3WMUA

The structure of an anti-cancer lectin mytilec apo-form from the mussel mytilus galloprovincialis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
151
Chain Sequence
b'HMATFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYVHPKGGSTNPPNETLTVMHGDKHGAMEFIFVSPKNKDKRVLVYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Crystal structure of MytiLec, a galactose-binding lectin from the mussel Mytilus galloprovincialis with cytotoxicity against certain cancer cell types
pubmed doi rcsb
source organism Mytilus galloprovincialis
molecule tags Sugar binding protein
total genus 40
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3wmuA00
1FV3A 3P53A 4IHZA 1S0DA 5JMCA 4I0YA 3UJ4A 2K4AB 1AFCA 1JY0A 3HBWA 3FJFA 4L4IA 3AKFA 3VEQA 4QBVA 5DVHA 2R9KB 3JUTA 3O3QA 3WO4A 4HJJA 2VSAA 2AXMA 3LLPA 4DEPA 3CA4A 4ISQA 3FUQA 1W3AA 1JLXA 4I3NA 3FJKA 1BFGA 2D1ZA 5JLVA 5F90A 2XOAA 4P0JA 2BFHA 1EYLA 1ISVA 4Z9WB 5E24E 5I1BA 1ONKB 4QKSA 1FWVA 3BAHA 1TFMB 1M16A 4TLPA 3LTQA 2ERMA 2DS0A 3W9TA 1DQOA 1TIEA 2VXTI 3MALA 4J2KA 3HOMA 1BFCA 1PWAA 2GO2A 3CRIA 3HN1A 2IWTB 4G6MA 3WO3A 1DZDA 1RMLA 3OBTA 4I4VA 1XG6A 2DRZA 4IZEA 1FMZA 2F2FA 3CAHA 4I2SA 3UJ0A 3QYDA 4QKRA 2E4MA 1V6UA 2Q9XA 1XYFA 4XFSA 4OW4A 2UUSA 3O5WB 3I2XA 2D7RA 3V0BA 4G9NA 4P6AA 1FMMS 3FJBA 2KI4A 1R8OA 3FJAA 3SNVA 5GAQA 5BXPA 4I96A 1FQ9A 3N7MA 3V0BB 1IRPA 4WBCA 3H6QA 4J23B 4XFTA 5D61A 3WINA 1HWNB 4J2SA 2IHOA 2VXRA 5FNXA 4EFPA 1JQZA 2Y9GA 3FJHA 2ESUA 2FDBM 1GGPB 1MC9A 4QD2B 4OEEA 2NTDA 4ZBVB 2AFGA 3IM7A 3QR5A 1T4QA 4OEFA 4Q9PA 1Z4SA 3O4BA 4GOVA 1FN0A 4ZA3B 1S0EA 3Q7YA 4JKQA 1G9BA 4JKXB 4LO7C 3RSJA 1S0LA 4XFUA 4CJMA 4X3AA 4EFQA 3VT2A 5DZUA 1BFBA 2K8RA 1K5UA 1FGAA 5BQUA 1S0CA 4L4HA 1FWUA 3AH4A 2KH2A 5FZUA 4KEIA 1TWMA 2VSEA 2VLCA 4LO0A 4ZKTB 3BB2A 1IT0A 3CA6A 1HIBA 3WMUA 4A7YA 4I37A 1N4KA 4ZFWB 2D20A 8I1BA 3IAGC 3VT1A 3FUOA 3P6JA 2Z48A 3A22A 4ZOTA 4IQPA 5BP5A 1TTUA 2NM1A 3AZWA 1M2TB 4H04A 3CRGA 3BA7A 5FNWA 3BRFA 1EV2A 1EVTA 4LO1A 4ZFUB 4X38A 3FJEA 4X39A 3OGFA 5BXTA 1QQLA 4A7ZA 1XZZA 1IOBA 2RQ9A 3AKGA 2J3PA 4I4YA 4JP0A 3OBRA 4IZXA 4A7KA 1SR4A 3FGMA 3O4CA 1JTCA 4I1EA 1AVWB 3BRGC 3BAOA 1II4A 3POKA 4I7IA 4P0LA 3V79C 2NZ9A 3CA3A 5G00A 4HR6C 1PUMB 3O4DA 1E0OA 2VU9A 4OUJA 2BEBA 3P6IA 5D63A 5FZYA 1VCLA 2M49A 2Y9FA 1W3GA 4HA2A 4F83A 1AVAC 1DFCA 2F2FC 4I4RA 4OWLA 2BEAA 3PG0A 3FJ8A 4GAIA 2P39A 1JLYA 2NP0A 2AAIB 5FZZA 1BASA 1DQGA 4EEEB 2VUAA 1BA7A 4ZGRB 3AJ5A 3FFZA 4Q9GA 4GP3A 41BIA 1DZCA 2DREA 3IM5A 1HWPB 4D8HA 1ISXA 4G9MA 1IJTA 3PMEA 3BAUA 4EFRA 3ZC9A 4I4OA 3TC2A 1ISYA 3CA0A 4I4SA 4OWJA 3RTJB 3VSFA 1DJSB 1ITBA 4IY8A 5F8YA 2HWAA 1JT5A 3I2AA 5HPZA 3HALA 3FJJA 1TP0A 2AQZA 2YUGA 3N7KA 1Q1UA 2D24A 3WINC 1RY7A 1AVXB 3WA1A 1RG8A 5B2HA 4I8MA 4JQ0A 3N7LA 3AH1A 4FGFA 2HWMA 1UPSA 1I1EA 3R4SA 1T9FA 1HCDA 4KEJA 3PUBA 2HZ9A 5DSSB 3WO2A 4PC4A 4QBCA 3RMYA 1G9DA 1V6WA 3HSMA 3E8LC 4GP0A 2RG9B 5F8SA 1J0SA 3D7WB 3AJ6A 4LO2A 3CA1A 3H6RB 1HWOB 1Z2VA 3UDAA 3WMVA 3O44A 2Y9XE 1IHKA 4I6IA 3NBCA 3ZC8A 5BOWA 5EHAA 1DFQA 3CU1B 3BAGA 1YXWA 4FVVA 3VSZA 5BXRA 1G9AA 4LO3C 1HCEA 2MLLB 1ISZA 1WBAA 1NUNA 2FFUA 2F8XC 2LIQA 1CE7B 1D0HA 4GAFA 4OWKA 2NYYA 1P63A 2L5XA 1KNMA 1YBIA 4KC3A 3B9UA 1RZOB 1YTOA 3F62B 3FJ9A 3AKIA 5BP5C 5BXSA 2KKIA 2GZBA 1S0GA 3BAVA 3OJ2A 4AN6A 4DCKC 4QALA 3VT0A 2FGFA 4DENA 1NZKA 3JRRA 7I1BA 1Q04A 4I1BA 1YYNA 9ILBA 3T8SA 4OEGA 3AZVA 5BVPI 31BIA 4I4XA 1A8DA 4GOYA 4II0A 4LO7B 1BFFA 1L2HA 2D43A 3V0AA 2MC2A 1SR4C 2X2TA 3AKHA 1MD6A 3VWCA 2D22A 4KEKA 1I1BA 4H9WA 4R6UB 1Q03A 3V0AB 2QN4A 1V6VA 1V6XA 2X2SA 3C9ZA 1EPWA 3I29B 3K1XA 3UD8A 4ZLBB 1W3FA 1G9CA 2NVHA 1BARA 3OJMA 3FJCA 1DLLA 3CRHA 3NBEA 4IYBA 1AF9A 3BA5A 5D62A 1WD3A 4I4UA 3ZXGA 4IY9A 4JPZA 1OQLB 1PC8B 1YF8B 2D23A 3N7JA 3PHZA 3UD7A 2E4MC 1JT4A 2D44A 4I4PA 1SZ6B 1S0BA 2Y9WC 21BIA 4IONA 1PUUB 1DIWA 2P23A 4USOA 3OGGA 3IIRA 2I1BA 3A23A 3BADA 1HWMB 1S0FA 3CQAA 3KMVA 4Q91A 3F1RA 1WD4A 2QYIB 2FO1A 3BRDA 2LIEA 1F31A 1QXMA 4F34A 6I1BA 2Z49A 4QD2C 3NBDA 4USPA 4JAWA 3O49A 1JT3A 4X37A 1ISWA 1AVUA 2FFVA 3FJDA 2ET2A 3H6SE 2ZR1B 2D7IA 2MIBA 3N0KA 4I4QA 4D0ZA 2ZQNA 3Q7WA 4XKIA 3VUOA 4J2XA 2DRYA 4LO2C 3H6RA 3BAQA 1QQKA 3HMYA 3A07A 4EB2B 3BX1C 5EC5A 4Z8SB 4ZFYB 2K43A 5DUYA 3O4AA 1ILR1 5F8WA 3Q7XA 2KLLA 3O4OA 1K5VA 4JRAA 1IRAX 1G82A 5BQUC 4ISRA 4J2YA 3IM6A 3RTIB 1CVSA 1WBCA 3OJVA 3FJIA 3A21A 4QC4A 1R8NA 1TOOA 1Z0HA 3ZXDA 4AN7B 4LO0C 4G1RA 1JT7A 3EF2A 3MPPG 3AH2A 5EG6C 2RSTA 3NBNA 4EKXB 1PZZA 1IILA 1AXMA 3NJ5A 4KBBA 2WBCA 3RMXA 3R4UA 4LO8B 1XHBA 2Q3NB 4G6JA 3ZX7A 3BTAA 1ABRB 2ZQOA 3S8KA 1FV2A 1BLAA 3UD9A 2WRYA 1TWEA 4P0KA 4QO3A 3ILAA 4LO1C 4YOLA 4D0TA 3S8JA 1HKNA 3CA5A 2HW9A 4LO3A 4ENDA 1BLDA 3BA4A 2KI6B
chains in the Genus database with same CATH superfamily
1FV3A 3P53A 4IHZA 1S0DA 5JMCA 4I0YA 3UJ4A 2K4AB 1AFCA 1JY0A 3HBWA 3FJFA 4L4IA 3AKFA 3VEQA 4QBVA 5DVHA 2R9KB 3JUTA 3O3QA 4MZHA 3WO4A 4HJJA 2VSAA 2AXMA 3LLPA 4DEPA 3CA4A 4ISQA 3FUQA 1W3AA 1JLXA 4I3NA 3FJKA 1BFGA 2D1ZA 5JLVA 5F90A 2XOAA 4P0JA 2BFHA 1EYLA 1ISVA 4Z9WB 5E24E 5I1BA 1ONKB 4QKSA 1FWVA 3BAHA 1TFMB 1M16A 4TLPA 3LTQA 2ERMA 2DS0A 3W9TA 1DQOA 1TIEA 2VXTI 3MALA 4J2KA 3HOMA 1BFCA 1PWAA 2GO2A 3CRIA 3HN1A 2IWTB 4G6MA 3WO3A 4MZFB 1DZDA 1RMLA 3OBTA 4I4VA 1XG6A 2DRZA 4IZEA 1FMZA 2F2FA 3CAHA 4I2SA 3UJ0A 3QYDA 4QKRA 2E4MA 1V6UA 2Q9XA 1XYFA 4XFSA 4OW4A 4UY4A 2UUSA 3O5WB 3I2XA 2D7RA 3V0BA 4G9NA 4P6AA 1FMMS 3FJBA 2KI4A 1R8OA 3FJAA 3SNVA 5GAQA 5BXPA 4I96A 1FQ9A 3N7MA 3V0BB 1IRPA 4WBCA 3H6QA 4J23B 4XFTA 5D61A 3WINA 1HWNB 2NS2A 4J2SA 2IHOA 2VXRA 5FNXA 4EFPA 1JQZA 2Y9GA 3FJHA 2ESUA 2FDBM 1GGPB 1MC9A 4QD2B 4OEEA 2NTDA 4ZBVB 2AFGA 3IM7A 3QR5A 1T4QA 4OEFA 4Q9PA 1Z4SA 3O4BA 4GOVA 1FN0A 4ZA3B 1S0EA 3Q7YA 4JKQA 1G9BA 4JKXB 4LO7C 3RSJA 1S0LA 4XFUA 4CJMA 4X3AA 4EFQA 3VT2A 5DZUA 1BFBA 2K8RA 1K5UA 1FGAA 5BQUA 1S0CA 4L4HA 1FWUA 3AH4A 2KH2A 5FZUA 4KEIA 1TWMA 2VSEA 2VLCA 4LO0A 4ZKTB 3BB2A 1IT0A 3CA6A 1HIBA 3WMUA 4A7YA 4I37A 1N4KA 4ZFWB 2D20A 8I1BA 3IAGC 3VT1A 3FUOA 3P6JA 2Z48A 3A22A 4ZOTA 4IQPA 5BP5A 1TTUA 2NM1A 3AZWA 1M2TB 4H04A 3CRGA 3BA7A 5FNWA 3BRFA 1EV2A 1EVTA 4LO1A 4ZFUB 4X38A 3FJEA 4X39A 3OGFA 5BXTA 1QQLA 4A7ZA 1XZZA 1IOBA 2RQ9A 3AKGA 2J3PA 4I4YA 4JP0A 3OBRA 4IZXA 4A7KA 1SR4A 3FGMA 3O4CA 1JTCA 4I1EA 1AVWB 3BRGC 3BAOA 1II4A 3POKA 4I7IA 4P0LA 3V79C 2NZ9A 3CA3A 5G00A 4HR6C 1PUMB 3O4DA 1E0OA 2VU9A 4OUJA 2BEBA 3P6IA 5D63A 5FZYA 1VCLA 2M49A 2Y9FA 1W3GA 4HA2A 4F83A 1AVAC 1DFCA 2F2FC 4I4RA 4OWLA 2BEAA 3PG0A 3FJ8A 4GAIA 2P39A 1JLYA 2NP0A 2AAIB 5FZZA 1BASA 1DQGA 4EEEB 2VUAA 1BA7A 4ZGRB 3AJ5A 3FFZA 4Q9GA 4GP3A 41BIA 1DZCA 2DREA 3IM5A 1HWPB 4D8HA 1ISXA 4G9MA 1IJTA 3PMEA 3BAUA 4EFRA 3ZC9A 4I4OA 3TC2A 1ISYA 3CA0A 4I4SA 4OWJA 3RTJB 3VSFA 1DJSB 1ITBA 4IY8A 5F8YA 2HWAA 1JT5A 3I2AA 5HPZA 3HALA 3FJJA 1TP0A 2AQZA 2YUGA 3N7KA 1Q1UA 2D24A 3WINC 1RY7A 1AVXB 3WA1A 1RG8A 5B2HA 4I8MA 4JQ0A 3N7LA 3AH1A 4FGFA 2HWMA 1UPSA 1I1EA 3R4SA 1T9FA 1HCDA 4KEJA 3PUBA 2HZ9A 5DSSB 3WO2A 4PC4A 4QBCA 3RMYA 1G9DA 1V6WA 3HSMA 3E8LC 4GP0A 2RG9B 5F8SA 1J0SA 3D7WB 3AJ6A 4LO2A 3CA1A 3H6RB 1HWOB 1Z2VA 3UDAA 3WMVA 3O44A 2Y9XE 1IHKA 4I6IA 3NBCA 3ZC8A 5BOWA 5EHAA 1DFQA 3CU1B 3BAGA 1YXWA 4FVVA 3VSZA 5BXRA 1G9AA 4LO3C 1HCEA 2MLLB 1ISZA 1WBAA 1NUNA 2FFUA 2F8XC 2LIQA 1CE7B 1D0HA 4GAFA 4OWKA 2NYYA 1P63A 2L5XA 1KNMA 1YBIA 4KC3A 3B9UA 1RZOB 1YTOA 3F62B 3FJ9A 3AKIA 5BP5C 5BXSA 2KKIA 2GZBA 1S0GA 3BAVA 3OJ2A 4AN6A 4DCKC 4QALA 3VT0A 2FGFA 4DENA 1NZKA 3JRRA 7I1BA 1Q04A 4I1BA 1YYNA 9ILBA 3T8SA 4OEGA 3AZVA 5BVPI 31BIA 4I4XA 1A8DA 4GOYA 4II0A 4LO7B 4H75A 1BFFA 1L2HA 2D43A 3V0AA 2MC2A 1SR4C 2X2TA 3AKHA 1MD6A 3VWCA 2D22A 4KEKA 1I1BA 4H9WA 4R6UB 1Q03A 3V0AB 2QN4A 1V6VA 1V6XA 2X2SA 3C9ZA 1EPWA 3I29B 3K1XA 3UD8A 4ZLBB 1W3FA 1G9CA 2NVHA 1BARA 3OJMA 3FJCA 1DLLA 3CRHA 3NBEA 4IYBA 1AF9A 3BA5A 5D62A 1WD3A 4I4UA 3ZXGA 4IY9A 4JPZA 1OQLB 1PC8B 1YF8B 2D23A 3N7JA 3PHZA 3UD7A 2E4MC 1JT4A 2D44A 4I4PA 1SZ6B 1S0BA 2Y9WC 21BIA 4IONA 1PUUB 1DIWA 2P23A 4USOA 3OGGA 3IIRA 2I1BA 3A23A 3BADA 1HWMB 1S0FA 3CQAA 3KMVA 4Q91A 3F1RA 1WD4A 2QYIB 2FO1A 3BRDA 2LIEA 1F31A 1QXMA 4F34A 6I1BA 2Z49A 4QD2C 3NBDA 4USPA 4JAWA 3O49A 1JT3A 4X37A 1ISWA 1AVUA 2FFVA 3FJDA 2ET2A 3H6SE 2ZR1B 2D7IA 2MIBA 3N0KA 4I4QA 4D0ZA 2ZQNA 3Q7WA 4XKIA 3VUOA 4J2XA 4MZGB 2DRYA 4LO2C 3H6RA 3BAQA 1QQKA 3HMYA 3A07A 4EB2B 3BX1C 5EC5A 4Z8SB 4ZFYB 2K43A 5DUYA 3O4AA 1ILR1 5F8WA 3Q7XA 2KLLA 3O4OA 1K5VA 4JRAA 1IRAX 1G82A 5BQUC 4ISRA 4J2YA 3IM6A 3RTIB 1CVSA 1WBCA 3OJVA 3FJIA 3A21A 4QC4A 1R8NA 1TOOA 1Z0HA 3ZXDA 4AN7B 4LO0C 4G1RA 1JT7A 3EF2A 3MPPG 3AH2A 5EG6C 2RSTA 3NBNA 4EKXB 1PZZA 1IILA 1AXMA 3NJ5A 4KBBA 2WBCA 3RMXA 3R4UA 4LO8B 1XHBA 2Q3NB 4G6JA 3ZX7A 3BTAA 1ABRB 2ZQOA 3S8KA 1FV2A 1BLAA 3UD9A 2WRYA 1TWEA 4P0KA 4QO3A 3ILAA 4LO1C 4YOLA 4D0TA 3S8JA 1HKNA 3CA5A 2HW9A 4LO3A 4ENDA 1BLDA 3BA4A 2KI6B
chains in the Genus database with same CATH topology
1FV3A 3P53A 4IHZA 1S0DA 5JMCA 4I0YA 3UJ4A 2K4AB 1AFCA 1JY0A 3HBWA 3FJFA 4L4IA 3AKFA 3VEQA 4QBVA 5DVHA 2R9KB 3JUTA 3O3QA 4MZHA 3WO4A 4HJJA 2VSAA 2AXMA 3LLPA 4DEPA 3CA4A 4ISQA 3FUQA 1W3AA 1JLXA 4I3NA 3FJKA 1BFGA 2D1ZA 5JLVA 5F90A 2XOAA 4P0JA 2BFHA 1EYLA 1ISVA 4Z9WB 5E24E 5I1BA 1ONKB 4QKSA 1FWVA 3BAHA 1TFMB 1M16A 4TLPA 3LTQA 2ERMA 2DS0A 3W9TA 1DQOA 1TIEA 2VXTI 3MALA 4J2KA 3HOMA 1BFCA 1PWAA 2GO2A 3CRIA 3HN1A 2IWTB 4G6MA 3WO3A 4MZFB 1DZDA 1RMLA 3OBTA 4I4VA 1XG6A 2DRZA 4IZEA 1FMZA 2F2FA 3CAHA 4I2SA 3UJ0A 3QYDA 4QKRA 2E4MA 1V6UA 2Q9XA 1XYFA 4XFSA 4OW4A 4UY4A 2UUSA 3O5WB 3I2XA 2D7RA 3V0BA 4G9NA 4P6AA 1FMMS 3FJBA 2KI4A 1R8OA 3FJAA 3SNVA 5GAQA 5BXPA 4I96A 1FQ9A 3N7MA 3V0BB 1IRPA 4WBCA 3H6QA 4J23B 4XFTA 5D61A 3WINA 1HWNB 2NS2A 4J2SA 2IHOA 2VXRA 5FNXA 4EFPA 1JQZA 2Y9GA 3FJHA 2ESUA 2FDBM 1GGPB 1MC9A 4QD2B 4OEEA 2NTDA 4ZBVB 2AFGA 3IM7A 3QR5A 1T4QA 4OEFA 4Q9PA 1Z4SA 3O4BA 4GOVA 1FN0A 4ZA3B 1S0EA 3Q7YA 4JKQA 1G9BA 4JKXB 4LO7C 3RSJA 1S0LA 4XFUA 4CJMA 4X3AA 4EFQA 3VT2A 5DZUA 1BFBA 2K8RA 1K5UA 1FGAA 5BQUA 1S0CA 4L4HA 1FWUA 3AH4A 2KH2A 5FZUA 4KEIA 1TWMA 2VSEA 2VLCA 4LO0A 4ZKTB 3BB2A 1IT0A 3CA6A 1HIBA 3WMUA 4A7YA 4I37A 1N4KA 4ZFWB 2D20A 8I1BA 3IAGC 3VT1A 3FUOA 3P6JA 2Z48A 3A22A 4ZOTA 4IQPA 5BP5A 1TTUA 2NM1A 3AZWA 1M2TB 4H04A 3CRGA 3BA7A 5FNWA 3BRFA 1EV2A 1EVTA 4LO1A 4ZFUB 4X38A 3FJEA 4X39A 3OGFA 5BXTA 1QQLA 4A7ZA 1XZZA 1IOBA 2RQ9A 3AKGA 2J3PA 4I4YA 4JP0A 3OBRA 4IZXA 4A7KA 1SR4A 3FGMA 3O4CA 1JTCA 4I1EA 1AVWB 3BRGC 3BAOA 1II4A 3POKA 4I7IA 4P0LA 3V79C 2NZ9A 3CA3A 5G00A 4HR6C 1PUMB 3O4DA 1E0OA 2VU9A 4OUJA 2BEBA 3P6IA 5D63A 5FZYA 1VCLA 2M49A 2Y9FA 1W3GA 4HA2A 4F83A 1AVAC 1DFCA 2F2FC 4I4RA 4OWLA 2BEAA 3PG0A 3FJ8A 4GAIA 2P39A 1JLYA 2NP0A 2AAIB 5FZZA 1BASA 1DQGA 4EEEB 2VUAA 1BA7A 4ZGRB 3AJ5A 3FFZA 4Q9GA 4GP3A 41BIA 1DZCA 2DREA 3IM5A 1HWPB 4D8HA 1ISXA 4G9MA 1IJTA 3PMEA 3BAUA 4EFRA 3ZC9A 4I4OA 3TC2A 1ISYA 3CA0A 4I4SA 4OWJA 3RTJB 3VSFA 1DJSB 1ITBA 4IY8A 5F8YA 2HWAA 1JT5A 3I2AA 5HPZA 3HALA 3FJJA 1TP0A 2AQZA 2YUGA 3N7KA 1Q1UA 2D24A 3WINC 1RY7A 1AVXB 3WA1A 1RG8A 5B2HA 4I8MA 4JQ0A 3N7LA 3AH1A 4FGFA 2HWMA 1UPSA 1I1EA 3R4SA 1T9FA 1HCDA 4KEJA 3PUBA 2HZ9A 5DSSB 3WO2A 4PC4A 4QBCA 3RMYA 1G9DA 1V6WA 3HSMA 3E8LC 4GP0A 2RG9B 5F8SA 1J0SA 3D7WB 3AJ6A 4LO2A 3CA1A 3H6RB 1HWOB 1Z2VA 3UDAA 3WMVA 3O44A 2Y9XE 1IHKA 4I6IA 3NBCA 3ZC8A 5BOWA 5EHAA 1DFQA 3CU1B 3BAGA 1YXWA 4FVVA 3VSZA 5BXRA 1G9AA 4LO3C 1HCEA 2MLLB 1ISZA 1WBAA 1NUNA 2FFUA 2F8XC 2LIQA 1CE7B 1D0HA 4GAFA 4OWKA 2NYYA 1P63A 2L5XA 1KNMA 1YBIA 4KC3A 3B9UA 1RZOB 1YTOA 3F62B 3FJ9A 3AKIA 5BP5C 5BXSA 2KKIA 2GZBA 1S0GA 3BAVA 3OJ2A 4AN6A 4DCKC 4QALA 3VT0A 2FGFA 4DENA 1NZKA 3JRRA 7I1BA 1Q04A 4I1BA 1YYNA 9ILBA 3T8SA 4OEGA 3AZVA 5BVPI 31BIA 4I4XA 1A8DA 4GOYA 4II0A 4LO7B 4H75A 1BFFA 1L2HA 2D43A 3V0AA 2MC2A 1SR4C 2X2TA 3AKHA 1MD6A 3VWCA 2D22A 4KEKA 1I1BA 4H9WA 4R6UB 1Q03A 3V0AB 2QN4A 1V6VA 1V6XA 2X2SA 3C9ZA 1EPWA 3I29B 3K1XA 3UD8A 4ZLBB 1W3FA 1G9CA 2NVHA 1BARA 3OJMA 3FJCA 1DLLA 3CRHA 3NBEA 4IYBA 1AF9A 3BA5A 5D62A 1WD3A 4I4UA 3ZXGA 4IY9A 4JPZA 1OQLB 1PC8B 1YF8B 2D23A 3N7JA 3PHZA 3UD7A 2E4MC 1JT4A 2D44A 4I4PA 1SZ6B 1S0BA 2Y9WC 21BIA 4IONA 1PUUB 1DIWA 2P23A 4USOA 3OGGA 3IIRA 2I1BA 3A23A 3BADA 1HWMB 1S0FA 3CQAA 3KMVA 4Q91A 3F1RA 1WD4A 2QYIB 2FO1A 3BRDA 2LIEA 1F31A 1QXMA 4F34A 6I1BA 2Z49A 4QD2C 3NBDA 4USPA 4JAWA 3O49A 1JT3A 4X37A 1ISWA 1AVUA 2FFVA 3FJDA 2ET2A 3H6SE 2ZR1B 2D7IA 2MIBA 3N0KA 4I4QA 4D0ZA 2ZQNA 3Q7WA 4XKIA 3VUOA 4J2XA 4MZGB 2DRYA 4LO2C 3H6RA 3BAQA 1QQKA 3HMYA 3A07A 4EB2B 3BX1C 5EC5A 4Z8SB 4ZFYB 2K43A 5DUYA 3O4AA 1ILR1 5F8WA 3Q7XA 2KLLA 3O4OA 1K5VA 4JRAA 1IRAX 1G82A 5BQUC 4ISRA 4J2YA 3IM6A 3RTIB 1CVSA 1WBCA 3OJVA 3FJIA 3A21A 4QC4A 1R8NA 1TOOA 1Z0HA 3ZXDA 4AN7B 4LO0C 4G1RA 1JT7A 3EF2A 3MPPG 3AH2A 5EG6C 2RSTA 3NBNA 4EKXB 1PZZA 1IILA 1AXMA 3NJ5A 4KBBA 2WBCA 3RMXA 3R4UA 4LO8B 1XHBA 2Q3NB 4G6JA 3ZX7A 3BTAA 1ABRB 2ZQOA 3S8KA 1FV2A 1BLAA 3UD9A 2WRYA 1TWEA 4P0KA 4QO3A 3ILAA 4LO1C 4YOLA 4D0TA 3S8JA 1HKNA 3CA5A 2HW9A 4LO3A 4ENDA 1BLDA 3BA4A 2KI6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FV3 A;  3P53 A;  4IHZ A;  1S0D A;  5JMC A;  4I0Y A;  3UJ4 A;  2K4A B;  1AFC A;  1JY0 A;  3HBW A;  3FJF A;  4L4I A;  3AKF A;  3VEQ A;  4QBV A;  5DVH A;  2R9K B;  3JUT A;  3O3Q A;  3WO4 A;  4HJJ A;  2VSA A;  2AXM A;  3LLP A;  4DEP A;  3CA4 A;  4ISQ A;  3FUQ A;  1W3A A;  1JLX A;  4I3N A;  3FJK A;  1BFG A;  2D1Z A;  5JLV A;  5F90 A;  2XOA A;  4P0J A;  2BFH A;  1EYL A;  1ISV A;  4Z9W B;  5E24 E;  5I1B A;  1ONK B;  4QKS A;  1FWV A;  3BAH A;  1TFM B;  1M16 A;  4TLP A;  3LTQ A;  2ERM A;  2DS0 A;  3W9T A;  1DQO A;  1TIE A;  2VXT I;  3MAL A;  4J2K A;  3HOM A;  1BFC A;  1PWA A;  2GO2 A;  3CRI A;  3HN1 A;  2IWT B;  4G6M A;  3WO3 A;  1DZD A;  1RML A;  3OBT A;  4I4V A;  1XG6 A;  2DRZ A;  4IZE A;  1FMZ A;  2F2F A;  3CAH A;  4I2S A;  3UJ0 A;  3QYD A;  4QKR A;  2E4M A;  1V6U A;  2Q9X A;  1XYF A;  4XFS A;  4OW4 A;  2UUS A;  3O5W B;  3I2X A;  2D7R A;  3V0B A;  4G9N A;  4P6A A;  1FMM S;  3FJB A;  2KI4 A;  1R8O A;  3FJA A;  3SNV A;  5GAQ A;  5BXP A;  4I96 A;  1FQ9 A;  3N7M A;  3V0B B;  1IRP A;  4WBC A;  3H6Q A;  4J23 B;  4XFT A;  5D61 A;  3WIN A;  1HWN B;  4J2S A;  2IHO A;  2VXR A;  5FNX A;  4EFP A;  1JQZ A;  2Y9G A;  3FJH A;  2ESU A;  2FDB M;  1GGP B;  1MC9 A;  4QD2 B;  4OEE A;  2NTD A;  4ZBV B;  2AFG A;  3IM7 A;  3QR5 A;  1T4Q A;  4OEF A;  4Q9P A;  1Z4S A;  3O4B A;  4GOV A;  1FN0 A;  4ZA3 B;  1S0E A;  3Q7Y A;  4JKQ A;  1G9B A;  4JKX B;  4LO7 C;  3RSJ A;  1S0L A;  4XFU A;  4CJM A;  4X3A A;  4EFQ A;  3VT2 A;  5DZU A;  1BFB A;  2K8R A;  1K5U A;  1FGA A;  5BQU A;  1S0C A;  4L4H A;  1FWU A;  3AH4 A;  2KH2 A;  5FZU A;  4KEI A;  1TWM A;  2VSE A;  2VLC A;  4LO0 A;  4ZKT B;  3BB2 A;  1IT0 A;  3CA6 A;  1HIB A;  3WMU A;  4A7Y A;  4I37 A;  1N4K A;  4ZFW B;  2D20 A;  8I1B A;  3IAG C;  3VT1 A;  3FUO A;  3P6J A;  2Z48 A;  3A22 A;  4ZOT A;  4IQP A;  5BP5 A;  1TTU A;  2NM1 A;  3AZW A;  1M2T B;  4H04 A;  3CRG A;  3BA7 A;  5FNW A;  3BRF A;  1EV2 A;  1EVT A;  4LO1 A;  4ZFU B;  4X38 A;  3FJE A;  4X39 A;  3OGF A;  5BXT A;  1QQL A;  4A7Z A;  1XZZ A;  1IOB A;  2RQ9 A;  3AKG A;  2J3P A;  4I4Y A;  4JP0 A;  3OBR A;  4IZX A;  4A7K A;  1SR4 A;  3FGM A;  3O4C A;  1JTC A;  4I1E A;  1AVW B;  3BRG C;  3BAO A;  1II4 A;  3POK A;  4I7I A;  4P0L A;  3V79 C;  2NZ9 A;  3CA3 A;  5G00 A;  4HR6 C;  1PUM B;  3O4D A;  1E0O A;  2VU9 A;  4OUJ A;  2BEB A;  3P6I A;  5D63 A;  5FZY A;  1VCL A;  2M49 A;  2Y9F A;  1W3G A;  4HA2 A;  4F83 A;  1AVA C;  1DFC A;  2F2F C;  4I4R A;  4OWL A;  2BEA A;  3PG0 A;  3FJ8 A;  4GAI A;  2P39 A;  1JLY A;  2NP0 A;  2AAI B;  5FZZ A;  1BAS A;  1DQG A;  4EEE B;  2VUA A;  1BA7 A;  4ZGR B;  3AJ5 A;  3FFZ A;  4Q9G A;  4GP3 A;  41BI A;  1DZC A;  2DRE A;  3IM5 A;  1HWP B;  4D8H A;  1ISX A;  4G9M A;  1IJT A;  3PME A;  3BAU A;  4EFR A;  3ZC9 A;  4I4O A;  3TC2 A;  1ISY A;  3CA0 A;  4I4S A;  4OWJ A;  3RTJ B;  3VSF A;  1DJS B;  1ITB A;  4IY8 A;  5F8Y A;  2HWA A;  1JT5 A;  3I2A A;  5HPZ A;  3HAL A;  3FJJ A;  1TP0 A;  2AQZ A;  2YUG A;  3N7K A;  1Q1U A;  2D24 A;  3WIN C;  1RY7 A;  1AVX B;  3WA1 A;  1RG8 A;  5B2H A;  4I8M A;  4JQ0 A;  3N7L A;  3AH1 A;  4FGF A;  2HWM A;  1UPS A;  1I1E A;  3R4S A;  1T9F A;  1HCD A;  4KEJ A;  3PUB A;  2HZ9 A;  5DSS B;  3WO2 A;  4PC4 A;  4QBC A;  3RMY A;  1G9D A;  1V6W A;  3HSM A;  3E8L C;  4GP0 A;  2RG9 B;  5F8S A;  1J0S A;  3D7W B;  3AJ6 A;  4LO2 A;  3CA1 A;  3H6R B;  1HWO B;  1Z2V A;  3UDA A;  3WMV A;  3O44 A;  2Y9X E;  1IHK A;  4I6I A;  3NBC A;  3ZC8 A;  5BOW A;  5EHA A;  1DFQ A;  3CU1 B;  3BAG A;  1YXW A;  4FVV A;  3VSZ A;  5BXR A;  1G9A A;  4LO3 C;  1HCE A;  2MLL B;  1ISZ A;  1WBA A;  1NUN A;  2FFU A;  2F8X C;  2LIQ A;  1CE7 B;  1D0H A;  4GAF A;  4OWK A;  2NYY A;  1P63 A;  2L5X A;  1KNM A;  1YBI A;  4KC3 A;  3B9U A;  1RZO B;  1YTO A;  3F62 B;  3FJ9 A;  3AKI A;  5BP5 C;  5BXS A;  2KKI A;  2GZB A;  1S0G A;  3BAV A;  3OJ2 A;  4AN6 A;  4DCK C;  4QAL A;  3VT0 A;  2FGF A;  4DEN A;  1NZK A;  3JRR A;  7I1B A;  1Q04 A;  4I1B A;  1YYN A;  9ILB A;  3T8S A;  4OEG A;  3AZV A;  5BVP I;  31BI A;  4I4X A;  1A8D A;  4GOY A;  4II0 A;  4LO7 B;  1BFF A;  1L2H A;  2D43 A;  3V0A A;  2MC2 A;  1SR4 C;  2X2T A;  3AKH A;  1MD6 A;  3VWC A;  2D22 A;  4KEK A;  1I1B A;  4H9W A;  4R6U B;  1Q03 A;  3V0A B;  2QN4 A;  1V6V A;  1V6X A;  2X2S A;  3C9Z A;  1EPW A;  3I29 B;  3K1X A;  3UD8 A;  4ZLB B;  1W3F A;  1G9C A;  2NVH A;  1BAR A;  3OJM A;  3FJC A;  1DLL A;  3CRH A;  3NBE A;  4IYB A;  1AF9 A;  3BA5 A;  5D62 A;  1WD3 A;  4I4U A;  3ZXG A;  4IY9 A;  4JPZ A;  1OQL B;  1PC8 B;  1YF8 B;  2D23 A;  3N7J A;  3PHZ A;  3UD7 A;  2E4M C;  1JT4 A;  2D44 A;  4I4P A;  1SZ6 B;  1S0B A;  2Y9W C;  21BI A;  4ION A;  1PUU B;  1DIW A;  2P23 A;  4USO A;  3OGG A;  3IIR A;  2I1B A;  3A23 A;  3BAD A;  1HWM B;  1S0F A;  3CQA A;  3KMV A;  4Q91 A;  3F1R A;  1WD4 A;  2QYI B;  2FO1 A;  3BRD A;  2LIE A;  1F31 A;  1QXM A;  4F34 A;  6I1B A;  2Z49 A;  4QD2 C;  3NBD A;  4USP A;  4JAW A;  3O49 A;  1JT3 A;  4X37 A;  1ISW A;  1AVU A;  2FFV A;  3FJD A;  2ET2 A;  3H6S E;  2ZR1 B;  2D7I A;  2MIB A;  3N0K A;  4I4Q A;  4D0Z A;  2ZQN A;  3Q7W A;  4XKI A;  3VUO A;  4J2X A;  2DRY A;  4LO2 C;  3H6R A;  3BAQ A;  1QQK A;  3HMY A;  3A07 A;  4EB2 B;  3BX1 C;  5EC5 A;  4Z8S B;  4ZFY B;  2K43 A;  5DUY A;  3O4A A;  1ILR 1;  5F8W A;  3Q7X A;  2KLL A;  3O4O A;  1K5V A;  4JRA A;  1IRA X;  1G82 A;  5BQU C;  4ISR A;  4J2Y A;  3IM6 A;  3RTI B;  1CVS A;  1WBC A;  3OJV A;  3FJI A;  3A21 A;  4QC4 A;  1R8N A;  1TOO A;  1Z0H A;  3ZXD A;  4AN7 B;  4LO0 C;  4G1R A;  1JT7 A;  3EF2 A;  3MPP G;  3AH2 A;  5EG6 C;  2RST A;  3NBN A;  4EKX B;  1PZZ A;  1IIL A;  1AXM A;  3NJ5 A;  4KBB A;  2WBC A;  3RMX A;  3R4U A;  4LO8 B;  1XHB A;  2Q3N B;  4G6J A;  3ZX7 A;  3BTA A;  1ABR B;  2ZQO A;  3S8K A;  1FV2 A;  1BLA A;  3UD9 A;  2WRY A;  1TWE A;  4P0K A;  4QO3 A;  3ILA A;  4LO1 C;  4YOL A;  4D0T A;  3S8J A;  1HKN A;  3CA5 A;  2HW9 A;  4LO3 A;  4END A;  1BLD A;  3BA4 A;  2KI6 B; 
#chains in the Genus database with same CATH topology
 1FV3 A;  3P53 A;  4IHZ A;  1S0D A;  5JMC A;  4I0Y A;  3UJ4 A;  2K4A B;  1AFC A;  1JY0 A;  3HBW A;  3FJF A;  4L4I A;  3AKF A;  3VEQ A;  4QBV A;  5DVH A;  2R9K B;  3JUT A;  3O3Q A;  4MZH A;  3WO4 A;  4HJJ A;  2VSA A;  2AXM A;  3LLP A;  4DEP A;  3CA4 A;  4ISQ A;  3FUQ A;  1W3A A;  1JLX A;  4I3N A;  3FJK A;  1BFG A;  2D1Z A;  5JLV A;  5F90 A;  2XOA A;  4P0J A;  2BFH A;  1EYL A;  1ISV A;  4Z9W B;  5E24 E;  5I1B A;  1ONK B;  4QKS A;  1FWV A;  3BAH A;  1TFM B;  1M16 A;  4TLP A;  3LTQ A;  2ERM A;  2DS0 A;  3W9T A;  1DQO A;  1TIE A;  2VXT I;  3MAL A;  4J2K A;  3HOM A;  1BFC A;  1PWA A;  2GO2 A;  3CRI A;  3HN1 A;  2IWT B;  4G6M A;  3WO3 A;  4MZF B;  1DZD A;  1RML A;  3OBT A;  4I4V A;  1XG6 A;  2DRZ A;  4IZE A;  1FMZ A;  2F2F A;  3CAH A;  4I2S A;  3UJ0 A;  3QYD A;  4QKR A;  2E4M A;  1V6U A;  2Q9X A;  1XYF A;  4XFS A;  4OW4 A;  4UY4 A;  2UUS A;  3O5W B;  3I2X A;  2D7R A;  3V0B A;  4G9N A;  4P6A A;  1FMM S;  3FJB A;  2KI4 A;  1R8O A;  3FJA A;  3SNV A;  5GAQ A;  5BXP A;  4I96 A;  1FQ9 A;  3N7M A;  3V0B B;  1IRP A;  4WBC A;  3H6Q A;  4J23 B;  4XFT A;  5D61 A;  3WIN A;  1HWN B;  2NS2 A;  4J2S A;  2IHO A;  2VXR A;  5FNX A;  4EFP A;  1JQZ A;  2Y9G A;  3FJH A;  2ESU A;  2FDB M;  1GGP B;  1MC9 A;  4QD2 B;  4OEE A;  2NTD A;  4ZBV B;  2AFG A;  3IM7 A;  3QR5 A;  1T4Q A;  4OEF A;  4Q9P A;  1Z4S A;  3O4B A;  4GOV A;  1FN0 A;  4ZA3 B;  1S0E A;  3Q7Y A;  4JKQ A;  1G9B A;  4JKX B;  4LO7 C;  3RSJ A;  1S0L A;  4XFU A;  4CJM A;  4X3A A;  4EFQ A;  3VT2 A;  5DZU A;  1BFB A;  2K8R A;  1K5U A;  1FGA A;  5BQU A;  1S0C A;  4L4H A;  1FWU A;  3AH4 A;  2KH2 A;  5FZU A;  4KEI A;  1TWM A;  2VSE A;  2VLC A;  4LO0 A;  4ZKT B;  3BB2 A;  1IT0 A;  3CA6 A;  1HIB A;  3WMU A;  4A7Y A;  4I37 A;  1N4K A;  4ZFW B;  2D20 A;  8I1B A;  3IAG C;  3VT1 A;  3FUO A;  3P6J A;  2Z48 A;  3A22 A;  4ZOT A;  4IQP A;  5BP5 A;  1TTU A;  2NM1 A;  3AZW A;  1M2T B;  4H04 A;  3CRG A;  3BA7 A;  5FNW A;  3BRF A;  1EV2 A;  1EVT A;  4LO1 A;  4ZFU B;  4X38 A;  3FJE A;  4X39 A;  3OGF A;  5BXT A;  1QQL A;  4A7Z A;  1XZZ A;  1IOB A;  2RQ9 A;  3AKG A;  2J3P A;  4I4Y A;  4JP0 A;  3OBR A;  4IZX A;  4A7K A;  1SR4 A;  3FGM A;  3O4C A;  1JTC A;  4I1E A;  1AVW B;  3BRG C;  3BAO A;  1II4 A;  3POK A;  4I7I A;  4P0L A;  3V79 C;  2NZ9 A;  3CA3 A;  5G00 A;  4HR6 C;  1PUM B;  3O4D A;  1E0O A;  2VU9 A;  4OUJ A;  2BEB A;  3P6I A;  5D63 A;  5FZY A;  1VCL A;  2M49 A;  2Y9F A;  1W3G A;  4HA2 A;  4F83 A;  1AVA C;  1DFC A;  2F2F C;  4I4R A;  4OWL A;  2BEA A;  3PG0 A;  3FJ8 A;  4GAI A;  2P39 A;  1JLY A;  2NP0 A;  2AAI B;  5FZZ A;  1BAS A;  1DQG A;  4EEE B;  2VUA A;  1BA7 A;  4ZGR B;  3AJ5 A;  3FFZ A;  4Q9G A;  4GP3 A;  41BI A;  1DZC A;  2DRE A;  3IM5 A;  1HWP B;  4D8H A;  1ISX A;  4G9M A;  1IJT A;  3PME A;  3BAU A;  4EFR A;  3ZC9 A;  4I4O A;  3TC2 A;  1ISY A;  3CA0 A;  4I4S A;  4OWJ A;  3RTJ B;  3VSF A;  1DJS B;  1ITB A;  4IY8 A;  5F8Y A;  2HWA A;  1JT5 A;  3I2A A;  5HPZ A;  3HAL A;  3FJJ A;  1TP0 A;  2AQZ A;  2YUG A;  3N7K A;  1Q1U A;  2D24 A;  3WIN C;  1RY7 A;  1AVX B;  3WA1 A;  1RG8 A;  5B2H A;  4I8M A;  4JQ0 A;  3N7L A;  3AH1 A;  4FGF A;  2HWM A;  1UPS A;  1I1E A;  3R4S A;  1T9F A;  1HCD A;  4KEJ A;  3PUB A;  2HZ9 A;  5DSS B;  3WO2 A;  4PC4 A;  4QBC A;  3RMY A;  1G9D A;  1V6W A;  3HSM A;  3E8L C;  4GP0 A;  2RG9 B;  5F8S A;  1J0S A;  3D7W B;  3AJ6 A;  4LO2 A;  3CA1 A;  3H6R B;  1HWO B;  1Z2V A;  3UDA A;  3WMV A;  3O44 A;  2Y9X E;  1IHK A;  4I6I A;  3NBC A;  3ZC8 A;  5BOW A;  5EHA A;  1DFQ A;  3CU1 B;  3BAG A;  1YXW A;  4FVV A;  3VSZ A;  5BXR A;  1G9A A;  4LO3 C;  1HCE A;  2MLL B;  1ISZ A;  1WBA A;  1NUN A;  2FFU A;  2F8X C;  2LIQ A;  1CE7 B;  1D0H A;  4GAF A;  4OWK A;  2NYY A;  1P63 A;  2L5X A;  1KNM A;  1YBI A;  4KC3 A;  3B9U A;  1RZO B;  1YTO A;  3F62 B;  3FJ9 A;  3AKI A;  5BP5 C;  5BXS A;  2KKI A;  2GZB A;  1S0G A;  3BAV A;  3OJ2 A;  4AN6 A;  4DCK C;  4QAL A;  3VT0 A;  2FGF A;  4DEN A;  1NZK A;  3JRR A;  7I1B A;  1Q04 A;  4I1B A;  1YYN A;  9ILB A;  3T8S A;  4OEG A;  3AZV A;  5BVP I;  31BI A;  4I4X A;  1A8D A;  4GOY A;  4II0 A;  4LO7 B;  4H75 A;  1BFF A;  1L2H A;  2D43 A;  3V0A A;  2MC2 A;  1SR4 C;  2X2T A;  3AKH A;  1MD6 A;  3VWC A;  2D22 A;  4KEK A;  1I1B A;  4H9W A;  4R6U B;  1Q03 A;  3V0A B;  2QN4 A;  1V6V A;  1V6X A;  2X2S A;  3C9Z A;  1EPW A;  3I29 B;  3K1X A;  3UD8 A;  4ZLB B;  1W3F A;  1G9C A;  2NVH A;  1BAR A;  3OJM A;  3FJC A;  1DLL A;  3CRH A;  3NBE A;  4IYB A;  1AF9 A;  3BA5 A;  5D62 A;  1WD3 A;  4I4U A;  3ZXG A;  4IY9 A;  4JPZ A;  1OQL B;  1PC8 B;  1YF8 B;  2D23 A;  3N7J A;  3PHZ A;  3UD7 A;  2E4M C;  1JT4 A;  2D44 A;  4I4P A;  1SZ6 B;  1S0B A;  2Y9W C;  21BI A;  4ION A;  1PUU B;  1DIW A;  2P23 A;  4USO A;  3OGG A;  3IIR A;  2I1B A;  3A23 A;  3BAD A;  1HWM B;  1S0F A;  3CQA A;  3KMV A;  4Q91 A;  3F1R A;  1WD4 A;  2QYI B;  2FO1 A;  3BRD A;  2LIE A;  1F31 A;  1QXM A;  4F34 A;  6I1B A;  2Z49 A;  4QD2 C;  3NBD A;  4USP A;  4JAW A;  3O49 A;  1JT3 A;  4X37 A;  1ISW A;  1AVU A;  2FFV A;  3FJD A;  2ET2 A;  3H6S E;  2ZR1 B;  2D7I A;  2MIB A;  3N0K A;  4I4Q A;  4D0Z A;  2ZQN A;  3Q7W A;  4XKI A;  3VUO A;  4J2X A;  4MZG B;  2DRY A;  4LO2 C;  3H6R A;  3BAQ A;  1QQK A;  3HMY A;  3A07 A;  4EB2 B;  3BX1 C;  5EC5 A;  4Z8S B;  4ZFY B;  2K43 A;  5DUY A;  3O4A A;  1ILR 1;  5F8W A;  3Q7X A;  2KLL A;  3O4O A;  1K5V A;  4JRA A;  1IRA X;  1G82 A;  5BQU C;  4ISR A;  4J2Y A;  3IM6 A;  3RTI B;  1CVS A;  1WBC A;  3OJV A;  3FJI A;  3A21 A;  4QC4 A;  1R8N A;  1TOO A;  1Z0H A;  3ZXD A;  4AN7 B;  4LO0 C;  4G1R A;  1JT7 A;  3EF2 A;  3MPP G;  3AH2 A;  5EG6 C;  2RST A;  3NBN A;  4EKX B;  1PZZ A;  1IIL A;  1AXM A;  3NJ5 A;  4KBB A;  2WBC A;  3RMX A;  3R4U A;  4LO8 B;  1XHB A;  2Q3N B;  4G6J A;  3ZX7 A;  3BTA A;  1ABR B;  2ZQO A;  3S8K A;  1FV2 A;  1BLA A;  3UD9 A;  2WRY A;  1TWE A;  4P0K A;  4QO3 A;  3ILA A;  4LO1 C;  4YOL A;  4D0T A;  3S8J A;  1HKN A;  3CA5 A;  2HW9 A;  4LO3 A;  4END A;  1BLD A;  3BA4 A;  2KI6 B; 
#chains in the Genus database with same CATH homology
 1FV3 A;  3P53 A;  4IHZ A;  1S0D A;  5JMC A;  4I0Y A;  3UJ4 A;  2K4A B;  1AFC A;  1JY0 A;  3HBW A;  3FJF A;  4L4I A;  3AKF A;  3VEQ A;  4QBV A;  5DVH A;  2R9K B;  3JUT A;  3O3Q A;  4MZH A;  3WO4 A;  4HJJ A;  2VSA A;  2AXM A;  3LLP A;  4DEP A;  3CA4 A;  4ISQ A;  3FUQ A;  1W3A A;  1JLX A;  4I3N A;  3FJK A;  1BFG A;  2D1Z A;  5JLV A;  5F90 A;  2XOA A;  4P0J A;  2BFH A;  1EYL A;  1ISV A;  4Z9W B;  5E24 E;  5I1B A;  1ONK B;  4QKS A;  1FWV A;  3BAH A;  1TFM B;  1M16 A;  4TLP A;  3LTQ A;  2ERM A;  2DS0 A;  3W9T A;  1DQO A;  1TIE A;  2VXT I;  3MAL A;  4J2K A;  3HOM A;  1BFC A;  1PWA A;  2GO2 A;  3CRI A;  3HN1 A;  2IWT B;  4G6M A;  3WO3 A;  4MZF B;  1DZD A;  1RML A;  3OBT A;  4I4V A;  1XG6 A;  2DRZ A;  4IZE A;  1FMZ A;  2F2F A;  3CAH A;  4I2S A;  3UJ0 A;  3QYD A;  4QKR A;  2E4M A;  1V6U A;  2Q9X A;  1XYF A;  4XFS A;  4OW4 A;  4UY4 A;  2UUS A;  3O5W B;  3I2X A;  2D7R A;  3V0B A;  4G9N A;  4P6A A;  1FMM S;  3FJB A;  2KI4 A;  1R8O A;  3FJA A;  3SNV A;  5GAQ A;  5BXP A;  4I96 A;  1FQ9 A;  3N7M A;  3V0B B;  1IRP A;  4WBC A;  3H6Q A;  4J23 B;  4XFT A;  5D61 A;  3WIN A;  1HWN B;  2NS2 A;  4J2S A;  2IHO A;  2VXR A;  5FNX A;  4EFP A;  1JQZ A;  2Y9G A;  3FJH A;  2ESU A;  2FDB M;  1GGP B;  1MC9 A;  4QD2 B;  4OEE A;  2NTD A;  4ZBV B;  2AFG A;  3IM7 A;  3QR5 A;  1T4Q A;  4OEF A;  4Q9P A;  1Z4S A;  3O4B A;  4GOV A;  1FN0 A;  4ZA3 B;  1S0E A;  3Q7Y A;  4JKQ A;  1G9B A;  4JKX B;  4LO7 C;  3RSJ A;  1S0L A;  4XFU A;  4CJM A;  4X3A A;  4EFQ A;  3VT2 A;  5DZU A;  1BFB A;  2K8R A;  1K5U A;  1FGA A;  5BQU A;  1S0C A;  4L4H A;  1FWU A;  3AH4 A;  2KH2 A;  5FZU A;  4KEI A;  1TWM A;  2VSE A;  2VLC A;  4LO0 A;  4ZKT B;  3BB2 A;  1IT0 A;  3CA6 A;  1HIB A;  3WMU A;  4A7Y A;  4I37 A;  1N4K A;  4ZFW B;  2D20 A;  8I1B A;  3IAG C;  3VT1 A;  3FUO A;  3P6J A;  2Z48 A;  3A22 A;  4ZOT A;  4IQP A;  5BP5 A;  1TTU A;  2NM1 A;  3AZW A;  1M2T B;  4H04 A;  3CRG A;  3BA7 A;  5FNW A;  3BRF A;  1EV2 A;  1EVT A;  4LO1 A;  4ZFU B;  4X38 A;  3FJE A;  4X39 A;  3OGF A;  5BXT A;  1QQL A;  4A7Z A;  1XZZ A;  1IOB A;  2RQ9 A;  3AKG A;  2J3P A;  4I4Y A;  4JP0 A;  3OBR A;  4IZX A;  4A7K A;  1SR4 A;  3FGM A;  3O4C A;  1JTC A;  4I1E A;  1AVW B;  3BRG C;  3BAO A;  1II4 A;  3POK A;  4I7I A;  4P0L A;  3V79 C;  2NZ9 A;  3CA3 A;  5G00 A;  4HR6 C;  1PUM B;  3O4D A;  1E0O A;  2VU9 A;  4OUJ A;  2BEB A;  3P6I A;  5D63 A;  5FZY A;  1VCL A;  2M49 A;  2Y9F A;  1W3G A;  4HA2 A;  4F83 A;  1AVA C;  1DFC A;  2F2F C;  4I4R A;  4OWL A;  2BEA A;  3PG0 A;  3FJ8 A;  4GAI A;  2P39 A;  1JLY A;  2NP0 A;  2AAI B;  5FZZ A;  1BAS A;  1DQG A;  4EEE B;  2VUA A;  1BA7 A;  4ZGR B;  3AJ5 A;  3FFZ A;  4Q9G A;  4GP3 A;  41BI A;  1DZC A;  2DRE A;  3IM5 A;  1HWP B;  4D8H A;  1ISX A;  4G9M A;  1IJT A;  3PME A;  3BAU A;  4EFR A;  3ZC9 A;  4I4O A;  3TC2 A;  1ISY A;  3CA0 A;  4I4S A;  4OWJ A;  3RTJ B;  3VSF A;  1DJS B;  1ITB A;  4IY8 A;  5F8Y A;  2HWA A;  1JT5 A;  3I2A A;  5HPZ A;  3HAL A;  3FJJ A;  1TP0 A;  2AQZ A;  2YUG A;  3N7K A;  1Q1U A;  2D24 A;  3WIN C;  1RY7 A;  1AVX B;  3WA1 A;  1RG8 A;  5B2H A;  4I8M A;  4JQ0 A;  3N7L A;  3AH1 A;  4FGF A;  2HWM A;  1UPS A;  1I1E A;  3R4S A;  1T9F A;  1HCD A;  4KEJ A;  3PUB A;  2HZ9 A;  5DSS B;  3WO2 A;  4PC4 A;  4QBC A;  3RMY A;  1G9D A;  1V6W A;  3HSM A;  3E8L C;  4GP0 A;  2RG9 B;  5F8S A;  1J0S A;  3D7W B;  3AJ6 A;  4LO2 A;  3CA1 A;  3H6R B;  1HWO B;  1Z2V A;  3UDA A;  3WMV A;  3O44 A;  2Y9X E;  1IHK A;  4I6I A;  3NBC A;  3ZC8 A;  5BOW A;  5EHA A;  1DFQ A;  3CU1 B;  3BAG A;  1YXW A;  4FVV A;  3VSZ A;  5BXR A;  1G9A A;  4LO3 C;  1HCE A;  2MLL B;  1ISZ A;  1WBA A;  1NUN A;  2FFU A;  2F8X C;  2LIQ A;  1CE7 B;  1D0H A;  4GAF A;  4OWK A;  2NYY A;  1P63 A;  2L5X A;  1KNM A;  1YBI A;  4KC3 A;  3B9U A;  1RZO B;  1YTO A;  3F62 B;  3FJ9 A;  3AKI A;  5BP5 C;  5BXS A;  2KKI A;  2GZB A;  1S0G A;  3BAV A;  3OJ2 A;  4AN6 A;  4DCK C;  4QAL A;  3VT0 A;  2FGF A;  4DEN A;  1NZK A;  3JRR A;  7I1B A;  1Q04 A;  4I1B A;  1YYN A;  9ILB A;  3T8S A;  4OEG A;  3AZV A;  5BVP I;  31BI A;  4I4X A;  1A8D A;  4GOY A;  4II0 A;  4LO7 B;  4H75 A;  1BFF A;  1L2H A;  2D43 A;  3V0A A;  2MC2 A;  1SR4 C;  2X2T A;  3AKH A;  1MD6 A;  3VWC A;  2D22 A;  4KEK A;  1I1B A;  4H9W A;  4R6U B;  1Q03 A;  3V0A B;  2QN4 A;  1V6V A;  1V6X A;  2X2S A;  3C9Z A;  1EPW A;  3I29 B;  3K1X A;  3UD8 A;  4ZLB B;  1W3F A;  1G9C A;  2NVH A;  1BAR A;  3OJM A;  3FJC A;  1DLL A;  3CRH A;  3NBE A;  4IYB A;  1AF9 A;  3BA5 A;  5D62 A;  1WD3 A;  4I4U A;  3ZXG A;  4IY9 A;  4JPZ A;  1OQL B;  1PC8 B;  1YF8 B;  2D23 A;  3N7J A;  3PHZ A;  3UD7 A;  2E4M C;  1JT4 A;  2D44 A;  4I4P A;  1SZ6 B;  1S0B A;  2Y9W C;  21BI A;  4ION A;  1PUU B;  1DIW A;  2P23 A;  4USO A;  3OGG A;  3IIR A;  2I1B A;  3A23 A;  3BAD A;  1HWM B;  1S0F A;  3CQA A;  3KMV A;  4Q91 A;  3F1R A;  1WD4 A;  2QYI B;  2FO1 A;  3BRD A;  2LIE A;  1F31 A;  1QXM A;  4F34 A;  6I1B A;  2Z49 A;  4QD2 C;  3NBD A;  4USP A;  4JAW A;  3O49 A;  1JT3 A;  4X37 A;  1ISW A;  1AVU A;  2FFV A;  3FJD A;  2ET2 A;  3H6S E;  2ZR1 B;  2D7I A;  2MIB A;  3N0K A;  4I4Q A;  4D0Z A;  2ZQN A;  3Q7W A;  4XKI A;  3VUO A;  4J2X A;  4MZG B;  2DRY A;  4LO2 C;  3H6R A;  3BAQ A;  1QQK A;  3HMY A;  3A07 A;  4EB2 B;  3BX1 C;  5EC5 A;  4Z8S B;  4ZFY B;  2K43 A;  5DUY A;  3O4A A;  1ILR 1;  5F8W A;  3Q7X A;  2KLL A;  3O4O A;  1K5V A;  4JRA A;  1IRA X;  1G82 A;  5BQU C;  4ISR A;  4J2Y A;  3IM6 A;  3RTI B;  1CVS A;  1WBC A;  3OJV A;  3FJI A;  3A21 A;  4QC4 A;  1R8N A;  1TOO A;  1Z0H A;  3ZXD A;  4AN7 B;  4LO0 C;  4G1R A;  1JT7 A;  3EF2 A;  3MPP G;  3AH2 A;  5EG6 C;  2RST A;  3NBN A;  4EKX B;  1PZZ A;  1IIL A;  1AXM A;  3NJ5 A;  4KBB A;  2WBC A;  3RMX A;  3R4U A;  4LO8 B;  1XHB A;  2Q3N B;  4G6J A;  3ZX7 A;  3BTA A;  1ABR B;  2ZQO A;  3S8K A;  1FV2 A;  1BLA A;  3UD9 A;  2WRY A;  1TWE A;  4P0K A;  4QO3 A;  3ILA A;  4LO1 C;  4YOL A;  4D0T A;  3S8J A;  1HKN A;  3CA5 A;  2HW9 A;  4LO3 A;  4END A;  1BLD A;  3BA4 A;  2KI6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...