3WMM0

Crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
40
structure length
40
Chain Sequence
TGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
pubmed doi rcsb
molecule keywords Photosynthetic reaction center C subunit
molecule tags Photosynthesis
total genus 16
structure length 40
sequence length 40
chains with identical sequence 2, 4, 6, 8, B, E, G, J, N, P, R, T, V, X, Z
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00556 LHC Antenna complex alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3wmm000
1IJDB 1JO5A 1LGHB 1KZUB 1WRGA 1NKZB 2FKWB 3WMM0 1JMMA 1DX7A
chains in the Genus database with same CATH superfamily
5CCHC 2YXQB 4BRYB 4H44D 2I1KA 1LNQA 4LC1A 3CXHI 3L71J 1ZRTE 2WPSA 2Z4EA 2WSEJ 3V2QA 5APYA 2E5YA 3H1IG 3CXHH 2KP8A 3G71P 3ABVC 4H0LD 1MFTA 3HE4A 2N1TB 1BCCD 3AE6C 2M5AA 3WUVA 5BVZA 4PV1D 2QE7H 2LXCB 4NPDA 2Z5IA 3H25A 1S5LH 4L74A 1L4AB 2XZRA 1GL2C 2LR2A 4WY4D 2A45G 4H0LC 1NTMK 1SQPK 4LGDE 2Z5HA 5H2FE 3WU2H 4WVZA 3I55P 4PV1C 1SQXJ 4D6TD 2HFED 1KB9E 3AEBC 1IFDA 4RKUJ 5TJHA 2KK7A 3AE2C 1IFNA 4YPCA 1RF1C 4B86A 1HBWA 3U59A 2HLOA 1SQVE 4WY4C 2KS1B 1J1DC 1HJ0A 1QEXA 3RBXA 1DEEG 1NWQA 4OGQD 2AXCA 2UWJE 1L0LE 1LT9B 4L76A 1FZAA 1TU3F 4ZKUA 1ZOYC 1E5WA 3A7OA 3G6EP 5AVZB 2QG4A 3NFQA 5B66H 3CWBG 1NTKK 3L72D 1IFPA 3D71A 4PJ0H 1ZR2A 3MTUE 1T3JA 1FBMA 1FZGA 3TSIA 3C9IA 4N78D 2FXMA 2Y0EA 2HODB 1KZUB 3VOPA 1SS1A 3T97A 2C9NY 5AW7B 1FE6A 3P8MC 5KJ7A 2AEJA 1L0NK 2Y0CA 1Z56A 4RO0A 2E74D 1RY3A 1EZVI 1A02F 1EXJA 2N1TD 4R4LA 1IFMA 1Q90D 2IBZD 1BGYD 3HTKA 1SQPJ 2RH0A 5CCHA 1KYOI 1PP9J 5CBNA 1P84I 2WSSH 1YHQP 1VDFA 2W6AA 2XNXA 2E74C 3A0BE 3H1LE 4HKZH 3CCQP 1P84H 1HF9A 3QH9A 3JCUH 3N7NA 1MV8A 2QJPB 1JY2O 2ZJSE 4JYBA 1NKNA 2ITAA 4EOTA 1SQBD 2WTYA 2NZ2A 5AW3B 3O6QB 1FZFA 1G1IA 1CI6A 3NTNA 3ZDMA 3CCMP 1JNMA 5CCGA 4DJGA 1EZVG 3C1LA 1X79B 2KZJA 3AE5C 1NTKJ 2E75B 3H1IE 2K1AA 1AJYA 1G2CB 5APQA 5KLVE 1AQTA 1KILE 1OZHA 1RE4C 5B5EE 3TGUD 1HWTC 3IN6A 2C0WA 4HH2A 3H1KG 1W5CE 1FU1A 3SWFA 3V4WA 4IL6H 1RF1A 1JOCA 4JF7A 3BRTB 2E76B 3HD7B 2OYHC 2FFDC 1NU1K 1VQ4P 2GA1A 3PH0A 3SFDC 3KQGA 3HRNA 2FYUK 1N7LA 3B5NB 1T3UA 1AVOA 1SFCA 2B88A 3FXEA 1M1KQ 3CCLP 3USSA 3CXHE 1FS0E 5AVSB 2HR3A 1SQQK 4PD4I 3O8ZA 1YIJP 4K35A 1DEBA 2L91A 1DD4A 2E43A 1S5LE 5TISH 1ZXGA 2NPSC 1OW6A 2R44A 5CJ0A 3VMZA 3CWBE 1ZN5A 4U3FJ 2Q5UA 3WU2E 3D6YA 2KYVA 1JCCA 4WWIA 1AQ5A 2KNCB 2JO1A 2JJLA 3NMDA 1OW7A 4BRYA 1NVOA 1ZV8A 5GTIH 4WBAA 1WMKA 1YQ3C 1NTZK 2B87B 4O9BA 2YKQA 1T2KC 1JMMA 2QJPC 3IR9A 2BCCE 2E75D 3AEAC 2OTJP 3VP8A 5KLVJ 2N1TA 1M1JC 3M91A 1S9KD 2W90A 3CCSP 1NU1J 4JYCA 1LTJC 2KI7B 4LLHA 1LTAC 3GLMA 5B66E 3L75D 1NTMG 1Q86Q 1ZP0C 4D6TG 1URQD 2D2CD 4PJ0E 1NH4A 3H1HE 1LTGC 1L4AA 1YJWP 2PAJA 3FX0A 1AFOA 3M0AA 1PV3A 2G3AA 3H1JG 1K9MQ 5GTHH 5AW9B 2YXRB 4Y99B 4OH8B 3CMAP 1FJPA 1NAFA 1T8ZA 3LW5H 2HPCB 1URQC 4KT0J 1GL2B 2D2CC 1OW8A 2C9LY 1KQFB 4H0LB 3AEEC 3P8CD 2KS1A 1JY2P 2K9JB 1Q2NA 4PV1B 3EFGA 3II6A 4EI2A 3L72G 3AE1C 1NYHA 1EZVD 1HJBA 3L36A 1KFMA 4I1LA 3L71D 2R5BA 3CLQA 1LT9A 2KB7P 3SWYA 2FKWB 4WY4B 1MFZA 2KZIA 2V4HA 3CD6P 1LP1B 3H1KE 5AVVB 1P84E 3JCUE 1J1DB 3MZWB 1K8AQ 1KYOD 1NTZJ 1P84D 1CZQA 5APSA 2N9YB 1KQSO 1OVRA 2OYIC 1JY3P 3R4YA 2HODA 2WMMA 2IBZG 5K5GB 1BGYG 1VQMP 1SQXD 2M3EA 1VQ5P 2YIUC 2BCCJ 2FYZA 2XU6A 2Y9YA 4MN4C 2K9YA 2O01N 4IFMA 1LTIC 1SQBG 3L4FA 1PGOA 4IL6E 4ASVA 3KZIH 3AE3C 3H1HJ 2FYNC 4C7NB 2V7QJ 1PFIA 1YQ4C 3RL0D 1NGMB 1LT1A 4L73A 1FOSF 2A06D 4RESB 1USEA 2NRGA 2PP6A 5KLIC 2WSCJ 1HGVA 3BCCD 3O6QA 2JWAA 2GM4A 1GL2D 2E74B 2YKPA 1BCCE 3A2AA 2MKVA 5AVTB 2AEMA 3RL0C 2H88C 3TGUG 1S3JA 3GHGB 5KAIH 1X0TA 5KTBA 2JDIH 1PPJD 2M3BA 2AEFA 4HYTB 1G2CA 1BE3J 5AVXB 4Y99C 3L70J 5TISE 2ZYAA 4PD4D 1H8AA 1LTTC 4N3YB 1NTME 3G4SP 5AVQB 4D6TE 2R3CA 4GOFA 1NTMD 2FYUG 1SQPD 3HD7A 2CK3H 2Q7CA 2WZ7A 1JMBA 3H1JE 5GTIE 2W8ZA 2ZXXA 3TK1A 3L73G 3B5NA 2O01H 3EQ2A 3B71A 1RE3A 3H1JD 1QL2A 3W67A 4IFDK 2JEEA 1W2BO 2OYHB 3TDKA 2FFDB 3VN0A 2N9BA 1LTSC 1OFCX 3M9HA 3M9BA 1BSNA 1A02J 1M56D 1JUNA 1Q81Q 3L72E 5DJUB 5E79E 1RF0C 5APWA 3VP9A 3VMYA 5BU8B 2OQQA 1ZR4A 4NPEA 2KLVA 1LGHB 1NTKD 1LJ2A 1N7SD 1S5LX 1E79H 1OVUA 4N78E 3A3YB 3CPWO 1L0LK 1JM0A 4UB6H 3WMM0 5AVUB 2WT7B 2FXOA 3PLNA 3GMAA 5GTHE 2KNCA 1Y47A 5AVYB 1S72P 3L74G 3HUSC 3RL0g 2NPSB 1N7SC 1L0ND 1PGPA 1IZNB 2IBZE 4H13C 1BCCJ 1PGQA 2B87A 1EQ7A 3TYYA 1BGYE 5KKZC 2QJYB 3L75G 3MGNA 2WSEH 1QL1A 3OW2O 2Q1KA 3CX5D 1FZCC 1MZ9A 3MUDC 4BXLA 1KYOH 2KUBA 1SQBE 4YTPC 1HVVA 4D6TJ 3GHGC 2ZT9C 2JWDA 3CCVP 1DD3A 2KOGA 4EDFA 1VQ6P 1M1JB 1K05A 1OIPA 1CW5A 1LTJB 1HUCA 1WT6A 4A7PA 1KMIZ 4U3FD 2WSFJ 1SQVJ 2HPCA 1GL2A 3L71G 1HTLC 2H8PD 1AV1A 2K37A 2KIKA 2W6BA 3TGUE 3PRJA 3UIAA 2K9JA 1L0LJ 3PTZA 1S4XA 2LKMA 1JY3O 3OJAB 1NHLA 3L72J 3TNUB 1SLQA 1Y8AA 1URQB 1Q7YQ 2D2CB 3Q2YA 1NAYA 5KLVK 1YTZI 1VQNP 2GUSA 3N4XA 4WY4A 3LIDA 1LP1A 4R4MA 4OWFA 1EDJA 4HJGH 1SP4A 1NU1D 2OTKE 2FYUE 3V4QA 3AEDC 1GK6A 1SQXG 2JKVA 2FYUD 3Q3DA 3CCRP 4ZNCA 3LW5J 2NPSD 3M0DC 3L73E 5CJ4A 5KAIE 1KILC 1PIXA 3L35A 3L73D 1N73C 1SQQD 2I8DA 4PD4H 2QEXP 2P2UA 1JB0J 2OYIB 1X22A 1BSHA 2M8RA 2ZVOB 2QVAA 3KXDA 3D70A 3MIWA 2A06G 1LWUC 5CMZA 3H1LJ 3A0HH 3AECC 1T2KD 2QJYC 4W80A 4IL6X 3BCCG 2YIUB 4C7NA 4IFFA 3EFFK 3CC2P 1VQ8P 1FOSE 3Q5RA 1KB9I 2QIWA 1VQLP 1PPJG 3H32B 4ZKPA 1NTZD 2FYNB 3W68A 2QM7A 2FY8A 3L74D 1S9KE 1GMJA 2BASA 3H1IJ 3F5HA 3GHGA 3L75E 5KLIB 2QJKC 1HH0A 1VQKP 1N86A 1JO5A 2O3JA 3AE7C 4N6JA 1SQPG 4I6MC 3B4SA 1PP9G 1ZMEC 3RK3D 3RL0B 5CBOA 2KLUA 2XV5A 4KJMA 1KN7A 1NO4A 4UB6E 2JP3A 3ITKA 1U7JA 3V2RA 3VMXA 4QMAA 3U1AA 2R5DA 4I2LC 1RE4A 3C8VA 3AEGC 3CMEP 4ZMDA 1WRGA 3P8CE 5AW5B 3RK3C 1IJDB 3HE5B 3RBZA 3CX5I 3CCJP 2HYNA 1EZVE 3CX5H 3L71E 3WUTA 2Q9IA 2OYHA 2FFDA 2R32A 1NTKG 1VQOP 4U7JA 3PJSK 2P67A 5CHXA 3M06A 1OVVA 3M9QA 5DJTB 1YYCA 1KYOE 1H0TB 3V5BA 4I7ZC 2W83C 1DIPA 3CWBJ 4EYYQ 2YO3A 1RH5B 2YNYA 1BE3D 3CC4P 3L70D 1VQ7P 1L0NG 3IAOA 2RMZA 2WT7A 2O1JA 4BWNA 2KSJA 3FWLA 1PL5A 3MD0A 1SQXE 2WPRA 3VMAA 2H7HA 1H88A 1JTHB 2B89A 2AXTH 2NPSA 2JR8A 3AE9C 1GW4A 1KC8Q 1D7MA 2PFXA 3WUUA 4DT0A 1RQUA 1QX8A 3HUSB 2QM8A 3EWKA 5AW2B 3Q5SA 1N7SB 2QSIA 4IOIH 4H13B 2A06E 5KJ7C 3G3ZA 4YXDC 1GTWA 5KKZB 1QLED 4M3LA 1JY2N 4U3FG 3BCCE 1LTBC 1PZQA 2XDJA 1DX7A 3E1RA 2A45I 5KAFH 1YI2P 2SPZA 1FZCB 1J1EC 1QGKB 1M1JA 5AVWB 3S1KA 1RHZB 1LTJA 3VTPC 3S9OA 1EDIA 4C7RA 4WB4A 2OARA 3PP5A 1PPJE 3V6IA 2ZT9B 1R5LA 2OYOA 4YXWH 5CCGD 1UIXA 2YKOA 2LXBA 1OMIA 2ZYDA 3JC22 4PD4E 2P10A 2Y0DA 1ZRTD 5KLVG 3AE4C 1VF5D 2G8YA 1JY3N 1NU1G 1GK4A 3TNUA 3A0HE 1SQPE 3H1KJ 4H44C 1URQA 1J2JB 2KXPB 2KSEA 3SSUA 1PP9E 2PRRA 2W27A 5CCGC 3CCEP 5APUA 1PP9D 4AUWA 4XA4A 2FBWC 4GKGA 1U7MA 1AA0A 3GF7A 5M1BA 1VF5C 1K04A 4UB8H 1RQVA 2IX7C 2CPSA 1SQQG 2WPQA 1SFCD 2QA4P 4Y28J 1GDTA 1KB9D 1FDIA 1W2EA 3H6PA 4JBZA 3P32A 1BDDA 1FDMA 1SQVK 3VYIA 3OA7A 4W7YA 1NTKE 1SQVD 4DOJA 1K73Q 2ZVNB 2OYIA 4L75A 4RJTA 2WQYC 1H89A 2M0BA 1SFCC 3FGAD 2XKMA 4H13D 1KILB 2J5UA 4GDOA 3F89A 1L0LD 2OGUA 2IZ0A 1N73B 1S2EA 1FC2C 1NTZG 3BCCJ 2WITA 2V7QH 1L0NE 4GOEA 2K88A 1FZEA 1LWUB 4OGQC 2IFMA 2QRXA 5APTA 3CI9A 2WSCH 2YMKA 3H32A 2Q3EA 2ZT9D 3CX5E 2K3RA 2P7JA 3KHUA 1X8YA 2CPBA 1KQGB 2BCCG 1NKZB 2ZAEB 2IFNA 2ZXEB 3KDPB 5AW4B 3V2NA 2Y9ZA 1YTZT 1CSBA 1NTMJ 1EDLA 3BASA 1USDA 4XFJA 3TF5A 3R2PA 4TLFA 3H1HG 1L4AD 1M7LA 3BVHA 4U3FE 2QJKB 3JSVC 3IF4A 3KYQA 2N1TC 3H1JJ 3H1LD 1SQBK 1M8OB 2WPVB 2DW3A 3GW6A 2P1JA 1EXIA 1UIIA 1MUUA 2AXTE 1YITP 1XTCC 1YJNP 3S4RA 1DH3A 2IPPA 3HE5A 1EDKA 5AW8B 2E5TA 1L4AC 2FXPA 1HGZA 3HE4B 2IDBA 2GUVA 1N2DC 2M5AB 5AW0B 1BE3G 3L70G 3KZIE 3RK3B 3A5TA 5L8RJ 1PGJA 4CPGA 1NU1E 3H1ID 1H0TA 3I5CA 5KLVD 4ASWA 1FAVA 2P58A 1KILD 5APVA 1JCDA 1VL2A 3AEFC 3NXSA 5KAFE 1ZW0A 3AE8C 1NJIQ 1VPCA 1FZBA 1L0NJ 4KHXA 4EIJA 2IZ1A 1G1JA 1RF0A 1U57A 4I7ZB 2MJZA 1QVFO 1LT9C 3E1IA 1R5SA 1SQQE 1BGYJ 3KPEA 1JTHA 5C39A 4JQ0D 1IK9A 1VQ9P 1GW3A 1YJ9P 2PGDA 1N8RQ 2Q3IA 4NPFX 3D6ZA 3RK2B 3MHVA 5AW6B 3G9RA 3CXHD 4XE5B 3HUSA 1ZLLA 1R8EA 2HG5D 1YBKA 1SQBJ 4K3AA 1X9VA 2H43A 1N7SA 3P7KA 3CC7P 1Q82Q 2J58A 1NTZE 2ZFCA 1Y9BA 5H2FH 4UB8E 2R3SA 3CWBD 3SFEC 3L74E 1FZCA 3T97B 1KFNA 3MUDA 1KB9H 3K5BA 2H89C 1M57D 1BCCG 1S1CX 3TGUJ 2I1JA 2WSFH 3Q5PA 2YMYA 5EFWB 4DCKA 1J1EB 1GU4A 3RK3E 4C46A 3HTKB 2XNDH 3I56P 1IO4A 2BCCD 3LIEA 5E79H 1KORA 3QWOC 3GG2A 1KV4A 2C0XA 4GT1A 2W6JH 1OWAA 2RKLA 2FYUJ 2YO2A 5AVRB 3E7KA 2E76D 1FJKA 3HD7D 2E75C 2IYPA 3H1HD 4GODA 1CI6B 2WWWA 3L73J 2O1KA 4H44B 1FDOA 1KD1Q 4W7ZA 3B5ND 1SQVG 3SWKA 3BATA 1SQQJ 2IBZI 1T6AA 4JPZB 1EC5A 2E76C 3HD7C 3RK2D 1VF5B 3V2PA 3U1CA 1L0LG 1L2PA 1M90Q 4HB1A 2WVRA 1BE3E 3L70E 3B5NC 3IFMA 2Q6QA 3M0DA 1RE3C 1RF1B 3L37A 1KILA 2BEQD 1KTMA 5BU5A 3A0BH 2L5GB 3RK2C 1N73A 4Z1MH 4GIFA 3H1KD 2O01J 3RGUA 1XTGB 3L74J 3CCUP 1SFCB 3Q1MA 2RN0A 1QVGO 1LWUA 5KJ7D 4AQRD 1VQPP 3MP7B 1IFJA 4DZOA 1SQXK 2VRSA 3L75J 1OXZA 3PHLA 3BRVB 3OAKA 3CL3D 4OGQB 2BEZF 5CCHD 1GZLA 1KQLA 4TT3H 5B5EH 3B8EB 3FXDA 3FWNA 2B9BA 1IK7A 2POHA 1JEKA 4AYCA 3H1LG 2E42A 1IC2A 5APXA 1NOHA 2IYOA 2OTLP 1MKMA 2ZYGA 1IFIA 1AVYA 4OVNF 2J59M 1BDCA 1GD2E 1SVFA 5AW1B 2A45H 1GU5A 1OX3A 3GF3A
chains in the Genus database with same CATH topology
5CCHC 5AW9B 1FZEA 4Y99B 1LWUB 2IFMA 4OH8B 2I1KA 1FJPA 1NAFA 5APTA 3CI9A 2NPSD 2WSCH 1T8ZA 3LW5H 2HPCB 1URQC 3M0DC 1GL2B 3H32A 5CJ4A 4LC1A 2C9LY 1KILC 2WPSA 2Z4EA 2P7JA 3L35A 1X8YA 3V2QA 5APYA 2CPBA 3P8CD 1JY2P 2KP8A 1N73C 1NKZB 3EFGA 3HE4A 2N1TB 3II6A 2IFNA 2P2UA 5BVZA 2OYIB 1HJBA 3L36A 2ZXEB 2M8RA 3KDPB 1KFMA 4I1LA 5AW4B 3V2NA 1YTZT 2R5BA 3MIWA 1CSBA 2Z5IA 3CLQA 1LT9A 1LWUC 2KB7P 5CMZA 3BASA 3SWYA 2FKWB 1T2KD 4WY4B 1L4AB 1MFZA 2XZRA 1GL2C 5AVVB 4W80A 3R2PA 1J1DB 4WY4D 1L4AD 2A45G 4C7NA 1M7LA 1NTMK 4IFFA 1CZQA 5APSA 3BVHA 1SQPK 4LGDE 2Z5HA 3KYQA 2N1TC 2HFED 1SQBK 1FOSE 1IFDA 2OYIC 2P1JA 1JY3P 1MUUA 2HODA 3H32B 1XTCC 1IFNA 4ZKPA 1RF1C 1DH3A 4B86A 1HBWA 2IPPA 3U59A 2HLOA 3HE5A 2QM7A 5AW8B 4WY4C 1L4AC 1S9KE 1HGZA 2BASA 1J1DC 3HE4B 2FYZA 3GHGA 2GUVA 2XU6A 1N2DC 1HH0A 1NWQA 1N86A 5AW0B 1JO5A 1LT9B 4IFMA 4N6JA 4I6MC 1FZAA 3RK3B 4ZKUA 3A5TA 1E5WA 1LTIC 3A7OA 5AVZB 3I5CA 3NFQA 3L4FA 1FAVA 3RK3D 1KILD 1NTKK 3RL0B 4C7NB 2XV5A 1NO4A 5APVA 1PFIA 1ZR2A 3MTUE 3RL0D 1JCDA 1T3JA 3NXSA 1FBMA 3V2RA 3VMXA 1FOSF 1FZGA 4RESB 3TSIA 3U1AA 2PP6A 1VPCA 2R5DA 4I2LC 3C9IA 1FZBA 4N78D 1RE4A 4KHXA 4EIJA 1HGVA 2FXMA 1G1JA 2HODB 1RF0A 1WRGA 1KZUB 3VOPA 2MJZA 3T97A 1LT9C 3P8CE 5AW7B 2C9NY 3E1IA 2GM4A 5AW5B 3RK3C 1IJDB 3HE5B 3P8MC 1GL2D 5KJ7A 3KPEA 1JTHA 2YKPA 3A2AA 1L0NK 5AVTB 1Z56A 2HYNA 1IK9A 1RY3A 1GW3A 3RL0C 3GHGB 1A02F 2Q3IA 5KTBA 2Q9IA 2OYHA 2FFDA 2R32A 2N1TD 3RK2B 1IFMA 2M3BA 4HYTB 2P67A 5CHXA 3M06A 5AW6B 1G2CA 5AVXB 4Y99C 4XE5B 3M9QA 3HTKA 1YYCA 3HUSA 5CCHA 1ZLLA 3V5BA 2HG5D 1H8AA 1LTTC 1X9VA 4N3YB 2H43A 1N7SA 3P7KA 2YO3A 1VDFA 2W6AA 2J58A 2XNXA 5AVQB 2R3CA 2YNYA 3N7NA 1MV8A 1JY2O 3HD7A 4JYBA 2Q7CA 1NKNA 4EOTA 2ZFCA 2WT7A 2O1JA 2KSJA 2WTYA 3MD0A 2WZ7A 5AW3B 1FZCA 1KFNA 2WPRA 3MUDA 1FZFA 1G1IA 3TK1A 1CI6A 2H7HA 3B5NA 3NTNA 2O01H 1H88A 1JTHB 3EQ2A 1RE3A 2NPSA 1JNMA 1QL2A 1GW4A 5CCGA 4IFDK 2JEEA 2I1JA 2WSFH 2OYHB 2FFDB 1X79B 3VN0A 2YMYA 2N9BA 1LTSC 3M9HA 1J1EB 1G2CB 5APQA 1GU4A 3M9BA 1A02J 4C46A 1RE4C 3HTKB 1JUNA 3HUSB 1IO4A 1RF0C 5APWA 3VP9A 3VMYA 2QM8A 5BU8B 1HWTC 1ZR4A 5AW2B 1N7SB 2C0WA 4HH2A 2KLVA 1LGHB 3LIEA 5KJ7C 1N7SD 3G3ZA 1GTWA 1FU1A 3SWFA 2C0XA 4GT1A 3V4WA 4N78E 3A3YB 1RF1A 1OWAA 1JOCA 4JF7A 1L0LK 3BRTB 4M3LA 1JY2N 3HD7B 2OYHC 2FFDC 2YO2A 1LTBC 3WMM0 2XDJA 1NU1K 5AVUB 5AVRB 2WT7B 1DX7A 1FJKA 2A45I 3HD7D 1FZCB 1J1EC 1M1JA 3KQGA 3HRNA 5AVWB 5AVYB 1LTJA 1CI6B 2FYUK 3VTPC 1N7LA 2WWWA 3B5NB 3HUSC 2O1KA 1T3UA 4W7ZA 4C7RA 4WB4A 1SFCA 2NPSB 2OARA 3PP5A 3B5ND 1N7SC 3BATA 1EQ7A 3TYYA 5CCGD 2YKOA 3HD7C 5AVSB 3RK2D 3V2PA 3MGNA 1SQQK 2WSEH 1QL1A 3O8ZA 3U1CA 1FZCC 1DEBA 1JY3N 1MZ9A 1GK4A 3TNUA 2E43A 3B5NC 3IFMA 1URQA 1J2JB 3M0DA 1RE3C 2NPSC 1RF1B 3L37A 1HVVA 5CJ0A 2W27A 5CCGC 1KILA 3GHGC 3VMZA 1ZN5A 5BU5A 2Q5UA 2L5GB 5APUA 2KOGA 4AUWA 4XA4A 2KYVA 3RK2C 1N73A 4GKGA 1JCCA 1M1JB 1AQ5A 1CW5A 4GIFA 1LTJB 1HUCA 1XTGB 1WT6A 2JJLA 2IX7C 2CPSA 1SFCB 3NMDA 1ZV8A 1LWUA 2WPQA 5KJ7D 4WBAA 1SFCD 1NTZK 4AQRD 2HPCA 1GDTA 4O9BA 1GL2A 1W2EA 2YKQA 1HTLC 1T2KC 1IFJA 2H8PD 4DZOA 1JMMA 3H6PA 1SQXK 2VRSA 1OXZA 2W6BA 3IR9A 3BRVB 3P32A 1FDMA 1SQVK 3UIAA 3VYIA 3OA7A 4W7YA 3VP8A 3OAKA 3CL3D 2N1TA 2LKMA 1M1JC 1JY3O 4DOJA 3M91A 1S9KD 3OJAB 1NHLA 1GZLA 4JYCA 5CCHD 1SLQA 3TNUB 1LTJC 1KQLA 4LLHA 2OYIA 1LTAC 3B8EB 1URQB 1H89A 1SFCC 2XKMA 2POHA 4AYCA 2E42A 1IC2A 1URQD 1KILB 1YTZI 5KLVK 2GUSA 1NH4A 3N4XA 5APXA 1LTGC 1NOHA 4WY4A 1L4AA 3LIDA 1IFIA 2PAJA 1N73B 1SP4A 2J59M 2WITA 3V4QA 1GD2E 1AFOA 1SVFA 5AW1B 3M0AA 2A45H 1GU5A 1GK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJD B;  1JO5 A;  1LGH B;  1KZU B;  1WRG A;  1NKZ B;  2FKW B;  3WMM 0;  1JMM A;  1DX7 A; 
#chains in the Genus database with same CATH topology
 5CCH C;  2YXQ B;  4BRY B;  4H44 D;  2I1K A;  1LNQ A;  4LC1 A;  3CXH I;  3L71 J;  1ZRT E;  2WPS A;  2Z4E A;  2WSE J;  3V2Q A;  5APY A;  2E5Y A;  3H1I G;  3CXH H;  2KP8 A;  3G71 P;  3ABV C;  4H0L D;  1MFT A;  3HE4 A;  2N1T B;  1BCC D;  3AE6 C;  2M5A A;  3WUV A;  5BVZ A;  4PV1 D;  2QE7 H;  2LXC B;  4NPD A;  2Z5I A;  3H25 A;  1S5L H;  4L74 A;  1L4A B;  2XZR A;  1GL2 C;  2LR2 A;  4WY4 D;  2A45 G;  4H0L C;  1NTM K;  1SQP K;  4LGD E;  2Z5H A;  5H2F E;  3WU2 H;  4WVZ A;  3I55 P;  4PV1 C;  1SQX J;  4D6T D;  2HFE D;  1KB9 E;  3AEB C;  1IFD A;  4RKU J;  5TJH A;  2KK7 A;  3AE2 C;  1IFN A;  4YPC A;  1RF1 C;  4B86 A;  1HBW A;  3U59 A;  2HLO A;  1SQV E;  4WY4 C;  2KS1 B;  1J1D C;  1HJ0 A;  1QEX A;  3RBX A;  1DEE G;  1NWQ A;  4OGQ D;  2AXC A;  2UWJ E;  1L0L E;  1LT9 B;  4L76 A;  1FZA A;  1TU3 F;  4ZKU A;  1ZOY C;  1E5W A;  3A7O A;  3G6E P;  5AVZ B;  2QG4 A;  3NFQ A;  5B66 H;  3CWB G;  1NTK K;  3L72 D;  1IFP A;  3D71 A;  4PJ0 H;  1ZR2 A;  3MTU E;  1T3J A;  1FBM A;  1FZG A;  3TSI A;  3C9I A;  4N78 D;  2FXM A;  2Y0E A;  2HOD B;  1KZU B;  3VOP A;  1SS1 A;  3T97 A;  2C9N Y;  5AW7 B;  1FE6 A;  3P8M C;  5KJ7 A;  2AEJ A;  1L0N K;  2Y0C A;  1Z56 A;  4RO0 A;  2E74 D;  1RY3 A;  1EZV I;  1A02 F;  1EXJ A;  2N1T D;  4R4L A;  1IFM A;  1Q90 D;  2IBZ D;  1BGY D;  3HTK A;  1SQP J;  2RH0 A;  5CCH A;  1KYO I;  1PP9 J;  5CBN A;  1P84 I;  2WSS H;  1YHQ P;  1VDF A;  2W6A A;  2XNX A;  2E74 C;  3A0B E;  3H1L E;  4HKZ H;  3CCQ P;  1P84 H;  1HF9 A;  3QH9 A;  3JCU H;  3N7N A;  1MV8 A;  2QJP B;  1JY2 O;  2ZJS E;  4JYB A;  1NKN A;  2ITA A;  4EOT A;  1SQB D;  2WTY A;  2NZ2 A;  5AW3 B;  3O6Q B;  1FZF A;  1G1I A;  1CI6 A;  3NTN A;  3ZDM A;  3CCM P;  1JNM A;  5CCG A;  4DJG A;  1EZV G;  3C1L A;  1X79 B;  2KZJ A;  3AE5 C;  1NTK J;  2E75 B;  3H1I E;  2K1A A;  1AJY A;  1G2C B;  5APQ A;  5KLV E;  1AQT A;  1KIL E;  1OZH A;  1RE4 C;  5B5E E;  3TGU D;  1HWT C;  3IN6 A;  2C0W A;  4HH2 A;  3H1K G;  1W5C E;  1FU1 A;  3SWF A;  3V4W A;  4IL6 H;  1RF1 A;  1JOC A;  4JF7 A;  3BRT B;  2E76 B;  3HD7 B;  2OYH C;  2FFD C;  1NU1 K;  1VQ4 P;  2GA1 A;  3PH0 A;  3SFD C;  3KQG A;  3HRN A;  2FYU K;  1N7L A;  3B5N B;  1T3U A;  1AVO A;  1SFC A;  2B88 A;  3FXE A;  1M1K Q;  3CCL P;  3USS A;  3CXH E;  1FS0 E;  5AVS B;  2HR3 A;  1SQQ K;  4PD4 I;  3O8Z A;  1YIJ P;  4K35 A;  1DEB A;  2L91 A;  1DD4 A;  2E43 A;  1S5L E;  5TIS H;  1ZXG A;  2NPS C;  1OW6 A;  2R44 A;  5CJ0 A;  3VMZ A;  3CWB E;  1ZN5 A;  4U3F J;  2Q5U A;  3WU2 E;  3D6Y A;  2KYV A;  1JCC A;  4WWI A;  1AQ5 A;  2KNC B;  2JO1 A;  2JJL A;  3NMD A;  1OW7 A;  4BRY A;  1NVO A;  1ZV8 A;  5GTI H;  4WBA A;  1WMK A;  1YQ3 C;  1NTZ K;  2B87 B;  4O9B A;  2YKQ A;  1T2K C;  1JMM A;  2QJP C;  3IR9 A;  2BCC E;  2E75 D;  3AEA C;  2OTJ P;  3VP8 A;  5KLV J;  2N1T A;  1M1J C;  3M91 A;  1S9K D;  2W90 A;  3CCS P;  1NU1 J;  4JYC A;  1LTJ C;  2KI7 B;  4LLH A;  1LTA C;  3GLM A;  5B66 E;  3L75 D;  1NTM G;  1Q86 Q;  1ZP0 C;  4D6T G;  1URQ D;  2D2C D;  4PJ0 E;  1NH4 A;  3H1H E;  1LTG C;  1L4A A;  1YJW P;  2PAJ A;  3FX0 A;  1AFO A;  3M0A A;  1PV3 A;  2G3A A;  3H1J G;  1K9M Q;  5GTH H;  5AW9 B;  2YXR B;  4Y99 B;  4OH8 B;  3CMA P;  1FJP A;  1NAF A;  1T8Z A;  3LW5 H;  2HPC B;  1URQ C;  4KT0 J;  1GL2 B;  2D2C C;  1OW8 A;  2C9L Y;  1KQF B;  4H0L B;  3AEE C;  3P8C D;  2KS1 A;  1JY2 P;  2K9J B;  1Q2N A;  4PV1 B;  3EFG A;  3II6 A;  4EI2 A;  3L72 G;  3AE1 C;  1NYH A;  1EZV D;  1HJB A;  3L36 A;  1KFM A;  4I1L A;  3L71 D;  2R5B A;  3CLQ A;  1LT9 A;  2KB7 P;  3SWY A;  2FKW B;  4WY4 B;  1MFZ A;  2KZI A;  2V4H A;  3CD6 P;  1LP1 B;  3H1K E;  5AVV B;  1P84 E;  3JCU E;  1J1D B;  3MZW B;  1K8A Q;  1KYO D;  1NTZ J;  1P84 D;  1CZQ A;  5APS A;  2N9Y B;  1KQS O;  1OVR A;  2OYI C;  1JY3 P;  3R4Y A;  2HOD A;  2WMM A;  2IBZ G;  5K5G B;  1BGY G;  1VQM P;  1SQX D;  2M3E A;  1VQ5 P;  2YIU C;  2BCC J;  2FYZ A;  2XU6 A;  2Y9Y A;  4MN4 C;  2K9Y A;  2O01 N;  4IFM A;  1LTI C;  1SQB G;  3L4F A;  1PGO A;  4IL6 E;  4ASV A;  3KZI H;  3AE3 C;  3H1H J;  2FYN C;  4C7N B;  2V7Q J;  1PFI A;  1YQ4 C;  3RL0 D;  1NGM B;  1LT1 A;  4L73 A;  1FOS F;  2A06 D;  4RES B;  1USE A;  2NRG A;  2PP6 A;  5KLI C;  2WSC J;  1HGV A;  3BCC D;  3O6Q A;  2JWA A;  2GM4 A;  1GL2 D;  2E74 B;  2YKP A;  1BCC E;  3A2A A;  2MKV A;  5AVT B;  2AEM A;  3RL0 C;  2H88 C;  3TGU G;  1S3J A;  3GHG B;  5KAI H;  1X0T A;  5KTB A;  2JDI H;  1PPJ D;  2M3B A;  2AEF A;  4HYT B;  1G2C A;  1BE3 J;  5AVX B;  4Y99 C;  3L70 J;  5TIS E;  2ZYA A;  4PD4 D;  1H8A A;  1LTT C;  4N3Y B;  1NTM E;  3G4S P;  5AVQ B;  4D6T E;  2R3C A;  4GOF A;  1NTM D;  2FYU G;  1SQP D;  3HD7 A;  2CK3 H;  2Q7C A;  2WZ7 A;  1JMB A;  3H1J E;  5GTI E;  2W8Z A;  2ZXX A;  3TK1 A;  3L73 G;  3B5N A;  2O01 H;  3EQ2 A;  3B71 A;  1RE3 A;  3H1J D;  1QL2 A;  3W67 A;  4IFD K;  2JEE A;  1W2B O;  2OYH B;  3TDK A;  2FFD B;  3VN0 A;  2N9B A;  1LTS C;  1OFC X;  3M9H A;  3M9B A;  1BSN A;  1A02 J;  1M56 D;  1JUN A;  1Q81 Q;  3L72 E;  5DJU B;  5E79 E;  1RF0 C;  5APW A;  3VP9 A;  3VMY A;  5BU8 B;  2OQQ A;  1ZR4 A;  4NPE A;  2KLV A;  1LGH B;  1NTK D;  1LJ2 A;  1N7S D;  1S5L X;  1E79 H;  1OVU A;  4N78 E;  3A3Y B;  3CPW O;  1L0L K;  1JM0 A;  4UB6 H;  3WMM 0;  5AVU B;  2WT7 B;  2FXO A;  3PLN A;  3GMA A;  5GTH E;  2KNC A;  1Y47 A;  5AVY B;  1S72 P;  3L74 G;  3HUS C;  3RL0 g;  2NPS B;  1N7S C;  1L0N D;  1PGP A;  1IZN B;  2IBZ E;  4H13 C;  1BCC J;  1PGQ A;  2B87 A;  1EQ7 A;  3TYY A;  1BGY E;  5KKZ C;  2QJY B;  3L75 G;  3MGN A;  2WSE H;  1QL1 A;  3OW2 O;  2Q1K A;  3CX5 D;  1FZC C;  1MZ9 A;  3MUD C;  4BXL A;  1KYO H;  2KUB A;  1SQB E;  4YTP C;  1HVV A;  4D6T J;  3GHG C;  2ZT9 C;  2JWD A;  3CCV P;  1DD3 A;  2KOG A;  4EDF A;  1VQ6 P;  1M1J B;  1K05 A;  1OIP A;  1CW5 A;  1LTJ B;  1HUC A;  1WT6 A;  4A7P A;  1KMI Z;  4U3F D;  2WSF J;  1SQV J;  2HPC A;  1GL2 A;  3L71 G;  1HTL C;  2H8P D;  1AV1 A;  2K37 A;  2KIK A;  2W6B A;  3TGU E;  3PRJ A;  3UIA A;  2K9J A;  1L0L J;  3PTZ A;  1S4X A;  2LKM A;  1JY3 O;  3OJA B;  1NHL A;  3L72 J;  3TNU B;  1SLQ A;  1Y8A A;  1URQ B;  1Q7Y Q;  2D2C B;  3Q2Y A;  1NAY A;  5KLV K;  1YTZ I;  1VQN P;  2GUS A;  3N4X A;  4WY4 A;  3LID A;  1LP1 A;  4R4M A;  4OWF A;  1EDJ A;  4HJG H;  1SP4 A;  1NU1 D;  2OTK E;  2FYU E;  3V4Q A;  3AED C;  1GK6 A;  1SQX G;  2JKV A;  2FYU D;  3Q3D A;  3CCR P;  4ZNC A;  3LW5 J;  2NPS D;  3M0D C;  3L73 E;  5CJ4 A;  5KAI E;  1KIL C;  1PIX A;  3L35 A;  3L73 D;  1N73 C;  1SQQ D;  2I8D A;  4PD4 H;  2QEX P;  2P2U A;  1JB0 J;  2OYI B;  1X22 A;  1BSH A;  2M8R A;  2ZVO B;  2QVA A;  3KXD A;  3D70 A;  3MIW A;  2A06 G;  1LWU C;  5CMZ A;  3H1L J;  3A0H H;  3AEC C;  1T2K D;  2QJY C;  4W80 A;  4IL6 X;  3BCC G;  2YIU B;  4C7N A;  4IFF A;  3EFF K;  3CC2 P;  1VQ8 P;  1FOS E;  3Q5R A;  1KB9 I;  2QIW A;  1VQL P;  1PPJ G;  3H32 B;  4ZKP A;  1NTZ D;  2FYN B;  3W68 A;  2QM7 A;  2FY8 A;  3L74 D;  1S9K E;  1GMJ A;  2BAS A;  3H1I J;  3F5H A;  3GHG A;  3L75 E;  5KLI B;  2QJK C;  1HH0 A;  1VQK P;  1N86 A;  1JO5 A;  2O3J A;  3AE7 C;  4N6J A;  1SQP G;  4I6M C;  3B4S A;  1PP9 G;  1ZME C;  3RK3 D;  3RL0 B;  5CBO A;  2KLU A;  2XV5 A;  4KJM A;  1KN7 A;  1NO4 A;  4UB6 E;  2JP3 A;  3ITK A;  1U7J A;  3V2R A;  3VMX A;  4QMA A;  3U1A A;  2R5D A;  4I2L C;  1RE4 A;  3C8V A;  3AEG C;  3CME P;  4ZMD A;  1WRG A;  3P8C E;  5AW5 B;  3RK3 C;  1IJD B;  3HE5 B;  3RBZ A;  3CX5 I;  3CCJ P;  2HYN A;  1EZV E;  3CX5 H;  3L71 E;  3WUT A;  2Q9I A;  2OYH A;  2FFD A;  2R32 A;  1NTK G;  1VQO P;  4U7J A;  3PJS K;  2P67 A;  5CHX A;  3M06 A;  1OVV A;  3M9Q A;  5DJT B;  1YYC A;  1KYO E;  1H0T B;  3V5B A;  4I7Z C;  2W83 C;  1DIP A;  3CWB J;  4EYY Q;  2YO3 A;  1RH5 B;  2YNY A;  1BE3 D;  3CC4 P;  3L70 D;  1VQ7 P;  1L0N G;  3IAO A;  2RMZ A;  2WT7 A;  2O1J A;  4BWN A;  2KSJ A;  3FWL A;  1PL5 A;  3MD0 A;  1SQX E;  2WPR A;  3VMA A;  2H7H A;  1H88 A;  1JTH B;  2B89 A;  2AXT H;  2NPS A;  2JR8 A;  3AE9 C;  1GW4 A;  1KC8 Q;  1D7M A;  2PFX A;  3WUU A;  4DT0 A;  1RQU A;  1QX8 A;  3HUS B;  2QM8 A;  3EWK A;  5AW2 B;  3Q5S A;  1N7S B;  2QSI A;  4IOI H;  4H13 B;  2A06 E;  5KJ7 C;  3G3Z A;  4YXD C;  1GTW A;  5KKZ B;  1QLE D;  4M3L A;  1JY2 N;  4U3F G;  3BCC E;  1LTB C;  1PZQ A;  2XDJ A;  1DX7 A;  3E1R A;  2A45 I;  5KAF H;  1YI2 P;  2SPZ A;  1FZC B;  1J1E C;  1QGK B;  1M1J A;  5AVW B;  3S1K A;  1RHZ B;  1LTJ A;  3VTP C;  3S9O A;  1EDI A;  4C7R A;  4WB4 A;  2OAR A;  3PP5 A;  1PPJ E;  3V6I A;  2ZT9 B;  1R5L A;  2OYO A;  4YXW H;  5CCG D;  1UIX A;  2YKO A;  2LXB A;  1OMI A;  2ZYD A;  3JC2 2;  4PD4 E;  2P10 A;  2Y0D A;  1ZRT D;  5KLV G;  3AE4 C;  1VF5 D;  2G8Y A;  1JY3 N;  1NU1 G;  1GK4 A;  3TNU A;  3A0H E;  1SQP E;  3H1K J;  4H44 C;  1URQ A;  1J2J B;  2KXP B;  2KSE A;  3SSU A;  1PP9 E;  2PRR A;  2W27 A;  5CCG C;  3CCE P;  5APU A;  1PP9 D;  4AUW A;  4XA4 A;  2FBW C;  4GKG A;  1U7M A;  1AA0 A;  3GF7 A;  5M1B A;  1VF5 C;  1K04 A;  4UB8 H;  1RQV A;  2IX7 C;  2CPS A;  1SQQ G;  2WPQ A;  1SFC D;  2QA4 P;  4Y28 J;  1GDT A;  1KB9 D;  1FDI A;  1W2E A;  3H6P A;  4JBZ A;  3P32 A;  1BDD A;  1FDM A;  1SQV K;  3VYI A;  3OA7 A;  4W7Y A;  1NTK E;  1SQV D;  4DOJ A;  1K73 Q;  2ZVN B;  2OYI A;  4L75 A;  4RJT A;  2WQY C;  1H89 A;  2M0B A;  1SFC C;  3FGA D;  2XKM A;  4H13 D;  1KIL B;  2J5U A;  4GDO A;  3F89 A;  1L0L D;  2OGU A;  2IZ0 A;  1N73 B;  1S2E A;  1FC2 C;  1NTZ G;  3BCC J;  2WIT A;  2V7Q H;  1L0N E;  4GOE A;  2K88 A;  1FZE A;  1LWU B;  4OGQ C;  2IFM A;  2QRX A;  5APT A;  3CI9 A;  2WSC H;  2YMK A;  3H32 A;  2Q3E A;  2ZT9 D;  3CX5 E;  2K3R A;  2P7J A;  3KHU A;  1X8Y A;  2CPB A;  1KQG B;  2BCC G;  1NKZ B;  2ZAE B;  2IFN A;  2ZXE B;  3KDP B;  5AW4 B;  3V2N A;  2Y9Z A;  1YTZ T;  1CSB A;  1NTM J;  1EDL A;  3BAS A;  1USD A;  4XFJ A;  3TF5 A;  3R2P A;  4TLF A;  3H1H G;  1L4A D;  1M7L A;  3BVH A;  4U3F E;  2QJK B;  3JSV C;  3IF4 A;  3KYQ A;  2N1T C;  3H1J J;  3H1L D;  1SQB K;  1M8O B;  2WPV B;  2DW3 A;  3GW6 A;  2P1J A;  1EXI A;  1UII A;  1MUU A;  2AXT E;  1YIT P;  1XTC C;  1YJN P;  3S4R A;  1DH3 A;  2IPP A;  3HE5 A;  1EDK A;  5AW8 B;  2E5T A;  1L4A C;  2FXP A;  1HGZ A;  3HE4 B;  2IDB A;  2GUV A;  1N2D C;  2M5A B;  5AW0 B;  1BE3 G;  3L70 G;  3KZI E;  3RK3 B;  3A5T A;  5L8R J;  1PGJ A;  4CPG A;  1NU1 E;  3H1I D;  1H0T A;  3I5C A;  5KLV D;  4ASW A;  1FAV A;  2P58 A;  1KIL D;  5APV A;  1JCD A;  1VL2 A;  3AEF C;  3NXS A;  5KAF E;  1ZW0 A;  3AE8 C;  1NJI Q;  1VPC A;  1FZB A;  1L0N J;  4KHX A;  4EIJ A;  2IZ1 A;  1G1J A;  1RF0 A;  1U57 A;  4I7Z B;  2MJZ A;  1QVF O;  1LT9 C;  3E1I A;  1R5S A;  1SQQ E;  1BGY J;  3KPE A;  1JTH A;  5C39 A;  4JQ0 D;  1IK9 A;  1VQ9 P;  1GW3 A;  1YJ9 P;  2PGD A;  1N8R Q;  2Q3I A;  4NPF X;  3D6Z A;  3RK2 B;  3MHV A;  5AW6 B;  3G9R A;  3CXH D;  4XE5 B;  3HUS A;  1ZLL A;  1R8E A;  2HG5 D;  1YBK A;  1SQB J;  4K3A A;  1X9V A;  2H43 A;  1N7S A;  3P7K A;  3CC7 P;  1Q82 Q;  2J58 A;  1NTZ E;  2ZFC A;  1Y9B A;  5H2F H;  4UB8 E;  2R3S A;  3CWB D;  3SFE C;  3L74 E;  1FZC A;  3T97 B;  1KFN A;  3MUD A;  1KB9 H;  3K5B A;  2H89 C;  1M57 D;  1BCC G;  1S1C X;  3TGU J;  2I1J A;  2WSF H;  3Q5P A;  2YMY A;  5EFW B;  4DCK A;  1J1E B;  1GU4 A;  3RK3 E;  4C46 A;  3HTK B;  2XND H;  3I56 P;  1IO4 A;  2BCC D;  3LIE A;  5E79 H;  1KOR A;  3QWO C;  3GG2 A;  1KV4 A;  2C0X A;  4GT1 A;  2W6J H;  1OWA A;  2RKL A;  2FYU J;  2YO2 A;  5AVR B;  3E7K A;  2E76 D;  1FJK A;  3HD7 D;  2E75 C;  2IYP A;  3H1H D;  4GOD A;  1CI6 B;  2WWW A;  3L73 J;  2O1K A;  4H44 B;  1FDO A;  1KD1 Q;  4W7Z A;  3B5N D;  1SQV G;  3SWK A;  3BAT A;  1SQQ J;  2IBZ I;  1T6A A;  4JPZ B;  1EC5 A;  2E76 C;  3HD7 C;  3RK2 D;  1VF5 B;  3V2P A;  3U1C A;  1L0L G;  1L2P A;  1M90 Q;  4HB1 A;  2WVR A;  1BE3 E;  3L70 E;  3B5N C;  3IFM A;  2Q6Q A;  3M0D A;  1RE3 C;  1RF1 B;  3L37 A;  1KIL A;  2BEQ D;  1KTM A;  5BU5 A;  3A0B H;  2L5G B;  3RK2 C;  1N73 A;  4Z1M H;  4GIF A;  3H1K D;  2O01 J;  3RGU A;  1XTG B;  3L74 J;  3CCU P;  1SFC B;  3Q1M A;  2RN0 A;  1QVG O;  1LWU A;  5KJ7 D;  4AQR D;  1VQP P;  3MP7 B;  1IFJ A;  4DZO A;  1SQX K;  2VRS A;  3L75 J;  1OXZ A;  3PHL A;  3BRV B;  3OAK A;  3CL3 D;  4OGQ B;  2BEZ F;  5CCH D;  1GZL A;  1KQL A;  4TT3 H;  5B5E H;  3B8E B;  3FXD A;  3FWN A;  2B9B A;  1IK7 A;  2POH A;  1JEK A;  4AYC A;  3H1L G;  2E42 A;  1IC2 A;  5APX A;  1NOH A;  2IYO A;  2OTL P;  1MKM A;  2ZYG A;  1IFI A;  1AVY A;  4OVN F;  2J59 M;  1BDC A;  1GD2 E;  1SVF A;  5AW1 B;  2A45 H;  1GU5 A;  1OX3 A;  3GF3 A; 
#chains in the Genus database with same CATH homology
 5CCH C;  5AW9 B;  1FZE A;  4Y99 B;  1LWU B;  2IFM A;  4OH8 B;  2I1K A;  1FJP A;  1NAF A;  5APT A;  3CI9 A;  2NPS D;  2WSC H;  1T8Z A;  3LW5 H;  2HPC B;  1URQ C;  3M0D C;  1GL2 B;  3H32 A;  5CJ4 A;  4LC1 A;  2C9L Y;  1KIL C;  2WPS A;  2Z4E A;  2P7J A;  3L35 A;  1X8Y A;  3V2Q A;  5APY A;  2CPB A;  3P8C D;  1JY2 P;  2KP8 A;  1N73 C;  1NKZ B;  3EFG A;  3HE4 A;  2N1T B;  3II6 A;  2IFN A;  2P2U A;  5BVZ A;  2OYI B;  1HJB A;  3L36 A;  2ZXE B;  2M8R A;  3KDP B;  1KFM A;  4I1L A;  5AW4 B;  3V2N A;  1YTZ T;  2R5B A;  3MIW A;  1CSB A;  2Z5I A;  3CLQ A;  1LT9 A;  1LWU C;  2KB7 P;  5CMZ A;  3BAS A;  3SWY A;  2FKW B;  1T2K D;  4WY4 B;  1L4A B;  1MFZ A;  2XZR A;  1GL2 C;  5AVV B;  4W80 A;  3R2P A;  1J1D B;  4WY4 D;  1L4A D;  2A45 G;  4C7N A;  1M7L A;  1NTM K;  4IFF A;  1CZQ A;  5APS A;  3BVH A;  1SQP K;  4LGD E;  2Z5H A;  3KYQ A;  2N1T C;  2HFE D;  1SQB K;  1FOS E;  1IFD A;  2OYI C;  2P1J A;  1JY3 P;  1MUU A;  2HOD A;  3H32 B;  1XTC C;  1IFN A;  4ZKP A;  1RF1 C;  1DH3 A;  4B86 A;  1HBW A;  2IPP A;  3U59 A;  2HLO A;  3HE5 A;  2QM7 A;  5AW8 B;  4WY4 C;  1L4A C;  1S9K E;  1HGZ A;  2BAS A;  1J1D C;  3HE4 B;  2FYZ A;  3GHG A;  2GUV A;  2XU6 A;  1N2D C;  1HH0 A;  1NWQ A;  1N86 A;  5AW0 B;  1JO5 A;  1LT9 B;  4IFM A;  4N6J A;  4I6M C;  1FZA A;  3RK3 B;  4ZKU A;  3A5T A;  1E5W A;  1LTI C;  3A7O A;  5AVZ B;  3I5C A;  3NFQ A;  3L4F A;  1FAV A;  3RK3 D;  1KIL D;  1NTK K;  3RL0 B;  4C7N B;  2XV5 A;  1NO4 A;  5APV A;  1PFI A;  1ZR2 A;  3MTU E;  3RL0 D;  1JCD A;  1T3J A;  3NXS A;  1FBM A;  3V2R A;  3VMX A;  1FOS F;  1FZG A;  4RES B;  3TSI A;  3U1A A;  2PP6 A;  1VPC A;  2R5D A;  4I2L C;  3C9I A;  1FZB A;  4N78 D;  1RE4 A;  4KHX A;  4EIJ A;  1HGV A;  2FXM A;  1G1J A;  2HOD B;  1RF0 A;  1WRG A;  1KZU B;  3VOP A;  2MJZ A;  3T97 A;  1LT9 C;  3P8C E;  5AW7 B;  2C9N Y;  3E1I A;  2GM4 A;  5AW5 B;  3RK3 C;  1IJD B;  3HE5 B;  3P8M C;  1GL2 D;  5KJ7 A;  3KPE A;  1JTH A;  2YKP A;  3A2A A;  1L0N K;  5AVT B;  1Z56 A;  2HYN A;  1IK9 A;  1RY3 A;  1GW3 A;  3RL0 C;  3GHG B;  1A02 F;  2Q3I A;  5KTB A;  2Q9I A;  2OYH A;  2FFD A;  2R32 A;  2N1T D;  3RK2 B;  1IFM A;  2M3B A;  4HYT B;  2P67 A;  5CHX A;  3M06 A;  5AW6 B;  1G2C A;  5AVX B;  4Y99 C;  4XE5 B;  3M9Q A;  3HTK A;  1YYC A;  3HUS A;  5CCH A;  1ZLL A;  3V5B A;  2HG5 D;  1H8A A;  1LTT C;  1X9V A;  4N3Y B;  2H43 A;  1N7S A;  3P7K A;  2YO3 A;  1VDF A;  2W6A A;  2J58 A;  2XNX A;  5AVQ B;  2R3C A;  2YNY A;  3N7N A;  1MV8 A;  1JY2 O;  3HD7 A;  4JYB A;  2Q7C A;  1NKN A;  4EOT A;  2ZFC A;  2WT7 A;  2O1J A;  2KSJ A;  2WTY A;  3MD0 A;  2WZ7 A;  5AW3 B;  1FZC A;  1KFN A;  2WPR A;  3MUD A;  1FZF A;  1G1I A;  3TK1 A;  1CI6 A;  2H7H A;  3B5N A;  3NTN A;  2O01 H;  1H88 A;  1JTH B;  3EQ2 A;  1RE3 A;  2NPS A;  1JNM A;  1QL2 A;  1GW4 A;  5CCG A;  4IFD K;  2JEE A;  2I1J A;  2WSF H;  2OYH B;  2FFD B;  1X79 B;  3VN0 A;  2YMY A;  2N9B A;  1LTS C;  3M9H A;  1J1E B;  1G2C B;  5APQ A;  1GU4 A;  3M9B A;  1A02 J;  4C46 A;  1RE4 C;  3HTK B;  1JUN A;  3HUS B;  1IO4 A;  1RF0 C;  5APW A;  3VP9 A;  3VMY A;  2QM8 A;  5BU8 B;  1HWT C;  1ZR4 A;  5AW2 B;  1N7S B;  2C0W A;  4HH2 A;  2KLV A;  1LGH B;  3LIE A;  5KJ7 C;  1N7S D;  3G3Z A;  1GTW A;  1FU1 A;  3SWF A;  2C0X A;  4GT1 A;  3V4W A;  4N78 E;  3A3Y B;  1RF1 A;  1OWA A;  1JOC A;  4JF7 A;  1L0L K;  3BRT B;  4M3L A;  1JY2 N;  3HD7 B;  2OYH C;  2FFD C;  2YO2 A;  1LTB C;  3WMM 0;  2XDJ A;  1NU1 K;  5AVU B;  5AVR B;  2WT7 B;  1DX7 A;  1FJK A;  2A45 I;  3HD7 D;  1FZC B;  1J1E C;  1M1J A;  3KQG A;  3HRN A;  5AVW B;  5AVY B;  1LTJ A;  1CI6 B;  2FYU K;  3VTP C;  1N7L A;  2WWW A;  3B5N B;  3HUS C;  2O1K A;  1T3U A;  4W7Z A;  4C7R A;  4WB4 A;  1SFC A;  2NPS B;  2OAR A;  3PP5 A;  3B5N D;  1N7S C;  3BAT A;  1EQ7 A;  3TYY A;  5CCG D;  2YKO A;  3HD7 C;  5AVS B;  3RK2 D;  3V2P A;  3MGN A;  1SQQ K;  2WSE H;  1QL1 A;  3O8Z A;  3U1C A;  1FZC C;  1DEB A;  1JY3 N;  1MZ9 A;  1GK4 A;  3TNU A;  2E43 A;  3B5N C;  3IFM A;  1URQ A;  1J2J B;  3M0D A;  1RE3 C;  2NPS C;  1RF1 B;  3L37 A;  1HVV A;  5CJ0 A;  2W27 A;  5CCG C;  1KIL A;  3GHG C;  3VMZ A;  1ZN5 A;  5BU5 A;  2Q5U A;  2L5G B;  5APU A;  2KOG A;  4AUW A;  4XA4 A;  2KYV A;  3RK2 C;  1N73 A;  4GKG A;  1JCC A;  1M1J B;  1AQ5 A;  1CW5 A;  4GIF A;  1LTJ B;  1HUC A;  1XTG B;  1WT6 A;  2JJL A;  2IX7 C;  2CPS A;  1SFC B;  3NMD A;  1ZV8 A;  1LWU A;  2WPQ A;  5KJ7 D;  4WBA A;  1SFC D;  1NTZ K;  4AQR D;  2HPC A;  1GDT A;  4O9B A;  1GL2 A;  1W2E A;  2YKQ A;  1HTL C;  1T2K C;  1IFJ A;  2H8P D;  4DZO A;  1JMM A;  3H6P A;  1SQX K;  2VRS A;  1OXZ A;  2W6B A;  3IR9 A;  3BRV B;  3P32 A;  1FDM A;  1SQV K;  3UIA A;  3VYI A;  3OA7 A;  4W7Y A;  3VP8 A;  3OAK A;  3CL3 D;  2N1T A;  2LKM A;  1M1J C;  1JY3 O;  4DOJ A;  3M91 A;  1S9K D;  3OJA B;  1NHL A;  1GZL A;  4JYC A;  5CCH D;  1SLQ A;  3TNU B;  1LTJ C;  1KQL A;  4LLH A;  2OYI A;  1LTA C;  3B8E B;  1URQ B;  1H89 A;  1SFC C;  2XKM A;  2POH A;  4AYC A;  2E42 A;  1IC2 A;  1URQ D;  1KIL B;  1YTZ I;  5KLV K;  2GUS A;  1NH4 A;  3N4X A;  5APX A;  1LTG C;  1NOH A;  4WY4 A;  1L4A A;  3LID A;  1IFI A;  2PAJ A;  1N73 B;  1SP4 A;  2J59 M;  2WIT A;  3V4Q A;  1GD2 E;  1AFO A;  1SVF A;  5AW1 B;  3M0A A;  2A45 H;  1GU5 A;  1GK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...