3WNEA

Cyclic hexapeptide pkidng in complex with hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
154
structure length
138
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
total genus 47
structure length 138
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wneA00
1CZBA 1QSYA 4C8LA 1X1PA 3SQ1A 4JLHA 4RW4A 4FK2A 1KFDA 1J5OA 4Z0UA 4CF0A 3HPHA 2XY6A 4CK2A 1N6QA 2XHBA 1T7PA 3QEVA 1JLGA 1WSFA 4YNQA 4IG0A 3IRXA 4BE1A 3I0SA 3EYZA 3OYLA 5KTQA 4DTPA 1BIUA 1HRHA 3ZSQA 1RDAA 1BCMA 1VSMA 3VQBA 1L5UA 4FJLA 3OYCA 3OYMA 4ELVA 3P83D 4LD0A 3RR7A 3OYKA 4F3TA 4ELUA 4B8AB 2A1SA 2HVHA 4ID5A 4CFBA 2IGIA 3CM6A 3VA0A 2PYLA 2RKIA 4H4MA 4FLXA 3THVA 4BDPA 3LZIA 1UA0A 1S1VA 4NYNA 4NCAA 2GV9A 2QXFA 3HT3A 3LANA 3P1GA 5FDLA 1U49A 4F2RA 3VQ9A 3NAEA 1X9SA 1RTJA 4CGIA 2G8IA 1Z25A 3M8RA 1NKEA 3PX4A 4HUEA 3LDSA 4CECA 3TABA 4KB1A 3VQ4A 2KZMA 1KFSA 4FJIA 3HYFA 4E7HA 3RMAA 3KLHA 4M3WA 5C25A 1YVUA 4OLAA 1HNVA 1BI4B 3BGRA 4DTSA 2IS3A 3B6OA 1HQUA 2PY5A 4L8RB 3V1QA 1Z26A 1I3AA 1MU2A 3U6FA 3V9SA 3LP3A 4QCLA 3AA2A 2YNHA 1B9DA 4B08A 4CJFA 2YKMA 4FM0A 3T1AA 4CESA 2E6LA 2IC3A 3AVKA 4DG1A 1J9AA 2HB5A 4KFBA 4AHRA 4E7KA 3V4IA 2P5OA 1RBUA 1TKZA 1KVCA 3AVGA 3NH2A 4CCHA 3EY1A 4DU4A 3L3VA 1REVA 1C1CA 1WAFA 3TAMA 3ZT2A 1U45A 3F9KA 3VQ6A 1ZBFA 1YTAA 5DMRA 3S3NA 3OYBA 4J2AA 5EU7A 4ZHRA 3DLBA 1B92A 3DOLA 4Z4FA 1XWLA 2PZSA 4AILC 4DTJA 4CJLA 2BE2A 4O5BA 5CZ2A 3QINA 4Z4GA 1LAWA 1KVBA 3AVBA 4CEAA 4AHUA 3DYAA 1TKDA 2HHXA 1S5JA 4JS5A 3JSMA 4K8XA 4ZTFA 4CEFA 2HHVA 3KLIA 3SYZA 2EX3A 3V9UA 3DRSA 4FZYA 3LAKA 3DMJA 4DSEA 4OKJA 4FLTA 4FJ5A 5KGWA 1WN7A 4ICLA 3NH0A 3SQ0A 1LAVA 4B9SA 3QERA 2VWJA 4W5RA 2OZSA 4FZZA 1NK9A 1FXXA 2ZD1A 3L2QA 4B3OA 2VG7A 3RMBA 1L3SA 1ZYQA 3D45A 1NJZA 4B9LA 1ZBUA 1RDBA 4DSKA 4KHUA 4BDYA 3QETA 1BIZA 3SPZA 3I0RA 3NFAA 2Q3SA 1WNSA 4FJHA 4NCGA 4CIGA 3SPYA 4DS5A 1NK4A 1BQNA 3OY9A 4KREA 3AA4A 1RBTA 1EETA 3NBPA 3DLEA 5HRPA 4O44A 3HP9A 3OYHA 3PY8A 3NF7A 3D0PA 4CJKA 1JLAA 3T19A 1KSPA 3AO5A 2R7YA 1X9MA 4I2PA 1JLCA 4E1MA 1IKXA 4O55A 3V1RA 3K5LA 3ZSWA 1QE1A 1RBRA 3TWHA 4FLUA 2IOCA 4OPKA 3NF6A 1JL1A 1HYZA 2HNDA 4TSXA 3RTVA 1T8EA 4DTMA 4F8RA 4CJSA 2X6SA 4Z4CA 1U48A 1HYVA 2KW4A 3M8SA 3SQ4A 3PX0A 3PO5A 4CHNA 1T05A 4DLGA 3RRGA 3KK1A 3KD5E 4HUFA 1KRPA 4HHTA 4Z4EA 4DQPA 4FVMA 2ATQA 3AA3A 4MQ3A 1QSSA 2B5JA 2HHSA 4IDKA 3OYEA 3KKRA 4FXDA 3QEWA 4HUGA 4ID1A 3QLHA 4FCYA 4DFMA 3SZ2A 4O4GA 3WNEA 3AVAA 1L3TA 3TAQA 3AVLA 3CYMA 1TK0A 1S6QA 1TKXA 4LH5A 2VG6A 3V9ZA 1D9DA 2KTQA 5I42A 4LSNA 1JLQA 4C8OA 1QHTA 2VG5A 2FBTA 1NK0A 1RT4A 3LPTA 1TAUA 3SUOA 4F4KA 2DY4A 3DM2A 4NCBA 1SUQA 2P1JA 3B6PA 3DLRA 3HPOA 3MXMA 1C1BA 4E19A 1TK8A 4J2DA 2KFZA 1ASUA 2YKNA 1VRUA 3HJFA 4M3XA 2Y1IA 4CEOA 1IO2A 4E1NA 5C42A 3ZT0A 2JGUA 3C6UA 3AO2A 4FLZA 3O4QA 4WE1A 4MFBA 3ZT1A 4CEBA 3L2RA 3OJUA 2QKKA 1TKTA 1UOCA 1VSJA 3CQ8A 4FJ7A 3IAYA 4OLBA 3VQPA 4W5OA 2KQ2A 5HRSA 4KKOA 3RRHA 4DF8A 2P5GA 4KHNA 4M3UA 3ZSOA 1WSGA 3BDPA 4CHYA 4N47A 3IG1A 3O4NA 4W5TA 3OJSA 4OGEA 4Y1DA 3U3YA 1TV6A 2BANA 2O4IA 3L2WA 4DTUA 1C1AA 4YFUA 1RTIA 4O0IA 4IG3A 4CHPA 3K5MA 4DTOA 3KIOA 4DF4A 1TL1A 1FKOA 4J2BA 3VQAA 1LWCA 1WLJA 1HMVA 1S1UA 4GMJB 2F96A 3ZCMA 4CJ5A 5KRSA 4RG8A 4FJMA 3A2FA 4CEDA 4OJRA 2I5JA 1JXEA 1RT2A 3NGIA 1T03A 4DMNA 4DU1A 4B9UA 4FLVA 1EX4A 1X9WA 4Q5VA 2YHBA 3AVJA 1BCOA 3L8BA 1RTHA 4BE2A 1HQEA 4G1QA 4CE9A 4CJEA 1L3VA 4KO0A 3AO1A 2FC0A 3K5NA 1Q9YA 1QSLA 4M3ZA 4GVMA 1BHLA 3DLKA 3SV3A 1JXBA 5HRNA 3V9XA 4FJGA 1WSJA 5JS1A 3G10A 4FJ9A 1NK7A 4BE0A 2F8SA 4KAZA 3VQ5A 3NE6A 4E7IA 4M3YA 3MECA 4CJQA 5KRTA 5CY4A 4CFAA 4CJTA 1UA1A 3NHGA 3CG7A 4RW7A 5KI6A 3VN5A 2RN2A 3SUQA 1U47A 2DTUA 3ALYA 4AH9A 1K6YA 3VQ8A 4CJUA 4FJJA 4OGCA 3NH1A 3M8PA 2XY5A 4DSLA 4EZ6A 3RR8A 3S9HA 1EP4A 1VSDA 3NCIA 1XHZA 4F3OA 1IKWA 4PUOA 3QEIA 1GOAA 3C6TA 1NKCA 4KHQA 1A5VA 3O3GA 1YTUA 3MXIA 4Y1CA 1SKWA 1F21A 4CGDA 4DSJA 4CF9A 4CFCA 4CGGA 5FROA 4AHSA 3OYIA 2BDPA 4B9MA 5FRNA 1SL2A 1CZ9A 1O1WA 2ZQBA 3ZSYA 4DQRA 1WSIA 4C8NA 2FBYA 4I9QA 3IS9A 3KKSA 3DRRA 1ASVA 3HVTA 1EKEA 4FJKA 1NJYA 1QQCA 3SUNA 2X74A 5CYQA 1EXQA 3ULDA 2HMIA 3G0ZA 3V9WA 2E4LA 1D8YA 4KHYA 4I7FA 1RT3A 3FFIA 3SUPA 2D0AA 2Z1IA 3DLGA 4IKFA 2ETJA 4R5PA 5K14A 1UWBA 3OYGA 2RF2A 3NDKA 5J2MA 2XY7A 5HROA 1YT3A 4AHCA 3K59A 1NJXA 4QAGA 1RCHA 4DS4A 2QK9A 3AVMA 1S1XA 4CJWA 2IDOA 5C24A 5D3GA 3RMCA 4M3TA 4DSIA 1UAXA 3H08A 3VQ7A 3KD1E 4FJ8A 1IH7A 2DFEA 3QIPA 3TAPA 2G8UA 1IG9A 4CJPA 1WSEA 1RT1A 1VSLA 3LWMA 3LAMA 4JRQA 1J54A 4DSFA 1NKBA 4B9VA 4KPYA 4DLEA 1NK8A 3K5OA 4CEQA 4CEZA 4W5NA 2RPIA 3E01A 4FK4A 1RT6A 1C0TA 3CFRA 2KZZA 1HNIA 3RMDA 1U4BA 1QS4A 3AO3A 4CK1A 3HPGA 1KTQA 1XHXA 4IBNA 3QNOA 2HVIA 4E3SA 1L3UA 1C0UA 1RDDA 1U04A 3EZ5A 4FYDA 1DTTA 4RW6A 5SWMA 2P51A 2Z1GA 3NF9A 2G8KA 2XRIA 2YHAA 2G8HA 4DU3A 2X78A 3AVIA 2XY8A 4M41A 3AVNA 1VK0A 1RT5A 3ZT3A 4W5QA 1W9HA 4IFYA 4M45A 3LWLA 3S3MA 1KLNA 4PQUA 3VQCA 1S9EA 4ELTA 4CGHA 3KLEA 3WNFA 4DTNA 3ZSRA 4Z4HA 1BQMA 3AVCA 4CIEA 4EZ9A 1JKHA 2D0CA 4CF8A 4B8CA 4DQQA 1ASWA 1BI4A 4DQIA 1S1TA 3DI6A 4IFVA 3LP1A 5DK5A 2OPPA 2DFFA 2WONA 4CK3A 4DFJA 4F2SA 4LY7A 4N76A 5HBMA 1J53A 2ZE2A 3M8QA 3O3HA 4K8ZA 4KTWA 1Q9XA 3L2VA 3VQDA 4OPJA 1WAJA 3DOKA 1DTQA 1ITGA 2JLEA 3TAGA 3TANA 3HM9A 2HNYA 3HO1A 2HHUA 3VA3A 3NGZA 3VQEA 3V6DA 4LH4A 2O4GA 3F73A 1GOCA 4CF2A 3PV8A 1XI1A 3OYJA 3LP0A 3AVHA 3UIQA 4DQSA 5E41A 4E7JA 1D5AA 1JLEA 1VSHA 4AHVA 4CF1A 3HVRA 5CZ1A 3OS1A 4XIUA 4E0DA 1JL2A 2HHTA 1TAQA 2NUBA 2FBVA 4PY5A 3CM5A 3V81A 2F8TA 4KHSA 2KFNA 1FK9A 3TARA 5J2QA 4RW9A 1ZBHA 2OPRA 2G8WA 1ZBIA 1DLOA 1Y97A 5FRMA 3KK3A 1CLQA 4C8KA 4I2QA 3OYAA 5J2PA 1RDCA 2W42A 4OKKA 3SI6A 1TGOA 3QIOA 4C8MA 4CHQA 3JYTA 1ZBLA 4FM1A 3T3FA 3MEDA 4CGFA 3MXJA 3QNNA 1TL3A 1RNHA 1RBSA 4RW8A 2X6NA 3ZSXA 3S3OA 4KB0A 4H8KA 1KVAA 1SL1A 4O0JA 1HPZA 2A1RA 3AA5X 1IKYA 5HLFA 3HK2A 2GBZA 1VSIA 1BL3A 5HP1A 1SKRA 3K57A 4DTRA 4I9LA 2OPQA 4E89A 3K58A 1NOZA 1VSEA 1C0MA 3L2UA 4KTQA 2EHGA 3HXMA 3LALA 3OS0A 1B9FA 1R0AA 4FK0A 5I3UA 4HCBA 3SCXA 1FKPA 1VSFA 4DTXA 1RBVA 5JS2A 2VWKA 1SV5A 3C94A 3V1OA 2G8VA 1CXQA 2HW3A 3SQ2A 4FM2A 3AVFA 1HJRA 3TR8A 3WNHA 2LSNA 3LP2A 4UQGA 2YNGA 4GW6A 3QO9A 3MEEA 4PA1A 4CJ4A 3KK2A 4BDZA 4M42A 2G8FA 1KLMA 4Z4IA 2AJQA 3DRPA 2YNFA 3HSTB 2OYQA 3OYDA 3KJVA 3DLHA 1LWFA 2QKBA 1WSHA 2IAJA 4J2EA 4PWDA 3SV4A 4DFKA 1IKVA 3ASMA 3PX6A 1A5WA 3LPUA 3O3FA 4E7LA 4HCCA 2YNIA 3ZSVA 3CFOA 1W0HA 2GUIA 2HHWA 4N41A 4CJRA 3I8DA 4OKEA 1TK5A 1NOYA 3QEXA 2BGGA 1G15A 4BWJA 3L3UA 3OVNA 2D0BA 4ZTJA 1RTDA 3ITHA 4FZXC 4FJNA 4KRFA 3LZJA 2OPSA 1N5YA 4FJXA 4EP4A 1JLBA 2DFHA 3TAEA 4H4OA 3VQQA 4CERA 4DWIA 2HHQA 1A5XA 2B6AA 4EP5A 3KLFA 1NJWA 1C6VA 5CYMA 4CHZA 3MEGA 4KI4A 4QOZB 1D9FA 3K2PA 4Q0BA 1JLFA 4KTZA 4FLYA 5J1EA 1HYSA 2Z1JA 3AO4A 2OZMA 3AV9A 4KI6A 5SZTA 5HRRA 3WNGA 3CFPA 1SL0A 1VRTA 3NGYA 3P5JA 3QESA 2Y1JA 2OA8A 4B9NA 4FLWA 1RILA 4NYFA 4CFDA 3MAQA 4KHWA 4CJVA 3SNNA 3ZSZA 4JRPA 1S6PA 3KTQA 5J2NA 1S9GA 5KGXA 4JS4A 3OYFA 3ZT4A 4AHTA 2WOMA 2Z1HA 4CEEA 4FW2A 2FBXA 1Q8IA 4CJ3A 4CHOA 4HVJA 1S1WA 4CIFA 4BACA 2D5RA 3QEPA 1XC9A 3ISNC 1BGXT 4CGJA 3PUFA 1LW0A 4OVLA 3OYNA 4DFPA 3PO4A 1I39A 2HNZA 3C95A 3NF8A 3KLGA 3SJJA 1NK6A 4B9TA 1VSKA 2E6MA 2ITGA 4HTUA 1RT7A 4KV8A 3RWUA 1LV5A 3OS2A 2PYJA 5T7BA 2YV0X 3HP6A 1KCFA 4M3RA 1NK5A 1LWEA 1LW2A 4FW1A 3TI0A 1TVRA 2B4JA 4BWMA 3HL8A 3U3GA 4N5SA 2XO7A 1SKSA 4LSLA 1QTMA 1GOBA 4N56A 1CXUA 3TAFA 1BISA
chains in the Genus database with same CATH superfamily
1CZBA 4JLHA 4DHYA 3ZLJA 2XY6A 4LF6K 4CK2A 1N6QA 5E26A 4IG0A 1TUUA 1N33K 3ZSQA 1RDAA 2HMPA 1L5UA 2QWPA 3OYMA 4ELVA 3P83D 4B8AB 3CM6A 3VA0A 4H4MA 3THVA 4H0TB 2GV9A 3L4QA 2QXFA 3LANA 3P1GA 5AQWA 1NGHA 2VWBA 1U49A 1NM1A 1Z25A 3J81O 2QM1A 1KFSA 3MWTA 4X62K 3HYFA 5C25A 4KH4A 4DV0K 4K41A 4DTSA 1Z26A 1I3AA 4DV3K 3V9SA 2YNHA 1B9DA 4CJFA 4FM0A 2YKMA 3N4PA 3T1AA 1KD1O 4DG1A 3D7EO 3WXMB 1J9AA 2HB5A 4O8UA 3VTIA 3VEYA 2P5OA 5LJWA 3AVGA 4CBXA 3HZ6A 3I8BA 4DU4A 3F9KA 3I55N 1ZBFA 3S3NA 3O4WA 4Z4FA 2NZTA 3VMFB 3DLBA 4NXMK 2PZSA 4DTJA 4CJLA 5GAHP 4Z4GA 3LM2A 2GTDA 1TKDA 4AHUA 3DYAA 3BF1A 3PIOL 4JS5A 1ATNA 2HHVA 2EX3A 4DV5K 3LAKA 4DSEA 2OCEA 4OKJA 4FJ5A 3ZEUB 1BA0A 4JKBA 3CCLN 2OZSA 4FZZA 4BG8A 3D45A 4B9LA 4JKHA 1Y64A 3QMLA 4BDYA 5I9EB 3G4SN 4RTFD 3VF2A 3THYA 1YHQN 2E2OA 4CIGA 3AA4A 4H0VB 3DLEA 3OYHA 3O9UA 1JLAA 3AO5A 1X9MA 4LFBK 4WQ5C 1JLCA 2VGMA 4O55A 3V1RA 1OVQA 1N36K 3FR0A 1NJIO 3TWHA 3H1VX 1R59O 5JVGL 5M1OA 1HYZA 1RDWX 1ESVA 4TSXA 3RTVA 1T8EA 4CJSA 3M8SA 3SQ4A 3PO5A 3KD5E 2QWLA 4DQPA 4PHTX 1VAZA 2FSKA 3CJBA 1QSSA 2HHSA 4IDKA 4JI6K 1VQMN 3MN5A 3O9TA 5B8HA 2A42A 4DFMA 2YJFA 3AVAA 5GAEP 2E8AA 3AVLA 1S6QA 1D9DA 1QHTA 4BRLA 2FBTA 3SUOA 4F4KA 2DY4A 3DM2A 4NCBA 1H1VA 3MXMA 3D6RA 4E19A 4J2DA 4M3XA 3PSIA 4JYAK 3O4QA 2NRZA 4MFBA 4DCHA 5AZIB 3EKSA 3CQ8A 3CCJN 4FJ7A 1S22A 3CC7N 3IAYA 3VQPA 4KHNA 2KQ2A 4JK9A 3THYB 3RRHA 4DF8A 2UXDK 4M3UA 5MLCQ 2QWMA 3O4NA 4OPHA 4W5TA 4X64K 5DM7L 4IG3A 4OX9K 3BP8A 3ZYYX 1FKOA 2IVNA 1GLEG 5C2FA 1WLJA 3UKUB 5FPDA 4CEDA 3G71N 3UKRB 1C0FA 5LY3A 3L4IA 2QXLA 1L3VA 1ZC6A 4KO0A 5C0YA 1Q18A 1QSLA 3J8AA 4EIAA 3DWLA 2F8SA 3VQ5A 4BVOA 3NE6A 1MA9B 3AAQA 3MECA 3NHGA 3VN5A 3A5NC 2RN2A 2DTUA 3ALYA 3CETA 1IV0A 4CJUA 5AQHA 3NH1A 3M8PA 4DSLA 3RR8A 3S9HA 1VSDA 4IEIA 4JHDB 4FOIA 3OBYA 4DV4K 3HBTA 4CFCA 3G25A 2BDPA 2JWLA 4C8NA 2FBYA 2I7PA 1Q7YO 1NG9A 4FJKA 1EXQA 3ULDA 2HMIA 1D8YA 2HF4A 1RT3A 2O8DA 4IKFA 5BPNA 3NDKA 2RF2A 5J2MA 4U7BA 2XY7A 1WUAA 4KHPK 3K59A 4QAGA 4DS4A 3AVMA 1J5EK 2IDOA 3BY5A 3GDQA 5AQLA 1IH7A 2DFEA 3EKUA 1VSLA 3LWMA 4JRQA 1HKGA 4DSFA 1EQYA 2O8FB 1O13A 3K5OA 2RPIA 3E01A 5LJVA 1U4BA 1BDGA 1L3UA 4BR9A 1DTTA 1T44A 4WQ5A 2YHAA 1HJOA 4DU3A 3ZX0A 2X78A 4MLHA 4M63C 3O6WA 3ZT3A 1Q82O 4UY8O 2VCPA 4M45A 2RE2A 4PQUA 1JJ2M 4ELTA 4CGHA 5AZJA 3H3NO 3WNFA 1XNQK 4A2BA 1BI4A 2P9LB 5DK5A 2DFFA 1V4SA 2YHWA 4N76A 2F9TA 3IFRA 5HBMA 2I7NA 4K8ZA 3O80A 4KTWA 5KPRA 3L2VA 5CE3A 4YOUA 1XQSC 1WAJA 1DTQA 3TANA 2HHUA 4K42A 5LMUK 3L6QA 3OYJA 1QZ6A 5AR0A 4E7JA 1VSHA 1JLEA 1JL2A 2HHTA 1TAQA 3CM5A 3V81A 3L0QA 3TARA 1NNEA 1BOTO 2OPRA 2G8WA 1Y97A 3Q7CA 3WXJA 2IVOA 3P4IA 5KPTA 1WBDA 4AM7A 2P9SB 3QIOA 4BVPA 2HF3A 3T3FA 5AQSA 2H3GX 3MXJA 4WFNL 4KB0A 4JK8A 3GOIA 3ZETA 3UE5A 4AM6A 3AA5X 3LDNA 4YOTA 4DTRA 1BWFO 4E89A 3E9OA 5KPZA 1NOZA 2O8CB 1C0MA 3L2UA 4KTQA 5EVZA 3LALA 3LDQA 5I3UA 1VSFA 4DTXA 1RBVA 2VWKA 3V1OA 3T7ZA 2G8VA 2HW3A 1SS6A 3WNHA 1N32K 3HSCA 4GW6A 4M42A 4KH6A 4H0YB 4Z4IA 1KLMA 2YNFA 3HSTB 3CERA 4R79A 3KJVA 1YXQA 3DLHA 2OYQA 2QKBA 4PWDA 4BRMA 2ASMA 4E7LA 2YNIA 1VQON 1W0HA 4CBUA 2KLAA 4ZTJA 4FJNA 4XH4A 1N5YA 3LDOA 4H4OA 4PL8A 4BQZA 4JI0K 3KLFA 4K25A 1KAYA 1D9FA 4Q0BA 3FZMA 1NGGA 3E9LA 2NRWA 4DR3K 3HTVA 4JAXA 4K43A 5AQZA 4V19S 1SL0A 3QESA 1QHAA 1ATRA 1VQ8N 1X9JA 4NYFA 3MAQA 4KHWA 2E2NA 3DJCA 4JS4A 5KGXA 3TTFA 2A5XA 3I56N 3FFKB 4HVJA 2FBXA 1Q8IA 3QEPA 4BACA 3ZX3A 4CIFA 1BGXT 4YY3K 1LW0A 3OYNA 4DFPA 3NF8A 3KLGA 1NK6A 4B9TA 2UXCK 2E6MA 4JV5K 5FPMA 3VF6A 2YV0X 3UB5A 2PBDA 5AFUH 3VESA 2ZJRL 4M3RA 2BTFA 3C7NA 1LWEA 1LW2A 3CJAA 4IOCL 1TVRA 3TI0A 2B4JA 1QTMA 3HL8A 4B1YB 4N5SA 2F4VK 1GOBA 4N56A 4C8LA 3SQ1A 4GV9A 4RW4A 1KFDA 1VQ7N 3HPHA 1JLGA 4YNQA 3WEEA 3OYLA 4DTPA 1BIUA 1M1KO 1W2BM 3QICA 4LF9K 4NLBA 4ELUA 5AJ3K 3EN9A 4CFBA 5BREA 3CCEN 2HBKA 2RKIA 4FLXA 2Q36A 4NYNA 3NVKA 3JAMO 3FGUA 4F2RA 3VQ9A 1X9SA 1RTJA 4CGIA 3M8RA 4HUEA 4H0XB 2KZMA 2GEMA 3ZETB 4FJIA 1YVUA 1HNVA 1BI4B 2P9LA 3BGRA 2IS3A 2PY5A 3VGLA 3WXLA 3U6FA 4BRQA 2V51B 4QCLA 4B08A 4FLVA 3AVKA 4E7KA 1WB9A 4I6MB 4CCHA 3EY1A 1C1CA 1QVGM 3VTHA 1U45A 1Q81O 2O8BA 5AQFA 4J2AA 3OYBA 1B92A 3DOLA 1XWLA 3EZWA 4O5BA 5CZ2A 5BR8K 5BPMA 1KXPA 3HRGA 4JI1K 1KVBA 1DEJA 3AVBA 4C23A 4CEAA 3QBXA 3JS6A 4PKGA 4JI2K 3DMJA 5KGWA 4B3MK 3SK3A 4B9SA 1U6ZA 1NK9A 1ZYQA 4DSKA 1I94K 3QETA 1YUWA 3SPZA 3A5OC 2YCHA 3I0RA 2Q3SA 3EE9A 3OY9A 4KREA 1RBTA 1KAZA 1EETA 5ADXH 4PL7A 3D0PA 4CJKA 2QEXN 2QWNA 1J6ZA 3VENA 4M7XA 4I2PA 3F9MA 2ZJQL 4BRFA 1RBRA 3CCVN 2HSTA 1HKBA 3QFUA 2X6SA 1U48A 1HNWK 3EE8A 1T05A 5AQTA 1KRPA 5GIPA 4DB3A 3GL1A 4U67L 3OYEA 4FCYA 3P38A 1L3TA 2HBMA 3CYMA 1TKXA 4LH5A 2O8BB 5I42A 4LSNA 2VG5A 4JKDA 4QS9A 3BF3A 3LPTA 4BGAA 4JI7K 3HPOA 2KFZA 2YKNA 3TSUA 1IO2A 1NMDA 2JGUA 3C6UA 3VEZA 4CEBA 4FWLA 3L2RA 2HBJA 3A0IX 1TKTA 2UUCK 3CPEA 4OLBA 3FE1A 4W5OA 2HOEA 2P5GA 3SBTA 3BDPA 4N47A 1NGDA 3OJSA 4OGEA 4BRKA 3QBWA 2BANA 3VETA 3L2WA 4NO7A 4DTUA 3CXCM 4YFUA 1RTIA 4O0IA 3K5MA 4DTOA 3ZX2A 4YOVA 4DF4A 2FF3B 1TL1A 5LMNK 1E4GT 2VQFK 4GMJB 2F96A 4CJ5A 5BN8A 1JXEA 3KVGA 1T03A 4B3SK 1VHXA 3HI0A 4Q5VA 2V7ZA 4FWQA 3L8BA 3LDLA 2DPNA 1HQEA 3M6GA 4G1QA 4CE9A 3AO1A 2FC0A 4YOXA 4GVMA 3CCMN 1BHLA 3SV3A 5HRNA 4BY9C 3CPWM 1NGCA 5JVHL 3DLLL 3A5MC 1YJ9N 4M3YA 4CFAA 3VEOA 2E1ZA 5M1FA 2ZGZA 4FJJA 4OGCA 1P8ZA 1GLDG 3C6TA 4Y0WA 3O3GA 3R1XA 1F21A 4CGDA 2NRVA 2IIRA 3CHWA 5FROA 4AHSA 3OYIA 2ZQBA 3ZSYA 1WSIA 3DRRA 3BZKA 3DAWA 1NJYA 3SUNA 4I6MA 2E4LA 4KHYA 2Z1IA 2W41A 5AQPA 2ETJA 2V7YA 4XH1A 4R5PA 4OO1J 1NJXA 2QK9A 3J7AP 3H46O 3T1HK 5D3GA 3MX5A 4M3TA 4BRGA 2ASOA 3KWGA 1IG9A 1WSEA 3LAMA 4B3RK 3NVMA 2FSJA 4B1XB 4CEZA 4CEQA 3VGKA 4FK4A 1RT6A 1C0TA 3AGKA 2KZZA 3RMDA 1QS4A 4JKCA 3QNOA 4FYDA 1U04A 3C6HA 5SWMA 5C10A 2Z1GA 3NF9A 2G8KA 2G8HA 1DT9A 3GE1A 2D1KA 2OANA 3AVNA 1VK0A 3H3OB 4W5QA 1W9HA 4IFYA 2ITMA 3VQCA 3CI5A 3KLEA 3ZSRA 4CIEA 4EZ9A 1MDUB 1ASWA 1S1TA 1GLCG 3DI6A 1HR0K 4F2SA 5TKWA 3CMEN 4LY7A 1J53A 4X66K 4OPJA 3O8MA 3HO1A 2HNYA 4LFCK 3VA3A 3VEVA 3VQEA 3V6DA 3F73A 4YOWA 4CI6A 1P90A 4IDHA 3LP0A 5F0XA 4DQSA 5E41A 4CF1A 3HVRA 5CZ1A 4E0DA 4JKFA 2FBVA 3SLCA 1WOQA 1ZBHA 4RW9A 2WUSA 4B1WB 3KK3A 1X3NA 1ZXOA 4CZIA 1VQLN 4C8KA 1RDCA 2W42A 2NRXA 3SI6A 4C8MA 4CHQA 1ZBLA 3D2FB 3MEDA 1RNHA 3JXUA 3QFPA 3S3OA 4JK7A 1X3MA 3S41A 2A1RA 2GBZA 1SKRA 1BL3A 2W40A 3K57A 4KH5A 3WXKA 1VSEA 3VERA 5F2RA 2YI1A 3OS0A 1R0AA 3D2EA 5JS2A 4B1UB 1SV5A 4H5NA 3AVFA 4WCEL 1HJRA 3TR8A 4UQGA 2YNGA 4PA1A 3MEEA 3DRPA 3CJ7A 4IZ9A 3VF4A 4J2EA 4DFKA 1NGAA 1A5WA 2NNWA 4BG9A 4NB4A 5FPNA 2O8CA 2GUIA 3WUHA 4C1NI 2HHWA 1QVFM 4EHTA 1TK5A 2IVPA 1G15A 4BWJA 3OVNA 2Q97A 3CQXA 3ITHA 1RTDA 1YI2N 4FJXA 2DFHA 3DXKB 3U8XA 4CERA 2HHQA 1A5XA 1XMOK 3MEGA 3ID8A 4KI4A 3K2PA 4KTZA 3BZCA 2YJEA 2Z1JA 3AO4A 4BROA 4DR5K 4WQ4A 2P9KB 3WNGA 3CFPA 1SQKA 2Q0UA 3NGYA 2P9NB 2Y1JA 2OA8A 4C1NK 1RILA 3ZEUA 3SNNA 4JRPA 5J2NA 4DUZK 3O5BA 4AHTA 2Z1HA 4CJ3A 1QQOA 3RSEB 1XC9A 3ISNC 1EWRA 4H5WA 3PUFA 4OVLA 3PO4A 2HNZA 2E5LK 1VQKN 4BRCA 4CJ7A 1VSKA 3C0BA 4HTUA 4KV8A 4IJAA 3EO3A 1U2VA 3RVCA 2E20A 4B9QA 3AY9A 4BWMA 3D2EB 1JCFA 4H03B 3R8EA 1QSYA 1X1PA 4JI4K 4Z0UA 3G6EN 1T7PA 2XHBA 4BE1A 3EYZA 5KTQA 1HRHA 4BQLA 2E2QA 1BCMA 5TKYA 1VSMA 3VQBA 3TPQA 1ATSA 3OYCA 4O8KA 4A2AA 3RR7A 3CCQN 2RHKA 2A1SA 2HVHA 1LOTB 3CCUN 2IGIA 4FWSA 1YJNN 2PYLA 4IEEA 4BDPA 3LZIA 4NCAA 4HTLA 3HT3A 5FDLA 1OH7A 2YX6A 3NAEA 2G8IA 4JKAA 2VYPA 3PX4A 3LDSA 3TABA 5GAGP 3VQ4A 2QWRA 1DGKN 3KLHA 4OLAA 4BR2A 2WC9A 1HQUA 4L8RB 3V1QA 3M1FA 3AA2A 4CESA 1TKZA 3OHRA 4JI3K 3L3VA 5AQOA 3TAMA 3ZT2A 2UUBK 1NGEA 2P9KA 5DMRA 5EU7A 4ZHRA 4AILC 2YHYA 2BE2A 3THXA 4KBOA 3VEXA 4JKGB 4H5VA 1S5JA 4BRDA 5AFUA 3R3LA 4CEFA 1Q86O 3KLIA 4PKHA 2ASPA 3V9UA 5FPEA 5JLHA 3DRSA 1D4XA 2P9PA 2W6LA 5HOOA 3NH0A 2O8EB 3SQ0A 2ZGYA 1NWKA 2GELA 4CZJA 2VWJA 4W5RA 1KQSM 4MDAA 2VG7A 1L3SA 3CC2N 1ZBUA 4KHUA 1NLVA 4MDBA 3MN7A 1BIZA 3NFAA 4FJHA 4NCGA 2A3ZA 4DS5A 1BQNA 4ISFA 1VQ5N 3NBPA 4O44A 3WQUA 3T19A 4E1MA 1IKXA 3ZSWA 1QE1A 4BRAA 3SJHA 4OPKA 1TYQA 4Z94A 3K9JA 2HNDA 1BG3A 3N4QA 4Z4CA 1HYVA 4IFEA 4CHNA 4JNEA 3KK1A 2GWKA 3VGMA 4HUFA 4HHTA 4Z4EA 4FVMA 1OH5A 4MQ3A 1HPMA 4JEPA 1ZBSA 2J4RA 5A2QO 4FXDA 3QEWA 4ID1A 3IKMA 3FZKA 4CZFA 3TAQA 2QI2A 4CD3A 4H0PA 1NK0A 3WQTA 4JN4A 1XC3A 3T1YK 3DLRA 2BH1A 2NLXA 4YDUA 3O1WA 3HJFA 2Y1IA 4CEOA 4E1JA 5EXWA 5C42A 1U2VB 4FLZA 1S3XA 4WE1A 3ZT1A 3OJUA 2FLOA 5CR4A 1UOCA 4GKKK 1OH8A 5EX5A 3IG1A 4Y1DA 3I33A 1IBKK 5AQMA 2O4IA 3J80O 3KIOA 5EY4A 3MMVA 3VQAA 2O8EA 1LWCA 3ZCMA 5KRSA 2I5JA 1RT2A 4CZLA 4DMNA 3CD6N 3Q7BA 2YHBA 3AVJA 1BCOA 2A41A 4BE2A 3KZBA 4CJEA 5DM6L 1Q9YA 4M3ZA 4ISGA 1N34K 3DLKA 3P31A 3PIPL 1JXBA 3V9XA 5GADP 2ZF5O 4FJ9A 1NK7A 5BR9A 4BE0A 1K73O 4KAZA 4BR5A 5KRTA 5KI6A 1XMQK 3H6EA 4AH9A 3VQ8A 3TSQA 4DR6K 1EP4A 1FJGK 2E1YA 2NRRA 1GOAA 4ILGB 1NKCA 4KHQA 1YTUA 4BR4A 3MXIA 4JI5K 4QS8A 4Y1CA 1SKWA 5CHIA 3DXKA 4B9MA 5EOYA 4L3QA 1SL2A 1O1WA 3CCRN 2HBLA 1ASVA 5IWAK 3HVTA 4XH5A 3MK6A 2QA4N 4DV2K 1Z6RA 3E9PA 3V9WA 2UYTA 5GIOA 2P9IB 3FFIA 3DLGA 3OYGA 2FXUA 3SAGA 1YT3A 4OPAA 2FSNA 4CJWA 5C24A 3RMCA 1UAXA 3KD1E 3QIPA 4CJPA 4B9VA 1NK8A 4FWPA 3ENOA 3CFRA 1HNIA 3HPGA 1KTQA 4IBNA 2HVIA 4E3SA 3EZ5A 3WXIA 4RW6A 2P51A 2XRIA 2V52B 1CZAN 3GBTA 4FWKA 2XY8A 4M41A 3BUZB 1NGIA 3LWLA 2QW9A 1S9EA 4DTNA 2AP1A 1T6DA 3BEXA 3CF5L 1BQMA 1JKHA 3CJCA 4CF8A 4B8CA 4CZMA 4DQQA 4DQIA 3WT0A 2OPPA 2WONA 4GY2B 4IO8A 4FO0A 1GLFO 3O3HA 3CJ9A 3VQDA 4RWTA 2JLEA 1ITGA 5BN9A 2P9SA 3HM9A 1KC8O 4IOXA 4LH4A 5ELZA 2O4GA 1YIJN 4GV6A 2KHOA 4CF2A 3PV8A 4A5AA 4LF8K 3U9ZA 3AVHA 3UIQA 4DR2K 1D5AA 1RFQA 4AHVA 2F7TA 3OS1A 1GLLO 2O8DB 2NUBA 1WBBA 2E2PA 4PY5A 1HX1A 2F8TA 4KHSA 4YDUC 3FZHA 1W97L 3TTCA 4J8FA 5JLFA 4JI8K 1DLOA 1CLQA 4I2QA 4IWVA 5J2PA 3EL2A 1NGBA 3JYTA 4FM1A 4CGFA 1RBSA 2X6NA 4BRIA 4H8KA 1SL1A 4O0JA 4FWNA 1VQNN 1IKYA 3HK2A 3J7YP 1VQ4N 1VSIA 3WEEB 5HP1A 2D4WA 4I9LA 1OKJA 4JKGA 3A8YA 2EHGA 1B9FA 4HCBA 3C94A 3SMPA 4EAHD 3SQ2A 3K9KA 4A59A 4BC3A 5GINA 2LSNA 3LP2A 4JD2A 3DXMA 2AJQA 1QQNA 3U4LA 2G8FA 3M3ZA 3IUCA 1WSHA 2IAJA 3MCPA 3UKRA 4BR0A 2D0PA 1EO1A 1IKVA 3PX6A 3LPUA 3O3FA 4HCCA 3ZSVA 3CFOA 1VQPN 4CZKA 4FVUA 5M1NA 4N41A 3I8DA 1BO5O 2CGJA 5BRFA 5FLXO 5AZJB 2D0BA 4FWOA 1KAXA 1SAZA 4KRFA 4DR1K 4FWMA 3VQQA 4DWIA 4EP5A 1NJWA 2HHHK 3T69A 4MLEA 5AQJA 4A62A 1K8KB 4FLYA 5J1EA 4KI6A 2OZMA 3AV9A 5SZTA 3GG4A 2PFUA 4HWIA 1VRTA 3P5JA 4B9NA 1YF5L 4CJVA 3SBGA 1S6PA 2NRHA 2AA4A 5AQYA 3C65A 1NU0A 2WOMA 5BRDA 5M1KA 4CEEA 1N8RO 4IO9L 2D5RA 1MWKA 4CGJA 1YVNA 3KK7A 4CD1A 1I39A 3TTDA 4B1ZA 2ITGA 1QZ5A 1RT7A 3K0SA 3CCSN 3RWUA 2QWQA 3EEQA 3CQYA 3HP6A 1G99A 3ATVA 3O9SA 1YITN 5H1SQ 1HUXA 1SKSA 4AF1A 1CXUA 1BISA 4FK2A 2QTDA 1RDUA 1J5OA 3OBWA 5F1XA 1NGJA 4CF0A 4H5TA 4JD2B 3QEVA 5KQ8A 1WSFA 3IRXA 1M90O 3I0SA 3FZFA 4CBWA 4DV6K 4FJLA 3P39A 4LD0A 3OYKA 4F3TA 3U9DA 3E1YA 4XEIA 4ID5A 3PSFA 1UA0A 1S1VA 1HNXK 4H0OA 4YHHK 3TSPA 4G9ZA 1NKEA 4DR7K 4BC4A 4CECA 3MDQA 4KB1A 4E7HA 3RMAA 4M3WA 5AQVA 1JCGA 3B6OA 1MU2A 3CJ1A 3AGRA 3LP3A 2Q2RA 4B3TK 5LL6Z 1ILYA 2E6LA 2IC3A 4KFBA 4AHRA 3MN6A 3O9RA 4IXCA 3V4IA 1RBUA 1KVCA 3NH2A 1REVA 1WAFA 1HKCA 3TU5A 3VQ6A 1YTAA 4NXNK 4X65K 2Q31A 4NLCA 3QINA 1LAWA 2GX9A 1BU6O 2NRTA 2HHXA 3R9PA 3JSMA 4K8XA 4ZTFA 3SYZA 4FZYA 4FLTA 1WN7A 4ICLA 1LAVA 3QERA 1IG8A 2Q1NA 1FXXA 1GLJO 2ZD1A 3L2QA 3NMUA 4B3OA 3RMBA 2F9WA 1NJZA 1RDBA 1MWMA 4BREA 4ILHA 1WNSA 5BPLA 3SPYA 1NK4A 1IBMK 4WFBL 5HRPA 3HP9A 3PY8A 3NF7A 1KSPA 2R7YA 4A57A 4BR7A 1QQMA 3K5LA 4EHUA 3IDHA 4FLUA 3O1BA 2IOCA 5ADXA 3QDKA 3NF6A 1JL1A 4QS7A 4YORA 1OH6A 4DTMA 3DXMB 4F8RA 3ENHA 2KW4A 3PX0A 1HNZK 1T3VA 3KWIA 4DLGA 3RRGA 3MWPA 5C12A 5JICA 2ATQA 3AA3A 3ID6A 2B5JA 4MO5A 4FPAA 3KKRA 4HUGA 3QLHA 4MO4A 4BC2A 3C6AA 1GLAG 3SZ2A 4O4GA 3WNEA 2CGKA 4GVEA 1TK0A 2VG6A 3V9ZA 2KTQA 4IJNA 4C8OA 1JLQA 4YOYA 2WTUA 1RT4A 3F5TA 1K9MO 1TAUA 1SUQA 2P1JA 3B6PA 1TK8A 1C1BA 1ASUA 1VQ6N 3THXB 1VRUA 3F2KA 4LF4K 4E1NA 3ZT0A 3AO2A 4JHDA 2QKKA 1W7AA 3LDPA 1VSJA 5M1QA 4BRNA 5C2DA 1JCEA 5HRSA 4KKOA 4RCHA 3HOTA 2UU9K 3SAFA 3ZSOA 1WSGA 2ZJPL 4CHYA 3J7ZO 4DR4K 4FOEA 3R6MA 3U3YA 1TV6A 3MN9A 3FZLA 1C1AA 3QB0A 4FL9A 4CHPA 4J2BA 4FSVA 1HMVA 1S1UA 2EWSA 4RG8A 3A2FA 4FJMA 4OJRA 3NGIA 1V4TA 4DU1A 4B9UA 1EX4A 4ILJA 1RGIA 3ENBA 1X9WA 2P9UB 3ULEB 4O5FA 1RTHA 3K5NA 4A61A 5JS1A 4FJGA 1WSJA 3G10A 3THWA 4E7IA 1BUPA 1TUYA 2FF6A 3M5RA 3VPZA 5CY4A 4CJQA 4CJTA 4DV1K 1UA1A 1XNRK 3CG7A 4RW7A 1U47A 3SUQA 4LFAK 4CW7B 1K6YA 5M1PA 2XY5A 4EZ6A 1NBWA 3NCIA 1TYQB 1XHZA 4F3OA 4EFHA 5IT9O 1IKWA 3SMSA 3QEIA 3W0LA 4PUOA 2UUAK 1A5VA 5AQIA 1Z05A 2UXBK 4DSJA 1S72N 4CF9A 4CGGA 5FRNA 4CZEA 1CZ9A 4DQRA 4CVNE 2JWKA 4I9QA 3IS9A 3KKSA 4ISEA 4WQ4C 1EKEA 3AAPA 1YJWN 1QQCA 5HL7L 2X74A 5CYQA 4BGBA 3G0ZA 5BRHA 4I7FA 3O9QA 3SUPA 2D0AA 3PLAA 2P9IA 5K14A 1UWBA 5HROA 4AHCA 2BUPA 1RCHA 4LF7K 3SAHA 3W3DA 1S1XA 3H45C 2P9NA 4DSIA 4GKJK 3VQ7A 3H08A 4FJ8A 3TAPA 2G8UA 1RT1A 1K8AO 4KPYA 1J54A 1NKBA 4DLEA 1YAGA 4W5NA 1HLUA 4CK1A 3AO3A 3RSEA 3C7NB 1XHXA 4F9OA 1C0UA 1RDDA 2A6AA 5JMVA 5AQKA 3AVIA 1RT5A 4BC5A 3S3MA 3A5LC 2ZWHA 1KLNA 3VEWA 3FLCO 3LM9A 3HM8A 4Z4HA 3AVCA 2D0CA 1E4FT 4A5BA 4IFVA 1DKGD 3LP1A 1NMNA 4GNIA 4CK3A 4DFJA 4AQYK 2WFBA 1SZ2A 2ZE2A 3M8QA 4K0KK 1Q9XA 5AQXA 3E66A 3IMXA 5AZIA 5AQQA 3DOKA 4CZHA 1EWQA 3TAGA 4JKEA 3NGZA 3VOVA 1GOCA 1BA1A 1XI1A 2CGLA 2YHXA 4LF5K 4XIUA 4CZGA 3AARA 3H1QA 2KFNA 1FK9A 1XUPO 5J2QA 3UKUA 1ZBIA 5FRMA 5AQUA 1FW6A 1K8KA 2CH6A 2P9PB 3CIPA 3OYAA 4H5RA 3D2FA 4OKKA 1TGOA 2D0OA 3QNNA 1TL3A 3O08A 4RW8A 3ZSXA 5E84A 1T6CA 1KVAA 3MCAB 1HPZA 5HLFA 4BRPA 2VQEK 3THWB 4DV7K 4PKIA 1OVYA 2OPQA 3K58A 4IOAL 4WF9L 4B1VA 3CC4N 3HXMA 4FK0A 2A40A 3SCXA 1FKPA 4DQ8A 3HOSA 1CXQA 2CH5A 4FM2A 4FWRA 2OTJN 3OW2M 4CJ4A 3QO9A 4BDZA 2P9UA 3ULEA 4DKWA 3KK2A 1VQ9N 2O8FA 3OYDA 3CMAN 1LWFA 2OTLN 3KHYA 3SV4A 3ASMA 2WBNA 2GWJA 5AQGA 4CJRA 4OKEA 4WFAL 1NOYA 3QEXA 2BGGA 3L3UA 4FZXC 5KQDA 3LZJA 2OPSA 2Q0RA 2GUPA 4EP4A 5AQNA 1JLBA 3TAEA 3OTOK 2VGNA 5C15A 3OA9A 1IBLK 2B6AA 1GLBG 1C6VA 5CYMA 4CHZA 4QOZB 1C0GA 2W6KA 1JLFA 2E88A 2KKZA 1HYSA 1IJJA 4M7YA 2ZM6K 5HRRA 2PAVA 2QWOA 4WYBA 4FLWA 1E3MA 3ATUA 4CFDA 1LCUA 3ZSZA 3KTQA 1S9GA 3OYFA 3ZT4A 4GV3A 4FW2A 4CHOA 1S1WA 3B8AX 4BRHA 3C95A 3SJJA 1LV5A 4LC9B 3OS2A 2PYJA 5T7BA 3LL3A 4FPBA 1NGFA 3MX2A 1KCFA 5AQRA 1NK5A 4FW1A 3U3GA 2XO7A 4DUYK 4LSLA 3TAFA
chains in the Genus database with same CATH topology
1CZBA 1QSYA 4C8LA 1X1PA 3SQ1A 4JLHA 4RW4A 4FK2A 1KFDA 1J5OA 4Z0UA 4CF0A 3HPHA 2XY6A 4CK2A 1N6QA 2XHBA 1T7PA 3QEVA 1JLGA 1WSFA 4YNQA 4IG0A 3IRXA 4BE1A 3I0SA 3EYZA 3OYLA 5KTQA 4DTPA 1BIUA 1HRHA 3ZSQA 1RDAA 1BCMA 1VSMA 3VQBA 1L5UA 4FJLA 3OYCA 3OYMA 4ELVA 3P83D 4LD0A 3RR7A 3OYKA 4F3TA 4ELUA 4B8AB 2A1SA 2HVHA 4ID5A 4CFBA 2IGIA 3CM6A 3VA0A 2PYLA 2RKIA 4H4MA 4FLXA 3THVA 4BDPA 3LZIA 1UA0A 1S1VA 4NYNA 4NCAA 2GV9A 2QXFA 3HT3A 3LANA 3P1GA 5FDLA 1U49A 4F2RA 3VQ9A 3NAEA 1X9SA 1RTJA 4CGIA 2G8IA 1Z25A 3M8RA 1NKEA 3PX4A 4HUEA 3LDSA 4CECA 3TABA 4KB1A 3VQ4A 2KZMA 1KFSA 4FJIA 3HYFA 4E7HA 3RMAA 3KLHA 4M3WA 5C25A 1YVUA 4OLAA 1HNVA 1BI4B 3BGRA 4DTSA 2IS3A 3B6OA 1HQUA 2PY5A 4L8RB 3V1QA 1Z26A 1I3AA 1MU2A 3U6FA 3V9SA 3LP3A 4QCLA 3AA2A 2YNHA 1B9DA 4B08A 4CJFA 2YKMA 4FM0A 3T1AA 4CESA 2E6LA 2IC3A 3AVKA 4DG1A 1J9AA 2HB5A 4KFBA 4AHRA 4E7KA 3V4IA 2P5OA 1RBUA 1TKZA 1KVCA 3AVGA 3NH2A 4CCHA 3EY1A 4DU4A 3L3VA 1REVA 1C1CA 1WAFA 3TAMA 3ZT2A 1U45A 3F9KA 3VQ6A 1ZBFA 1YTAA 5DMRA 3S3NA 3OYBA 4J2AA 5EU7A 4ZHRA 3DLBA 1B92A 3DOLA 4Z4FA 1XWLA 2PZSA 4AILC 4DTJA 4CJLA 2BE2A 4O5BA 5CZ2A 3QINA 4Z4GA 1LAWA 1KVBA 3AVBA 4CEAA 4AHUA 3DYAA 1TKDA 2HHXA 1S5JA 4JS5A 3JSMA 4K8XA 4ZTFA 4CEFA 2HHVA 3KLIA 3SYZA 2EX3A 3V9UA 3DRSA 4FZYA 3LAKA 3DMJA 4DSEA 4OKJA 4FLTA 4FJ5A 5KGWA 1WN7A 4ICLA 3NH0A 3SQ0A 1LAVA 4B9SA 3QERA 2VWJA 4W5RA 2OZSA 4FZZA 1NK9A 1FXXA 2ZD1A 3L2QA 4B3OA 2VG7A 3RMBA 1L3SA 1ZYQA 3D45A 1NJZA 4B9LA 1ZBUA 1RDBA 4DSKA 4KHUA 4BDYA 3QETA 1BIZA 3SPZA 3I0RA 3NFAA 2Q3SA 1WNSA 4FJHA 4NCGA 4CIGA 3SPYA 4DS5A 1NK4A 1BQNA 3OY9A 4KREA 3AA4A 1RBTA 1EETA 3NBPA 3DLEA 5HRPA 4O44A 3HP9A 3OYHA 3PY8A 3NF7A 3D0PA 4CJKA 1JLAA 3T19A 1KSPA 3AO5A 2R7YA 1X9MA 4I2PA 1JLCA 4E1MA 1IKXA 4O55A 3V1RA 3K5LA 3ZSWA 1QE1A 1RBRA 3TWHA 4FLUA 2IOCA 4OPKA 3NF6A 1JL1A 1HYZA 2HNDA 4TSXA 3RTVA 1T8EA 4DTMA 4F8RA 4CJSA 2X6SA 4Z4CA 1U48A 1HYVA 2KW4A 3M8SA 3SQ4A 3PX0A 3PO5A 4CHNA 1T05A 4DLGA 3RRGA 3KK1A 3KD5E 4HUFA 1KRPA 4HHTA 4Z4EA 4DQPA 4FVMA 2ATQA 3AA3A 4MQ3A 1QSSA 2B5JA 2HHSA 4IDKA 3OYEA 3KKRA 4FXDA 3QEWA 4HUGA 4ID1A 3QLHA 4FCYA 4DFMA 3SZ2A 4O4GA 3WNEA 3AVAA 1L3TA 3TAQA 3AVLA 3CYMA 1TK0A 1S6QA 1TKXA 4LH5A 2VG6A 3V9ZA 1D9DA 2KTQA 5I42A 4LSNA 1JLQA 4C8OA 1QHTA 2VG5A 2FBTA 1NK0A 1RT4A 3LPTA 1TAUA 3SUOA 4F4KA 2DY4A 3DM2A 4NCBA 1SUQA 2P1JA 3B6PA 3DLRA 3HPOA 3MXMA 1C1BA 4E19A 1TK8A 4J2DA 2KFZA 1ASUA 2YKNA 1VRUA 3HJFA 4M3XA 2Y1IA 4CEOA 1IO2A 4E1NA 5C42A 3ZT0A 2JGUA 3C6UA 3AO2A 4FLZA 3O4QA 4WE1A 4MFBA 3ZT1A 4CEBA 3L2RA 3OJUA 2QKKA 1TKTA 1UOCA 1VSJA 3CQ8A 4FJ7A 3IAYA 4OLBA 3VQPA 4W5OA 2KQ2A 5HRSA 4KKOA 3RRHA 4DF8A 2P5GA 4KHNA 4M3UA 3ZSOA 1WSGA 3BDPA 4CHYA 4N47A 3IG1A 3O4NA 4W5TA 3OJSA 4OGEA 4Y1DA 3U3YA 1TV6A 2BANA 2O4IA 3L2WA 4DTUA 1C1AA 4YFUA 1RTIA 4O0IA 4IG3A 4CHPA 3K5MA 4DTOA 3KIOA 4DF4A 1TL1A 1FKOA 4J2BA 3VQAA 1LWCA 1WLJA 1HMVA 1S1UA 4GMJB 2F96A 3ZCMA 4CJ5A 5KRSA 4RG8A 4FJMA 3A2FA 4CEDA 4OJRA 2I5JA 1JXEA 1RT2A 3NGIA 1T03A 4DMNA 4DU1A 4B9UA 4FLVA 1EX4A 1X9WA 4Q5VA 2YHBA 3AVJA 1BCOA 3L8BA 1RTHA 4BE2A 1HQEA 4G1QA 4CE9A 4CJEA 1L3VA 4KO0A 3AO1A 2FC0A 3K5NA 1Q9YA 1QSLA 4M3ZA 4GVMA 1BHLA 3DLKA 3SV3A 1JXBA 5HRNA 3V9XA 4FJGA 1WSJA 5JS1A 3G10A 4FJ9A 1NK7A 4BE0A 2F8SA 4KAZA 3VQ5A 3NE6A 4E7IA 4M3YA 3MECA 4CJQA 5KRTA 5CY4A 4CFAA 4CJTA 1UA1A 3NHGA 3CG7A 4RW7A 5KI6A 3VN5A 2RN2A 3SUQA 1U47A 2DTUA 3ALYA 4AH9A 1K6YA 3VQ8A 4CJUA 4FJJA 4OGCA 3NH1A 3M8PA 2XY5A 4DSLA 4EZ6A 3RR8A 3S9HA 1EP4A 1VSDA 3NCIA 1XHZA 4F3OA 1IKWA 4PUOA 3QEIA 1GOAA 3C6TA 1NKCA 4KHQA 1A5VA 3O3GA 1YTUA 3MXIA 4Y1CA 1SKWA 1F21A 4CGDA 4DSJA 4CF9A 4CFCA 4CGGA 5FROA 4AHSA 3OYIA 2BDPA 4B9MA 5FRNA 1SL2A 1CZ9A 1O1WA 2ZQBA 3ZSYA 4DQRA 1WSIA 4C8NA 2FBYA 4I9QA 3IS9A 3KKSA 3DRRA 1ASVA 3HVTA 1EKEA 4FJKA 1NJYA 1QQCA 3SUNA 2X74A 5CYQA 1EXQA 3ULDA 2HMIA 3G0ZA 3V9WA 2E4LA 1D8YA 4KHYA 4I7FA 1RT3A 3FFIA 3SUPA 2D0AA 2Z1IA 3DLGA 4IKFA 2ETJA 4R5PA 5K14A 1UWBA 3OYGA 2RF2A 3NDKA 5J2MA 2XY7A 5HROA 1YT3A 4AHCA 3K59A 1NJXA 4QAGA 1RCHA 4DS4A 2QK9A 3AVMA 1S1XA 4CJWA 2IDOA 5C24A 5D3GA 3RMCA 4M3TA 4DSIA 1UAXA 3H08A 3VQ7A 3KD1E 4FJ8A 1IH7A 2DFEA 3QIPA 3TAPA 2G8UA 1IG9A 4CJPA 1WSEA 1RT1A 1VSLA 3LWMA 3LAMA 4JRQA 1J54A 4DSFA 1NKBA 4B9VA 4KPYA 4DLEA 1NK8A 3K5OA 4CEQA 4CEZA 4W5NA 2RPIA 3E01A 4FK4A 1RT6A 1C0TA 3CFRA 2KZZA 1HNIA 3RMDA 1U4BA 1QS4A 3AO3A 4CK1A 3HPGA 1KTQA 1XHXA 4IBNA 3QNOA 2HVIA 4E3SA 1L3UA 1C0UA 1RDDA 1U04A 3EZ5A 4FYDA 1DTTA 4RW6A 5SWMA 2P51A 2Z1GA 3NF9A 2G8KA 2XRIA 2YHAA 2G8HA 4DU3A 2X78A 3AVIA 2XY8A 4M41A 3AVNA 1VK0A 1RT5A 3ZT3A 4W5QA 1W9HA 4IFYA 4M45A 3LWLA 3S3MA 1KLNA 4PQUA 3VQCA 1S9EA 4ELTA 4CGHA 3KLEA 3WNFA 4DTNA 3ZSRA 4Z4HA 1BQMA 3AVCA 4CIEA 4EZ9A 1JKHA 2D0CA 4CF8A 4B8CA 4DQQA 1ASWA 1BI4A 4DQIA 1S1TA 3DI6A 4IFVA 3LP1A 5DK5A 2OPPA 2DFFA 2WONA 4CK3A 4DFJA 4F2SA 4LY7A 4N76A 5HBMA 1J53A 2ZE2A 3M8QA 3O3HA 4K8ZA 4KTWA 1Q9XA 3L2VA 3VQDA 4OPJA 1WAJA 3DOKA 1DTQA 1ITGA 2JLEA 3TAGA 3TANA 3HM9A 2HNYA 3HO1A 2HHUA 3VA3A 3NGZA 3VQEA 3V6DA 4LH4A 2O4GA 3F73A 1GOCA 4CF2A 3PV8A 1XI1A 3OYJA 3LP0A 3AVHA 3UIQA 4DQSA 5E41A 4E7JA 1D5AA 1JLEA 1VSHA 4AHVA 4CF1A 3HVRA 5CZ1A 3OS1A 4XIUA 4E0DA 1JL2A 2HHTA 1TAQA 2NUBA 2FBVA 4PY5A 3CM5A 3V81A 2F8TA 4KHSA 2KFNA 1FK9A 3TARA 5J2QA 4RW9A 1ZBHA 2OPRA 2G8WA 1ZBIA 1DLOA 1Y97A 5FRMA 3KK3A 1CLQA 4C8KA 4I2QA 3OYAA 5J2PA 1RDCA 2W42A 4OKKA 3SI6A 1TGOA 3QIOA 4C8MA 4CHQA 3JYTA 1ZBLA 4FM1A 3T3FA 3MEDA 4CGFA 3MXJA 3QNNA 1TL3A 1RNHA 1RBSA 4RW8A 2X6NA 3ZSXA 3S3OA 4KB0A 4H8KA 1KVAA 1SL1A 4O0JA 1HPZA 2A1RA 3AA5X 1IKYA 5HLFA 3HK2A 2GBZA 1VSIA 1BL3A 5HP1A 1SKRA 3K57A 4DTRA 4I9LA 2OPQA 4E89A 3K58A 1NOZA 1VSEA 1C0MA 3L2UA 4KTQA 2EHGA 3HXMA 3LALA 3OS0A 1B9FA 1R0AA 4FK0A 5I3UA 4HCBA 3SCXA 1FKPA 1VSFA 4DTXA 1RBVA 5JS2A 2VWKA 1SV5A 3C94A 3V1OA 2G8VA 1CXQA 2HW3A 3SQ2A 4FM2A 3AVFA 1HJRA 3TR8A 3WNHA 2LSNA 3LP2A 4UQGA 2YNGA 4GW6A 3QO9A 3MEEA 4PA1A 4CJ4A 3KK2A 4BDZA 4M42A 2G8FA 1KLMA 4Z4IA 2AJQA 3DRPA 2YNFA 3HSTB 2OYQA 3OYDA 3KJVA 3DLHA 1LWFA 2QKBA 1WSHA 2IAJA 4J2EA 4PWDA 3SV4A 4DFKA 1IKVA 3ASMA 3PX6A 1A5WA 3LPUA 3O3FA 4E7LA 4HCCA 2YNIA 3ZSVA 3CFOA 1W0HA 2GUIA 2HHWA 4N41A 4CJRA 3I8DA 4OKEA 1TK5A 1NOYA 3QEXA 2BGGA 1G15A 4BWJA 3L3UA 3OVNA 2D0BA 4ZTJA 1RTDA 3ITHA 4FZXC 4FJNA 4KRFA 3LZJA 2OPSA 1N5YA 4FJXA 4EP4A 1JLBA 2DFHA 3TAEA 4H4OA 3VQQA 4CERA 4DWIA 2HHQA 1A5XA 2B6AA 4EP5A 3KLFA 1NJWA 1C6VA 5CYMA 4CHZA 3MEGA 4KI4A 4QOZB 1D9FA 3K2PA 4Q0BA 1JLFA 4KTZA 4FLYA 5J1EA 1HYSA 2Z1JA 3AO4A 2OZMA 3AV9A 4KI6A 5SZTA 5HRRA 3WNGA 3CFPA 1SL0A 1VRTA 3NGYA 3P5JA 3QESA 2Y1JA 2OA8A 4B9NA 4FLWA 1RILA 4NYFA 4CFDA 3MAQA 4KHWA 4CJVA 3SNNA 3ZSZA 4JRPA 1S6PA 3KTQA 5J2NA 1S9GA 5KGXA 4JS4A 3OYFA 3ZT4A 4AHTA 2WOMA 2Z1HA 4CEEA 4FW2A 2FBXA 1Q8IA 4CJ3A 4CHOA 4HVJA 1S1WA 4CIFA 4BACA 2D5RA 3QEPA 1XC9A 3ISNC 1BGXT 4CGJA 3PUFA 1LW0A 4OVLA 3OYNA 4DFPA 3PO4A 1I39A 2HNZA 3C95A 3NF8A 3KLGA 3SJJA 1NK6A 4B9TA 1VSKA 2E6MA 2ITGA 4HTUA 1RT7A 4KV8A 3RWUA 1LV5A 3OS2A 2PYJA 5T7BA 2YV0X 3HP6A 1KCFA 4M3RA 1NK5A 1LWEA 1LW2A 4FW1A 3TI0A 1TVRA 2B4JA 4BWMA 3HL8A 3U3GA 4N5SA 2XO7A 1SKSA 4LSLA 1QTMA 1GOBA 4N56A 1CXUA 3TAFA 1BISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZB A;  1QSY A;  4C8L A;  1X1P A;  3SQ1 A;  4JLH A;  4RW4 A;  4FK2 A;  1KFD A;  1J5O A;  4Z0U A;  4CF0 A;  3HPH A;  2XY6 A;  4CK2 A;  1N6Q A;  2XHB A;  1T7P A;  3QEV A;  1JLG A;  1WSF A;  4YNQ A;  4IG0 A;  3IRX A;  4BE1 A;  3I0S A;  3EYZ A;  3OYL A;  5KTQ A;  4DTP A;  1BIU A;  1HRH A;  3ZSQ A;  1RDA A;  1BCM A;  1VSM A;  3VQB A;  1L5U A;  4FJL A;  3OYC A;  3OYM A;  4ELV A;  3P83 D;  4LD0 A;  3RR7 A;  3OYK A;  4F3T A;  4ELU A;  4B8A B;  2A1S A;  2HVH A;  4ID5 A;  4CFB A;  2IGI A;  3CM6 A;  3VA0 A;  2PYL A;  2RKI A;  4H4M A;  4FLX A;  3THV A;  4BDP A;  3LZI A;  1UA0 A;  1S1V A;  4NYN A;  4NCA A;  2GV9 A;  2QXF A;  3HT3 A;  3LAN A;  3P1G A;  5FDL A;  1U49 A;  4F2R A;  3VQ9 A;  3NAE A;  1X9S A;  1RTJ A;  4CGI A;  2G8I A;  1Z25 A;  3M8R A;  1NKE A;  3PX4 A;  4HUE A;  3LDS A;  4CEC A;  3TAB A;  4KB1 A;  3VQ4 A;  2KZM A;  1KFS A;  4FJI A;  3HYF A;  4E7H A;  3RMA A;  3KLH A;  4M3W A;  5C25 A;  1YVU A;  4OLA A;  1HNV A;  1BI4 B;  3BGR A;  4DTS A;  2IS3 A;  3B6O A;  1HQU A;  2PY5 A;  4L8R B;  3V1Q A;  1Z26 A;  1I3A A;  1MU2 A;  3U6F A;  3V9S A;  3LP3 A;  4QCL A;  3AA2 A;  2YNH A;  1B9D A;  4B08 A;  4CJF A;  2YKM A;  4FM0 A;  3T1A A;  4CES A;  2E6L A;  2IC3 A;  3AVK A;  4DG1 A;  1J9A A;  2HB5 A;  4KFB A;  4AHR A;  4E7K A;  3V4I A;  2P5O A;  1RBU A;  1TKZ A;  1KVC A;  3AVG A;  3NH2 A;  4CCH A;  3EY1 A;  4DU4 A;  3L3V A;  1REV A;  1C1C A;  1WAF A;  3TAM A;  3ZT2 A;  1U45 A;  3F9K A;  3VQ6 A;  1ZBF A;  1YTA A;  5DMR A;  3S3N A;  3OYB A;  4J2A A;  5EU7 A;  4ZHR A;  3DLB A;  1B92 A;  3DOL A;  4Z4F A;  1XWL A;  2PZS A;  4AIL C;  4DTJ A;  4CJL A;  2BE2 A;  4O5B A;  5CZ2 A;  3QIN A;  4Z4G A;  1LAW A;  1KVB A;  3AVB A;  4CEA A;  4AHU A;  3DYA A;  1TKD A;  2HHX A;  1S5J A;  4JS5 A;  3JSM A;  4K8X A;  4ZTF A;  4CEF A;  2HHV A;  3KLI A;  3SYZ A;  2EX3 A;  3V9U A;  3DRS A;  4FZY A;  3LAK A;  3DMJ A;  4DSE A;  4OKJ A;  4FLT A;  4FJ5 A;  5KGW A;  1WN7 A;  4ICL A;  3NH0 A;  3SQ0 A;  1LAV A;  4B9S A;  3QER A;  2VWJ A;  4W5R A;  2OZS A;  4FZZ A;  1NK9 A;  1FXX A;  2ZD1 A;  3L2Q A;  4B3O A;  2VG7 A;  3RMB A;  1L3S A;  1ZYQ A;  3D45 A;  1NJZ A;  4B9L A;  1ZBU A;  1RDB A;  4DSK A;  4KHU A;  4BDY A;  3QET A;  1BIZ A;  3SPZ A;  3I0R A;  3NFA A;  2Q3S A;  1WNS A;  4FJH A;  4NCG A;  4CIG A;  3SPY A;  4DS5 A;  1NK4 A;  1BQN A;  3OY9 A;  4KRE A;  3AA4 A;  1RBT A;  1EET A;  3NBP A;  3DLE A;  5HRP A;  4O44 A;  3HP9 A;  3OYH A;  3PY8 A;  3NF7 A;  3D0P A;  4CJK A;  1JLA A;  3T19 A;  1KSP A;  3AO5 A;  2R7Y A;  1X9M A;  4I2P A;  1JLC A;  4E1M A;  1IKX A;  4O55 A;  3V1R A;  3K5L A;  3ZSW A;  1QE1 A;  1RBR A;  3TWH A;  4FLU A;  2IOC A;  4OPK A;  3NF6 A;  1JL1 A;  1HYZ A;  2HND A;  4TSX A;  3RTV A;  1T8E A;  4DTM A;  4F8R A;  4CJS A;  2X6S A;  4Z4C A;  1U48 A;  1HYV A;  2KW4 A;  3M8S A;  3SQ4 A;  3PX0 A;  3PO5 A;  4CHN A;  1T05 A;  4DLG A;  3RRG A;  3KK1 A;  3KD5 E;  4HUF A;  1KRP A;  4HHT A;  4Z4E A;  4DQP A;  4FVM A;  2ATQ A;  3AA3 A;  4MQ3 A;  1QSS A;  2B5J A;  2HHS A;  4IDK A;  3OYE A;  3KKR A;  4FXD A;  3QEW A;  4HUG A;  4ID1 A;  3QLH A;  4FCY A;  4DFM A;  3SZ2 A;  4O4G A;  3WNE A;  3AVA A;  1L3T A;  3TAQ A;  3AVL A;  3CYM A;  1TK0 A;  1S6Q A;  1TKX A;  4LH5 A;  2VG6 A;  3V9Z A;  1D9D A;  2KTQ A;  5I42 A;  4LSN A;  1JLQ A;  4C8O A;  1QHT A;  2VG5 A;  2FBT A;  1NK0 A;  1RT4 A;  3LPT A;  1TAU A;  3SUO A;  4F4K A;  2DY4 A;  3DM2 A;  4NCB A;  1SUQ A;  2P1J A;  3B6P A;  3DLR A;  3HPO A;  3MXM A;  1C1B A;  4E19 A;  1TK8 A;  4J2D A;  2KFZ A;  1ASU A;  2YKN A;  1VRU A;  3HJF A;  4M3X A;  2Y1I A;  4CEO A;  1IO2 A;  4E1N A;  5C42 A;  3ZT0 A;  2JGU A;  3C6U A;  3AO2 A;  4FLZ A;  3O4Q A;  4WE1 A;  4MFB A;  3ZT1 A;  4CEB A;  3L2R A;  3OJU A;  2QKK A;  1TKT A;  1UOC A;  1VSJ A;  3CQ8 A;  4FJ7 A;  3IAY A;  4OLB A;  3VQP A;  4W5O A;  2KQ2 A;  5HRS A;  4KKO A;  3RRH A;  4DF8 A;  2P5G A;  4KHN A;  4M3U A;  3ZSO A;  1WSG A;  3BDP A;  4CHY A;  4N47 A;  3IG1 A;  3O4N A;  4W5T A;  3OJS A;  4OGE A;  4Y1D A;  3U3Y A;  1TV6 A;  2BAN A;  2O4I A;  3L2W A;  4DTU A;  1C1A A;  4YFU A;  1RTI A;  4O0I A;  4IG3 A;  4CHP A;  3K5M A;  4DTO A;  3KIO A;  4DF4 A;  1TL1 A;  1FKO A;  4J2B A;  3VQA A;  1LWC A;  1WLJ A;  1HMV A;  1S1U A;  4GMJ B;  2F96 A;  3ZCM A;  4CJ5 A;  5KRS A;  4RG8 A;  4FJM A;  3A2F A;  4CED A;  4OJR A;  2I5J A;  1JXE A;  1RT2 A;  3NGI A;  1T03 A;  4DMN A;  4DU1 A;  4B9U A;  4FLV A;  1EX4 A;  1X9W A;  4Q5V A;  2YHB A;  3AVJ A;  1BCO A;  3L8B A;  1RTH A;  4BE2 A;  1HQE A;  4G1Q A;  4CE9 A;  4CJE A;  1L3V A;  4KO0 A;  3AO1 A;  2FC0 A;  3K5N A;  1Q9Y A;  1QSL A;  4M3Z A;  4GVM A;  1BHL A;  3DLK A;  3SV3 A;  1JXB A;  5HRN A;  3V9X A;  4FJG A;  1WSJ A;  5JS1 A;  3G10 A;  4FJ9 A;  1NK7 A;  4BE0 A;  2F8S A;  4KAZ A;  3VQ5 A;  3NE6 A;  4E7I A;  4M3Y A;  3MEC A;  4CJQ A;  5KRT A;  5CY4 A;  4CFA A;  4CJT A;  1UA1 A;  3NHG A;  3CG7 A;  4RW7 A;  5KI6 A;  3VN5 A;  2RN2 A;  3SUQ A;  1U47 A;  2DTU A;  3ALY A;  4AH9 A;  1K6Y A;  3VQ8 A;  4CJU A;  4FJJ A;  4OGC A;  3NH1 A;  3M8P A;  2XY5 A;  4DSL A;  4EZ6 A;  3RR8 A;  3S9H A;  1EP4 A;  1VSD A;  3NCI A;  1XHZ A;  4F3O A;  1IKW A;  4PUO A;  3QEI A;  1GOA A;  3C6T A;  1NKC A;  4KHQ A;  1A5V A;  3O3G A;  1YTU A;  3MXI A;  4Y1C A;  1SKW A;  1F21 A;  4CGD A;  4DSJ A;  4CF9 A;  4CFC A;  4CGG A;  5FRO A;  4AHS A;  3OYI A;  2BDP A;  4B9M A;  5FRN A;  1SL2 A;  1CZ9 A;  1O1W A;  2ZQB A;  3ZSY A;  4DQR A;  1WSI A;  4C8N A;  2FBY A;  4I9Q A;  3IS9 A;  3KKS A;  3DRR A;  1ASV A;  3HVT A;  1EKE A;  4FJK A;  1NJY A;  1QQC A;  3SUN A;  2X74 A;  5CYQ A;  1EXQ A;  3ULD A;  2HMI A;  3G0Z A;  3V9W A;  2E4L A;  1D8Y A;  4KHY A;  4I7F A;  1RT3 A;  3FFI A;  3SUP A;  2D0A A;  2Z1I A;  3DLG A;  4IKF A;  2ETJ A;  4R5P A;  5K14 A;  1UWB A;  3OYG A;  2RF2 A;  3NDK A;  5J2M A;  2XY7 A;  5HRO A;  1YT3 A;  4AHC A;  3K59 A;  1NJX A;  4QAG A;  1RCH A;  4DS4 A;  2QK9 A;  3AVM A;  1S1X A;  4CJW A;  2IDO A;  5C24 A;  5D3G A;  3RMC A;  4M3T A;  4DSI A;  1UAX A;  3H08 A;  3VQ7 A;  3KD1 E;  4FJ8 A;  1IH7 A;  2DFE A;  3QIP A;  3TAP A;  2G8U A;  1IG9 A;  4CJP A;  1WSE A;  1RT1 A;  1VSL A;  3LWM A;  3LAM A;  4JRQ A;  1J54 A;  4DSF A;  1NKB A;  4B9V A;  4KPY A;  4DLE A;  1NK8 A;  3K5O A;  4CEQ A;  4CEZ A;  4W5N A;  2RPI A;  3E01 A;  4FK4 A;  1RT6 A;  1C0T A;  3CFR A;  2KZZ A;  1HNI A;  3RMD A;  1U4B A;  1QS4 A;  3AO3 A;  4CK1 A;  3HPG A;  1KTQ A;  1XHX A;  4IBN A;  3QNO A;  2HVI A;  4E3S A;  1L3U A;  1C0U A;  1RDD A;  1U04 A;  3EZ5 A;  4FYD A;  1DTT A;  4RW6 A;  5SWM A;  2P51 A;  2Z1G A;  3NF9 A;  2G8K A;  2XRI A;  2YHA A;  2G8H A;  4DU3 A;  2X78 A;  3AVI A;  2XY8 A;  4M41 A;  3AVN A;  1VK0 A;  1RT5 A;  3ZT3 A;  4W5Q A;  1W9H A;  4IFY A;  4M45 A;  3LWL A;  3S3M A;  1KLN A;  4PQU A;  3VQC A;  1S9E A;  4ELT A;  4CGH A;  3KLE A;  3WNF A;  4DTN A;  3ZSR A;  4Z4H A;  1BQM A;  3AVC A;  4CIE A;  4EZ9 A;  1JKH A;  2D0C A;  4CF8 A;  4B8C A;  4DQQ A;  1ASW A;  1BI4 A;  4DQI A;  1S1T A;  3DI6 A;  4IFV A;  3LP1 A;  5DK5 A;  2OPP A;  2DFF A;  2WON A;  4CK3 A;  4DFJ A;  4F2S A;  4LY7 A;  4N76 A;  5HBM A;  1J53 A;  2ZE2 A;  3M8Q A;  3O3H A;  4K8Z A;  4KTW A;  1Q9X A;  3L2V A;  3VQD A;  4OPJ A;  1WAJ A;  3DOK A;  1DTQ A;  1ITG A;  2JLE A;  3TAG A;  3TAN A;  3HM9 A;  2HNY A;  3HO1 A;  2HHU A;  3VA3 A;  3NGZ A;  3VQE A;  3V6D A;  4LH4 A;  2O4G A;  3F73 A;  1GOC A;  4CF2 A;  3PV8 A;  1XI1 A;  3OYJ A;  3LP0 A;  3AVH A;  3UIQ A;  4DQS A;  5E41 A;  4E7J A;  1D5A A;  1JLE A;  1VSH A;  4AHV A;  4CF1 A;  3HVR A;  5CZ1 A;  3OS1 A;  4XIU A;  4E0D A;  1JL2 A;  2HHT A;  1TAQ A;  2NUB A;  2FBV A;  4PY5 A;  3CM5 A;  3V81 A;  2F8T A;  4KHS A;  2KFN A;  1FK9 A;  3TAR A;  5J2Q A;  4RW9 A;  1ZBH A;  2OPR A;  2G8W A;  1ZBI A;  1DLO A;  1Y97 A;  5FRM A;  3KK3 A;  1CLQ A;  4C8K A;  4I2Q A;  3OYA A;  5J2P A;  1RDC A;  2W42 A;  4OKK A;  3SI6 A;  1TGO A;  3QIO A;  4C8M A;  4CHQ A;  3JYT A;  1ZBL A;  4FM1 A;  3T3F A;  3MED A;  4CGF A;  3MXJ A;  3QNN A;  1TL3 A;  1RNH A;  1RBS A;  4RW8 A;  2X6N A;  3ZSX A;  3S3O A;  4KB0 A;  4H8K A;  1KVA A;  1SL1 A;  4O0J A;  1HPZ A;  2A1R A;  3AA5 X;  1IKY A;  5HLF A;  3HK2 A;  2GBZ A;  1VSI A;  1BL3 A;  5HP1 A;  1SKR A;  3K57 A;  4DTR A;  4I9L A;  2OPQ A;  4E89 A;  3K58 A;  1NOZ A;  1VSE A;  1C0M A;  3L2U A;  4KTQ A;  2EHG A;  3HXM A;  3LAL A;  3OS0 A;  1B9F A;  1R0A A;  4FK0 A;  5I3U A;  4HCB A;  3SCX A;  1FKP A;  1VSF A;  4DTX A;  1RBV A;  5JS2 A;  2VWK A;  1SV5 A;  3C94 A;  3V1O A;  2G8V A;  1CXQ A;  2HW3 A;  3SQ2 A;  4FM2 A;  3AVF A;  1HJR A;  3TR8 A;  3WNH A;  2LSN A;  3LP2 A;  4UQG A;  2YNG A;  4GW6 A;  3QO9 A;  3MEE A;  4PA1 A;  4CJ4 A;  3KK2 A;  4BDZ A;  4M42 A;  2G8F A;  1KLM A;  4Z4I A;  2AJQ A;  3DRP A;  2YNF A;  3HST B;  2OYQ A;  3OYD A;  3KJV A;  3DLH A;  1LWF A;  2QKB A;  1WSH A;  2IAJ A;  4J2E A;  4PWD A;  3SV4 A;  4DFK A;  1IKV A;  3ASM A;  3PX6 A;  1A5W A;  3LPU A;  3O3F A;  4E7L A;  4HCC A;  2YNI A;  3ZSV A;  3CFO A;  1W0H A;  2GUI A;  2HHW A;  4N41 A;  4CJR A;  3I8D A;  4OKE A;  1TK5 A;  1NOY A;  3QEX A;  2BGG A;  1G15 A;  4BWJ A;  3L3U A;  3OVN A;  2D0B A;  4ZTJ A;  1RTD A;  3ITH A;  4FZX C;  4FJN A;  4KRF A;  3LZJ A;  2OPS A;  1N5Y A;  4FJX A;  4EP4 A;  1JLB A;  2DFH A;  3TAE A;  4H4O A;  3VQQ A;  4CER A;  4DWI A;  2HHQ A;  1A5X A;  2B6A A;  4EP5 A;  3KLF A;  1NJW A;  1C6V A;  5CYM A;  4CHZ A;  3MEG A;  4KI4 A;  4QOZ B;  1D9F A;  3K2P A;  4Q0B A;  1JLF A;  4KTZ A;  4FLY A;  5J1E A;  1HYS A;  2Z1J A;  3AO4 A;  2OZM A;  3AV9 A;  4KI6 A;  5SZT A;  5HRR A;  3WNG A;  3CFP A;  1SL0 A;  1VRT A;  3NGY A;  3P5J A;  3QES A;  2Y1J A;  2OA8 A;  4B9N A;  4FLW A;  1RIL A;  4NYF A;  4CFD A;  3MAQ A;  4KHW A;  4CJV A;  3SNN A;  3ZSZ A;  4JRP A;  1S6P A;  3KTQ A;  5J2N A;  1S9G A;  5KGX A;  4JS4 A;  3OYF A;  3ZT4 A;  4AHT A;  2WOM A;  2Z1H A;  4CEE A;  4FW2 A;  2FBX A;  1Q8I A;  4CJ3 A;  4CHO A;  4HVJ A;  1S1W A;  4CIF A;  4BAC A;  2D5R A;  3QEP A;  1XC9 A;  3ISN C;  1BGX T;  4CGJ A;  3PUF A;  1LW0 A;  4OVL A;  3OYN A;  4DFP A;  3PO4 A;  1I39 A;  2HNZ A;  3C95 A;  3NF8 A;  3KLG A;  3SJJ A;  1NK6 A;  4B9T A;  1VSK A;  2E6M A;  2ITG A;  4HTU A;  1RT7 A;  4KV8 A;  3RWU A;  1LV5 A;  3OS2 A;  2PYJ A;  5T7B A;  2YV0 X;  3HP6 A;  1KCF A;  4M3R A;  1NK5 A;  1LWE A;  1LW2 A;  4FW1 A;  3TI0 A;  1TVR A;  2B4J A;  4BWM A;  3HL8 A;  3U3G A;  4N5S A;  2XO7 A;  1SKS A;  4LSL A;  1QTM A;  1GOB A;  4N56 A;  1CXU A;  3TAF A;  1BIS A; 
#chains in the Genus database with same CATH topology
 1CZB A;  4JLH A;  4DHY A;  3ZLJ A;  2XY6 A;  4LF6 K;  4CK2 A;  1N6Q A;  5E26 A;  4IG0 A;  1TUU A;  1N33 K;  3ZSQ A;  1RDA A;  2HMP A;  1L5U A;  2QWP A;  3OYM A;  4ELV A;  3P83 D;  4B8A B;  3CM6 A;  3VA0 A;  4H4M A;  3THV A;  4H0T B;  2GV9 A;  3L4Q A;  2QXF A;  3LAN A;  3P1G A;  5AQW A;  1NGH A;  2VWB A;  1U49 A;  1NM1 A;  1Z25 A;  3J81 O;  2QM1 A;  1KFS A;  3MWT A;  4X62 K;  3HYF A;  5C25 A;  4KH4 A;  4DV0 K;  4K41 A;  4DTS A;  1Z26 A;  1I3A A;  4DV3 K;  3V9S A;  2YNH A;  1B9D A;  4CJF A;  4FM0 A;  2YKM A;  3N4P A;  3T1A A;  1KD1 O;  4DG1 A;  3D7E O;  3WXM B;  1J9A A;  2HB5 A;  4O8U A;  3VTI A;  3VEY A;  2P5O A;  5LJW A;  3AVG A;  4CBX A;  3HZ6 A;  3I8B A;  4DU4 A;  3F9K A;  3I55 N;  1ZBF A;  3S3N A;  3O4W A;  4Z4F A;  2NZT A;  3VMF B;  3DLB A;  4NXM K;  2PZS A;  4DTJ A;  4CJL A;  5GAH P;  4Z4G A;  3LM2 A;  2GTD A;  1TKD A;  4AHU A;  3DYA A;  3BF1 A;  3PIO L;  4JS5 A;  1ATN A;  2HHV A;  2EX3 A;  4DV5 K;  3LAK A;  4DSE A;  2OCE A;  4OKJ A;  4FJ5 A;  3ZEU B;  1BA0 A;  4JKB A;  3CCL N;  2OZS A;  4FZZ A;  4BG8 A;  3D45 A;  4B9L A;  4JKH A;  1Y64 A;  3QML A;  4BDY A;  5I9E B;  3G4S N;  4RTF D;  3VF2 A;  3THY A;  1YHQ N;  2E2O A;  4CIG A;  3AA4 A;  4H0V B;  3DLE A;  3OYH A;  3O9U A;  1JLA A;  3AO5 A;  1X9M A;  4LFB K;  4WQ5 C;  1JLC A;  2VGM A;  4O55 A;  3V1R A;  1OVQ A;  1N36 K;  3FR0 A;  1NJI O;  3TWH A;  3H1V X;  1R59 O;  5JVG L;  5M1O A;  1HYZ A;  1RDW X;  1ESV A;  4TSX A;  3RTV A;  1T8E A;  4CJS A;  3M8S A;  3SQ4 A;  3PO5 A;  3KD5 E;  2QWL A;  4DQP A;  4PHT X;  1VAZ A;  2FSK A;  3CJB A;  1QSS A;  2HHS A;  4IDK A;  4JI6 K;  1VQM N;  3MN5 A;  3O9T A;  5B8H A;  2A42 A;  4DFM A;  2YJF A;  3AVA A;  5GAE P;  2E8A A;  3AVL A;  1S6Q A;  1D9D A;  1QHT A;  4BRL A;  2FBT A;  3SUO A;  4F4K A;  2DY4 A;  3DM2 A;  4NCB A;  1H1V A;  3MXM A;  3D6R A;  4E19 A;  4J2D A;  4M3X A;  3PSI A;  4JYA K;  3O4Q A;  2NRZ A;  4MFB A;  4DCH A;  5AZI B;  3EKS A;  3CQ8 A;  3CCJ N;  4FJ7 A;  1S22 A;  3CC7 N;  3IAY A;  3VQP A;  4KHN A;  2KQ2 A;  4JK9 A;  3THY B;  3RRH A;  4DF8 A;  2UXD K;  4M3U A;  5MLC Q;  2QWM A;  3O4N A;  4OPH A;  4W5T A;  4X64 K;  5DM7 L;  4IG3 A;  4OX9 K;  3BP8 A;  3ZYY X;  1FKO A;  2IVN A;  1GLE G;  5C2F A;  1WLJ A;  3UKU B;  5FPD A;  4CED A;  3G71 N;  3UKR B;  1C0F A;  5LY3 A;  3L4I A;  2QXL A;  1L3V A;  1ZC6 A;  4KO0 A;  5C0Y A;  1Q18 A;  1QSL A;  3J8A A;  4EIA A;  3DWL A;  2F8S A;  3VQ5 A;  4BVO A;  3NE6 A;  1MA9 B;  3AAQ A;  3MEC A;  3NHG A;  3VN5 A;  3A5N C;  2RN2 A;  2DTU A;  3ALY A;  3CET A;  1IV0 A;  4CJU A;  5AQH A;  3NH1 A;  3M8P A;  4DSL A;  3RR8 A;  3S9H A;  1VSD A;  4IEI A;  4JHD B;  4FOI A;  3OBY A;  4DV4 K;  3HBT A;  4CFC A;  3G25 A;  2BDP A;  2JWL A;  4C8N A;  2FBY A;  2I7P A;  1Q7Y O;  1NG9 A;  4FJK A;  1EXQ A;  3ULD A;  2HMI A;  1D8Y A;  2HF4 A;  1RT3 A;  2O8D A;  4IKF A;  5BPN A;  3NDK A;  2RF2 A;  5J2M A;  4U7B A;  2XY7 A;  1WUA A;  4KHP K;  3K59 A;  4QAG A;  4DS4 A;  3AVM A;  1J5E K;  2IDO A;  3BY5 A;  3GDQ A;  5AQL A;  1IH7 A;  2DFE A;  3EKU A;  1VSL A;  3LWM A;  4JRQ A;  1HKG A;  4DSF A;  1EQY A;  2O8F B;  1O13 A;  3K5O A;  2RPI A;  3E01 A;  5LJV A;  1U4B A;  1BDG A;  1L3U A;  4BR9 A;  1DTT A;  1T44 A;  4WQ5 A;  2YHA A;  1HJO A;  4DU3 A;  3ZX0 A;  2X78 A;  4MLH A;  4M63 C;  3O6W A;  3ZT3 A;  1Q82 O;  4UY8 O;  2VCP A;  4M45 A;  2RE2 A;  4PQU A;  1JJ2 M;  4ELT A;  4CGH A;  5AZJ A;  3H3N O;  3WNF A;  1XNQ K;  4A2B A;  1BI4 A;  2P9L B;  5DK5 A;  2DFF A;  1V4S A;  2YHW A;  4N76 A;  2F9T A;  3IFR A;  5HBM A;  2I7N A;  4K8Z A;  3O80 A;  4KTW A;  5KPR A;  3L2V A;  5CE3 A;  4YOU A;  1XQS C;  1WAJ A;  1DTQ A;  3TAN A;  2HHU A;  4K42 A;  5LMU K;  3L6Q A;  3OYJ A;  1QZ6 A;  5AR0 A;  4E7J A;  1VSH A;  1JLE A;  1JL2 A;  2HHT A;  1TAQ A;  3CM5 A;  3V81 A;  3L0Q A;  3TAR A;  1NNE A;  1BOT O;  2OPR A;  2G8W A;  1Y97 A;  3Q7C A;  3WXJ A;  2IVO A;  3P4I A;  5KPT A;  1WBD A;  4AM7 A;  2P9S B;  3QIO A;  4BVP A;  2HF3 A;  3T3F A;  5AQS A;  2H3G X;  3MXJ A;  4WFN L;  4KB0 A;  4JK8 A;  3GOI A;  3ZET A;  3UE5 A;  4AM6 A;  3AA5 X;  3LDN A;  4YOT A;  4DTR A;  1BWF O;  4E89 A;  3E9O A;  5KPZ A;  1NOZ A;  2O8C B;  1C0M A;  3L2U A;  4KTQ A;  5EVZ A;  3LAL A;  3LDQ A;  5I3U A;  1VSF A;  4DTX A;  1RBV A;  2VWK A;  3V1O A;  3T7Z A;  2G8V A;  2HW3 A;  1SS6 A;  3WNH A;  1N32 K;  3HSC A;  4GW6 A;  4M42 A;  4KH6 A;  4H0Y B;  4Z4I A;  1KLM A;  2YNF A;  3HST B;  3CER A;  4R79 A;  3KJV A;  1YXQ A;  3DLH A;  2OYQ A;  2QKB A;  4PWD A;  4BRM A;  2ASM A;  4E7L A;  2YNI A;  1VQO N;  1W0H A;  4CBU A;  2KLA A;  4ZTJ A;  4FJN A;  4XH4 A;  1N5Y A;  3LDO A;  4H4O A;  4PL8 A;  4BQZ A;  4JI0 K;  3KLF A;  4K25 A;  1KAY A;  1D9F A;  4Q0B A;  3FZM A;  1NGG A;  3E9L A;  2NRW A;  4DR3 K;  3HTV A;  4JAX A;  4K43 A;  5AQZ A;  4V19 S;  1SL0 A;  3QES A;  1QHA A;  1ATR A;  1VQ8 N;  1X9J A;  4NYF A;  3MAQ A;  4KHW A;  2E2N A;  3DJC A;  4JS4 A;  5KGX A;  3TTF A;  2A5X A;  3I56 N;  3FFK B;  4HVJ A;  2FBX A;  1Q8I A;  3QEP A;  4BAC A;  3ZX3 A;  4CIF A;  1BGX T;  4YY3 K;  1LW0 A;  3OYN A;  4DFP A;  3NF8 A;  3KLG A;  1NK6 A;  4B9T A;  2UXC K;  2E6M A;  4JV5 K;  5FPM A;  3VF6 A;  2YV0 X;  3UB5 A;  2PBD A;  5AFU H;  3VES A;  2ZJR L;  4M3R A;  2BTF A;  3C7N A;  1LWE A;  1LW2 A;  3CJA A;  4IOC L;  1TVR A;  3TI0 A;  2B4J A;  1QTM A;  3HL8 A;  4B1Y B;  4N5S A;  2F4V K;  1GOB A;  4N56 A;  4C8L A;  3SQ1 A;  4GV9 A;  4RW4 A;  1KFD A;  1VQ7 N;  3HPH A;  1JLG A;  4YNQ A;  3WEE A;  3OYL A;  4DTP A;  1BIU A;  1M1K O;  1W2B M;  3QIC A;  4LF9 K;  4NLB A;  4ELU A;  5AJ3 K;  3EN9 A;  4CFB A;  5BRE A;  3CCE N;  2HBK A;  2RKI A;  4FLX A;  2Q36 A;  4NYN A;  3NVK A;  3JAM O;  3FGU A;  4F2R A;  3VQ9 A;  1X9S A;  1RTJ A;  4CGI A;  3M8R A;  4HUE A;  4H0X B;  2KZM A;  2GEM A;  3ZET B;  4FJI A;  1YVU A;  1HNV A;  1BI4 B;  2P9L A;  3BGR A;  2IS3 A;  2PY5 A;  3VGL A;  3WXL A;  3U6F A;  4BRQ A;  2V51 B;  4QCL A;  4B08 A;  4FLV A;  3AVK A;  4E7K A;  1WB9 A;  4I6M B;  4CCH A;  3EY1 A;  1C1C A;  1QVG M;  3VTH A;  1U45 A;  1Q81 O;  2O8B A;  5AQF A;  4J2A A;  3OYB A;  1B92 A;  3DOL A;  1XWL A;  3EZW A;  4O5B A;  5CZ2 A;  5BR8 K;  5BPM A;  1KXP A;  3HRG A;  4JI1 K;  1KVB A;  1DEJ A;  3AVB A;  4C23 A;  4CEA A;  3QBX A;  3JS6 A;  4PKG A;  4JI2 K;  3DMJ A;  5KGW A;  4B3M K;  3SK3 A;  4B9S A;  1U6Z A;  1NK9 A;  1ZYQ A;  4DSK A;  1I94 K;  3QET A;  1YUW A;  3SPZ A;  3A5O C;  2YCH A;  3I0R A;  2Q3S A;  3EE9 A;  3OY9 A;  4KRE A;  1RBT A;  1KAZ A;  1EET A;  5ADX H;  4PL7 A;  3D0P A;  4CJK A;  2QEX N;  2QWN A;  1J6Z A;  3VEN A;  4M7X A;  4I2P A;  3F9M A;  2ZJQ L;  4BRF A;  1RBR A;  3CCV N;  2HST A;  1HKB A;  3QFU A;  2X6S A;  1U48 A;  1HNW K;  3EE8 A;  1T05 A;  5AQT A;  1KRP A;  5GIP A;  4DB3 A;  3GL1 A;  4U67 L;  3OYE A;  4FCY A;  3P38 A;  1L3T A;  2HBM A;  3CYM A;  1TKX A;  4LH5 A;  2O8B B;  5I42 A;  4LSN A;  2VG5 A;  4JKD A;  4QS9 A;  3BF3 A;  3LPT A;  4BGA A;  4JI7 K;  3HPO A;  2KFZ A;  2YKN A;  3TSU A;  1IO2 A;  1NMD A;  2JGU A;  3C6U A;  3VEZ A;  4CEB A;  4FWL A;  3L2R A;  2HBJ A;  3A0I X;  1TKT A;  2UUC K;  3CPE A;  4OLB A;  3FE1 A;  4W5O A;  2HOE A;  2P5G A;  3SBT A;  3BDP A;  4N47 A;  1NGD A;  3OJS A;  4OGE A;  4BRK A;  3QBW A;  2BAN A;  3VET A;  3L2W A;  4NO7 A;  4DTU A;  3CXC M;  4YFU A;  1RTI A;  4O0I A;  3K5M A;  4DTO A;  3ZX2 A;  4YOV A;  4DF4 A;  2FF3 B;  1TL1 A;  5LMN K;  1E4G T;  2VQF K;  4GMJ B;  2F96 A;  4CJ5 A;  5BN8 A;  1JXE A;  3KVG A;  1T03 A;  4B3S K;  1VHX A;  3HI0 A;  4Q5V A;  2V7Z A;  4FWQ A;  3L8B A;  3LDL A;  2DPN A;  1HQE A;  3M6G A;  4G1Q A;  4CE9 A;  3AO1 A;  2FC0 A;  4YOX A;  4GVM A;  3CCM N;  1BHL A;  3SV3 A;  5HRN A;  4BY9 C;  3CPW M;  1NGC A;  5JVH L;  3DLL L;  3A5M C;  1YJ9 N;  4M3Y A;  4CFA A;  3VEO A;  2E1Z A;  5M1F A;  2ZGZ A;  4FJJ A;  4OGC A;  1P8Z A;  1GLD G;  3C6T A;  4Y0W A;  3O3G A;  3R1X A;  1F21 A;  4CGD A;  2NRV A;  2IIR A;  3CHW A;  5FRO A;  4AHS A;  3OYI A;  2ZQB A;  3ZSY A;  1WSI A;  3DRR A;  3BZK A;  3DAW A;  1NJY A;  3SUN A;  4I6M A;  2E4L A;  4KHY A;  2Z1I A;  2W41 A;  5AQP A;  2ETJ A;  2V7Y A;  4XH1 A;  4R5P A;  4OO1 J;  1NJX A;  2QK9 A;  3J7A P;  3H46 O;  3T1H K;  5D3G A;  3MX5 A;  4M3T A;  4BRG A;  2ASO A;  3KWG A;  1IG9 A;  1WSE A;  3LAM A;  4B3R K;  3NVM A;  2FSJ A;  4B1X B;  4CEZ A;  4CEQ A;  3VGK A;  4FK4 A;  1RT6 A;  1C0T A;  3AGK A;  2KZZ A;  3RMD A;  1QS4 A;  4JKC A;  3QNO A;  4FYD A;  1U04 A;  3C6H A;  5SWM A;  5C10 A;  2Z1G A;  3NF9 A;  2G8K A;  2G8H A;  1DT9 A;  3GE1 A;  2D1K A;  2OAN A;  3AVN A;  1VK0 A;  3H3O B;  4W5Q A;  1W9H A;  4IFY A;  2ITM A;  3VQC A;  3CI5 A;  3KLE A;  3ZSR A;  4CIE A;  4EZ9 A;  1MDU B;  1ASW A;  1S1T A;  1GLC G;  3DI6 A;  1HR0 K;  4F2S A;  5TKW A;  3CME N;  4LY7 A;  1J53 A;  4X66 K;  4OPJ A;  3O8M A;  3HO1 A;  2HNY A;  4LFC K;  3VA3 A;  3VEV A;  3VQE A;  3V6D A;  3F73 A;  4YOW A;  4CI6 A;  1P90 A;  4IDH A;  3LP0 A;  5F0X A;  4DQS A;  5E41 A;  4CF1 A;  3HVR A;  5CZ1 A;  4E0D A;  4JKF A;  2FBV A;  3SLC A;  1WOQ A;  1ZBH A;  4RW9 A;  2WUS A;  4B1W B;  3KK3 A;  1X3N A;  1ZXO A;  4CZI A;  1VQL N;  4C8K A;  1RDC A;  2W42 A;  2NRX A;  3SI6 A;  4C8M A;  4CHQ A;  1ZBL A;  3D2F B;  3MED A;  1RNH A;  3JXU A;  3QFP A;  3S3O A;  4JK7 A;  1X3M A;  3S41 A;  2A1R A;  2GBZ A;  1SKR A;  1BL3 A;  2W40 A;  3K57 A;  4KH5 A;  3WXK A;  1VSE A;  3VER A;  5F2R A;  2YI1 A;  3OS0 A;  1R0A A;  3D2E A;  5JS2 A;  4B1U B;  1SV5 A;  4H5N A;  3AVF A;  4WCE L;  1HJR A;  3TR8 A;  4UQG A;  2YNG A;  4PA1 A;  3MEE A;  3DRP A;  3CJ7 A;  4IZ9 A;  3VF4 A;  4J2E A;  4DFK A;  1NGA A;  1A5W A;  2NNW A;  4BG9 A;  4NB4 A;  5FPN A;  2O8C A;  2GUI A;  3WUH A;  4C1N I;  2HHW A;  1QVF M;  4EHT A;  1TK5 A;  2IVP A;  1G15 A;  4BWJ A;  3OVN A;  2Q97 A;  3CQX A;  3ITH A;  1RTD A;  1YI2 N;  4FJX A;  2DFH A;  3DXK B;  3U8X A;  4CER A;  2HHQ A;  1A5X A;  1XMO K;  3MEG A;  3ID8 A;  4KI4 A;  3K2P A;  4KTZ A;  3BZC A;  2YJE A;  2Z1J A;  3AO4 A;  4BRO A;  4DR5 K;  4WQ4 A;  2P9K B;  3WNG A;  3CFP A;  1SQK A;  2Q0U A;  3NGY A;  2P9N B;  2Y1J A;  2OA8 A;  4C1N K;  1RIL A;  3ZEU A;  3SNN A;  4JRP A;  5J2N A;  4DUZ K;  3O5B A;  4AHT A;  2Z1H A;  4CJ3 A;  1QQO A;  3RSE B;  1XC9 A;  3ISN C;  1EWR A;  4H5W A;  3PUF A;  4OVL A;  3PO4 A;  2HNZ A;  2E5L K;  1VQK N;  4BRC A;  4CJ7 A;  1VSK A;  3C0B A;  4HTU A;  4KV8 A;  4IJA A;  3EO3 A;  1U2V A;  3RVC A;  2E20 A;  4B9Q A;  3AY9 A;  4BWM A;  3D2E B;  1JCF A;  4H03 B;  3R8E A;  1QSY A;  1X1P A;  4JI4 K;  4Z0U A;  3G6E N;  1T7P A;  2XHB A;  4BE1 A;  3EYZ A;  5KTQ A;  1HRH A;  4BQL A;  2E2Q A;  1BCM A;  5TKY A;  1VSM A;  3VQB A;  3TPQ A;  1ATS A;  3OYC A;  4O8K A;  4A2A A;  3RR7 A;  3CCQ N;  2RHK A;  2A1S A;  2HVH A;  1LOT B;  3CCU N;  2IGI A;  4FWS A;  1YJN N;  2PYL A;  4IEE A;  4BDP A;  3LZI A;  4NCA A;  4HTL A;  3HT3 A;  5FDL A;  1OH7 A;  2YX6 A;  3NAE A;  2G8I A;  4JKA A;  2VYP A;  3PX4 A;  3LDS A;  3TAB A;  5GAG P;  3VQ4 A;  2QWR A;  1DGK N;  3KLH A;  4OLA A;  4BR2 A;  2WC9 A;  1HQU A;  4L8R B;  3V1Q A;  3M1F A;  3AA2 A;  4CES A;  1TKZ A;  3OHR A;  4JI3 K;  3L3V A;  5AQO A;  3TAM A;  3ZT2 A;  2UUB K;  1NGE A;  2P9K A;  5DMR A;  5EU7 A;  4ZHR A;  4AIL C;  2YHY A;  2BE2 A;  3THX A;  4KBO A;  3VEX A;  4JKG B;  4H5V A;  1S5J A;  4BRD A;  5AFU A;  3R3L A;  4CEF A;  1Q86 O;  3KLI A;  4PKH A;  2ASP A;  3V9U A;  5FPE A;  5JLH A;  3DRS A;  1D4X A;  2P9P A;  2W6L A;  5HOO A;  3NH0 A;  2O8E B;  3SQ0 A;  2ZGY A;  1NWK A;  2GEL A;  4CZJ A;  2VWJ A;  4W5R A;  1KQS M;  4MDA A;  2VG7 A;  1L3S A;  3CC2 N;  1ZBU A;  4KHU A;  1NLV A;  4MDB A;  3MN7 A;  1BIZ A;  3NFA A;  4FJH A;  4NCG A;  2A3Z A;  4DS5 A;  1BQN A;  4ISF A;  1VQ5 N;  3NBP A;  4O44 A;  3WQU A;  3T19 A;  4E1M A;  1IKX A;  3ZSW A;  1QE1 A;  4BRA A;  3SJH A;  4OPK A;  1TYQ A;  4Z94 A;  3K9J A;  2HND A;  1BG3 A;  3N4Q A;  4Z4C A;  1HYV A;  4IFE A;  4CHN A;  4JNE A;  3KK1 A;  2GWK A;  3VGM A;  4HUF A;  4HHT A;  4Z4E A;  4FVM A;  1OH5 A;  4MQ3 A;  1HPM A;  4JEP A;  1ZBS A;  2J4R A;  5A2Q O;  4FXD A;  3QEW A;  4ID1 A;  3IKM A;  3FZK A;  4CZF A;  3TAQ A;  2QI2 A;  4CD3 A;  4H0P A;  1NK0 A;  3WQT A;  4JN4 A;  1XC3 A;  3T1Y K;  3DLR A;  2BH1 A;  2NLX A;  4YDU A;  3O1W A;  3HJF A;  2Y1I A;  4CEO A;  4E1J A;  5EXW A;  5C42 A;  1U2V B;  4FLZ A;  1S3X A;  4WE1 A;  3ZT1 A;  3OJU A;  2FLO A;  5CR4 A;  1UOC A;  4GKK K;  1OH8 A;  5EX5 A;  3IG1 A;  4Y1D A;  3I33 A;  1IBK K;  5AQM A;  2O4I A;  3J80 O;  3KIO A;  5EY4 A;  3MMV A;  3VQA A;  2O8E A;  1LWC A;  3ZCM A;  5KRS A;  2I5J A;  1RT2 A;  4CZL A;  4DMN A;  3CD6 N;  3Q7B A;  2YHB A;  3AVJ A;  1BCO A;  2A41 A;  4BE2 A;  3KZB A;  4CJE A;  5DM6 L;  1Q9Y A;  4M3Z A;  4ISG A;  1N34 K;  3DLK A;  3P31 A;  3PIP L;  1JXB A;  3V9X A;  5GAD P;  2ZF5 O;  4FJ9 A;  1NK7 A;  5BR9 A;  4BE0 A;  1K73 O;  4KAZ A;  4BR5 A;  5KRT A;  5KI6 A;  1XMQ K;  3H6E A;  4AH9 A;  3VQ8 A;  3TSQ A;  4DR6 K;  1EP4 A;  1FJG K;  2E1Y A;  2NRR A;  1GOA A;  4ILG B;  1NKC A;  4KHQ A;  1YTU A;  4BR4 A;  3MXI A;  4JI5 K;  4QS8 A;  4Y1C A;  1SKW A;  5CHI A;  3DXK A;  4B9M A;  5EOY A;  4L3Q A;  1SL2 A;  1O1W A;  3CCR N;  2HBL A;  1ASV A;  5IWA K;  3HVT A;  4XH5 A;  3MK6 A;  2QA4 N;  4DV2 K;  1Z6R A;  3E9P A;  3V9W A;  2UYT A;  5GIO A;  2P9I B;  3FFI A;  3DLG A;  3OYG A;  2FXU A;  3SAG A;  1YT3 A;  4OPA A;  2FSN A;  4CJW A;  5C24 A;  3RMC A;  1UAX A;  3KD1 E;  3QIP A;  4CJP A;  4B9V A;  1NK8 A;  4FWP A;  3ENO A;  3CFR A;  1HNI A;  3HPG A;  1KTQ A;  4IBN A;  2HVI A;  4E3S A;  3EZ5 A;  3WXI A;  4RW6 A;  2P51 A;  2XRI A;  2V52 B;  1CZA N;  3GBT A;  4FWK A;  2XY8 A;  4M41 A;  3BUZ B;  1NGI A;  3LWL A;  2QW9 A;  1S9E A;  4DTN A;  2AP1 A;  1T6D A;  3BEX A;  3CF5 L;  1BQM A;  1JKH A;  3CJC A;  4CF8 A;  4B8C A;  4CZM A;  4DQQ A;  4DQI A;  3WT0 A;  2OPP A;  2WON A;  4GY2 B;  4IO8 A;  4FO0 A;  1GLF O;  3O3H A;  3CJ9 A;  3VQD A;  4RWT A;  2JLE A;  1ITG A;  5BN9 A;  2P9S A;  3HM9 A;  1KC8 O;  4IOX A;  4LH4 A;  5ELZ A;  2O4G A;  1YIJ N;  4GV6 A;  2KHO A;  4CF2 A;  3PV8 A;  4A5A A;  4LF8 K;  3U9Z A;  3AVH A;  3UIQ A;  4DR2 K;  1D5A A;  1RFQ A;  4AHV A;  2F7T A;  3OS1 A;  1GLL O;  2O8D B;  2NUB A;  1WBB A;  2E2P A;  4PY5 A;  1HX1 A;  2F8T A;  4KHS A;  4YDU C;  3FZH A;  1W97 L;  3TTC A;  4J8F A;  5JLF A;  4JI8 K;  1DLO A;  1CLQ A;  4I2Q A;  4IWV A;  5J2P A;  3EL2 A;  1NGB A;  3JYT A;  4FM1 A;  4CGF A;  1RBS A;  2X6N A;  4BRI A;  4H8K A;  1SL1 A;  4O0J A;  4FWN A;  1VQN N;  1IKY A;  3HK2 A;  3J7Y P;  1VQ4 N;  1VSI A;  3WEE B;  5HP1 A;  2D4W A;  4I9L A;  1OKJ A;  4JKG A;  3A8Y A;  2EHG A;  1B9F A;  4HCB A;  3C94 A;  3SMP A;  4EAH D;  3SQ2 A;  3K9K A;  4A59 A;  4BC3 A;  5GIN A;  2LSN A;  3LP2 A;  4JD2 A;  3DXM A;  2AJQ A;  1QQN A;  3U4L A;  2G8F A;  3M3Z A;  3IUC A;  1WSH A;  2IAJ A;  3MCP A;  3UKR A;  4BR0 A;  2D0P A;  1EO1 A;  1IKV A;  3PX6 A;  3LPU A;  3O3F A;  4HCC A;  3ZSV A;  3CFO A;  1VQP N;  4CZK A;  4FVU A;  5M1N A;  4N41 A;  3I8D A;  1BO5 O;  2CGJ A;  5BRF A;  5FLX O;  5AZJ B;  2D0B A;  4FWO A;  1KAX A;  1SAZ A;  4KRF A;  4DR1 K;  4FWM A;  3VQQ A;  4DWI A;  4EP5 A;  1NJW A;  2HHH K;  3T69 A;  4MLE A;  5AQJ A;  4A62 A;  1K8K B;  4FLY A;  5J1E A;  4KI6 A;  2OZM A;  3AV9 A;  5SZT A;  3GG4 A;  2PFU A;  4HWI A;  1VRT A;  3P5J A;  4B9N A;  1YF5 L;  4CJV A;  3SBG A;  1S6P A;  2NRH A;  2AA4 A;  5AQY A;  3C65 A;  1NU0 A;  2WOM A;  5BRD A;  5M1K A;  4CEE A;  1N8R O;  4IO9 L;  2D5R A;  1MWK A;  4CGJ A;  1YVN A;  3KK7 A;  4CD1 A;  1I39 A;  3TTD A;  4B1Z A;  2ITG A;  1QZ5 A;  1RT7 A;  3K0S A;  3CCS N;  3RWU A;  2QWQ A;  3EEQ A;  3CQY A;  3HP6 A;  1G99 A;  3ATV A;  3O9S A;  1YIT N;  5H1S Q;  1HUX A;  1SKS A;  4AF1 A;  1CXU A;  1BIS A;  4FK2 A;  2QTD A;  1RDU A;  1J5O A;  3OBW A;  5F1X A;  1NGJ A;  4CF0 A;  4H5T A;  4JD2 B;  3QEV A;  5KQ8 A;  1WSF A;  3IRX A;  1M90 O;  3I0S A;  3FZF A;  4CBW A;  4DV6 K;  4FJL A;  3P39 A;  4LD0 A;  3OYK A;  4F3T A;  3U9D A;  3E1Y A;  4XEI A;  4ID5 A;  3PSF A;  1UA0 A;  1S1V A;  1HNX K;  4H0O A;  4YHH K;  3TSP A;  4G9Z A;  1NKE A;  4DR7 K;  4BC4 A;  4CEC A;  3MDQ A;  4KB1 A;  4E7H A;  3RMA A;  4M3W A;  5AQV A;  1JCG A;  3B6O A;  1MU2 A;  3CJ1 A;  3AGR A;  3LP3 A;  2Q2R A;  4B3T K;  5LL6 Z;  1ILY A;  2E6L A;  2IC3 A;  4KFB A;  4AHR A;  3MN6 A;  3O9R A;  4IXC A;  3V4I A;  1RBU A;  1KVC A;  3NH2 A;  1REV A;  1WAF A;  1HKC A;  3TU5 A;  3VQ6 A;  1YTA A;  4NXN K;  4X65 K;  2Q31 A;  4NLC A;  3QIN A;  1LAW A;  2GX9 A;  1BU6 O;  2NRT A;  2HHX A;  3R9P A;  3JSM A;  4K8X A;  4ZTF A;  3SYZ A;  4FZY A;  4FLT A;  1WN7 A;  4ICL A;  1LAV A;  3QER A;  1IG8 A;  2Q1N A;  1FXX A;  1GLJ O;  2ZD1 A;  3L2Q A;  3NMU A;  4B3O A;  3RMB A;  2F9W A;  1NJZ A;  1RDB A;  1MWM A;  4BRE A;  4ILH A;  1WNS A;  5BPL A;  3SPY A;  1NK4 A;  1IBM K;  4WFB L;  5HRP A;  3HP9 A;  3PY8 A;  3NF7 A;  1KSP A;  2R7Y A;  4A57 A;  4BR7 A;  1QQM A;  3K5L A;  4EHU A;  3IDH A;  4FLU A;  3O1B A;  2IOC A;  5ADX A;  3QDK A;  3NF6 A;  1JL1 A;  4QS7 A;  4YOR A;  1OH6 A;  4DTM A;  3DXM B;  4F8R A;  3ENH A;  2KW4 A;  3PX0 A;  1HNZ K;  1T3V A;  3KWI A;  4DLG A;  3RRG A;  3MWP A;  5C12 A;  5JIC A;  2ATQ A;  3AA3 A;  3ID6 A;  2B5J A;  4MO5 A;  4FPA A;  3KKR A;  4HUG A;  3QLH A;  4MO4 A;  4BC2 A;  3C6A A;  1GLA G;  3SZ2 A;  4O4G A;  3WNE A;  2CGK A;  4GVE A;  1TK0 A;  2VG6 A;  3V9Z A;  2KTQ A;  4IJN A;  4C8O A;  1JLQ A;  4YOY A;  2WTU A;  1RT4 A;  3F5T A;  1K9M O;  1TAU A;  1SUQ A;  2P1J A;  3B6P A;  1TK8 A;  1C1B A;  1ASU A;  1VQ6 N;  3THX B;  1VRU A;  3F2K A;  4LF4 K;  4E1N A;  3ZT0 A;  3AO2 A;  4JHD A;  2QKK A;  1W7A A;  3LDP A;  1VSJ A;  5M1Q A;  4BRN A;  5C2D A;  1JCE A;  5HRS A;  4KKO A;  4RCH A;  3HOT A;  2UU9 K;  3SAF A;  3ZSO A;  1WSG A;  2ZJP L;  4CHY A;  3J7Z O;  4DR4 K;  4FOE A;  3R6M A;  3U3Y A;  1TV6 A;  3MN9 A;  3FZL A;  1C1A A;  3QB0 A;  4FL9 A;  4CHP A;  4J2B A;  4FSV A;  1HMV A;  1S1U A;  2EWS A;  4RG8 A;  3A2F A;  4FJM A;  4OJR A;  3NGI A;  1V4T A;  4DU1 A;  4B9U A;  1EX4 A;  4ILJ A;  1RGI A;  3ENB A;  1X9W A;  2P9U B;  3ULE B;  4O5F A;  1RTH A;  3K5N A;  4A61 A;  5JS1 A;  4FJG A;  1WSJ A;  3G10 A;  3THW A;  4E7I A;  1BUP A;  1TUY A;  2FF6 A;  3M5R A;  3VPZ A;  5CY4 A;  4CJQ A;  4CJT A;  4DV1 K;  1UA1 A;  1XNR K;  3CG7 A;  4RW7 A;  1U47 A;  3SUQ A;  4LFA K;  4CW7 B;  1K6Y A;  5M1P A;  2XY5 A;  4EZ6 A;  1NBW A;  3NCI A;  1TYQ B;  1XHZ A;  4F3O A;  4EFH A;  5IT9 O;  1IKW A;  3SMS A;  3QEI A;  3W0L A;  4PUO A;  2UUA K;  1A5V A;  5AQI A;  1Z05 A;  2UXB K;  4DSJ A;  1S72 N;  4CF9 A;  4CGG A;  5FRN A;  4CZE A;  1CZ9 A;  4DQR A;  4CVN E;  2JWK A;  4I9Q A;  3IS9 A;  3KKS A;  4ISE A;  4WQ4 C;  1EKE A;  3AAP A;  1YJW N;  1QQC A;  5HL7 L;  2X74 A;  5CYQ A;  4BGB A;  3G0Z A;  5BRH A;  4I7F A;  3O9Q A;  3SUP A;  2D0A A;  3PLA A;  2P9I A;  5K14 A;  1UWB A;  5HRO A;  4AHC A;  2BUP A;  1RCH A;  4LF7 K;  3SAH A;  3W3D A;  1S1X A;  3H45 C;  2P9N A;  4DSI A;  4GKJ K;  3VQ7 A;  3H08 A;  4FJ8 A;  3TAP A;  2G8U A;  1RT1 A;  1K8A O;  4KPY A;  1J54 A;  1NKB A;  4DLE A;  1YAG A;  4W5N A;  1HLU A;  4CK1 A;  3AO3 A;  3RSE A;  3C7N B;  1XHX A;  4F9O A;  1C0U A;  1RDD A;  2A6A A;  5JMV A;  5AQK A;  3AVI A;  1RT5 A;  4BC5 A;  3S3M A;  3A5L C;  2ZWH A;  1KLN A;  3VEW A;  3FLC O;  3LM9 A;  3HM8 A;  4Z4H A;  3AVC A;  2D0C A;  1E4F T;  4A5B A;  4IFV A;  1DKG D;  3LP1 A;  1NMN A;  4GNI A;  4CK3 A;  4DFJ A;  4AQY K;  2WFB A;  1SZ2 A;  2ZE2 A;  3M8Q A;  4K0K K;  1Q9X A;  5AQX A;  3E66 A;  3IMX A;  5AZI A;  5AQQ A;  3DOK A;  4CZH A;  1EWQ A;  3TAG A;  4JKE A;  3NGZ A;  3VOV A;  1GOC A;  1BA1 A;  1XI1 A;  2CGL A;  2YHX A;  4LF5 K;  4XIU A;  4CZG A;  3AAR A;  3H1Q A;  2KFN A;  1FK9 A;  1XUP O;  5J2Q A;  3UKU A;  1ZBI A;  5FRM A;  5AQU A;  1FW6 A;  1K8K A;  2CH6 A;  2P9P B;  3CIP A;  3OYA A;  4H5R A;  3D2F A;  4OKK A;  1TGO A;  2D0O A;  3QNN A;  1TL3 A;  3O08 A;  4RW8 A;  3ZSX A;  5E84 A;  1T6C A;  1KVA A;  3MCA B;  1HPZ A;  5HLF A;  4BRP A;  2VQE K;  3THW B;  4DV7 K;  4PKI A;  1OVY A;  2OPQ A;  3K58 A;  4IOA L;  4WF9 L;  4B1V A;  3CC4 N;  3HXM A;  4FK0 A;  2A40 A;  3SCX A;  1FKP A;  4DQ8 A;  3HOS A;  1CXQ A;  2CH5 A;  4FM2 A;  4FWR A;  2OTJ N;  3OW2 M;  4CJ4 A;  3QO9 A;  4BDZ A;  2P9U A;  3ULE A;  4DKW A;  3KK2 A;  1VQ9 N;  2O8F A;  3OYD A;  3CMA N;  1LWF A;  2OTL N;  3KHY A;  3SV4 A;  3ASM A;  2WBN A;  2GWJ A;  5AQG A;  4CJR A;  4OKE A;  4WFA L;  1NOY A;  3QEX A;  2BGG A;  3L3U A;  4FZX C;  5KQD A;  3LZJ A;  2OPS A;  2Q0R A;  2GUP A;  4EP4 A;  5AQN A;  1JLB A;  3TAE A;  3OTO K;  2VGN A;  5C15 A;  3OA9 A;  1IBL K;  2B6A A;  1GLB G;  1C6V A;  5CYM A;  4CHZ A;  4QOZ B;  1C0G A;  2W6K A;  1JLF A;  2E88 A;  2KKZ A;  1HYS A;  1IJJ A;  4M7Y A;  2ZM6 K;  5HRR A;  2PAV A;  2QWO A;  4WYB A;  4FLW A;  1E3M A;  3ATU A;  4CFD A;  1LCU A;  3ZSZ A;  3KTQ A;  1S9G A;  3OYF A;  3ZT4 A;  4GV3 A;  4FW2 A;  4CHO A;  1S1W A;  3B8A X;  4BRH A;  3C95 A;  3SJJ A;  1LV5 A;  4LC9 B;  3OS2 A;  2PYJ A;  5T7B A;  3LL3 A;  4FPB A;  1NGF A;  3MX2 A;  1KCF A;  5AQR A;  1NK5 A;  4FW1 A;  3U3G A;  2XO7 A;  4DUY K;  4LSL A;  3TAF A; 
#chains in the Genus database with same CATH homology
 1CZB A;  1QSY A;  4C8L A;  1X1P A;  3SQ1 A;  4JLH A;  4RW4 A;  4FK2 A;  1KFD A;  1J5O A;  4Z0U A;  4CF0 A;  3HPH A;  2XY6 A;  4CK2 A;  1N6Q A;  2XHB A;  1T7P A;  3QEV A;  1JLG A;  1WSF A;  4YNQ A;  4IG0 A;  3IRX A;  4BE1 A;  3I0S A;  3EYZ A;  3OYL A;  5KTQ A;  4DTP A;  1BIU A;  1HRH A;  3ZSQ A;  1RDA A;  1BCM A;  1VSM A;  3VQB A;  1L5U A;  4FJL A;  3OYC A;  3OYM A;  4ELV A;  3P83 D;  4LD0 A;  3RR7 A;  3OYK A;  4F3T A;  4ELU A;  4B8A B;  2A1S A;  2HVH A;  4ID5 A;  4CFB A;  2IGI A;  3CM6 A;  3VA0 A;  2PYL A;  2RKI A;  4H4M A;  4FLX A;  3THV A;  4BDP A;  3LZI A;  1UA0 A;  1S1V A;  4NYN A;  4NCA A;  2GV9 A;  2QXF A;  3HT3 A;  3LAN A;  3P1G A;  5FDL A;  1U49 A;  4F2R A;  3VQ9 A;  3NAE A;  1X9S A;  1RTJ A;  4CGI A;  2G8I A;  1Z25 A;  3M8R A;  1NKE A;  3PX4 A;  4HUE A;  3LDS A;  4CEC A;  3TAB A;  4KB1 A;  3VQ4 A;  2KZM A;  1KFS A;  4FJI A;  3HYF A;  4E7H A;  3RMA A;  3KLH A;  4M3W A;  5C25 A;  1YVU A;  4OLA A;  1HNV A;  1BI4 B;  3BGR A;  4DTS A;  2IS3 A;  3B6O A;  1HQU A;  2PY5 A;  4L8R B;  3V1Q A;  1Z26 A;  1I3A A;  1MU2 A;  3U6F A;  3V9S A;  3LP3 A;  4QCL A;  3AA2 A;  2YNH A;  1B9D A;  4B08 A;  4CJF A;  2YKM A;  4FM0 A;  3T1A A;  4CES A;  2E6L A;  2IC3 A;  3AVK A;  4DG1 A;  1J9A A;  2HB5 A;  4KFB A;  4AHR A;  4E7K A;  3V4I A;  2P5O A;  1RBU A;  1TKZ A;  1KVC A;  3AVG A;  3NH2 A;  4CCH A;  3EY1 A;  4DU4 A;  3L3V A;  1REV A;  1C1C A;  1WAF A;  3TAM A;  3ZT2 A;  1U45 A;  3F9K A;  3VQ6 A;  1ZBF A;  1YTA A;  5DMR A;  3S3N A;  3OYB A;  4J2A A;  5EU7 A;  4ZHR A;  3DLB A;  1B92 A;  3DOL A;  4Z4F A;  1XWL A;  2PZS A;  4AIL C;  4DTJ A;  4CJL A;  2BE2 A;  4O5B A;  5CZ2 A;  3QIN A;  4Z4G A;  1LAW A;  1KVB A;  3AVB A;  4CEA A;  4AHU A;  3DYA A;  1TKD A;  2HHX A;  1S5J A;  4JS5 A;  3JSM A;  4K8X A;  4ZTF A;  4CEF A;  2HHV A;  3KLI A;  3SYZ A;  2EX3 A;  3V9U A;  3DRS A;  4FZY A;  3LAK A;  3DMJ A;  4DSE A;  4OKJ A;  4FLT A;  4FJ5 A;  5KGW A;  1WN7 A;  4ICL A;  3NH0 A;  3SQ0 A;  1LAV A;  4B9S A;  3QER A;  2VWJ A;  4W5R A;  2OZS A;  4FZZ A;  1NK9 A;  1FXX A;  2ZD1 A;  3L2Q A;  4B3O A;  2VG7 A;  3RMB A;  1L3S A;  1ZYQ A;  3D45 A;  1NJZ A;  4B9L A;  1ZBU A;  1RDB A;  4DSK A;  4KHU A;  4BDY A;  3QET A;  1BIZ A;  3SPZ A;  3I0R A;  3NFA A;  2Q3S A;  1WNS A;  4FJH A;  4NCG A;  4CIG A;  3SPY A;  4DS5 A;  1NK4 A;  1BQN A;  3OY9 A;  4KRE A;  3AA4 A;  1RBT A;  1EET A;  3NBP A;  3DLE A;  5HRP A;  4O44 A;  3HP9 A;  3OYH A;  3PY8 A;  3NF7 A;  3D0P A;  4CJK A;  1JLA A;  3T19 A;  1KSP A;  3AO5 A;  2R7Y A;  1X9M A;  4I2P A;  1JLC A;  4E1M A;  1IKX A;  4O55 A;  3V1R A;  3K5L A;  3ZSW A;  1QE1 A;  1RBR A;  3TWH A;  4FLU A;  2IOC A;  4OPK A;  3NF6 A;  1JL1 A;  1HYZ A;  2HND A;  4TSX A;  3RTV A;  1T8E A;  4DTM A;  4F8R A;  4CJS A;  2X6S A;  4Z4C A;  1U48 A;  1HYV A;  2KW4 A;  3M8S A;  3SQ4 A;  3PX0 A;  3PO5 A;  4CHN A;  1T05 A;  4DLG A;  3RRG A;  3KK1 A;  3KD5 E;  4HUF A;  1KRP A;  4HHT A;  4Z4E A;  4DQP A;  4FVM A;  2ATQ A;  3AA3 A;  4MQ3 A;  1QSS A;  2B5J A;  2HHS A;  4IDK A;  3OYE A;  3KKR A;  4FXD A;  3QEW A;  4HUG A;  4ID1 A;  3QLH A;  4FCY A;  4DFM A;  3SZ2 A;  4O4G A;  3WNE A;  3AVA A;  1L3T A;  3TAQ A;  3AVL A;  3CYM A;  1TK0 A;  1S6Q A;  1TKX A;  4LH5 A;  2VG6 A;  3V9Z A;  1D9D A;  2KTQ A;  5I42 A;  4LSN A;  1JLQ A;  4C8O A;  1QHT A;  2VG5 A;  2FBT A;  1NK0 A;  1RT4 A;  3LPT A;  1TAU A;  3SUO A;  4F4K A;  2DY4 A;  3DM2 A;  4NCB A;  1SUQ A;  2P1J A;  3B6P A;  3DLR A;  3HPO A;  3MXM A;  1C1B A;  4E19 A;  1TK8 A;  4J2D A;  2KFZ A;  1ASU A;  2YKN A;  1VRU A;  3HJF A;  4M3X A;  2Y1I A;  4CEO A;  1IO2 A;  4E1N A;  5C42 A;  3ZT0 A;  2JGU A;  3C6U A;  3AO2 A;  4FLZ A;  3O4Q A;  4WE1 A;  4MFB A;  3ZT1 A;  4CEB A;  3L2R A;  3OJU A;  2QKK A;  1TKT A;  1UOC A;  1VSJ A;  3CQ8 A;  4FJ7 A;  3IAY A;  4OLB A;  3VQP A;  4W5O A;  2KQ2 A;  5HRS A;  4KKO A;  3RRH A;  4DF8 A;  2P5G A;  4KHN A;  4M3U A;  3ZSO A;  1WSG A;  3BDP A;  4CHY A;  4N47 A;  3IG1 A;  3O4N A;  4W5T A;  3OJS A;  4OGE A;  4Y1D A;  3U3Y A;  1TV6 A;  2BAN A;  2O4I A;  3L2W A;  4DTU A;  1C1A A;  4YFU A;  1RTI A;  4O0I A;  4IG3 A;  4CHP A;  3K5M A;  4DTO A;  3KIO A;  4DF4 A;  1TL1 A;  1FKO A;  4J2B A;  3VQA A;  1LWC A;  1WLJ A;  1HMV A;  1S1U A;  4GMJ B;  2F96 A;  3ZCM A;  4CJ5 A;  5KRS A;  4RG8 A;  4FJM A;  3A2F A;  4CED A;  4OJR A;  2I5J A;  1JXE A;  1RT2 A;  3NGI A;  1T03 A;  4DMN A;  4DU1 A;  4B9U A;  4FLV A;  1EX4 A;  1X9W A;  4Q5V A;  2YHB A;  3AVJ A;  1BCO A;  3L8B A;  1RTH A;  4BE2 A;  1HQE A;  4G1Q A;  4CE9 A;  4CJE A;  1L3V A;  4KO0 A;  3AO1 A;  2FC0 A;  3K5N A;  1Q9Y A;  1QSL A;  4M3Z A;  4GVM A;  1BHL A;  3DLK A;  3SV3 A;  1JXB A;  5HRN A;  3V9X A;  4FJG A;  1WSJ A;  5JS1 A;  3G10 A;  4FJ9 A;  1NK7 A;  4BE0 A;  2F8S A;  4KAZ A;  3VQ5 A;  3NE6 A;  4E7I A;  4M3Y A;  3MEC A;  4CJQ A;  5KRT A;  5CY4 A;  4CFA A;  4CJT A;  1UA1 A;  3NHG A;  3CG7 A;  4RW7 A;  5KI6 A;  3VN5 A;  2RN2 A;  3SUQ A;  1U47 A;  2DTU A;  3ALY A;  4AH9 A;  1K6Y A;  3VQ8 A;  4CJU A;  4FJJ A;  4OGC A;  3NH1 A;  3M8P A;  2XY5 A;  4DSL A;  4EZ6 A;  3RR8 A;  3S9H A;  1EP4 A;  1VSD A;  3NCI A;  1XHZ A;  4F3O A;  1IKW A;  4PUO A;  3QEI A;  1GOA A;  3C6T A;  1NKC A;  4KHQ A;  1A5V A;  3O3G A;  1YTU A;  3MXI A;  4Y1C A;  1SKW A;  1F21 A;  4CGD A;  4DSJ A;  4CF9 A;  4CFC A;  4CGG A;  5FRO A;  4AHS A;  3OYI A;  2BDP A;  4B9M A;  5FRN A;  1SL2 A;  1CZ9 A;  1O1W A;  2ZQB A;  3ZSY A;  4DQR A;  1WSI A;  4C8N A;  2FBY A;  4I9Q A;  3IS9 A;  3KKS A;  3DRR A;  1ASV A;  3HVT A;  1EKE A;  4FJK A;  1NJY A;  1QQC A;  3SUN A;  2X74 A;  5CYQ A;  1EXQ A;  3ULD A;  2HMI A;  3G0Z A;  3V9W A;  2E4L A;  1D8Y A;  4KHY A;  4I7F A;  1RT3 A;  3FFI A;  3SUP A;  2D0A A;  2Z1I A;  3DLG A;  4IKF A;  2ETJ A;  4R5P A;  5K14 A;  1UWB A;  3OYG A;  2RF2 A;  3NDK A;  5J2M A;  2XY7 A;  5HRO A;  1YT3 A;  4AHC A;  3K59 A;  1NJX A;  4QAG A;  1RCH A;  4DS4 A;  2QK9 A;  3AVM A;  1S1X A;  4CJW A;  2IDO A;  5C24 A;  5D3G A;  3RMC A;  4M3T A;  4DSI A;  1UAX A;  3H08 A;  3VQ7 A;  3KD1 E;  4FJ8 A;  1IH7 A;  2DFE A;  3QIP A;  3TAP A;  2G8U A;  1IG9 A;  4CJP A;  1WSE A;  1RT1 A;  1VSL A;  3LWM A;  3LAM A;  4JRQ A;  1J54 A;  4DSF A;  1NKB A;  4B9V A;  4KPY A;  4DLE A;  1NK8 A;  3K5O A;  4CEQ A;  4CEZ A;  4W5N A;  2RPI A;  3E01 A;  4FK4 A;  1RT6 A;  1C0T A;  3CFR A;  2KZZ A;  1HNI A;  3RMD A;  1U4B A;  1QS4 A;  3AO3 A;  4CK1 A;  3HPG A;  1KTQ A;  1XHX A;  4IBN A;  3QNO A;  2HVI A;  4E3S A;  1L3U A;  1C0U A;  1RDD A;  1U04 A;  3EZ5 A;  4FYD A;  1DTT A;  4RW6 A;  5SWM A;  2P51 A;  2Z1G A;  3NF9 A;  2G8K A;  2XRI A;  2YHA A;  2G8H A;  4DU3 A;  2X78 A;  3AVI A;  2XY8 A;  4M41 A;  3AVN A;  1VK0 A;  1RT5 A;  3ZT3 A;  4W5Q A;  1W9H A;  4IFY A;  4M45 A;  3LWL A;  3S3M A;  1KLN A;  4PQU A;  3VQC A;  1S9E A;  4ELT A;  4CGH A;  3KLE A;  3WNF A;  4DTN A;  3ZSR A;  4Z4H A;  1BQM A;  3AVC A;  4CIE A;  4EZ9 A;  1JKH A;  2D0C A;  4CF8 A;  4B8C A;  4DQQ A;  1ASW A;  1BI4 A;  4DQI A;  1S1T A;  3DI6 A;  4IFV A;  3LP1 A;  5DK5 A;  2OPP A;  2DFF A;  2WON A;  4CK3 A;  4DFJ A;  4F2S A;  4LY7 A;  4N76 A;  5HBM A;  1J53 A;  2ZE2 A;  3M8Q A;  3O3H A;  4K8Z A;  4KTW A;  1Q9X A;  3L2V A;  3VQD A;  4OPJ A;  1WAJ A;  3DOK A;  1DTQ A;  1ITG A;  2JLE A;  3TAG A;  3TAN A;  3HM9 A;  2HNY A;  3HO1 A;  2HHU A;  3VA3 A;  3NGZ A;  3VQE A;  3V6D A;  4LH4 A;  2O4G A;  3F73 A;  1GOC A;  4CF2 A;  3PV8 A;  1XI1 A;  3OYJ A;  3LP0 A;  3AVH A;  3UIQ A;  4DQS A;  5E41 A;  4E7J A;  1D5A A;  1JLE A;  1VSH A;  4AHV A;  4CF1 A;  3HVR A;  5CZ1 A;  3OS1 A;  4XIU A;  4E0D A;  1JL2 A;  2HHT A;  1TAQ A;  2NUB A;  2FBV A;  4PY5 A;  3CM5 A;  3V81 A;  2F8T A;  4KHS A;  2KFN A;  1FK9 A;  3TAR A;  5J2Q A;  4RW9 A;  1ZBH A;  2OPR A;  2G8W A;  1ZBI A;  1DLO A;  1Y97 A;  5FRM A;  3KK3 A;  1CLQ A;  4C8K A;  4I2Q A;  3OYA A;  5J2P A;  1RDC A;  2W42 A;  4OKK A;  3SI6 A;  1TGO A;  3QIO A;  4C8M A;  4CHQ A;  3JYT A;  1ZBL A;  4FM1 A;  3T3F A;  3MED A;  4CGF A;  3MXJ A;  3QNN A;  1TL3 A;  1RNH A;  1RBS A;  4RW8 A;  2X6N A;  3ZSX A;  3S3O A;  4KB0 A;  4H8K A;  1KVA A;  1SL1 A;  4O0J A;  1HPZ A;  2A1R A;  3AA5 X;  1IKY A;  5HLF A;  3HK2 A;  2GBZ A;  1VSI A;  1BL3 A;  5HP1 A;  1SKR A;  3K57 A;  4DTR A;  4I9L A;  2OPQ A;  4E89 A;  3K58 A;  1NOZ A;  1VSE A;  1C0M A;  3L2U A;  4KTQ A;  2EHG A;  3HXM A;  3LAL A;  3OS0 A;  1B9F A;  1R0A A;  4FK0 A;  5I3U A;  4HCB A;  3SCX A;  1FKP A;  1VSF A;  4DTX A;  1RBV A;  5JS2 A;  2VWK A;  1SV5 A;  3C94 A;  3V1O A;  2G8V A;  1CXQ A;  2HW3 A;  3SQ2 A;  4FM2 A;  3AVF A;  1HJR A;  3TR8 A;  3WNH A;  2LSN A;  3LP2 A;  4UQG A;  2YNG A;  4GW6 A;  3QO9 A;  3MEE A;  4PA1 A;  4CJ4 A;  3KK2 A;  4BDZ A;  4M42 A;  2G8F A;  1KLM A;  4Z4I A;  2AJQ A;  3DRP A;  2YNF A;  3HST B;  2OYQ A;  3OYD A;  3KJV A;  3DLH A;  1LWF A;  2QKB A;  1WSH A;  2IAJ A;  4J2E A;  4PWD A;  3SV4 A;  4DFK A;  1IKV A;  3ASM A;  3PX6 A;  1A5W A;  3LPU A;  3O3F A;  4E7L A;  4HCC A;  2YNI A;  3ZSV A;  3CFO A;  1W0H A;  2GUI A;  2HHW A;  4N41 A;  4CJR A;  3I8D A;  4OKE A;  1TK5 A;  1NOY A;  3QEX A;  2BGG A;  1G15 A;  4BWJ A;  3L3U A;  3OVN A;  2D0B A;  4ZTJ A;  1RTD A;  3ITH A;  4FZX C;  4FJN A;  4KRF A;  3LZJ A;  2OPS A;  1N5Y A;  4FJX A;  4EP4 A;  1JLB A;  2DFH A;  3TAE A;  4H4O A;  3VQQ A;  4CER A;  4DWI A;  2HHQ A;  1A5X A;  2B6A A;  4EP5 A;  3KLF A;  1NJW A;  1C6V A;  5CYM A;  4CHZ A;  3MEG A;  4KI4 A;  4QOZ B;  1D9F A;  3K2P A;  4Q0B A;  1JLF A;  4KTZ A;  4FLY A;  5J1E A;  1HYS A;  2Z1J A;  3AO4 A;  2OZM A;  3AV9 A;  4KI6 A;  5SZT A;  5HRR A;  3WNG A;  3CFP A;  1SL0 A;  1VRT A;  3NGY A;  3P5J A;  3QES A;  2Y1J A;  2OA8 A;  4B9N A;  4FLW A;  1RIL A;  4NYF A;  4CFD A;  3MAQ A;  4KHW A;  4CJV A;  3SNN A;  3ZSZ A;  4JRP A;  1S6P A;  3KTQ A;  5J2N A;  1S9G A;  5KGX A;  4JS4 A;  3OYF A;  3ZT4 A;  4AHT A;  2WOM A;  2Z1H A;  4CEE A;  4FW2 A;  2FBX A;  1Q8I A;  4CJ3 A;  4CHO A;  4HVJ A;  1S1W A;  4CIF A;  4BAC A;  2D5R A;  3QEP A;  1XC9 A;  3ISN C;  1BGX T;  4CGJ A;  3PUF A;  1LW0 A;  4OVL A;  3OYN A;  4DFP A;  3PO4 A;  1I39 A;  2HNZ A;  3C95 A;  3NF8 A;  3KLG A;  3SJJ A;  1NK6 A;  4B9T A;  1VSK A;  2E6M A;  2ITG A;  4HTU A;  1RT7 A;  4KV8 A;  3RWU A;  1LV5 A;  3OS2 A;  2PYJ A;  5T7B A;  2YV0 X;  3HP6 A;  1KCF A;  4M3R A;  1NK5 A;  1LWE A;  1LW2 A;  4FW1 A;  3TI0 A;  1TVR A;  2B4J A;  4BWM A;  3HL8 A;  3U3G A;  4N5S A;  2XO7 A;  1SKS A;  4LSL A;  1QTM A;  1GOB A;  4N56 A;  1CXU A;  3TAF A;  1BIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...