3WMUA

The structure of an anti-cancer lectin mytilec apo-form from the mussel mytilus galloprovincialis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
151
Chain Sequence
HMATFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYVHPKGGSTNPPNETLTVMHGDKHGAMEFIFVSPKNKDKRVLVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Crystal structure of MytiLec, a galactose-binding lectin from the mussel Mytilus galloprovincialis with cytotoxicity against certain cancer cell types
pubmed doi rcsb
source organism Mytilus galloprovincialis
molecule tags Sugar binding protein
total genus 40
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3wmuA00
1AVXB 4J23B 1HIBA 2ZR1B 4QBVA 4LO7B 4Z8SB 3P53A 4F34A 2F8XC 2NVHA 4I96A 3FJCA 1EV2A 4GP3A 4PC4A 3UDAA 4Z9WB 2LIEA 4I2SA 4CJMA 1JTCA 4ZGRB 4JKXB 3ZC9A 4Q9PA 3OJVA 3ZX7A 1T4QA 2K4AB 1BA7A 1G9BA 2FO1A 2E4MA 1PC8B 4X3AA 4OEFA 2NP0A 3HN1A 3O4AA 1PUMB 3PG0A 2Q9XA 1BLDA 2Q3NB 3A21A 3UD8A 2I1BA 1T9FA 1YTOA 1ILR1 2Y9FA 1KNMA 3BADA 1IOBA 2ET2A 3EF2A 2IWTB 4I37A 4HA2A 4H04A 1XHBA 3FJBA 3UD7A 1AVWB 2D1ZA 2BFHA 5FZYA 5B2HA 4X38A 2ZQNA 1ISVA 4L4IA 4I4VA 1FQ9A 5BXRA 4KEIA 3N7JA 1G9CA 1ISZA 2Y9WC 1F31A 1AXMA 3HBWA 1DZCA 2BEBA 3H6RB 3H6QA 2X2SA 4LO7C 4Q9GA 4GOVA 3ZXDA 4F83A 5FZZA 1WD3A 4OWJA 1FWUA 2VLCA 3FJJA 1S0EA 1XG6A 4R6UB 4G9NA 4KEKA 5EG6C 4X39A 1IHKA 5FNXA 4USPA 4WBCA 4I1BA 4ZFUB 3CU1B 1BFCA 1ABRB 2XOAA 4EKXB 31BIA 4JRAA 4QO3A 5D63A 4LO0C 4XKIA 2HZ9A 3AH1A 3CA0A 1NUNA 4P0LA 3NBDA 3O4OA 3AKFA 1FGAA 3CA6A 4ZA3B 1BFFA 3BX1C 2NM1A 1ISYA 1DLLA 2D7IA 3OGFA 5G00A 4JPZA 1QQLA 1YXWA 4ZBVB 3N7MA 2VXTI 3RSJA 1G9AA 3WO4A 2Y9GA 4LO3C 4J2XA 5DUYA 3IIRA 3AH2A 3LLPA 4AN7B 4X37A 1YF8B 4A7YA 4LO2C 1FMMS 2Z48A 1WD4A 1WBAA 4QKSA 2K43A 1IRAX 4I4QA 2NZ9A 3AKHA 3CRIA 3ILAA 4H9WA 5D61A 2D24A 2VU9A 1OQLB 3IM5A 4ZLBB 1DIWA 2LIQA 3ZC8A 1HWOB 3NJ5A 2VSEA 1DJSB 2AFGA 2DS0A 1FV3A 4HJJA 1DFQA 5BVPI 1W3GA 1S0DA 2VUAA 1DZDA 2KI4A 3RMXA 3QYDA 4QD2C 3AZWA 4XFSA 3S8JA 3NBNA 3AJ6A 5GAQA 4YOLA 1QXMA 5HPZA 5I1BA 2QN4A 4KEJA 3OGGA 2KH2A 4IZEA 3V0AB 3V0BB 4I3NA 2Y9XE 3I2AA 3K1XA 1V6WA 3CA1A 2R9KB 3IM6A 3AJ5A 1V6VA 5BP5C 2D20A 5F8SA 1VCLA 2UUSA 4EEEB 21BIA 3FJHA 4OEEA 1TOOA 3HSMA 1R8NA 1M16A 3BA7A 2M49A 3RTIB 2FFUA 3BB2A 4USOA 1I1BA 3FFZA 4QALA 1Z2VA 2QYIB 4AN6A 3P6IA 1DQOA 3NBCA 3O4BA 1Q04A 3BRFA 1K5UA 2FDBM 2MLLB 4QKRA 5FZUA 3FJKA 4QC4A 5EC5A 4XFTA 3AH4A 3F62B 3FJFA 3BA4A 3FJ9A 3MALA 3WINC 3FJIA 1S0FA 1SR4C 2FGFA 2WBCA 2GO2A 3BTAA 2HWMA 2DRYA 2D22A 3I29B 1W3FA 3Q7YA 3WO2A 1FMZA 1JQZA 1ITBA 1RY7A 4J2YA 3O4DA 1K5VA 1Z0HA 2X2TA 3E8LC 1YYNA 3POKA 1EYLA 3BAOA 1G82A 4I4OA 2RQ9A 5F8YA 2AAIB 1DQGA 2D7RA 1JLXA 4DEPA 4ISRA 3FGMA 3MPPG 4A7KA 1ONKB 5FNWA 1JT3A 1V6UA 2Z49A 4GP0A 1ISWA 1IILA 1A8DA 3AZVA 1CE7B 1HWPB 1PWAA 3RMYA 6I1BA 3HALA 4KC3A 1YBIA 4JP0A 4I4UA 1BFGA 4LO8B 1S0CA 1ISXA 1DFCA 4OWLA 4EFQA 2P23A 3B9UA 3HOMA 4J2SA 4LO1C 3OJ2A 1RG8A 5JLVA 1S0GA 1SZ6B 1BLAA 3VUOA 2FFVA 3Q7XA 4OW4A 1TP0A 1UPSA 3SNVA 3WMVA 4ZFYB 3O49A 3UJ4A 3PMEA 4I4YA 3OBRA 4OEGA 1JY0A 3IAGC 4G6MA 4XFUA 1MD6A 1IJTA 4QBCA 1AFCA 3VT1A 2E4MC 2NYYA 3TC2A 2VSAA 1CVSA 1JT5A 4LO0A 1TWEA 3NBEA 1BFBA 2D43A 3S8KA 3A22A 4Q91A 2VXRA 4JAWA 4J2KA 4ZFWB 1JT7A 4I6IA 5DVHA 5BOWA 4HR6C 4I1EA 3FUQA 2KKIA 3AKGA 4GAFA 1IT0A 2AQZA 3VWCA 5D62A 1G9DA 5E24E 3OJMA 3FUOA 1IRPA 2KLLA 4FVVA 4G1RA 3JUTA 3H6RA 3BRDA 4LO1A 4G9MA 1Z4SA 2HW9A 2MIBA 3WO3A 1N4KA 1NZKA 5BXSA 1WBCA 4LO3A 1Q03A 4ENDA 3BAGA 4JQ0A 5BQUC 3ZXGA 1P63A 4LO2A 3A07A 3FJAA 3WA1A 3W9TA 3Q7WA 3FJ8A 1QQKA 3LTQA 4I4PA 4P6AA 4EFPA 3I2XA 1BARA 4DENA 3BA5A 3VT2A 1TWMA 4IQPA 3CA5A 3UJ0A 4I4RA 3VSFA 3KMVA 3WMUA 1PZZA 3F1RA 2ERMA 3VT0A 3BAVA 1HCEA 4FGFA 3CQAA 4GOYA 1RMLA 9ILBA 4IZXA 3R4SA 2F2FC 1TTUA 1GGPB 3HMYA 3D7WB 3PHZA 2RSTA 4ZOTA 1EVTA 2ZQOA 1EPWA 3FJDA 4EFRA 1D0HA 5DSSB 1AF9A 41BIA 2NTDA 1HCDA 7I1BA 4D8HA 5DZUA 2GZBA 3BAUA 1JT4A 3A23A 2BEAA 3QR5A 3O3QA 2P39A 4I4XA 5BQUA 3UD9A 4I4SA 1HWNB 1BASA 1R8OA 2MC2A 2KI6B 3CA3A 3P6JA 5BP5A 4A7ZA 1TIEA 1II4A 4DCKC 4OUJA 2J3PA 1RZOB 4IYBA 3O5WB 3VEQA 5JMCA 1MC9A 1XYFA 4KBBA 1FN0A 3O44A 2ESUA 3H6SE 3FJEA 2IHOA 1L2HA 2F2FA 1J0SA 2YUGA 1HWMB 2HWAA 3T8SA 3N0KA 4GAIA 5EHAA 5F8WA 1S0BA 1Q1UA 3WINA 1AVAC 1S0LA 2L5XA 1SR4A 4IHZA 4QD2B 4TLPA 3C9ZA 5F90A 3VSZA 3V79C 1W3AA 3CAHA 4D0TA 2D23A 4ZKTB 3IM7A 1M2TB 3V0AA 4JKQA 3N7KA 3RTJB 3V0BA 1HKNA 3AKIA 8I1BA 4ISQA 3N7LA 4IY9A 3JRRA 2WRYA 3PUBA 1FV2A 4G6JA 4D0ZA 1FWVA 4L4HA 4IY8A 1PUUB 1XZZA 2K8RA 2D44A 4II0A 4I8MA 2AXMA 2RG9B 3BAQA 4OWKA 5BXPA 3OBTA 4P0JA 1AVUA 1E0OA 4I7IA 3CRGA 1V6XA 5BXTA 3BRGC 4P0KA 3BAHA 1TFMB 2DRZA 4I0YA 3R4UA 3CA4A 4EB2B 4IONA 3CRHA 1I1EA 2DREA 1JLYA 3O4CA
chains in the Genus database with same CATH superfamily
1AVXB 4J23B 1HIBA 2ZR1B 4QBVA 4LO7B 4Z8SB 3P53A 4F34A 2F8XC 2NVHA 4I96A 3FJCA 1EV2A 4GP3A 4PC4A 3UDAA 4Z9WB 2LIEA 4I2SA 4CJMA 1JTCA 4ZGRB 4JKXB 3ZC9A 4Q9PA 3OJVA 3ZX7A 1T4QA 2K4AB 4MZGB 1BA7A 1G9BA 2FO1A 2E4MA 1PC8B 4X3AA 4OEFA 2NP0A 3HN1A 3O4AA 1PUMB 3PG0A 2Q9XA 1BLDA 2Q3NB 3A21A 3UD8A 2I1BA 4H75A 1T9FA 1YTOA 1ILR1 2Y9FA 1KNMA 3BADA 1IOBA 2ET2A 3EF2A 2IWTB 4I37A 4HA2A 4H04A 1XHBA 3FJBA 3UD7A 1AVWB 2D1ZA 2BFHA 5FZYA 5B2HA 4X38A 4MZFB 2ZQNA 1ISVA 4L4IA 4I4VA 1FQ9A 5BXRA 4KEIA 3N7JA 1G9CA 1ISZA 2Y9WC 1F31A 1AXMA 3HBWA 1DZCA 2BEBA 3H6RB 3H6QA 2X2SA 4LO7C 4Q9GA 4GOVA 3ZXDA 4F83A 5FZZA 1WD3A 4OWJA 1FWUA 2VLCA 3FJJA 1S0EA 1XG6A 4R6UB 4G9NA 4KEKA 5EG6C 4X39A 1IHKA 5FNXA 4USPA 4WBCA 4I1BA 4ZFUB 3CU1B 1BFCA 1ABRB 2XOAA 4EKXB 31BIA 4JRAA 4QO3A 5D63A 4LO0C 4XKIA 2HZ9A 3AH1A 3CA0A 1NUNA 4P0LA 3NBDA 3O4OA 3AKFA 1FGAA 3CA6A 4ZA3B 1BFFA 3BX1C 2NM1A 1ISYA 1DLLA 2D7IA 3OGFA 5G00A 4JPZA 1QQLA 1YXWA 4ZBVB 3N7MA 2VXTI 3RSJA 1G9AA 3WO4A 2Y9GA 4LO3C 4J2XA 5DUYA 3IIRA 3AH2A 3LLPA 4AN7B 4X37A 1YF8B 4A7YA 4LO2C 1FMMS 2Z48A 1WD4A 1WBAA 4QKSA 2K43A 1IRAX 4I4QA 2NZ9A 3AKHA 3CRIA 3ILAA 4H9WA 5D61A 2D24A 2VU9A 1OQLB 3IM5A 4ZLBB 1DIWA 2LIQA 3ZC8A 1HWOB 3NJ5A 2VSEA 1DJSB 2AFGA 2DS0A 1FV3A 4HJJA 1DFQA 5BVPI 1W3GA 1S0DA 2VUAA 1DZDA 2KI4A 3RMXA 3QYDA 4QD2C 3AZWA 4XFSA 3S8JA 3NBNA 3AJ6A 5GAQA 4YOLA 1QXMA 5HPZA 5I1BA 2QN4A 4KEJA 3OGGA 2KH2A 4IZEA 3V0AB 3V0BB 4I3NA 2Y9XE 3I2AA 3K1XA 1V6WA 3CA1A 2R9KB 3IM6A 3AJ5A 1V6VA 5BP5C 2D20A 5F8SA 1VCLA 2UUSA 4EEEB 21BIA 3FJHA 4OEEA 1TOOA 3HSMA 1R8NA 1M16A 3BA7A 2M49A 3RTIB 2FFUA 3BB2A 4USOA 1I1BA 3FFZA 4QALA 1Z2VA 2QYIB 4AN6A 3P6IA 1DQOA 3NBCA 3O4BA 1Q04A 3BRFA 1K5UA 2FDBM 2MLLB 4QKRA 5FZUA 3FJKA 4QC4A 5EC5A 2NS2A 3AH4A 3F62B 4XFTA 3FJFA 3BA4A 3FJ9A 3MALA 3WINC 3FJIA 1S0FA 1SR4C 2FGFA 2WBCA 2GO2A 3BTAA 2HWMA 2DRYA 2D22A 3I29B 1W3FA 3Q7YA 3WO2A 1FMZA 1JQZA 1ITBA 1RY7A 4J2YA 3O4DA 1K5VA 1Z0HA 2X2TA 3E8LC 1YYNA 3POKA 1EYLA 3BAOA 1G82A 4I4OA 2RQ9A 5F8YA 2AAIB 1DQGA 2D7RA 1JLXA 4DEPA 4ISRA 3FGMA 3MPPG 4A7KA 1ONKB 5FNWA 1JT3A 1V6UA 2Z49A 4GP0A 1ISWA 1IILA 1A8DA 3AZVA 1CE7B 1HWPB 1PWAA 3RMYA 6I1BA 3HALA 4KC3A 1YBIA 4JP0A 4I4UA 1BFGA 4LO8B 1S0CA 1ISXA 1DFCA 4OWLA 4EFQA 2P23A 3B9UA 3HOMA 4J2SA 4LO1C 3OJ2A 1RG8A 5JLVA 1S0GA 1SZ6B 1BLAA 3VUOA 2FFVA 3Q7XA 4OW4A 1TP0A 1UPSA 3SNVA 3WMVA 4ZFYB 3O49A 3UJ4A 3PMEA 4I4YA 3OBRA 4OEGA 1JY0A 3IAGC 4G6MA 4XFUA 1MD6A 1IJTA 4QBCA 1AFCA 3VT1A 2E4MC 2NYYA 3TC2A 2VSAA 1CVSA 1JT5A 4LO0A 1TWEA 3NBEA 1BFBA 2D43A 3S8KA 3A22A 4Q91A 2VXRA 4JAWA 4J2KA 4ZFWB 1JT7A 4I6IA 5DVHA 5BOWA 4HR6C 4I1EA 3FUQA 2KKIA 3AKGA 4GAFA 1IT0A 2AQZA 3VWCA 5D62A 1G9DA 5E24E 3OJMA 3FUOA 1IRPA 2KLLA 4FVVA 4G1RA 3JUTA 3H6RA 3BRDA 4LO1A 4G9MA 1Z4SA 2HW9A 2MIBA 3WO3A 1N4KA 1NZKA 5BXSA 1WBCA 4LO3A 1Q03A 4ENDA 3BAGA 4JQ0A 5BQUC 3ZXGA 1P63A 4LO2A 3A07A 3FJAA 3WA1A 3W9TA 3Q7WA 3FJ8A 1QQKA 3LTQA 4I4PA 4P6AA 4EFPA 3I2XA 1BARA 4DENA 3BA5A 3VT2A 1TWMA 4IQPA 3CA5A 3UJ0A 4I4RA 3VSFA 3KMVA 3WMUA 1PZZA 3F1RA 2ERMA 3VT0A 3BAVA 1HCEA 4FGFA 3CQAA 4GOYA 1RMLA 9ILBA 4IZXA 3R4SA 2F2FC 1TTUA 1GGPB 3HMYA 3D7WB 3PHZA 2RSTA 4ZOTA 1EVTA 2ZQOA 1EPWA 3FJDA 4EFRA 1D0HA 4MZHA 5DSSB 1AF9A 41BIA 2NTDA 1HCDA 7I1BA 4D8HA 5DZUA 2GZBA 3BAUA 1JT4A 3A23A 2BEAA 3QR5A 3O3QA 2P39A 4I4XA 5BQUA 3UD9A 4I4SA 1HWNB 1BASA 1R8OA 2MC2A 2KI6B 3CA3A 3P6JA 5BP5A 4A7ZA 1TIEA 1II4A 4DCKC 4OUJA 2J3PA 1RZOB 4IYBA 3O5WB 3VEQA 5JMCA 1MC9A 1XYFA 4KBBA 1FN0A 3O44A 2ESUA 3H6SE 3FJEA 2IHOA 1L2HA 2F2FA 1J0SA 2YUGA 1HWMB 2HWAA 3T8SA 3N0KA 4GAIA 5EHAA 5F8WA 1S0BA 1Q1UA 3WINA 1AVAC 1S0LA 2L5XA 1SR4A 4IHZA 4QD2B 4TLPA 3C9ZA 5F90A 3VSZA 3V79C 1W3AA 3CAHA 4D0TA 2D23A 4ZKTB 3IM7A 1M2TB 3V0AA 4JKQA 3N7KA 3RTJB 3V0BA 1HKNA 3AKIA 8I1BA 4ISQA 3N7LA 4IY9A 3JRRA 2WRYA 3PUBA 1FV2A 4G6JA 4D0ZA 1FWVA 4L4HA 4IY8A 1PUUB 1XZZA 2K8RA 2D44A 4II0A 4I8MA 2AXMA 2RG9B 3BAQA 4OWKA 5BXPA 4UY4A 3OBTA 4P0JA 1AVUA 1E0OA 4I7IA 3CRGA 1V6XA 5BXTA 3BRGC 4P0KA 3BAHA 1TFMB 2DRZA 4I0YA 3R4UA 3CA4A 4EB2B 4IONA 3CRHA 1I1EA 2DREA 1JLYA 3O4CA
chains in the Genus database with same CATH topology
1AVXB 4J23B 1HIBA 2ZR1B 4QBVA 4LO7B 4Z8SB 3P53A 4F34A 2F8XC 2NVHA 4I96A 3FJCA 1EV2A 4GP3A 4PC4A 3UDAA 4Z9WB 2LIEA 4I2SA 4CJMA 1JTCA 4ZGRB 4JKXB 3ZC9A 4Q9PA 3OJVA 3ZX7A 1T4QA 2K4AB 4MZGB 1BA7A 1G9BA 2FO1A 2E4MA 1PC8B 4X3AA 4OEFA 2NP0A 3HN1A 3O4AA 1PUMB 3PG0A 2Q9XA 1BLDA 2Q3NB 3A21A 3UD8A 2I1BA 4H75A 1T9FA 1YTOA 1ILR1 2Y9FA 1KNMA 3BADA 1IOBA 2ET2A 3EF2A 2IWTB 4I37A 4HA2A 4H04A 1XHBA 3FJBA 3UD7A 1AVWB 2D1ZA 2BFHA 5FZYA 5B2HA 4X38A 4MZFB 2ZQNA 1ISVA 4L4IA 4I4VA 1FQ9A 5BXRA 4KEIA 3N7JA 1G9CA 1ISZA 2Y9WC 1F31A 1AXMA 3HBWA 1DZCA 2BEBA 3H6RB 3H6QA 2X2SA 4LO7C 4Q9GA 4GOVA 3ZXDA 4F83A 5FZZA 1WD3A 4OWJA 1FWUA 2VLCA 3FJJA 1S0EA 1XG6A 4R6UB 4G9NA 4KEKA 5EG6C 4X39A 1IHKA 5FNXA 4USPA 4WBCA 4I1BA 4ZFUB 3CU1B 1BFCA 1ABRB 2XOAA 4EKXB 31BIA 4JRAA 4QO3A 5D63A 4LO0C 4XKIA 2HZ9A 3AH1A 3CA0A 1NUNA 4P0LA 3NBDA 3O4OA 3AKFA 1FGAA 3CA6A 4ZA3B 1BFFA 3BX1C 2NM1A 1ISYA 1DLLA 2D7IA 3OGFA 5G00A 4JPZA 1QQLA 1YXWA 4ZBVB 3N7MA 2VXTI 3RSJA 1G9AA 3WO4A 2Y9GA 4LO3C 4J2XA 5DUYA 3IIRA 3AH2A 3LLPA 4AN7B 4X37A 1YF8B 4A7YA 4LO2C 1FMMS 2Z48A 1WD4A 1WBAA 4QKSA 2K43A 1IRAX 4I4QA 2NZ9A 3AKHA 3CRIA 3ILAA 4H9WA 5D61A 2D24A 2VU9A 1OQLB 3IM5A 4ZLBB 1DIWA 2LIQA 3ZC8A 1HWOB 3NJ5A 2VSEA 1DJSB 2AFGA 2DS0A 1FV3A 4HJJA 1DFQA 5BVPI 1W3GA 1S0DA 2VUAA 1DZDA 2KI4A 3RMXA 3QYDA 4QD2C 3AZWA 4XFSA 3S8JA 3NBNA 3AJ6A 5GAQA 4YOLA 1QXMA 5HPZA 5I1BA 2QN4A 4KEJA 3OGGA 2KH2A 4IZEA 3V0AB 3V0BB 4I3NA 2Y9XE 3I2AA 3K1XA 1V6WA 3CA1A 2R9KB 3IM6A 3AJ5A 1V6VA 5BP5C 2D20A 5F8SA 1VCLA 2UUSA 4EEEB 21BIA 3FJHA 4OEEA 1TOOA 3HSMA 1R8NA 1M16A 3BA7A 2M49A 3RTIB 2FFUA 3BB2A 4USOA 1I1BA 3FFZA 4QALA 1Z2VA 2QYIB 4AN6A 3P6IA 1DQOA 3NBCA 3O4BA 1Q04A 3BRFA 1K5UA 2FDBM 2MLLB 4QKRA 5FZUA 3FJKA 4QC4A 5EC5A 2NS2A 3AH4A 3F62B 4XFTA 3FJFA 3BA4A 3FJ9A 3MALA 3WINC 3FJIA 1S0FA 1SR4C 2FGFA 2WBCA 2GO2A 3BTAA 2HWMA 2DRYA 2D22A 3I29B 1W3FA 3Q7YA 3WO2A 1FMZA 1JQZA 1ITBA 1RY7A 4J2YA 3O4DA 1K5VA 1Z0HA 2X2TA 3E8LC 1YYNA 3POKA 1EYLA 3BAOA 1G82A 4I4OA 2RQ9A 5F8YA 2AAIB 1DQGA 2D7RA 1JLXA 4DEPA 4ISRA 3FGMA 3MPPG 4A7KA 1ONKB 5FNWA 1JT3A 1V6UA 2Z49A 4GP0A 1ISWA 1IILA 1A8DA 3AZVA 1CE7B 1HWPB 1PWAA 3RMYA 6I1BA 3HALA 4KC3A 1YBIA 4JP0A 4I4UA 1BFGA 4LO8B 1S0CA 1ISXA 1DFCA 4OWLA 4EFQA 2P23A 3B9UA 3HOMA 4J2SA 4LO1C 3OJ2A 1RG8A 5JLVA 1S0GA 1SZ6B 1BLAA 3VUOA 2FFVA 3Q7XA 4OW4A 1TP0A 1UPSA 3SNVA 3WMVA 4ZFYB 3O49A 3UJ4A 3PMEA 4I4YA 3OBRA 4OEGA 1JY0A 3IAGC 4G6MA 4XFUA 1MD6A 1IJTA 4QBCA 1AFCA 3VT1A 2E4MC 2NYYA 3TC2A 2VSAA 1CVSA 1JT5A 4LO0A 1TWEA 3NBEA 1BFBA 2D43A 3S8KA 3A22A 4Q91A 2VXRA 4JAWA 4J2KA 4ZFWB 1JT7A 4I6IA 5DVHA 5BOWA 4HR6C 4I1EA 3FUQA 2KKIA 3AKGA 4GAFA 1IT0A 2AQZA 3VWCA 5D62A 1G9DA 5E24E 3OJMA 3FUOA 1IRPA 2KLLA 4FVVA 4G1RA 3JUTA 3H6RA 3BRDA 4LO1A 4G9MA 1Z4SA 2HW9A 2MIBA 3WO3A 1N4KA 1NZKA 5BXSA 1WBCA 4LO3A 1Q03A 4ENDA 3BAGA 4JQ0A 5BQUC 3ZXGA 1P63A 4LO2A 3A07A 3FJAA 3WA1A 3W9TA 3Q7WA 3FJ8A 1QQKA 3LTQA 4I4PA 4P6AA 4EFPA 3I2XA 1BARA 4DENA 3BA5A 3VT2A 1TWMA 4IQPA 3CA5A 3UJ0A 4I4RA 3VSFA 3KMVA 3WMUA 1PZZA 3F1RA 2ERMA 3VT0A 3BAVA 1HCEA 4FGFA 3CQAA 4GOYA 1RMLA 9ILBA 4IZXA 3R4SA 2F2FC 1TTUA 1GGPB 3HMYA 3D7WB 3PHZA 2RSTA 4ZOTA 1EVTA 2ZQOA 1EPWA 3FJDA 4EFRA 1D0HA 4MZHA 5DSSB 1AF9A 41BIA 2NTDA 1HCDA 7I1BA 4D8HA 5DZUA 2GZBA 3BAUA 1JT4A 3A23A 2BEAA 3QR5A 3O3QA 2P39A 4I4XA 5BQUA 3UD9A 4I4SA 1HWNB 1BASA 1R8OA 2MC2A 2KI6B 3CA3A 3P6JA 5BP5A 4A7ZA 1TIEA 1II4A 4DCKC 4OUJA 2J3PA 1RZOB 4IYBA 3O5WB 3VEQA 5JMCA 1MC9A 1XYFA 4KBBA 1FN0A 3O44A 2ESUA 3H6SE 3FJEA 2IHOA 1L2HA 2F2FA 1J0SA 2YUGA 1HWMB 2HWAA 3T8SA 3N0KA 4GAIA 5EHAA 5F8WA 1S0BA 1Q1UA 3WINA 1AVAC 1S0LA 2L5XA 1SR4A 4IHZA 4QD2B 4TLPA 3C9ZA 5F90A 3VSZA 3V79C 1W3AA 3CAHA 4D0TA 2D23A 4ZKTB 3IM7A 1M2TB 3V0AA 4JKQA 3N7KA 3RTJB 3V0BA 1HKNA 3AKIA 8I1BA 4ISQA 3N7LA 4IY9A 3JRRA 2WRYA 3PUBA 1FV2A 4G6JA 4D0ZA 1FWVA 4L4HA 4IY8A 1PUUB 1XZZA 2K8RA 2D44A 4II0A 4I8MA 2AXMA 2RG9B 3BAQA 4OWKA 5BXPA 4UY4A 3OBTA 4P0JA 1AVUA 1E0OA 4I7IA 3CRGA 1V6XA 5BXTA 3BRGC 4P0KA 3BAHA 1TFMB 2DRZA 4I0YA 3R4UA 3CA4A 4EB2B 4IONA 3CRHA 1I1EA 2DREA 1JLYA 3O4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVX B;  4J23 B;  1HIB A;  2ZR1 B;  4QBV A;  4LO7 B;  4Z8S B;  3P53 A;  4F34 A;  2F8X C;  2NVH A;  4I96 A;  3FJC A;  1EV2 A;  4GP3 A;  4PC4 A;  3UDA A;  4Z9W B;  2LIE A;  4I2S A;  4CJM A;  1JTC A;  4ZGR B;  4JKX B;  3ZC9 A;  4Q9P A;  3OJV A;  3ZX7 A;  1T4Q A;  2K4A B;  1BA7 A;  1G9B A;  2FO1 A;  2E4M A;  1PC8 B;  4X3A A;  4OEF A;  2NP0 A;  3HN1 A;  3O4A A;  1PUM B;  3PG0 A;  2Q9X A;  1BLD A;  2Q3N B;  3A21 A;  3UD8 A;  2I1B A;  1T9F A;  1YTO A;  1ILR 1;  2Y9F A;  1KNM A;  3BAD A;  1IOB A;  2ET2 A;  3EF2 A;  2IWT B;  4I37 A;  4HA2 A;  4H04 A;  1XHB A;  3FJB A;  3UD7 A;  1AVW B;  2D1Z A;  2BFH A;  5FZY A;  5B2H A;  4X38 A;  2ZQN A;  1ISV A;  4L4I A;  4I4V A;  1FQ9 A;  5BXR A;  4KEI A;  3N7J A;  1G9C A;  1ISZ A;  2Y9W C;  1F31 A;  1AXM A;  3HBW A;  1DZC A;  2BEB A;  3H6R B;  3H6Q A;  2X2S A;  4LO7 C;  4Q9G A;  4GOV A;  3ZXD A;  4F83 A;  5FZZ A;  1WD3 A;  4OWJ A;  1FWU A;  2VLC A;  3FJJ A;  1S0E A;  1XG6 A;  4R6U B;  4G9N A;  4KEK A;  5EG6 C;  4X39 A;  1IHK A;  5FNX A;  4USP A;  4WBC A;  4I1B A;  4ZFU B;  3CU1 B;  1BFC A;  1ABR B;  2XOA A;  4EKX B;  31BI A;  4JRA A;  4QO3 A;  5D63 A;  4LO0 C;  4XKI A;  2HZ9 A;  3AH1 A;  3CA0 A;  1NUN A;  4P0L A;  3NBD A;  3O4O A;  3AKF A;  1FGA A;  3CA6 A;  4ZA3 B;  1BFF A;  3BX1 C;  2NM1 A;  1ISY A;  1DLL A;  2D7I A;  3OGF A;  5G00 A;  4JPZ A;  1QQL A;  1YXW A;  4ZBV B;  3N7M A;  2VXT I;  3RSJ A;  1G9A A;  3WO4 A;  2Y9G A;  4LO3 C;  4J2X A;  5DUY A;  3IIR A;  3AH2 A;  3LLP A;  4AN7 B;  4X37 A;  1YF8 B;  4A7Y A;  4LO2 C;  1FMM S;  2Z48 A;  1WD4 A;  1WBA A;  4QKS A;  2K43 A;  1IRA X;  4I4Q A;  2NZ9 A;  3AKH A;  3CRI A;  3ILA A;  4H9W A;  5D61 A;  2D24 A;  2VU9 A;  1OQL B;  3IM5 A;  4ZLB B;  1DIW A;  2LIQ A;  3ZC8 A;  1HWO B;  3NJ5 A;  2VSE A;  1DJS B;  2AFG A;  2DS0 A;  1FV3 A;  4HJJ A;  1DFQ A;  5BVP I;  1W3G A;  1S0D A;  2VUA A;  1DZD A;  2KI4 A;  3RMX A;  3QYD A;  4QD2 C;  3AZW A;  4XFS A;  3S8J A;  3NBN A;  3AJ6 A;  5GAQ A;  4YOL A;  1QXM A;  5HPZ A;  5I1B A;  2QN4 A;  4KEJ A;  3OGG A;  2KH2 A;  4IZE A;  3V0A B;  3V0B B;  4I3N A;  2Y9X E;  3I2A A;  3K1X A;  1V6W A;  3CA1 A;  2R9K B;  3IM6 A;  3AJ5 A;  1V6V A;  5BP5 C;  2D20 A;  5F8S A;  1VCL A;  2UUS A;  4EEE B;  21BI A;  3FJH A;  4OEE A;  1TOO A;  3HSM A;  1R8N A;  1M16 A;  3BA7 A;  2M49 A;  3RTI B;  2FFU A;  3BB2 A;  4USO A;  1I1B A;  3FFZ A;  4QAL A;  1Z2V A;  2QYI B;  4AN6 A;  3P6I A;  1DQO A;  3NBC A;  3O4B A;  1Q04 A;  3BRF A;  1K5U A;  2FDB M;  2MLL B;  4QKR A;  5FZU A;  3FJK A;  4QC4 A;  5EC5 A;  4XFT A;  3AH4 A;  3F62 B;  3FJF A;  3BA4 A;  3FJ9 A;  3MAL A;  3WIN C;  3FJI A;  1S0F A;  1SR4 C;  2FGF A;  2WBC A;  2GO2 A;  3BTA A;  2HWM A;  2DRY A;  2D22 A;  3I29 B;  1W3F A;  3Q7Y A;  3WO2 A;  1FMZ A;  1JQZ A;  1ITB A;  1RY7 A;  4J2Y A;  3O4D A;  1K5V A;  1Z0H A;  2X2T A;  3E8L C;  1YYN A;  3POK A;  1EYL A;  3BAO A;  1G82 A;  4I4O A;  2RQ9 A;  5F8Y A;  2AAI B;  1DQG A;  2D7R A;  1JLX A;  4DEP A;  4ISR A;  3FGM A;  3MPP G;  4A7K A;  1ONK B;  5FNW A;  1JT3 A;  1V6U A;  2Z49 A;  4GP0 A;  1ISW A;  1IIL A;  1A8D A;  3AZV A;  1CE7 B;  1HWP B;  1PWA A;  3RMY A;  6I1B A;  3HAL A;  4KC3 A;  1YBI A;  4JP0 A;  4I4U A;  1BFG A;  4LO8 B;  1S0C A;  1ISX A;  1DFC A;  4OWL A;  4EFQ A;  2P23 A;  3B9U A;  3HOM A;  4J2S A;  4LO1 C;  3OJ2 A;  1RG8 A;  5JLV A;  1S0G A;  1SZ6 B;  1BLA A;  3VUO A;  2FFV A;  3Q7X A;  4OW4 A;  1TP0 A;  1UPS A;  3SNV A;  3WMV A;  4ZFY B;  3O49 A;  3UJ4 A;  3PME A;  4I4Y A;  3OBR A;  4OEG A;  1JY0 A;  3IAG C;  4G6M A;  4XFU A;  1MD6 A;  1IJT A;  4QBC A;  1AFC A;  3VT1 A;  2E4M C;  2NYY A;  3TC2 A;  2VSA A;  1CVS A;  1JT5 A;  4LO0 A;  1TWE A;  3NBE A;  1BFB A;  2D43 A;  3S8K A;  3A22 A;  4Q91 A;  2VXR A;  4JAW A;  4J2K A;  4ZFW B;  1JT7 A;  4I6I A;  5DVH A;  5BOW A;  4HR6 C;  4I1E A;  3FUQ A;  2KKI A;  3AKG A;  4GAF A;  1IT0 A;  2AQZ A;  3VWC A;  5D62 A;  1G9D A;  5E24 E;  3OJM A;  3FUO A;  1IRP A;  2KLL A;  4FVV A;  4G1R A;  3JUT A;  3H6R A;  3BRD A;  4LO1 A;  4G9M A;  1Z4S A;  2HW9 A;  2MIB A;  3WO3 A;  1N4K A;  1NZK A;  5BXS A;  1WBC A;  4LO3 A;  1Q03 A;  4END A;  3BAG A;  4JQ0 A;  5BQU C;  3ZXG A;  1P63 A;  4LO2 A;  3A07 A;  3FJA A;  3WA1 A;  3W9T A;  3Q7W A;  3FJ8 A;  1QQK A;  3LTQ A;  4I4P A;  4P6A A;  4EFP A;  3I2X A;  1BAR A;  4DEN A;  3BA5 A;  3VT2 A;  1TWM A;  4IQP A;  3CA5 A;  3UJ0 A;  4I4R A;  3VSF A;  3KMV A;  3WMU A;  1PZZ A;  3F1R A;  2ERM A;  3VT0 A;  3BAV A;  1HCE A;  4FGF A;  3CQA A;  4GOY A;  1RML A;  9ILB A;  4IZX A;  3R4S A;  2F2F C;  1TTU A;  1GGP B;  3HMY A;  3D7W B;  3PHZ A;  2RST A;  4ZOT A;  1EVT A;  2ZQO A;  1EPW A;  3FJD A;  4EFR A;  1D0H A;  5DSS B;  1AF9 A;  41BI A;  2NTD A;  1HCD A;  7I1B A;  4D8H A;  5DZU A;  2GZB A;  3BAU A;  1JT4 A;  3A23 A;  2BEA A;  3QR5 A;  3O3Q A;  2P39 A;  4I4X A;  5BQU A;  3UD9 A;  4I4S A;  1HWN B;  1BAS A;  1R8O A;  2MC2 A;  2KI6 B;  3CA3 A;  3P6J A;  5BP5 A;  4A7Z A;  1TIE A;  1II4 A;  4DCK C;  4OUJ A;  2J3P A;  1RZO B;  4IYB A;  3O5W B;  3VEQ A;  5JMC A;  1MC9 A;  1XYF A;  4KBB A;  1FN0 A;  3O44 A;  2ESU A;  3H6S E;  3FJE A;  2IHO A;  1L2H A;  2F2F A;  1J0S A;  2YUG A;  1HWM B;  2HWA A;  3T8S A;  3N0K A;  4GAI A;  5EHA A;  5F8W A;  1S0B A;  1Q1U A;  3WIN A;  1AVA C;  1S0L A;  2L5X A;  1SR4 A;  4IHZ A;  4QD2 B;  4TLP A;  3C9Z A;  5F90 A;  3VSZ A;  3V79 C;  1W3A A;  3CAH A;  4D0T A;  2D23 A;  4ZKT B;  3IM7 A;  1M2T B;  3V0A A;  4JKQ A;  3N7K A;  3RTJ B;  3V0B A;  1HKN A;  3AKI A;  8I1B A;  4ISQ A;  3N7L A;  4IY9 A;  3JRR A;  2WRY A;  3PUB A;  1FV2 A;  4G6J A;  4D0Z A;  1FWV A;  4L4H A;  4IY8 A;  1PUU B;  1XZZ A;  2K8R A;  2D44 A;  4II0 A;  4I8M A;  2AXM A;  2RG9 B;  3BAQ A;  4OWK A;  5BXP A;  3OBT A;  4P0J A;  1AVU A;  1E0O A;  4I7I A;  3CRG A;  1V6X A;  5BXT A;  3BRG C;  4P0K A;  3BAH A;  1TFM B;  2DRZ A;  4I0Y A;  3R4U A;  3CA4 A;  4EB2 B;  4ION A;  3CRH A;  1I1E A;  2DRE A;  1JLY A;  3O4C A; 
#chains in the Genus database with same CATH topology
 1AVX B;  4J23 B;  1HIB A;  2ZR1 B;  4QBV A;  4LO7 B;  4Z8S B;  3P53 A;  4F34 A;  2F8X C;  2NVH A;  4I96 A;  3FJC A;  1EV2 A;  4GP3 A;  4PC4 A;  3UDA A;  4Z9W B;  2LIE A;  4I2S A;  4CJM A;  1JTC A;  4ZGR B;  4JKX B;  3ZC9 A;  4Q9P A;  3OJV A;  3ZX7 A;  1T4Q A;  2K4A B;  4MZG B;  1BA7 A;  1G9B A;  2FO1 A;  2E4M A;  1PC8 B;  4X3A A;  4OEF A;  2NP0 A;  3HN1 A;  3O4A A;  1PUM B;  3PG0 A;  2Q9X A;  1BLD A;  2Q3N B;  3A21 A;  3UD8 A;  2I1B A;  4H75 A;  1T9F A;  1YTO A;  1ILR 1;  2Y9F A;  1KNM A;  3BAD A;  1IOB A;  2ET2 A;  3EF2 A;  2IWT B;  4I37 A;  4HA2 A;  4H04 A;  1XHB A;  3FJB A;  3UD7 A;  1AVW B;  2D1Z A;  2BFH A;  5FZY A;  5B2H A;  4X38 A;  4MZF B;  2ZQN A;  1ISV A;  4L4I A;  4I4V A;  1FQ9 A;  5BXR A;  4KEI A;  3N7J A;  1G9C A;  1ISZ A;  2Y9W C;  1F31 A;  1AXM A;  3HBW A;  1DZC A;  2BEB A;  3H6R B;  3H6Q A;  2X2S A;  4LO7 C;  4Q9G A;  4GOV A;  3ZXD A;  4F83 A;  5FZZ A;  1WD3 A;  4OWJ A;  1FWU A;  2VLC A;  3FJJ A;  1S0E A;  1XG6 A;  4R6U B;  4G9N A;  4KEK A;  5EG6 C;  4X39 A;  1IHK A;  5FNX A;  4USP A;  4WBC A;  4I1B A;  4ZFU B;  3CU1 B;  1BFC A;  1ABR B;  2XOA A;  4EKX B;  31BI A;  4JRA A;  4QO3 A;  5D63 A;  4LO0 C;  4XKI A;  2HZ9 A;  3AH1 A;  3CA0 A;  1NUN A;  4P0L A;  3NBD A;  3O4O A;  3AKF A;  1FGA A;  3CA6 A;  4ZA3 B;  1BFF A;  3BX1 C;  2NM1 A;  1ISY A;  1DLL A;  2D7I A;  3OGF A;  5G00 A;  4JPZ A;  1QQL A;  1YXW A;  4ZBV B;  3N7M A;  2VXT I;  3RSJ A;  1G9A A;  3WO4 A;  2Y9G A;  4LO3 C;  4J2X A;  5DUY A;  3IIR A;  3AH2 A;  3LLP A;  4AN7 B;  4X37 A;  1YF8 B;  4A7Y A;  4LO2 C;  1FMM S;  2Z48 A;  1WD4 A;  1WBA A;  4QKS A;  2K43 A;  1IRA X;  4I4Q A;  2NZ9 A;  3AKH A;  3CRI A;  3ILA A;  4H9W A;  5D61 A;  2D24 A;  2VU9 A;  1OQL B;  3IM5 A;  4ZLB B;  1DIW A;  2LIQ A;  3ZC8 A;  1HWO B;  3NJ5 A;  2VSE A;  1DJS B;  2AFG A;  2DS0 A;  1FV3 A;  4HJJ A;  1DFQ A;  5BVP I;  1W3G A;  1S0D A;  2VUA A;  1DZD A;  2KI4 A;  3RMX A;  3QYD A;  4QD2 C;  3AZW A;  4XFS A;  3S8J A;  3NBN A;  3AJ6 A;  5GAQ A;  4YOL A;  1QXM A;  5HPZ A;  5I1B A;  2QN4 A;  4KEJ A;  3OGG A;  2KH2 A;  4IZE A;  3V0A B;  3V0B B;  4I3N A;  2Y9X E;  3I2A A;  3K1X A;  1V6W A;  3CA1 A;  2R9K B;  3IM6 A;  3AJ5 A;  1V6V A;  5BP5 C;  2D20 A;  5F8S A;  1VCL A;  2UUS A;  4EEE B;  21BI A;  3FJH A;  4OEE A;  1TOO A;  3HSM A;  1R8N A;  1M16 A;  3BA7 A;  2M49 A;  3RTI B;  2FFU A;  3BB2 A;  4USO A;  1I1B A;  3FFZ A;  4QAL A;  1Z2V A;  2QYI B;  4AN6 A;  3P6I A;  1DQO A;  3NBC A;  3O4B A;  1Q04 A;  3BRF A;  1K5U A;  2FDB M;  2MLL B;  4QKR A;  5FZU A;  3FJK A;  4QC4 A;  5EC5 A;  2NS2 A;  3AH4 A;  3F62 B;  4XFT A;  3FJF A;  3BA4 A;  3FJ9 A;  3MAL A;  3WIN C;  3FJI A;  1S0F A;  1SR4 C;  2FGF A;  2WBC A;  2GO2 A;  3BTA A;  2HWM A;  2DRY A;  2D22 A;  3I29 B;  1W3F A;  3Q7Y A;  3WO2 A;  1FMZ A;  1JQZ A;  1ITB A;  1RY7 A;  4J2Y A;  3O4D A;  1K5V A;  1Z0H A;  2X2T A;  3E8L C;  1YYN A;  3POK A;  1EYL A;  3BAO A;  1G82 A;  4I4O A;  2RQ9 A;  5F8Y A;  2AAI B;  1DQG A;  2D7R A;  1JLX A;  4DEP A;  4ISR A;  3FGM A;  3MPP G;  4A7K A;  1ONK B;  5FNW A;  1JT3 A;  1V6U A;  2Z49 A;  4GP0 A;  1ISW A;  1IIL A;  1A8D A;  3AZV A;  1CE7 B;  1HWP B;  1PWA A;  3RMY A;  6I1B A;  3HAL A;  4KC3 A;  1YBI A;  4JP0 A;  4I4U A;  1BFG A;  4LO8 B;  1S0C A;  1ISX A;  1DFC A;  4OWL A;  4EFQ A;  2P23 A;  3B9U A;  3HOM A;  4J2S A;  4LO1 C;  3OJ2 A;  1RG8 A;  5JLV A;  1S0G A;  1SZ6 B;  1BLA A;  3VUO A;  2FFV A;  3Q7X A;  4OW4 A;  1TP0 A;  1UPS A;  3SNV A;  3WMV A;  4ZFY B;  3O49 A;  3UJ4 A;  3PME A;  4I4Y A;  3OBR A;  4OEG A;  1JY0 A;  3IAG C;  4G6M A;  4XFU A;  1MD6 A;  1IJT A;  4QBC A;  1AFC A;  3VT1 A;  2E4M C;  2NYY A;  3TC2 A;  2VSA A;  1CVS A;  1JT5 A;  4LO0 A;  1TWE A;  3NBE A;  1BFB A;  2D43 A;  3S8K A;  3A22 A;  4Q91 A;  2VXR A;  4JAW A;  4J2K A;  4ZFW B;  1JT7 A;  4I6I A;  5DVH A;  5BOW A;  4HR6 C;  4I1E A;  3FUQ A;  2KKI A;  3AKG A;  4GAF A;  1IT0 A;  2AQZ A;  3VWC A;  5D62 A;  1G9D A;  5E24 E;  3OJM A;  3FUO A;  1IRP A;  2KLL A;  4FVV A;  4G1R A;  3JUT A;  3H6R A;  3BRD A;  4LO1 A;  4G9M A;  1Z4S A;  2HW9 A;  2MIB A;  3WO3 A;  1N4K A;  1NZK A;  5BXS A;  1WBC A;  4LO3 A;  1Q03 A;  4END A;  3BAG A;  4JQ0 A;  5BQU C;  3ZXG A;  1P63 A;  4LO2 A;  3A07 A;  3FJA A;  3WA1 A;  3W9T A;  3Q7W A;  3FJ8 A;  1QQK A;  3LTQ A;  4I4P A;  4P6A A;  4EFP A;  3I2X A;  1BAR A;  4DEN A;  3BA5 A;  3VT2 A;  1TWM A;  4IQP A;  3CA5 A;  3UJ0 A;  4I4R A;  3VSF A;  3KMV A;  3WMU A;  1PZZ A;  3F1R A;  2ERM A;  3VT0 A;  3BAV A;  1HCE A;  4FGF A;  3CQA A;  4GOY A;  1RML A;  9ILB A;  4IZX A;  3R4S A;  2F2F C;  1TTU A;  1GGP B;  3HMY A;  3D7W B;  3PHZ A;  2RST A;  4ZOT A;  1EVT A;  2ZQO A;  1EPW A;  3FJD A;  4EFR A;  1D0H A;  4MZH A;  5DSS B;  1AF9 A;  41BI A;  2NTD A;  1HCD A;  7I1B A;  4D8H A;  5DZU A;  2GZB A;  3BAU A;  1JT4 A;  3A23 A;  2BEA A;  3QR5 A;  3O3Q A;  2P39 A;  4I4X A;  5BQU A;  3UD9 A;  4I4S A;  1HWN B;  1BAS A;  1R8O A;  2MC2 A;  2KI6 B;  3CA3 A;  3P6J A;  5BP5 A;  4A7Z A;  1TIE A;  1II4 A;  4DCK C;  4OUJ A;  2J3P A;  1RZO B;  4IYB A;  3O5W B;  3VEQ A;  5JMC A;  1MC9 A;  1XYF A;  4KBB A;  1FN0 A;  3O44 A;  2ESU A;  3H6S E;  3FJE A;  2IHO A;  1L2H A;  2F2F A;  1J0S A;  2YUG A;  1HWM B;  2HWA A;  3T8S A;  3N0K A;  4GAI A;  5EHA A;  5F8W A;  1S0B A;  1Q1U A;  3WIN A;  1AVA C;  1S0L A;  2L5X A;  1SR4 A;  4IHZ A;  4QD2 B;  4TLP A;  3C9Z A;  5F90 A;  3VSZ A;  3V79 C;  1W3A A;  3CAH A;  4D0T A;  2D23 A;  4ZKT B;  3IM7 A;  1M2T B;  3V0A A;  4JKQ A;  3N7K A;  3RTJ B;  3V0B A;  1HKN A;  3AKI A;  8I1B A;  4ISQ A;  3N7L A;  4IY9 A;  3JRR A;  2WRY A;  3PUB A;  1FV2 A;  4G6J A;  4D0Z A;  1FWV A;  4L4H A;  4IY8 A;  1PUU B;  1XZZ A;  2K8R A;  2D44 A;  4II0 A;  4I8M A;  2AXM A;  2RG9 B;  3BAQ A;  4OWK A;  5BXP A;  4UY4 A;  3OBT A;  4P0J A;  1AVU A;  1E0O A;  4I7I A;  3CRG A;  1V6X A;  5BXT A;  3BRG C;  4P0K A;  3BAH A;  1TFM B;  2DRZ A;  4I0Y A;  3R4U A;  3CA4 A;  4EB2 B;  4ION A;  3CRH A;  1I1E A;  2DRE A;  1JLY A;  3O4C A; 
#chains in the Genus database with same CATH homology
 1AVX B;  4J23 B;  1HIB A;  2ZR1 B;  4QBV A;  4LO7 B;  4Z8S B;  3P53 A;  4F34 A;  2F8X C;  2NVH A;  4I96 A;  3FJC A;  1EV2 A;  4GP3 A;  4PC4 A;  3UDA A;  4Z9W B;  2LIE A;  4I2S A;  4CJM A;  1JTC A;  4ZGR B;  4JKX B;  3ZC9 A;  4Q9P A;  3OJV A;  3ZX7 A;  1T4Q A;  2K4A B;  4MZG B;  1BA7 A;  1G9B A;  2FO1 A;  2E4M A;  1PC8 B;  4X3A A;  4OEF A;  2NP0 A;  3HN1 A;  3O4A A;  1PUM B;  3PG0 A;  2Q9X A;  1BLD A;  2Q3N B;  3A21 A;  3UD8 A;  2I1B A;  4H75 A;  1T9F A;  1YTO A;  1ILR 1;  2Y9F A;  1KNM A;  3BAD A;  1IOB A;  2ET2 A;  3EF2 A;  2IWT B;  4I37 A;  4HA2 A;  4H04 A;  1XHB A;  3FJB A;  3UD7 A;  1AVW B;  2D1Z A;  2BFH A;  5FZY A;  5B2H A;  4X38 A;  4MZF B;  2ZQN A;  1ISV A;  4L4I A;  4I4V A;  1FQ9 A;  5BXR A;  4KEI A;  3N7J A;  1G9C A;  1ISZ A;  2Y9W C;  1F31 A;  1AXM A;  3HBW A;  1DZC A;  2BEB A;  3H6R B;  3H6Q A;  2X2S A;  4LO7 C;  4Q9G A;  4GOV A;  3ZXD A;  4F83 A;  5FZZ A;  1WD3 A;  4OWJ A;  1FWU A;  2VLC A;  3FJJ A;  1S0E A;  1XG6 A;  4R6U B;  4G9N A;  4KEK A;  5EG6 C;  4X39 A;  1IHK A;  5FNX A;  4USP A;  4WBC A;  4I1B A;  4ZFU B;  3CU1 B;  1BFC A;  1ABR B;  2XOA A;  4EKX B;  31BI A;  4JRA A;  4QO3 A;  5D63 A;  4LO0 C;  4XKI A;  2HZ9 A;  3AH1 A;  3CA0 A;  1NUN A;  4P0L A;  3NBD A;  3O4O A;  3AKF A;  1FGA A;  3CA6 A;  4ZA3 B;  1BFF A;  3BX1 C;  2NM1 A;  1ISY A;  1DLL A;  2D7I A;  3OGF A;  5G00 A;  4JPZ A;  1QQL A;  1YXW A;  4ZBV B;  3N7M A;  2VXT I;  3RSJ A;  1G9A A;  3WO4 A;  2Y9G A;  4LO3 C;  4J2X A;  5DUY A;  3IIR A;  3AH2 A;  3LLP A;  4AN7 B;  4X37 A;  1YF8 B;  4A7Y A;  4LO2 C;  1FMM S;  2Z48 A;  1WD4 A;  1WBA A;  4QKS A;  2K43 A;  1IRA X;  4I4Q A;  2NZ9 A;  3AKH A;  3CRI A;  3ILA A;  4H9W A;  5D61 A;  2D24 A;  2VU9 A;  1OQL B;  3IM5 A;  4ZLB B;  1DIW A;  2LIQ A;  3ZC8 A;  1HWO B;  3NJ5 A;  2VSE A;  1DJS B;  2AFG A;  2DS0 A;  1FV3 A;  4HJJ A;  1DFQ A;  5BVP I;  1W3G A;  1S0D A;  2VUA A;  1DZD A;  2KI4 A;  3RMX A;  3QYD A;  4QD2 C;  3AZW A;  4XFS A;  3S8J A;  3NBN A;  3AJ6 A;  5GAQ A;  4YOL A;  1QXM A;  5HPZ A;  5I1B A;  2QN4 A;  4KEJ A;  3OGG A;  2KH2 A;  4IZE A;  3V0A B;  3V0B B;  4I3N A;  2Y9X E;  3I2A A;  3K1X A;  1V6W A;  3CA1 A;  2R9K B;  3IM6 A;  3AJ5 A;  1V6V A;  5BP5 C;  2D20 A;  5F8S A;  1VCL A;  2UUS A;  4EEE B;  21BI A;  3FJH A;  4OEE A;  1TOO A;  3HSM A;  1R8N A;  1M16 A;  3BA7 A;  2M49 A;  3RTI B;  2FFU A;  3BB2 A;  4USO A;  1I1B A;  3FFZ A;  4QAL A;  1Z2V A;  2QYI B;  4AN6 A;  3P6I A;  1DQO A;  3NBC A;  3O4B A;  1Q04 A;  3BRF A;  1K5U A;  2FDB M;  2MLL B;  4QKR A;  5FZU A;  3FJK A;  4QC4 A;  5EC5 A;  2NS2 A;  3AH4 A;  3F62 B;  4XFT A;  3FJF A;  3BA4 A;  3FJ9 A;  3MAL A;  3WIN C;  3FJI A;  1S0F A;  1SR4 C;  2FGF A;  2WBC A;  2GO2 A;  3BTA A;  2HWM A;  2DRY A;  2D22 A;  3I29 B;  1W3F A;  3Q7Y A;  3WO2 A;  1FMZ A;  1JQZ A;  1ITB A;  1RY7 A;  4J2Y A;  3O4D A;  1K5V A;  1Z0H A;  2X2T A;  3E8L C;  1YYN A;  3POK A;  1EYL A;  3BAO A;  1G82 A;  4I4O A;  2RQ9 A;  5F8Y A;  2AAI B;  1DQG A;  2D7R A;  1JLX A;  4DEP A;  4ISR A;  3FGM A;  3MPP G;  4A7K A;  1ONK B;  5FNW A;  1JT3 A;  1V6U A;  2Z49 A;  4GP0 A;  1ISW A;  1IIL A;  1A8D A;  3AZV A;  1CE7 B;  1HWP B;  1PWA A;  3RMY A;  6I1B A;  3HAL A;  4KC3 A;  1YBI A;  4JP0 A;  4I4U A;  1BFG A;  4LO8 B;  1S0C A;  1ISX A;  1DFC A;  4OWL A;  4EFQ A;  2P23 A;  3B9U A;  3HOM A;  4J2S A;  4LO1 C;  3OJ2 A;  1RG8 A;  5JLV A;  1S0G A;  1SZ6 B;  1BLA A;  3VUO A;  2FFV A;  3Q7X A;  4OW4 A;  1TP0 A;  1UPS A;  3SNV A;  3WMV A;  4ZFY B;  3O49 A;  3UJ4 A;  3PME A;  4I4Y A;  3OBR A;  4OEG A;  1JY0 A;  3IAG C;  4G6M A;  4XFU A;  1MD6 A;  1IJT A;  4QBC A;  1AFC A;  3VT1 A;  2E4M C;  2NYY A;  3TC2 A;  2VSA A;  1CVS A;  1JT5 A;  4LO0 A;  1TWE A;  3NBE A;  1BFB A;  2D43 A;  3S8K A;  3A22 A;  4Q91 A;  2VXR A;  4JAW A;  4J2K A;  4ZFW B;  1JT7 A;  4I6I A;  5DVH A;  5BOW A;  4HR6 C;  4I1E A;  3FUQ A;  2KKI A;  3AKG A;  4GAF A;  1IT0 A;  2AQZ A;  3VWC A;  5D62 A;  1G9D A;  5E24 E;  3OJM A;  3FUO A;  1IRP A;  2KLL A;  4FVV A;  4G1R A;  3JUT A;  3H6R A;  3BRD A;  4LO1 A;  4G9M A;  1Z4S A;  2HW9 A;  2MIB A;  3WO3 A;  1N4K A;  1NZK A;  5BXS A;  1WBC A;  4LO3 A;  1Q03 A;  4END A;  3BAG A;  4JQ0 A;  5BQU C;  3ZXG A;  1P63 A;  4LO2 A;  3A07 A;  3FJA A;  3WA1 A;  3W9T A;  3Q7W A;  3FJ8 A;  1QQK A;  3LTQ A;  4I4P A;  4P6A A;  4EFP A;  3I2X A;  1BAR A;  4DEN A;  3BA5 A;  3VT2 A;  1TWM A;  4IQP A;  3CA5 A;  3UJ0 A;  4I4R A;  3VSF A;  3KMV A;  3WMU A;  1PZZ A;  3F1R A;  2ERM A;  3VT0 A;  3BAV A;  1HCE A;  4FGF A;  3CQA A;  4GOY A;  1RML A;  9ILB A;  4IZX A;  3R4S A;  2F2F C;  1TTU A;  1GGP B;  3HMY A;  3D7W B;  3PHZ A;  2RST A;  4ZOT A;  1EVT A;  2ZQO A;  1EPW A;  3FJD A;  4EFR A;  1D0H A;  4MZH A;  5DSS B;  1AF9 A;  41BI A;  2NTD A;  1HCD A;  7I1B A;  4D8H A;  5DZU A;  2GZB A;  3BAU A;  1JT4 A;  3A23 A;  2BEA A;  3QR5 A;  3O3Q A;  2P39 A;  4I4X A;  5BQU A;  3UD9 A;  4I4S A;  1HWN B;  1BAS A;  1R8O A;  2MC2 A;  2KI6 B;  3CA3 A;  3P6J A;  5BP5 A;  4A7Z A;  1TIE A;  1II4 A;  4DCK C;  4OUJ A;  2J3P A;  1RZO B;  4IYB A;  3O5W B;  3VEQ A;  5JMC A;  1MC9 A;  1XYF A;  4KBB A;  1FN0 A;  3O44 A;  2ESU A;  3H6S E;  3FJE A;  2IHO A;  1L2H A;  2F2F A;  1J0S A;  2YUG A;  1HWM B;  2HWA A;  3T8S A;  3N0K A;  4GAI A;  5EHA A;  5F8W A;  1S0B A;  1Q1U A;  3WIN A;  1AVA C;  1S0L A;  2L5X A;  1SR4 A;  4IHZ A;  4QD2 B;  4TLP A;  3C9Z A;  5F90 A;  3VSZ A;  3V79 C;  1W3A A;  3CAH A;  4D0T A;  2D23 A;  4ZKT B;  3IM7 A;  1M2T B;  3V0A A;  4JKQ A;  3N7K A;  3RTJ B;  3V0B A;  1HKN A;  3AKI A;  8I1B A;  4ISQ A;  3N7L A;  4IY9 A;  3JRR A;  2WRY A;  3PUB A;  1FV2 A;  4G6J A;  4D0Z A;  1FWV A;  4L4H A;  4IY8 A;  1PUU B;  1XZZ A;  2K8R A;  2D44 A;  4II0 A;  4I8M A;  2AXM A;  2RG9 B;  3BAQ A;  4OWK A;  5BXP A;  4UY4 A;  3OBT A;  4P0J A;  1AVU A;  1E0O A;  4I7I A;  3CRG A;  1V6X A;  5BXT A;  3BRG C;  4P0K A;  3BAH A;  1TFM B;  2DRZ A;  4I0Y A;  3R4U A;  3CA4 A;  4EB2 B;  4ION A;  3CRH A;  1I1E A;  2DRE A;  1JLY A;  3O4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...