP 3AEBC 3CCJP 3T97A 5TJHA 5AW0B 2R5DA 3A0HH 3EFFK 3M0DC 3H1HJ 4JQ0D 1EZVG 4H0LD 3G71P 2KIKA 3L37A 1SQQD 3E1IA 1VQ9P 2P7JA 3H1JD 3CX5H 2V4HA 2O1JA 3L71J 1PZQA 3M0AA 3V4WA 3P8MC 3B5NB 1DX7A 1S5LX 2B89A 5TISE 1LTSC 3K5BA 4NPEA 1GW3A 3HUSA 3H6PA 3L73G 3G4SP 4HKZH 3RK2D 1SQXG 3P8CE 1SFCD 2KNCB 1OIPA 2ZYDA 3A0BE 1PP9E 5L8RJ 4BWNA 1GW4A 3BCCG 2IBZG 1SQPD 2E5TA 3V4QA 3PP5A 3KPEA 1YIJP 3P8CD 1HVVA 2A06E 1SP4A 2O01N 4L73A 1IJDB 5TISH 3S9OA 4H13D 4H44B 4H0LC 1SFCA 1ZXGA 2WPSA 4W7ZA 2KZJA 3AEDC 1LJ2A 3TSIA 1ZV8A 5AVYB 1LWUC 1VF5C 2KS1B 2WSEJ 1JY3N 2WSEH 4GT1A 4YXDC 5KAFH 3CC7P 2K9JA 3CCSP 1OW7A 3H1IE 3HUSB 1EC5A 2JO1A 1G1JA 4I7ZC 3VMAA 2AXCA 2O3JA 3L71G 4H0LB 1JCDA 2WQYC 3LW5J 1SQBD 2LXBA 2NPSC 3TGUJ 1IK9A 1KB9E 3L74E 5KLVE 5KJ7A 3RK2C 1NAYA 1JMMA 1VQOP 2W27A 1SQQG 3TK1A 3SSUA 3H1ID 1NTKE 4LC1A 2KSJA 1W2EA 4GDOA 1HH0A 1OFCX 3AEEC 1IO4A 1OW6A 1Q81Q 1KB9D 3L74D 5KLVD 3I5CA 1W2BO 1BCCD 3V2PA 1SLQA 2CPBA 4UB8H 3RK2B 2HODA 4DOJA 4EI2A 3BRVB 1SFCB 1NTKD 3S1KA 2Z5IA 4GKGA 5APTA 4H13C 1MZ9A 1GZLA 3SFDC 4WY4A 1BDCA 2K9JB 1PFIA 1U7JA 1N73B 1GL2D 2MJZA 1EXJA 1G1IA 2PFXA 5E79E 1JOCA 2ZVNB 1S9KE 3EQ2A 1HJBA 3MTUE 4H13B 2Q3IA 3KZIE 3HD7D 4AUWA 1VQ6P 3JC22 5CJ4A 1PP9G 2KLVA 4QMAA 5AVUB 3FXDA 1S5LH 2L91A 3RL0g 1T6AA 1GL2A 1L0LD 1FJKA 1PL5A 1KQSO 3O6QA 3CLQA 4M3LA 2HODB 1X22A 1MFTA 2A06G 1H88A 3SWFA 1H89A 3B8EB 2A45G 3V2RA 4BRYB 1RHZB 3P32A 1FZGA 2QM8A 5E79H 1RE3A 2C9NY 2L5GB 3V2NA 4GIFA 3FXEA 1USEA 1SQPK 3BASA 3RBZA 5AVTB 3CX5I 3H1IG 3KZIH 3GHGB 1VQ4P 3P7KA 2YMYA 2Q6QA 5KKZC 1LT1A 2YXRB 2J58A 1E79H 3HE4A 3AE9C 3L74G 1JCCA 5KLVG 2JEEA 4GOFA 1IFIA 3H1LE 1L4AD 1SQVE 2E43A 1FOSF 3HD7C 1NTKG 5KAIH 4L74A 4R4LA 1GL2B 2IYPA 2WSFJ 4NPFX 1Y47A 2WSFH 3O6QB 3SWKA 5KKZB 1BE3E 3W67A 4N3YB 3M9HA 1SQBK 1OWAA 4L75A 2WITA 2O01J 3G3ZA 1PGPA 5CCHA 1RF1A 2O01H 2YMKA 4ZKPA 5AW2B 1Z56A 3L75J 1NTMK 1IC2A 4XE5B 1HGZA 5B66E 3OAKA 1DEBA 2WPQA 1KV4A 1BE3D 3LIEA 2R3CA 2KUBA 2XNDH 4IFMA 3PH0A 2FYUE 3H1LJ 2QA4P 1GD2E 1NU1E 2ZXXA 1SQVJ 1W5CE 4C7RA 4C46A 1LNQA 3HE4B 2W6BA 1KORA 1RY3A 1TU3F 1HF9A 1AQ5A 3CMEP 1BDDA 1A02J 2GUSA 3Q5PA 5AW8B 1NTZE 5CCGD 4MN4C 3V5BA 3AE2C 2RN0A 2AXTH
chains in the Genus database with same CATH topology
3L37A 1X79B 3VMZA 3CL3D 2Q7CA 3E1IA 1LWUB 1T2KC 1IFDA 2IFMA 2P7JA 1GL2C 3MD0A 4LLHA 1FOSE 3L35A 2N1TD 2O1JA 2YKQA 1LGHB 3M0AA 4JYBA 3V4WA 3P8MC 5CCHD 3B5NB 1DX7A 3NTNA 1LT9C 1RE4A 3C9IA 1LTTC 2P2UA 2OYHC 1LTSC 2GUVA 1GU4A 1IFNA 1NO4A 2A45H 1J2JB 1FZEA 1L4AB 1NAFA 2IPPA 3VTPC 3MUDA 1GW3A 2NPSB 2N9BA 3HUSA 3H6PA 1DH3A 1FZBA 3IFMA 3OA7A 3VMYA 2I1KA 2WPRA 1NKNA 4Y99C 1KILC 1RE3C 3RK2D 2YO3A 3RL0C 1LTIC 3P8CE 2Q9IA 1L0LK 1SFCD 5APQA 4N78E 1JY3P 1GDTA 3VP8A 1LT9B 1N7SD 3L36A 2OYHB 1NKZB 2N1TA 1URQA 3V2QA 1GW4A 3V4QA 3PP5A 3KPEA 4I6MC 3MGNA 3P8CD 4Y99B 1KILB 3A3YB 1HVVA 3GHGA 2KB7P 2Q5UA 3RL0B 2JJLA 4N78D 3KYQA 3N4XA 3RK3C 2XU6A 1FZCC 1SP4A 1LTJA 4KHXA 5AW7B 2QM7A 5CCGC 1M1JA 1IJDB 3N7NA 1SFCA 5KLVK 4WY4C 2WPSA 4W7ZA 1LTAC 2IFNA 3TSIA 3A2AA 1ZV8A 1GK6A 1FJPA 5AVYB 2KYVA 1LWUC 1FAVA 1JY3N 2WSEH 1NTKK 1X9VA 4GT1A 2E42A 2H7HA 1KFNA 5APVA 5CCHC 3WMM0 1NWQA 1RF1C 3B5NC 3HUSB 1FZCB 2HLOA 1G1JA 5AVWB 1L4AC 1JCDA 5KTBA 1JUNA 4N6JA 2NPSC 4LGDE 1IK9A 2OARA 1NH4A 5KJ7A 3M9BA 1L0NK 1VPCA 2J59M 1G2CA 2C9LY 3NFQA 3RK2C 1JMMA 5APSA 2I1JA 3HD7A 1RF0C 1CZQA 2W6AA 2N1TB 2W27A 3TK1A 2HFED 2R5BA 1GK4A 1URQD 2YKPA 3U59A 2FYZA 1RF1B 1N7SC 1XTCC 5APYA 4LC1A 2KSJA 3TNUA 3EFGA 1W2EA 1FBMA 1HH0A 1IO4A 2P1JA 5AW5B 3A7OA 2FFDC 4C7NB 2HPCB 2XNXA 3I5CA 2YNYA 3BATA 3CI9A 3V2PA 2PP6A 3NXSA 2H8PD 1SLQA 2CPBA 3RK2B 2HODA 1M1JB 4DOJA 3BRVB 4EOTA 1SFCB 2Z5HA 4I2LC 2WT7A 1MFZA 3BRTB 2H43A 2Z5IA 1T3UA 5APXA 1N7SB 4GKGA 4HH2A 5APTA 1YTZI 1JY2O 2BASA 2R32A 1MZ9A 1T2KD 1GZLA 5CMZA 4WY4A 1M7LA 3MIWA 3H32B 1T3JA 1PFIA 2XV5A 1N73B 1GL2D 2MJZA 2FFDB 1ZN5A 5CHXA 1G1IA 1E5WA 2OYIA 1RE4C 3VOPA 2XDJA 2KP8A 5APWA 1JOCA 1S9KE 5BU8B 3EQ2A 3KQGA 3NMDA 1HJBA 5CJ0A 3HUSC 3TYYA 1CW5A 5KJ7D 3MTUE 3M0DA 4B86A 2Q3IA 3R2PA 4AQRD 3OJAB 2FXMA 1WT6A 4IFDK 3HD7B 1XTGB 3HD7D 4AUWA 1N86A 3HE5A 1L4AA 1YYCA 1FU1A 1A02F 1GU5A 5CJ4A 2Z4EA 2PAJA 2CPSA 2KLVA 5AW9B 1JNMA 5AVUB 2O1KA 5AVSB 1HWTC 1HUCA 3A5TA 2N1TC 2XKMA 1SVFA 1SQXK 1OXZA 1URQC 1GL2A 1YTZT 1FJKA 4EIJA 1JY2N 3CLQA 1CI6A 2KOGA 4W80A 4M3LA 2WTYA 2M8RA 1LT9A 5AVVB 2HODB 4I1LA 2OYHA 1QL1A 1H88A 3M9QA 1MV8A 3SWFA 2WT7B 3LW5H 1H89A 3B8EB 1AFOA 5BU5A 1N7LA 1LTJC 2A45G 4XA4A 3LIDA 3V2RA 1M1JC 5AVRB 3RK3D 3P32A 4OH8B 1FZGA 1SFCC 2QM8A 1KILA 1RE3A 3HTKA 1URQB 3M91A 2C9NY 1SQVK 2C0XA 2L5GB 1JO5A 4WY4D 4GIFA 4JF7A 3V2NA 1SQPK 3BASA 1ZR2A 1IFJA 5AW6B 1J1DB 2OYIB 1ZLLA 3KDPB 5AVTB 5AVZB 1J1EB 2FKWB 3VN0A 1HBWA 3GHGB 4AYCA 5BVZA 2ZFCA 3P7KA 1N73C 1HTLC 2WZ7A 1FZFA 2M3BA 2YMYA 1LTJB 5AVXB 2C0WA 2J58A 1NHLA 3HE4A 1IFMA 3B5ND 4HYTB 2POHA 2HYNA 1JCCA 3IR9A 1LTBC 2A45I 2YKOA 2JEEA 1JTHA 5APUA 3HE5B 5KJ7C 1IFIA 3VP9A 1L4AD 4RESB 1FZCA 2NPSD 2E43A 1FOSF 3BVHA 5CCGA 1JY2P 3HD7C 5AW3B 1MUUA 2IX7C 2YO2A 2WWWA 1GL2B 3HRNA 1H8AA 1JY3O 3O8ZA 5AVQB 2WSFH 1LTGC 1LWUA 2GM4A 1CI6B 2FYUK 3UIAA 1ZR4A 4IFFA 4JYCA 1QL2A 4N3YB 3M9HA 1NU1K 3U1CA 1SQBK 1OWAA 1SQQK 1GTWA 2WITA 3G3ZA 1KZUB 5CCHA 1HGVA 1RF1A 2O01H 3B5NA 1G2CB 1KFMA 4ZKPA 1N2DC 1KQLA 1NOHA 4ZKUA 3VMXA 1WRGA 3L4FA 5AW2B 1CSBA 1Z56A 1NTMK 1IC2A 1KILD 3HTKB 4XE5B 1HGZA 4WB4A 3RL0D 1NTZK 2NPSA 3OAKA 4C7NA 2HPCA 1EQ7A 1DEBA 2WPQA 3TNUB 3M06A 2XZRA 3LIEA 1X8YA 4WBAA 2WSCH 1T8ZA 1S9KD 2R3CA 1RF0A 4IFMA 2ZXEB 1GD2E 5AW1B 1FZAA 5AW4B 1J1DC 3SWYA 2OYIC 1N7SA 2LKMA 3U1AA 4C7RA 4C46A 2VRSA 4DZOA 1J1EC 3HE4B 2W6BA 3T97A 1FDMA 3GHGC 5AW0B 3VYIA 1VDFA 2P67A 2R5DA 1RY3A 2HG5D 1JTHB 3H32A 1N73A 3II6A 2FFDA 1AQ5A 3RK3B 1A02J 3M0DC 2GUSA 4O9BA 5AW8B 4W7YA 5CCGD 3V5BA 4WY4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKZ B;  1WRG A;  1DX7 A;  1JO5 A;  1JMM A;  1LGH B;  1KZU B;  1IJD B;  2FKW B;  3WMM 0; 
#chains in the Genus database with same CATH topology
 3ABV C;  1X79 B;  3VMZ A;  4TLF A;  2Q7C A;  1X0T A;  1T2K C;  3FWL A;  4LLH A;  2QG4 A;  3L35 A;  1AA0 A;  2YKQ A;  2RMZ A;  3C9I A;  1LTT C;  2P2U A;  2OYH C;  2QJK C;  2FYU J;  1EXI A;  1IFN A;  1NO4 A;  2E76 D;  1SQX D;  1L4A B;  1NU1 J;  3VTP C;  3MUD A;  1VQL P;  3AEC C;  3IFM A;  2W90 A;  3L72 E;  2I1K A;  2WPR A;  1EDL A;  4Y99 C;  2YO3 A;  1LTI C;  2Q3E A;  3A0H E;  2Q9I A;  1L0L K;  5APQ A;  4IL6 E;  3RGU A;  1ZP0 C;  1M1K Q;  1NYH A;  1N7S D;  2IBZ D;  1YBK A;  2OYH B;  1NKZ B;  2QJK B;  3H1H E;  1N8R Q;  1URQ A;  3TF5 A;  1VQN P;  2KLU A;  2HR3 A;  2FYN C;  3H1L G;  2Y0C A;  3CX5 E;  4Y99 B;  2UWJ E;  1SQV G;  1QLE D;  2WVR A;  4PD4 E;  1FZC C;  1LTJ A;  2KZI A;  5CCG C;  1M1J A;  3H1H D;  1ZOY C;  3FX0 A;  3CWB J;  1LTA C;  4R4M A;  1BE3 G;  1U57 A;  3A2A A;  3L72 J;  2FYN B;  1FAV A;  1QEX A;  3CX5 D;  3CXH E;  2Y9Y A;  1X9V A;  2E42 A;  1M8O B;  3L71 D;  2KSE A;  1NWQ A;  3B5N C;  4CPG A;  4IL6 H;  1FZC B;  2E76 C;  1U7M A;  3CD6 P;  1KQF B;  4JPZ B;  3GG2 A;  5KTB A;  4PV1 D;  1NH4 A;  2FYU G;  1QVG O;  1Q90 D;  1NU1 G;  2OTJ P;  1P84 H;  2R5B A;  1GK4 A;  1AV1 A;  2YKP A;  4PD4 H;  2FYZ A;  3PTZ A;  1N7S C;  3TNU A;  5B5E E;  2E76 B;  2P1J A;  5AW5 B;  2LXC B;  1NTZ G;  2HPC B;  3GF7 A;  3R4Y A;  1VQ5 P;  1AVY A;  3CI9 A;  3NXS A;  1ZME C;  1M1J B;  1H0T B;  5KAF E;  1L0N E;  4EOT A;  2Z5H A;  3CXH H;  1MFZ A;  2ITA A;  3AEA C;  3BRT B;  2J5U A;  2H43 A;  1N7S B;  4HH2 A;  1YTZ I;  3L70 E;  2JWD A;  3CCR P;  4H44 C;  5KLI C;  3T97 B;  1BSN A;  2R32 A;  5CMZ A;  3D6Z A;  1T3J A;  2YIU C;  4Y28 J;  3TGU E;  1E5W A;  2OTK E;  2IZ0 A;  1BGY J;  2BCC J;  2ZYA A;  3L72 G;  5BU8 B;  3HUS C;  4JBZ A;  5KJ7 D;  1PP9 D;  2K1A A;  5B5E H;  2ZT9 B;  5KLI B;  1WT6 A;  3SFE C;  2K88 A;  1Q82 Q;  1N86 A;  3TGU D;  2KI7 B;  1AJY A;  2YIU B;  1SS1 A;  3H1H G;  2PAJ A;  2Z4E A;  3JCU E;  3E1R A;  4UB8 E;  2O1K A;  2SPZ A;  3CCE P;  1HWT C;  1L0N J;  3RK3 E;  2G8Y A;  2P10 A;  1KYO H;  1OVV A;  2XKM A;  2QEX P;  1SVF A;  1SQX K;  2K3R A;  2AEM A;  2DW3 A;  2A06 D;  1YTZ T;  1QVF O;  2D2C D;  3L70 J;  2KOG A;  2WTY A;  3I55 P;  1LT9 A;  3MZW B;  4L76 A;  1SQP J;  3USS A;  3CC4 P;  1QL1 A;  4PV1 B;  1L2P A;  3LW5 H;  5BU5 A;  1N7L A;  4ZNC A;  4K3A A;  1QX8 A;  3RK3 D;  1SFC C;  1KIL A;  4WVZ A;  1VQP P;  1OX3 A;  4U3F E;  1IK7 A;  1JO5 A;  4WY4 D;  4JF7 A;  1IZN B;  3KDP B;  1PV3 A;  1J1E B;  4HJG H;  1NVO A;  2WSS H;  2ZFC A;  1N73 C;  2WZ7 A;  2M3B A;  3PRJ A;  5GTI H;  4GOD A;  3JCU H;  1S5L E;  3AEF C;  2HYN A;  1LTB C;  1S3J A;  2YKO A;  1S2E A;  1JTH A;  1GMJ A;  5APU A;  5KJ7 C;  4RES B;  1NGM B;  3BVH A;  3AE5 C;  5AW3 B;  1ZRT E;  3AE8 C;  3HRN A;  2JWA A;  1NTM J;  1LTG C;  1K9M Q;  1ZR4 A;  4JYC A;  1RQV A;  3U1C A;  4U3F J;  1SQQ K;  2D2C C;  1L0N G;  3QWO C;  1KFM A;  1N2D C;  1OVU A;  1KQL A;  3PLN A;  3VMX A;  1ZRT D;  3L70 G;  4A7P A;  4C7N A;  3AE7 C;  3M06 A;  1S9K D;  3TGU G;  1RF0 A;  2M5A A;  3AE6 C;  2D2C B;  1IFP A;  3E7K A;  1Q7Y Q;  1FZA A;  1FDI A;  2LKM A;  4OGQ D;  3D70 A;  1FDO A;  5KAI E;  1YJN P;  1FDM A;  3GHG C;  4DJG A;  2P67 A;  4YTP C;  2HG5 D;  1JTH B;  3H32 A;  3H1K J;  3II6 A;  2FFD A;  3RK3 B;  2B9B A;  4EYY Q;  1OMI A;  4O9B A;  3IAO A;  4W7Y A;  2QJY C;  4WY4 B;  2FXO A;  4ASW A;  4UB6 E;  3CL3 D;  1FC2 C;  1KC8 Q;  1IFD A;  2IFM A;  1P84 I;  3RBX A;  1S1C X;  1PPJ E;  1GL2 C;  3L75 E;  4PD4 I;  2N1T D;  1EDK A;  3MHV A;  4JYB A;  4EDF A;  5CCH D;  2E5Y A;  1RE4 A;  3Q5S A;  2GUV A;  2QJY B;  1GU4 A;  2FBW C;  1NAF A;  2IPP A;  2OTL P;  1DH3 A;  1FZB A;  3OA7 A;  4U3F G;  3CXH I;  3ITK A;  3L75 D;  1RE3 C;  4D6T J;  2IYO A;  3L36 A;  1PGO A;  2AXT E;  2N1T A;  2K37 A;  3H1L D;  1SQV D;  4UB6 H;  3V6I A;  3FGA D;  2KB7 P;  2JJL A;  1KMI Z;  3N4X A;  3IN6 A;  3N7N A;  3F5H A;  3H1K G;  5KLV K;  4OVN F;  4TT3 H;  1Y9B A;  2IFN A;  1K73 Q;  1GK6 A;  2QSI A;  4OGQ B;  1DEE G;  1KYO I;  1K04 A;  1DD3 A;  1NTK K;  2H7H A;  1JM0 A;  1KFN A;  5APV A;  5CCH C;  1S4X A;  1Q2N A;  3WMM 0;  1RF1 C;  1KD1 Q;  2W8Z A;  1M90 Q;  2HLO A;  2FYU D;  1M56 D;  5AVW B;  1L4A C;  3B4S A;  1LP1 A;  1NU1 D;  2B88 A;  4N6J A;  1KQG B;  3Q2Y A;  3M9B A;  2J59 M;  3C8V A;  1NJI Q;  1G2C A;  2C9L Y;  2I1J A;  2W6A A;  2N1T B;  1URQ D;  4BXL A;  3U59 A;  1RF1 B;  1NTZ D;  5APY A;  2B87 A;  3EFG A;  2GA1 A;  1YQ4 C;  3CWB E;  2E74 D;  3A7O A;  2OGU A;  2YNY A;  3BAT A;  1M57 D;  2LR2 A;  2H8P D;  4I2L C;  2WT7 A;  1PPJ G;  3L75 G;  3CWB D;  1JY2 O;  4K35 A;  3H25 A;  2BAS A;  1Y8A A;  1WMK A;  3WUV A;  2Y0E A;  1ZN5 A;  3L72 D;  5CHX A;  2QVA A;  2OYI A;  4PJ0 H;  1P84 E;  2H88 C;  1FE6 A;  4DCK A;  1UIX A;  3L73 J;  1LP1 B;  3KQG A;  3MUD C;  3NMD A;  3M0D A;  4B86 A;  3R2P A;  2ZT9 D;  2FXM A;  2IDB A;  1YYC A;  1A02 F;  1EDJ A;  1P84 D;  1K05 A;  3A5T A;  3BCC J;  4PD4 D;  1OXZ A;  1URQ C;  5DJT B;  1JY2 N;  5H2F H;  3GW6 A;  1VQ8 P;  4YXW H;  5AVV B;  2E74 C;  4I1L A;  3M9Q A;  2WT7 B;  3H1J E;  1LTJ C;  3LID A;  2PRR A;  1M1J C;  3CXH D;  2N9Y B;  2QJP C;  1BGY E;  2BCC E;  3HTK A;  1URQ B;  3M91 A;  1SQV K;  2C0X A;  3AE1 C;  1ZR2 A;  2NZ2 A;  5AW6 B;  1J1D B;  2OYI B;  5AVZ B;  2E74 B;  3VN0 A;  1VF5 D;  1HBW A;  5C39 A;  4AYC A;  5BVZ A;  3AE4 C;  1LTJ B;  2KS1 A;  1IFM A;  1BGY D;  1KYO E;  2BCC D;  4HYT B;  3CCV P;  2POH A;  2QJP B;  3G9R A;  4YPC A;  3VP9 A;  3D71 A;  1OVR A;  1SQQ J;  2ZT9 C;  2NPS D;  2W6J H;  1JY2 P;  3KHU A;  1SQP E;  3Q1M A;  2IX7 C;  2WWW A;  2MKV A;  3QH9 A;  3H1J J;  1JY3 O;  3O8Z A;  1KIL E;  3CWB G;  1KYO D;  1LWU A;  1L0N D;  2FYU K;  4IFF A;  3WUU A;  1NU1 K;  1R8E A;  1GTW A;  2OYO A;  1KZU B;  3L70 D;  1HGV A;  1RQU A;  1JB0 J;  1NOH A;  1WRG A;  4PV1 C;  3L4F A;  2Y9Z A;  1CSB A;  1VQM P;  1KIL D;  3HTK B;  5GTI E;  3RL0 D;  1NTZ K;  2NPS A;  1EQ7 A;  2WSC J;  3TNU B;  2XZR A;  4WBA A;  2WSC H;  1VQK P;  1RH5 B;  1VL2 A;  2NRG A;  3Q5R A;  2R3S A;  5AW1 B;  1SQB E;  3U1A A;  3ZDM A;  2W83 C;  1J1E C;  1PGQ A;  4DZO A;  4OWF A;  3VYI A;  2R44 A;  1VDF A;  2V7Q J;  1N73 A;  2V7Q H;  2ZJS E;  1JEK A;  1NTM E;  2H89 C;  1PP9 J;  4Z1M H;  3A0B H;  1BSH A;  1LWU B;  1VF5 B;  4IOI H;  3I56 P;  1BCC E;  3MD0 A;  1FOS E;  2KK7 A;  1YJ9 P;  1LGH B;  1NTM D;  3NTN A;  2WMM A;  1LT9 C;  5DJU B;  3H1J G;  4I7Z B;  4U3F D;  2A45 H;  1J2J B;  1FZE A;  2I8D A;  1Q86 Q;  1SQB J;  1BGY G;  2BCC G;  2NPS B;  2N9B A;  1EZV I;  3Q3D A;  2Q1K A;  3VMY A;  3IF4 A;  1OW8 A;  3CCQ P;  3C1L A;  1NKN A;  1KIL C;  2BEQ D;  1ZW0 A;  3RL0 C;  4N78 E;  1JY3 P;  3W68 A;  3H1K E;  1GDT A;  3H1I J;  5EFW B;  4BRY A;  3VP8 A;  5CBN A;  1LT9 B;  2WPV B;  2ZVO B;  3L74 J;  3V2Q A;  3B71 A;  4RJT A;  5KLV J;  1KB9 H;  1EDI A;  1BCC J;  2JKV A;  4I6M C;  3PHL A;  3MGN A;  1KIL B;  3A3Y B;  3GHG A;  2G3A A;  2Q5U A;  4N78 D;  3RL0 B;  3H1K D;  3KYQ A;  1JMB A;  1QGK B;  3RK3 C;  1SQP G;  1NTK J;  2XU6 A;  4KHX A;  5AW7 B;  1USD A;  1L0L E;  2QM7 A;  2ZYG A;  4WY4 C;  4KT0 J;  4XFJ A;  1FJP A;  2KYV A;  2E75 D;  4HB1 A;  2IZ1 A;  2IBZ I;  3GLM A;  4D6T E;  2FXP A;  3KXD A;  4WWI A;  1DIP A;  3TDK A;  4NPD A;  1JUN A;  4LGD E;  2OAR A;  1L0N K;  1VPC A;  3NFQ A;  4D6T D;  5APS A;  3HD7 A;  1RF0 C;  1SQB G;  1CZQ A;  5K5G B;  2HFE D;  2Y0D A;  1UII A;  4KJM A;  3CCU P;  1XTC C;  1L0L J;  1PGJ A;  1S72 P;  1FBM A;  1AQT A;  1NTM G;  2M0B A;  3PJS K;  2M3E A;  3OW2 O;  2ZAE B;  2FFD C;  4C7N B;  2XNX A;  4DT0 A;  2RH0 A;  2PP6 A;  1PPJ D;  1K8A Q;  1KTM A;  2M5A B;  2OQQ A;  1MKM A;  2AEJ A;  1DD4 A;  4IL6 X;  1BCC G;  1YQ3 C;  1T3U A;  5APX A;  3S4R A;  1HJ0 A;  1T2K D;  2CK3 H;  3CMA P;  1M7L A;  3MIW A;  3H32 B;  2QIW A;  4OGQ C;  2XV5 A;  2E75 C;  2FFD B;  1VQ7 P;  4GOE A;  1RE4 C;  3VOP A;  2P58 A;  2XDJ A;  2KP8 A;  5APW A;  1AVO A;  1YI2 P;  5CJ0 A;  3TYY A;  1CW5 A;  4AQR D;  3CC2 P;  3OJA B;  4IFD K;  3HD7 B;  1XTG B;  2QE7 H;  3HE5 A;  1L4A A;  1FU1 A;  1GU5 A;  2E75 B;  3WU2 E;  2CPS A;  5AW9 B;  3EWK A;  1JNM A;  1EZV E;  5AVS B;  1HUC A;  2N1T C;  1YHQ P;  4EIJ A;  1CI6 A;  2YXQ B;  4W80 A;  2M8R A;  3AE3 C;  2OYH A;  1R5L A;  5GTH E;  1MV8 A;  1L0L G;  2BEZ F;  2K9Y A;  1AFO A;  1EZV D;  3GF3 A;  4XA4 A;  4PJ0 E;  1BE3 J;  5AVR B;  2KXP B;  4OH8 B;  3L73 E;  1SQX E;  4D6T G;  3D6Y A;  1IFJ A;  1ZLL A;  2FKW B;  2AEF A;  3MP7 B;  1HTL C;  1FZF A;  1OZH A;  5B66 H;  2JDI H;  3WU2 H;  5AVX B;  3CCM P;  2C0W A;  2QRX A;  1NHL A;  3B5N D;  2RKL A;  3IR9 A;  2A45 I;  3BCC E;  2IBZ E;  3L73 D;  1D7M A;  3HE5 B;  5H2F E;  3AEG C;  3WUT A;  1FZC A;  5CBO A;  5CCG A;  2JR8 A;  1MUU A;  5GTH H;  3FWN A;  2YO2 A;  1YJW P;  1PIX A;  1H8A A;  5AVQ B;  3F89 A;  2GM4 A;  1CI6 B;  3UIA A;  1NTZ J;  2JP3 A;  3BCC D;  1QL2 A;  4ZMD A;  1KB9 I;  3GMA A;  1SQX J;  4RO0 A;  4ASV A;  3B5N A;  3JSV C;  1G2C B;  1R5S A;  4ZKU A;  2PGD A;  3CPW O;  4WB4 A;  2HPC A;  1KN7 A;  3L71 E;  2B87 B;  1X8Y A;  1T8Z A;  4RKU J;  4U7J A;  1H0T A;  3G6E P;  4H44 D;  2ZXE B;  2KNC A;  5AW4 B;  1J1D C;  3SWY A;  1FS0 E;  2OYI C;  1N7S A;  5M1B A;  1SQQ E;  2FY8 A;  2VRS A;  1YIT P;  3CCL P;  3AEB C;  3CCJ P;  3T97 A;  5TJH A;  5AW0 B;  2R5D A;  3A0H H;  3EFF K;  3M0D C;  3H1H J;  4JQ0 D;  1EZV G;  4H0L D;  3G71 P;  2KIK A;  3L37 A;  1SQQ D;  3E1I A;  1VQ9 P;  2P7J A;  3H1J D;  3CX5 H;  2V4H A;  2O1J A;  3L71 J;  1PZQ A;  3M0A A;  3V4W A;  3P8M C;  3B5N B;  1DX7 A;  1S5L X;  2B89 A;  5TIS E;  1LTS C;  3K5B A;  4NPE A;  1GW3 A;  3HUS A;  3H6P A;  3L73 G;  3G4S P;  4HKZ H;  3RK2 D;  1SQX G;  3P8C E;  1SFC D;  2KNC B;  1OIP A;  2ZYD A;  3A0B E;  1PP9 E;  5L8R J;  4BWN A;  1GW4 A;  3BCC G;  2IBZ G;  1SQP D;  2E5T A;  3V4Q A;  3PP5 A;  3KPE A;  1YIJ P;  3P8C D;  1HVV A;  2A06 E;  1SP4 A;  2O01 N;  4L73 A;  1IJD B;  5TIS H;  3S9O A;  4H13 D;  4H44 B;  4H0L C;  1SFC A;  1ZXG A;  2WPS A;  4W7Z A;  2KZJ A;  3AED C;  1LJ2 A;  3TSI A;  1ZV8 A;  5AVY B;  1LWU C;  1VF5 C;  2KS1 B;  2WSE J;  1JY3 N;  2WSE H;  4GT1 A;  4YXD C;  5KAF H;  3CC7 P;  2K9J A;  3CCS P;  1OW7 A;  3H1I E;  3HUS B;  1EC5 A;  2JO1 A;  1G1J A;  4I7Z C;  3VMA A;  2AXC A;  2O3J A;  3L71 G;  4H0L B;  1JCD A;  2WQY C;  3LW5 J;  1SQB D;  2LXB A;  2NPS C;  3TGU J;  1IK9 A;  1KB9 E;  3L74 E;  5KLV E;  5KJ7 A;  3RK2 C;  1NAY A;  1JMM A;  1VQO P;  2W27 A;  1SQQ G;  3TK1 A;  3SSU A;  3H1I D;  1NTK E;  4LC1 A;  2KSJ A;  1W2E A;  4GDO A;  1HH0 A;  1OFC X;  3AEE C;  1IO4 A;  1OW6 A;  1Q81 Q;  1KB9 D;  3L74 D;  5KLV D;  3I5C A;  1W2B O;  1BCC D;  3V2P A;  1SLQ A;  2CPB A;  4UB8 H;  3RK2 B;  2HOD A;  4DOJ A;  4EI2 A;  3BRV B;  1SFC B;  1NTK D;  3S1K A;  2Z5I A;  4GKG A;  5APT A;  4H13 C;  1MZ9 A;  1GZL A;  3SFD C;  4WY4 A;  1BDC A;  2K9J B;  1PFI A;  1U7J A;  1N73 B;  1GL2 D;  2MJZ A;  1EXJ A;  1G1I A;  2PFX A;  5E79 E;  1JOC A;  2ZVN B;  1S9K E;  3EQ2 A;  1HJB A;  3MTU E;  4H13 B;  2Q3I A;  3KZI E;  3HD7 D;  4AUW A;  1VQ6 P;  3JC2 2;  5CJ4 A;  1PP9 G;  2KLV A;  4QMA A;  5AVU B;  3FXD A;  1S5L H;  2L91 A;  3RL0 g;  1T6A A;  1GL2 A;  1L0L D;  1FJK A;  1PL5 A;  1KQS O;  3O6Q A;  3CLQ A;  4M3L A;  2HOD B;  1X22 A;  1MFT A;  2A06 G;  1H88 A;  3SWF A;  1H89 A;  3B8E B;  2A45 G;  3V2R A;  4BRY B;  1RHZ B;  3P32 A;  1FZG A;  2QM8 A;  5E79 H;  1RE3 A;  2C9N Y;  2L5G B;  3V2N A;  4GIF A;  3FXE A;  1USE A;  1SQP K;  3BAS A;  3RBZ A;  5AVT B;  3CX5 I;  3H1I G;  3KZI H;  3GHG B;  1VQ4 P;  3P7K A;  2YMY A;  2Q6Q A;  5KKZ C;  1LT1 A;  2YXR B;  2J58 A;  1E79 H;  3HE4 A;  3AE9 C;  3L74 G;  1JCC A;  5KLV G;  2JEE A;  4GOF A;  1IFI A;  3H1L E;  1L4A D;  1SQV E;  2E43 A;  1FOS F;  3HD7 C;  1NTK G;  5KAI H;  4L74 A;  4R4L A;  1GL2 B;  2IYP A;  2WSF J;  4NPF X;  1Y47 A;  2WSF H;  3O6Q B;  3SWK A;  5KKZ B;  1BE3 E;  3W67 A;  4N3Y B;  3M9H A;  1SQB K;  1OWA A;  4L75 A;  2WIT A;  2O01 J;  3G3Z A;  1PGP A;  5CCH A;  1RF1 A;  2O01 H;  2YMK A;  4ZKP A;  5AW2 B;  1Z56 A;  3L75 J;  1NTM K;  1IC2 A;  4XE5 B;  1HGZ A;  5B66 E;  3OAK A;  1DEB A;  2WPQ A;  1KV4 A;  1BE3 D;  3LIE A;  2R3C A;  2KUB A;  2XND H;  4IFM A;  3PH0 A;  2FYU E;  3H1L J;  2QA4 P;  1GD2 E;  1NU1 E;  2ZXX A;  1SQV J;  1W5C E;  4C7R A;  4C46 A;  1LNQ A;  3HE4 B;  2W6B A;  1KOR A;  1RY3 A;  1TU3 F;  1HF9 A;  1AQ5 A;  3CME P;  1BDD A;  1A02 J;  2GUS A;  3Q5P A;  5AW8 B;  1NTZ E;  5CCG D;  4MN4 C;  3V5B A;  3AE2 C;  2RN0 A;  2AXT H; 
#chains in the Genus database with same CATH homology
 3L37 A;  1X79 B;  3VMZ A;  3CL3 D;  2Q7C A;  3E1I A;  1LWU B;  1T2K C;  1IFD A;  2IFM A;  2P7J A;  1GL2 C;  3MD0 A;  4LLH A;  1FOS E;  3L35 A;  2N1T D;  2O1J A;  2YKQ A;  1LGH B;  3M0A A;  4JYB A;  3V4W A;  3P8M C;  5CCH D;  3B5N B;  1DX7 A;  3NTN A;  1LT9 C;  1RE4 A;  3C9I A;  1LTT C;  2P2U A;  2OYH C;  1LTS C;  2GUV A;  1GU4 A;  1IFN A;  1NO4 A;  2A45 H;  1J2J B;  1FZE A;  1L4A B;  1NAF A;  2IPP A;  3VTP C;  3MUD A;  1GW3 A;  2NPS B;  2N9B A;  3HUS A;  3H6P A;  1DH3 A;  1FZB A;  3IFM A;  3OA7 A;  3VMY A;  2I1K A;  2WPR A;  1NKN A;  4Y99 C;  1KIL C;  1RE3 C;  3RK2 D;  2YO3 A;  3RL0 C;  1LTI C;  3P8C E;  2Q9I A;  1L0L K;  1SFC D;  5APQ A;  4N78 E;  1JY3 P;  1GDT A;  3VP8 A;  1LT9 B;  1N7S D;  3L36 A;  2OYH B;  1NKZ B;  2N1T A;  1URQ A;  3V2Q A;  1GW4 A;  3V4Q A;  3PP5 A;  3KPE A;  4I6M C;  3MGN A;  3P8C D;  4Y99 B;  1KIL B;  3A3Y B;  1HVV A;  3GHG A;  2KB7 P;  2Q5U A;  3RL0 B;  2JJL A;  4N78 D;  3KYQ A;  3N4X A;  3RK3 C;  2XU6 A;  1FZC C;  1SP4 A;  1LTJ A;  4KHX A;  5AW7 B;  2QM7 A;  5CCG C;  1M1J A;  1IJD B;  3N7N A;  1SFC A;  5KLV K;  4WY4 C;  2WPS A;  4W7Z A;  1LTA C;  2IFN A;  3TSI A;  3A2A A;  1ZV8 A;  1GK6 A;  1FJP A;  5AVY B;  2KYV A;  1LWU C;  1FAV A;  1JY3 N;  2WSE H;  1NTK K;  1X9V A;  4GT1 A;  2E42 A;  2H7H A;  1KFN A;  5APV A;  5CCH C;  3WMM 0;  1NWQ A;  1RF1 C;  3B5N C;  3HUS B;  1FZC B;  2HLO A;  1G1J A;  5AVW B;  1L4A C;  1JCD A;  5KTB A;  1JUN A;  4N6J A;  2NPS C;  4LGD E;  1IK9 A;  2OAR A;  1NH4 A;  5KJ7 A;  3M9B A;  1L0N K;  1VPC A;  2J59 M;  1G2C A;  2C9L Y;  3NFQ A;  3RK2 C;  1JMM A;  5APS A;  2I1J A;  3HD7 A;  1RF0 C;  1CZQ A;  2W6A A;  2N1T B;  2W27 A;  3TK1 A;  2HFE D;  2R5B A;  1GK4 A;  1URQ D;  2YKP A;  3U59 A;  2FYZ A;  1RF1 B;  1N7S C;  1XTC C;  5APY A;  4LC1 A;  2KSJ A;  3TNU A;  3EFG A;  1W2E A;  1FBM A;  1HH0 A;  1IO4 A;  2P1J A;  5AW5 B;  3A7O A;  2FFD C;  4C7N B;  2HPC B;  2XNX A;  3I5C A;  2YNY A;  3BAT A;  3CI9 A;  3V2P A;  2PP6 A;  3NXS A;  2H8P D;  1SLQ A;  2CPB A;  3RK2 B;  2HOD A;  1M1J B;  4DOJ A;  3BRV B;  4EOT A;  1SFC B;  2Z5H A;  4I2L C;  2WT7 A;  1MFZ A;  3BRT B;  2H43 A;  2Z5I A;  1T3U A;  5APX A;  1N7S B;  4GKG A;  4HH2 A;  5APT A;  1YTZ I;  1JY2 O;  2BAS A;  2R32 A;  1MZ9 A;  1T2K D;  1GZL A;  5CMZ A;  4WY4 A;  1M7L A;  3MIW A;  3H32 B;  1T3J A;  1PFI A;  2XV5 A;  1N73 B;  1GL2 D;  2MJZ A;  2FFD B;  1ZN5 A;  5CHX A;  1G1I A;  1E5W A;  2OYI A;  1RE4 C;  3VOP A;  2XDJ A;  2KP8 A;  5APW A;  1JOC A;  1S9K E;  5BU8 B;  3EQ2 A;  3KQG A;  3NMD A;  1HJB A;  5CJ0 A;  3HUS C;  3TYY A;  1CW5 A;  5KJ7 D;  3MTU E;  3M0D A;  4B86 A;  2Q3I A;  3R2P A;  4AQR D;  3OJA B;  2FXM A;  1WT6 A;  4IFD K;  3HD7 B;  1XTG B;  3HD7 D;  4AUW A;  1N86 A;  3HE5 A;  1L4A A;  1YYC A;  1FU1 A;  1A02 F;  1GU5 A;  5CJ4 A;  2Z4E A;  2PAJ A;  2CPS A;  2KLV A;  5AW9 B;  1JNM A;  5AVU B;  2O1K A;  5AVS B;  1HWT C;  1HUC A;  3A5T A;  2N1T C;  2XKM A;  1SVF A;  1SQX K;  1OXZ A;  1URQ C;  1GL2 A;  1YTZ T;  1FJK A;  4EIJ A;  1JY2 N;  3CLQ A;  1CI6 A;  2KOG A;  4W80 A;  4M3L A;  2WTY A;  2M8R A;  1LT9 A;  5AVV B;  2HOD B;  4I1L A;  2OYH A;  1QL1 A;  1H88 A;  3M9Q A;  1MV8 A;  3SWF A;  2WT7 B;  3LW5 H;  1H89 A;  3B8E B;  1AFO A;  5BU5 A;  1N7L A;  1LTJ C;  2A45 G;  4XA4 A;  3LID A;  3V2R A;  1M1J C;  5AVR B;  3RK3 D;  3P32 A;  4OH8 B;  1FZG A;  1SFC C;  2QM8 A;  1KIL A;  1RE3 A;  3HTK A;  1URQ B;  3M91 A;  2C9N Y;  1SQV K;  2C0X A;  2L5G B;  1JO5 A;  4WY4 D;  4GIF A;  4JF7 A;  3V2N A;  1SQP K;  3BAS A;  1ZR2 A;  1IFJ A;  5AW6 B;  1J1D B;  2OYI B;  1ZLL A;  3KDP B;  5AVT B;  5AVZ B;  1J1E B;  2FKW B;  3VN0 A;  1HBW A;  3GHG B;  4AYC A;  5BVZ A;  2ZFC A;  3P7K A;  1N73 C;  1HTL C;  2WZ7 A;  1FZF A;  2M3B A;  2YMY A;  1LTJ B;  5AVX B;  2C0W A;  2J58 A;  1NHL A;  3HE4 A;  1IFM A;  3B5N D;  4HYT B;  2POH A;  2HYN A;  1JCC A;  3IR9 A;  1LTB C;  2A45 I;  2YKO A;  2JEE A;  1JTH A;  5APU A;  3HE5 B;  5KJ7 C;  1IFI A;  3VP9 A;  1L4A D;  4RES B;  1FZC A;  2NPS D;  2E43 A;  1FOS F;  3BVH A;  5CCG A;  1JY2 P;  3HD7 C;  5AW3 B;  1MUU A;  2IX7 C;  2YO2 A;  2WWW A;  1GL2 B;  3HRN A;  1H8A A;  1JY3 O;  3O8Z A;  5AVQ B;  2WSF H;  1LTG C;  1LWU A;  2GM4 A;  1CI6 B;  2FYU K;  3UIA A;  1ZR4 A;  4IFF A;  4JYC A;  1QL2 A;  4N3Y B;  3M9H A;  1NU1 K;  3U1C A;  1SQB K;  1OWA A;  1SQQ K;  1GTW A;  2WIT A;  3G3Z A;  1KZU B;  5CCH A;  1HGV A;  1RF1 A;  2O01 H;  3B5N A;  1G2C B;  1KFM A;  4ZKP A;  1N2D C;  1KQL A;  1NOH A;  4ZKU A;  3VMX A;  1WRG A;  3L4F A;  5AW2 B;  1CSB A;  1Z56 A;  1NTM K;  1IC2 A;  1KIL D;  3HTK B;  4XE5 B;  1HGZ A;  4WB4 A;  3RL0 D;  1NTZ K;  2NPS A;  3OAK A;  4C7N A;  2HPC A;  1EQ7 A;  1DEB A;  2WPQ A;  3TNU B;  3M06 A;  2XZR A;  3LIE A;  1X8Y A;  4WBA A;  2WSC H;  1T8Z A;  1S9K D;  2R3C A;  1RF0 A;  4IFM A;  2ZXE B;  1GD2 E;  5AW1 B;  1FZA A;  5AW4 B;  1J1D C;  3SWY A;  2OYI C;  1N7S A;  2LKM A;  3U1A A;  4C7R A;  4C46 A;  2VRS A;  4DZO A;  1J1E C;  3HE4 B;  2W6B A;  3T97 A;  1FDM A;  3GHG C;  5AW0 B;  3VYI A;  1VDF A;  2P67 A;  2R5D A;  1RY3 A;  2HG5 D;  1JTH B;  3H32 A;  1N73 A;  3II6 A;  2FFD A;  1AQ5 A;  3RK3 B;  1A02 J;  3M0D C;  2GUS A;  4O9B A;  5AW8 B;  4W7Y A;  5CCG D;  3V5B A;  4WY4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...