3WNEA

Cyclic hexapeptide pkidng in complex with hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
154
structure length
138
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
total genus 47
structure length 138
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wneA00
3RMDA 4IG0A 4CGDA 1L5UA 2KZZA 1KLMA 4FK4A 4ID1A 5FDLA 5SWMA 1SKWA 2HW3A 1G15A 4FJHA 4C8OA 1VRTA 2D0BA 4CJFA 1BQNA 1VSKA 4CCHA 1B9DA 4F4KA 4BE0A 2ATQA 3ZSWA 1VSDA 2BGGA 3DLKA 4Z4CA 3SQ0A 4AHSA 4FJ5A 2X6NA 1KTQA 3VQ9A 4F8RA 2E4LA 4J2DA 4E7KA 1RTDA 3SJJA 5E41A 1KVBA 1RDBA 2HNZA 2QKKA 4FK0A 4PWDA 1HNIA 1U04A 1RBVA 3O3GA 4FVMA 4OKEA 4Z4FA 3NCIA 4CJTA 3RMBA 5HP1A 3QETA 1ZBUA 1HPZA 4CECA 4XIUA 4CF2A 1ZYQA 3SQ2A 3LP2A 3KKRA 3TAPA 2FBTA 3SQ1A 3QNOA 4CHZA 2DFHA 3AVGA 3RR7A 1J5OA 4AH9A 3JYTA 4CIEA 1SL0A 3QIOA 4F3OA 2OYQA 4WE1A 3V9XA 3QEXA 1IO2A 3NF8A 3ZSOA 2VWJA 1QTMA 4F3TA 4FXDA 4O0JA 1TAUA 4FJMA 5HRSA 3ZSZA 1YTUA 1QHTA 3ZT4A 3WNFA 3JSMA 3AVBA 4FYDA 3KK2A 4QCLA 5C42A 3PX0A 4DSJA 5JS1A 3AV9A 1FKOA 3IAYA 4HCBA 1A5WA 1U4BA 3V9WA 3AVKA 4M3YA 3SCXA 3NAEA 3OS2A 4PA1A 4DLEA 3VQ5A 3DLEA 4H4OA 1CLQA 2HHXA 4LH5A 2YHAA 3QEPA 1UAXA 4CGGA 1TK5A 4FJ7A 5CZ2A 1J54A 3F73A 5J2MA 2KZMA 3OVNA 1C1CA 4M41A 1NJXA 3CG7A 3OYAA 4DTSA 1HYSA 3O3HA 3I0RA 3HP6A 3V4IA 1IG9A 4ID5A 4RW7A 4N56A 1BI4B 2IOCA 3HPHA 3OYEA 1HQUA 4NCAA 3D45A 4KREA 3ZCMA 3OYCA 1RTIA 3QERA 3NGZA 2PZSA 1WSEA 4FJJA 1HNVA 1RT1A 2O4GA 1SUQA 1UA0A 4MFBA 5SZTA 1FK9A 1EKEA 1NOZA 4M3RA 5HROA 4AHRA 1X9WA 1N6QA 1WSIA 1WSJA 3ZSRA 1IKWA 4LY7A 1TKTA 4CJVA 3V9ZA 4F2RA 4M42A 2Z1HA 2B4JA 4CJPA 1D5AA 3OYNA 3AVNA 1Z25A 1C6VA 3SV4A 4KHSA 2AJQA 2XO7A 2OPQA 4KB0A 1S5JA 4CFDA 4EP5A 3KK3A 4W5RA 1BGXT 4B9TA 3F9KA 3DI6A 1QSYA 3OJUA 3TAGA 3OYGA 5EU7A 4KKOA 3HVRA 3RTVA 1WSHA 3SUQA 2O4IA 1RNHA 1RTJA 4EZ6A 2RKIA 4DMNA 1TAQA 1D9DA 4H4MA 2OA8A 4CF8A 4B9UA 4M3TA 1EP4A 4FCYA 1BIZA 3AO4A 1X9MA 2FC0A 4GVMA 4JLHA 3CQ8A 3G0ZA 3C6TA 4GMJB 1BIUA 4DSLA 1KRPA 4CJKA 3LZIA 3LPUA 5I3UA 3NH0A 2XY8A 4B9MA 3AA2A 3LP1A 4KTWA 1VSIA 4AHVA 1BCOA 2IAJA 4EP4A 2PYLA 2HHQA 4C8KA 2P1JA 4QAGA 1BISA 4BDYA 3LALA 3ITHA 3TAMA 4CFBA 2YNGA 3DYAA 1TK8A 4CGHA 1SKRA 3VN5A 4C8NA 4CFAA 1IKVA 3OS0A 1L3UA 1ZBIA 2G8IA 4FLXA 1NKCA 3VA3A 3KKSA 3DOKA 4CEDA 4KPYA 1BL3A 3C6UA 3K5NA 4BWJA 1ZBLA 4KTQA 3DMJA 2OZSA 3NH2A 5KTQA 2A1RA 3UIQA 2Z1JA 1YVUA 4ZTFA 3NF9A 1REVA 4O0IA 3AVLA 1KVCA 4E1NA 3MECA 2F96A 3CFOA 2G8VA 1L3VA 4ELUA 3OY9A 4FM1A 4DFKA 4YNQA 3HPOA 1S9EA 3VQ4A 3OYJA 2JGUA 1LW2A 4DU1A 3VQAA 3VQQA 4NCGA 3KLIA 3O4QA 5J2PA 3BDPA 4E1MA 1ZBHA 4DTNA 3RRHA 3HT3A 3MEEA 1Q9XA 1RT6A 4KHUA 1XHZA 5K14A 3AO2A 1J53A 3DM2A 1JLFA 3WNEA 2Z1IA 1RDDA 4CGIA 4DG1A 4ICLA 4DQPA 2KFNA 2KFZA 1JLGA 2KTQA 4DF4A 4CE9A 5FRMA 1XI1A 3AVJA 4E7JA 4GW6A 4N41A 3V1OA 4RW9A 1T8EA 4JRPA 1A5VA 4DSEA 1KLNA 4Z4HA 1VSJA 3MEDA 1HMVA 2ETJA 1HYVA 4N47A 3VQPA 3DLRA 2RN2A 3QEVA 4KO0A 3T19A 4DFJA 4CJ4A 4CEQA 3SPZA 3ZSYA 3A2FA 1WAJA 1CXUA 4FLVA 3S3OA 4CHOA 4W5NA 2Z1GA 5CYQA 4B8CA 2G8UA 1WSGA 1WLJA 2X74A 4I9LA 4KHWA 4HHTA 3OYIA 4BDPA 4RW8A 1ASVA 1W9HA 4W5OA 2XY6A 1QS4A 3QESA 3E01A 1L3TA 4FM0A 1I3AA 1S1WA 2BANA 4FLUA 1GOAA 2P51A 1D8YA 3RRGA 3VQBA 4AHUA 4FJGA 1F21A 3OYKA 3V9SA 3K57A 4DQQA 4IBNA 4CK3A 4J2BA 3PY8A 2PYJA 5CZ1A 4DQRA 2D0AA 3SUOA 4PUOA 2WONA 4PQUA 1RTHA 3I0SA 1NOYA 4OGCA 5HRRA 3L3VA 4CK2A 3SUNA 4DF8A 4JS5A 4IFVA 1X9SA 3NGYA 4DSKA 4N5SA 3IRXA 3VQCA 5DMRA 5J2NA 3DLBA 4KHQA 3ASMA 5J1EA 3AVAA 3TAEA 1TL1A 1IKXA 1S1XA 2YKNA 3EYZA 4FJLA 4I9QA 4KHYA 4FW2A 4OLAA 2GV9A 4M45A 4IKFA 3HP9A 4AHTA 3D0PA 3NDKA 4E7HA 4F2SA 3TWHA 4BE1A 1QQCA 3TI0A 3KLGA 5T7BA 1RBUA 4DTMA 1NK5A 4CEFA 4Z4GA 1JL1A 2Y1JA 4M3ZA 3SQ4A 4KHNA 3AVIA 2Q3SA 1O1WA 3M8SA 2G8FA 3MXIA 2Y1IA 4CEZA 4DTRA 3VQ8A 5C25A 3LZJA 1GOCA 3MAQA 3ISNC 2HHWA 4CERA 4QOZB 3OYDA 1NKEA 4CEBA 1RBTA 1TVRA 1FKPA 2OPRA 2ZQBA 3OYMA 1QSLA 1UOCA 3CM6A 4MQ3A 3KIOA 3QEWA 3PO5A 1JL2A 2YNFA 4C8MA 4CHYA 3L2UA 3OYFA 1JLAA 3L8BA 1VSMA 1JLQA 3NF7A 3NH1A 3SV3A 1NK4A 1CXQA 4FJ8A 1A5XA 4FK2A 1SKSA 1RDAA 3RWUA 2YNHA 4FLYA 4KAZA 3VQ7A 4HUFA 4FM2A 1WN7A 1XHXA 1C0UA 3AA4A 1HJRA 1TGOA 4CJUA 2E6MA 3U6FA 2PY5A 3LAMA 4G1QA 2B6AA 4M3UA 4AILC 1LAWA 1LWEA 1UWBA 1QSSA 4Z4IA 3P5JA 1ASWA 4LD0A 3V9UA 2IS3A 4DS4A 2XY7A 1VSLA 3T1AA 1FXXA 4LSNA 3QEIA 1KCFA 3PV8A 4CEEA 3KJVA 3CYMA 3AVFA 3M8PA 1XWLA 2F8TA 2HB5A 1JLBA 3KLEA 1BQMA 1JKHA 4NYFA 3AVHA 3QINA 4E7IA 3PX4A 3KTQA 4K8XA 2G8WA 4DQIA 4KTZA 3OYHA 4FLZA 4RG8A 1WSFA 2KW4A 3OYBA 4DS5A 1N5YA 1IH7A 5KRSA 2BE2A 4I2PA 2QKBA 1D9FA 4FZZA 3L2RA 1NK6A 4K8ZA 4W5QA 3AVMA 3ZSQA 3TARA 4AHCA 3QLHA 3OJSA 4BE2A 4B9NA 1LW0A 4ZHRA 4OKKA 4O44A 1EXQA 3U3GA 3FFIA 1ZBFA 2IGIA 4ZTJA 1T03A 3KD5E 4Y1CA 1KVAA 1SV5A 1EX4A 2R7YA 3AA5X 4DFPA 3IS9A 2X6SA 5FRNA 4CF0A 4DSFA 1RT7A 4CJ5A 4FJ9A 4H8KA 4KI4A 3S3NA 1RT5A 3TAQA 1YTAA 4FZXC 2GBZA 2HVHA 2P5GA 3TANA 3TR8A 4YFUA 4E19A 5HRPA 3CFRA 3C95A 2X78A 3AO5A 4HUGA 2P5OA 3LWMA 3V1QA 1Z26A 1C1BA 4BWMA 1KFSA 2HHUA 1U47A 1RCHA 1EETA 3G10A 1XC9A 3MEGA 3HXMA 4B9SA 1NK7A 1BCMA 5D3GA 1RT4A 4OKJA 4CFCA 4Z4EA 2RPIA 4Q5VA 2G8HA 3KD1E 4BDZA 4B8AB 4KB1A 2FBYA 1NJZA 1HYZA 1UA1A 3SZ2A 1C1AA 1K6YA 3L3UA 4OPKA 3K58A 4DTXA 4C8LA 4FJKA 2GUIA 2ZE2A 4ELVA 1TKDA 4OLBA 4DTPA 3L2QA 4B3OA 4KRFA 1RBRA 3ULDA 1TKZA 3HPGA 3LANA 5KGWA 4OVLA 1HRHA 2HNYA 2VG5A 3ZT0A 2E6LA 1JXBA 2XHBA 4DQSA 3QNNA 4CIGA 4HCCA 3ZT3A 3DLHA 2B5JA 3CM5A 1B9FA 1LWFA 2RF2A 1KFDA 2OPSA 1HQEA 3NHGA 4DTUA 1R0AA 2JLEA 4DWIA 4FZYA 2QXFA 1S1VA 3AO3A 1ITGA 1VSFA 2VG7A 4IDKA 3KLFA 4DU4A 1LV5A 2G8KA 2WOMA 3HL8A 3AVCA 4CHNA 1I39A 1TK0A 1L3SA 4CEOA 1C0MA 4E89A 1S6QA 1U48A 2D5RA 1BI4A 3MXJA 1ASUA 4CESA 4CGFA 3AA3A 1VK0A 2FBXA 5HRNA 3HYFA 3MXMA 2HVIA 1DTTA 3HJFA 1X1PA 3VQEA 5CY4A 4EZ9A 4FJXA 4M3WA 2HHTA 2DTUA 4RW4A 1VSHA 1W0HA 2HNDA 5HBMA 1JLCA 1GOBA 2A1SA 4CJ3A 1B92A 1JXEA 4PY5A 3IG1A 1DLOA 3M8QA 2OZMA 3K2PA 3NF6A 4IG3A 2W42A 1LAVA 3RMAA 2HHVA 2ITGA 5HLFA 4HTUA 2DFFA 3B6PA 4CGJA 4CK1A 2YHBA 3K5LA 3TABA 3SNNA 4FW1A 5JS2A 1WNSA 3PX6A 3S9HA 1Q9YA 4CIFA 3DRSA 4TSXA 1LWCA 2I5JA 3P83D 4CJWA 3L2WA 3HSTB 4B9LA 5KI6A 4LH4A 3PUFA 3HO1A 1NJYA 3O3FA 3H08A 2DY4A 3QO9A 1Q8IA 1TL3A 3ZSVA 4CF9A 3LP0A 3NBPA 3KK1A 4NCBA 3OS1A 1RT2A 3EY1A 3NFAA 2OPPA 1RDCA 3TAFA 4CJEA 3SPYA 4J2EA 3V1RA 3SYZA 4DU3A 3QIPA 4DFMA 3V81A 1T05A 2QK9A 2KQ2A 4CJSA 3RR8A 4CEAA 3NE6A 3LPTA 4Z0UA 1NK8A 3VQDA 4BACA 3LP3A 4O4GA 4ELTA 4CHPA 1IKYA 4DLGA 4CF1A 3NGIA 4B08A 1YT3A 4O5BA 3C94A 2YNIA 1JLEA 1RILA 4DTJA 3LAKA 4OJRA 4OGEA 4UQGA 1C0TA 4HVJA 4FJIA 3M8RA 4FLTA 4CHQA 3KLHA 5I42A 1RBSA 3VQ6A 3WNHA 1VRUA 3LDSA 2HHSA 4E3SA 1NK0A 4CJLA 4B9VA 3DRRA 4FLWA 4I2QA 4RW6A 3THVA 3DRPA 5KGXA 1MU2A 1SL2A 4DSIA 3HK2A 1T7PA 2VWKA 4CJRA 1SL1A 3T3FA 2IC3A 3ZT1A 4OPJA 1KSPA 4NYNA 4KV8A 4Y1DA 3SUPA 1NK9A 4IFYA 1TV6A 3SI6A 2YKMA 4I7FA 3ZT2A 4E0DA 2XY5A 3ALYA 1WAFA 3DOLA 3HVTA 4E7LA 1DTQA 4FJNA 1U45A 3O4NA 3K59A 1S6PA 5FROA 4J2AA 2LSNA 3ZSXA 3EZ5A 1J9AA 3VA0A 2FBVA 4DTOA 3WNGA 2HMIA 1S1TA 1RT3A 2NUBA 4HUEA 4CJQA 3K5OA 4W5TA 2BDPA 3RMCA 1Y97A 2ZD1A 1BHLA 3B6OA 3P1GA 4N76A 1NJWA 1CZ9A 2D0CA 5C24A 1CZBA 1TKXA 2DFEA 3U3YA 2VG6A 3S3MA 1U49A 2YV0X 4JS4A 4M3XA 3HM9A 3DLGA 2IDOA 5KRTA 3AO1A 4KI6A 3BGRA 5DK5A 2XRIA 5CYMA 3CFPA 3PO4A 4L8RB 4JRQA 5J2QA 3L2VA 1NKBA 4R5PA 1VSEA 3OYLA 2EHGA 3LWLA 4Q0BA 1QE1A 1S9GA 3V6DA 4O55A 2EX3A 3I8DA 4KFBA 4LSLA 2F8SA 3K5MA 1S1UA
chains in the Genus database with same CATH superfamily
4CGDA 2KZZA 5M1OA 4FK4A 2QWNA 5FDLA 3JAMO 1VRTA 1BQNA 4CCHA 4F4KA 2F9TA 2BGGA 1NGFA 1VSDA 2IVOA 3SQ0A 4JV5K 3BUZB 4PKGA 4PKIA 1DEJA 4YHHK 4F8RA 3SJJA 3CCMN 2QKKA 4FK0A 3J7ZO 1KXPA 2JWLA 2E1ZA 4LF9K 4CHZA 4NXNK 3AVGA 3PIPL 4B3SK 4GV3A 1N32K 3C7NB 1SL0A 1QTMA 4JI3K 5DM6L 4KHPK 4R79A 3SMPA 3ZSZA 2P9LB 1NBWA 4CZMA 4YORA 3WNFA 3JSMA 4YOYA 1HNZK 3VEXA 1NGGA 3PX0A 1JJ2M 4MLEA 3J81O 4HCBA 3SCXA 3CCLN 4DLEA 4CVNE 1YITN 2HHXA 4LH5A 4WQ5A 2JWKA 1DGKN 1O13A 3F73A 1C1CA 3HP6A 5BRDA 4ID5A 4RW7A 3WEEB 5M1NA 3HPHA 4LFBK 1HQUA 4KREA 2VCPA 1MDUB 2CH6A 3OYCA 1D4XA 1RT1A 1SUQA 5BN9A 1KAXA 1X9WA 1NOZA 3IKMA 4M3RA 5LJVA 4H0VB 2BH1A 3V9ZA 1TKTA 4CJPA 3OYNA 2FSNA 1WBBA 4DCHA 2XO7A 4WF9L 1S5JA 1N8RO 4KB0A 2O8DB 1BGXT 4H03B 4B9TA 3F9KA 3OJUA 3OYGA 4DR5K 4KKOA 2O8EB 4CI6A 4X62K 3CC7N 5FPDA 2OA8A 4B9UA 1YVNA 4M3TA 3A5OC 3ZEUB 2NRVA 1X9MA 3BZCA 3LDPA 4JLHA 3N4QA 3CQ8A 2P9SB 3G0ZA 4LF8K 1BIUA 1BU6O 2A41A 1KRPA 3BEXA 4CJKA 5I3UA 4B9MA 3NH0A 3AA2A 1VSIA 1BCOA 2QM1A 1BISA 2V51B 4KH6A 4V19S 1T6DA 3ITHA 5CE3A 3U8XA 1D9FA 5ADXA 1SKRA 3SAGA 3VN5A 2G8IA 4FLXA 3KKSA 3OTOK 1FW6A 5KPZA 4KPYA 3C6UA 3K5NA 4B1XB 4BWJA 4KTQA 4B3MK 2Z1JA 1YVUA 4O0IA 2FSKA 3MECA 2F96A 4FWSA 3DXKA 2G8VA 4FM1A 2QWPA 4DR6K 4CZEA 2JGUA 5AQLA 3VQAA 3VQQA 2QWQA 3THWB 3O4QA 5J2PA 4F9OA 4DTNA 4XEIA 1Q9XA 3AO2A 3AGKA 1RDDA 4ICLA 3BF1A 2KTQA 4GY2B 4CE9A 4DUYK 5FRMA 4E7JA 2F7TA 5LMNK 4IEIA 4DSEA 2OANA 1HMVA 2ETJA 5BN8A 2NRXA 1WAJA 3S3OA 4BR5A 3OYIA 4RW8A 3LDQA 2YJEA 3CD6N 2J4RA 4W5OA 3FZFA 2A6AA 4NO7A 3KZBA 3OYKA 1XNQK 3K57A 3LDLA 2PYJA 3O6WA 4JAXA 3O5BA 4PQUA 1RTHA 3I0SA 1NOYA 2O8FB 4CK2A 3L3VA 4BRLA 4DF8A 4IFVA 3NGYA 1OKJA 3IRXA 3VQCA 5DMRA 5J2NA 2CGLA 5A2QO 3IUCA 5J1EA 4A57A 1IKXA 2HSTA 3SAHA 3O80A 3WQTA 2QWOA 4F2SA 4YOVA 3TWHA 4BE1A 1QQCA 3THXA 3KLGA 3ZETA 5T7BA 1NK5A 4CEFA 1JL1A 4AF1A 4M3ZA 3MWPA 3SQ4A 4KHNA 1O1WA 3MXIA 2Y1IA 2ZGZA 4JI4K 3BF3A 3ISNC 3RSEA 3OYDA 1TVRA 3P38A 3ZEUA 1K9MO 5GAHP 4GVEA 1UOCA 3CM6A 3QEWA 3PO5A 1V4TA 1NM1A 1JLQA 3NF7A 5AQXA 3SV3A 4FK2A 1SKSA 4CZLA 4FM2A 1RFQA 3CJ1A 2E6MA 1VQ5N 1U2VA 5I9EB 1QSSA 4JKDA 3G25A 4DV2K 1XMOK 3V9UA 4DS4A 3T1AA 1SZ2A 1FXXA 4JKEA 1HKGA 1KCFA 5EVZA 3TTDA 2A3ZA 3M8PA 1BO5O 4FWOA 4FWRA 2V7ZA 4NYFA 3AVHA 4E7IA 3OBYA 4DQIA 4JKCA 4FLZA 4LFAK 4IJAA 1IH7A 5KRSA 4I2PA 3HBTA 4FZZA 4K8ZA 4WFNL 4IJNA 1VQ4N 3MX5A 1C0GA 4A5AA 1LW0A 3TSQA 1EXQA 4BR4A 4ZTJA 3MWTA 4WQ5C 3KD5E 4Y1CA 1YAGA 3KK7A 4OX9K 4H8KA 3S3NA 3TAQA 3KHYA 2HVHA 2P5GA 5CHIA 3CFRA 3C95A 4AM7A 4HUGA 2WC9A 1OH7A 1EETA 3HXMA 2UUAK 4B9SA 1BCMA 5D3GA 2P9IA 3UE5A 3U4LA 2YHYA 3CERA 4BDZA 4KB1A 2FBYA 1NJZA 3WT0A 3EO3A 3CCRN 4OPKA 3CJ9A 3FZKA 4OLBA 2ZE2A 4KRFA 1RBRA 3ULDA 1TKZA 3HPGA 4DV3K 3MX2A 5JVHL 3ZT0A 1MWMA 5C2FA 3CM5A 1B9FA 2RHKA 2QXFA 1S1VA 5IWAK 1ITGA 3KLFA 4DU4A 2YHWA 4CHNA 3G6EN 4BRHA 2D5RA 1OVYA 3CCVN 2E88A 3O9QA 3CJCA 3MXMA 2DTUA 1X1PA 5CY4A 3FR0A 4M3WA 4RW4A 4DV1K 2O8BB 1VSHA 5HBMA 4BREA 1K8KB 1GOBA 4BRFA 3VERA 3E9OA 3IG1A 4BGAA 1K8AO 5FPMA 5GIPA 1ESVA 3RMAA 2ITGA 3D7EO 5HLFA 4HTUA 2DFFA 3TABA 5JS2A 4CIFA 3MN6A 3L2WA 4B9LA 3U9DA 5AFUH 3PUFA 4JI6K 3O3FA 1TL3A 2PBDA 4BR9A 3NBPA 2E2PA 3FGUA 4BR7A 3OS1A 3GG4A 3ZX2A 1G99A 1RDCA 3TAFA 4J2EA 2DPNA 4DU3A 3RR8A 4Z0UA 5AZJA 3MCPA 1IKYA 4DLGA 3NGIA 3C94A 2YNIA 4OGEA 4FLTA 4CHQA 4O8KA 3WXJA 4B9VA 1HNWK 1Z05A 3B8AX 2VWKA 4LF5K 3KVGA 4OPJA 4NYNA 4A59A 5ADXH 1QHAA 4KV8A 3C6AA 1NK9A 2YKMA 3CPWM 3O9UA 1XC3A 4FOIA 4FJNA 3K59A 2QTDA 1QQNA 4JI8K 1HX1A 1S1TA 2NUBA 2BDPA 3K5OA 5C0YA 3B6OA 1BHLA 4N76A 1CZ9A 2OTJN 1QZ5A 3U3YA 3BP8A 3VEYA 4M3XA 4U7BA 1Q86O 3BGRA 2RE2A 4JKGB 3PO4A 3DXMB 3NVMA 5J2QA 1IG8A 3L2VA 4BY9C 3HOTA 2EHGA 3EL2A 1T3VA 4JI1K 1X3NA 3CI5A 3SLCA 2FLOA 4C8KA 1L3TA 3O1WA 4BC4A 2YCHA 3CXCM 4ID1A 5AQNA 1TUUA 1VSKA 4IOAL 3DLKA 3UKRA 5F0XA 3BY5A 4J2DA 3CHWA 4WYBA 1U04A 4IWVA 3O3GA 3HOSA 4FVMA 2ZF5O 4Z4FA 3RMBA 4CECA 1HPZA 1ZYQA 1X9JA 4B9QA 2DFHA 4FWKA 5TKYA 4B1UB 4F3OA 2OTLN 3V9XA 4FXDA 4F3TA 1X3MA 3G4SN 3VF6A 4FYDA 4XH4A 5C42A 4BRDA 5JS1A 3AV9A 1FKOA 3AGRA 1NGDA 1M90O 4BRIA 4MO4A 4PA1A 3VQ5A 3BZKA 5AZIA 3QEPA 3QDKA 4CGGA 1TK5A 4FJ7A 1NJIO 3EKUA 2NRHA 3O8MA 3F9MA 1ATSA 2KZMA 3OVNA 1NGBA 4L3QA 4O8UA 4N56A 1BI4B 2IOCA 1S72N 3HM8A 3OYEA 4NCAA 4LF4K 2HBKA 5AQMA 1RTIA 3QERA 1WBDA 1HNVA 1U6ZA 1EKEA 5JICA 4GV9A 1WSIA 2E1YA 3ZSRA 1IKWA 3O4WA 1D5AA 3SV4A 4KHSA 4U67L 4EP5A 3I56N 2QEXN 3RTVA 3FZMA 3SUQA 1BA1A 4B1VA 1ZC6A 1E4GT 4JD2A 4CF8A 5AQJA 2VYPA 4IOXA 3WXKA 1NU0A 2AP1A 1YJWN 1EWQA 4H5WA 2FC0A 4GVMA 3C6TA 4DSLA 4EFHA 2Q0RA 2XY8A 4EP4A 2D0PA 4JKAA 5M1FA 3P31A 3LALA 4CGHA 3J7AP 1ZBIA 3VA3A 4CEDA 2E5LK 1ZBLA 3NH2A 5KTQA 2A1RA 3UIQA 2Q31A 1IV0A 1REVA 2QA4N 3AVLA 4QS8A 1N33K 1OH6A 3F2KA 3TSPA 3CJBA 3HPOA 1S9EA 4LF7K 3H1QA 4EHTA 1JCGA 1C0FA 1S22A 4LF6K 4FVUA 1RT6A 4KHUA 1XHZA 5K14A 1JLFA 4CGIA 1YJNN 5KQ8A 3G71N 1JLGA 4DF4A 5BPMA 4JRPA 1A5VA 1VSJA 4DV6K 4KO0A 3SPZA 3VPZA 4NLCA 4FWMA 4FLVA 2Z1GA 1VQKN 5CYQA 4B8CA 3OW2M 1WSGA 1WLJA 4HHTA 1VHXA 1ASVA 5FPNA 1XMQK 1W9HA 2XY6A 3M5RA 4JK9A 4FM0A 4XH1A 1VQLN 2P9PA 3VQBA 4AHUA 1T6CA 1I94K 4FJGA 1F21A 4DQQA 3SUOA 2VGNA 4DSKA 3Q7CA 3IMXA 1TL1A 4I9QA 4FJLA 2V52B 5E26A 1P90A 1BDGA 4IKFA 2A42A 3HP9A 3NDKA 3E9LA 5M1PA 3O9SA 3OHRA 3MDQA 5KPTA 4DTRA 4H0PA 2YJFA 5AQTA 3MAQA 3L4QA 5AFUA 4CERA 3I55N 4CEBA 3D2FB 2CGJA 4NB4A 4MQ3A 1JL2A 4IDHA 3WQUA 3OYFA 1JLAA 3L8BA 4BRGA 1LOTB 5JVGL 4DR3K 3QICA 1RDAA 3RWUA 2YNHA 4HUFA 1WN7A 3AA4A 1TGOA 1HLUA 3JXUA 4CJUA 1YHQN 4YDUA 2YX6A 4AILC 1LWEA 1SAZA 1UWBA 3ENBA 3ID6A 3LM2A 5EX5A 4PL8A 3O9RA 1HPMA 3CYMA 4CZKA 2F8TA 3KLEA 1JLBA 2CGKA 3QINA 4K8XA 2D1KA 3PSFA 3OYHA 1FJGK 4FWNA 1WSFA 1ATRA 2KW4A 4DS5A 4M63C 2GUPA 2QKBA 3CC4N 3L2RA 2UUBK 3ULEB 3ZSQA 2NRWA 4K25A 1Q18A 4ELTA 3OJSA 4B9NA 3C6HA 4OKKA 4M3YA 1SV5A 2R7YA 3AA5X 3IS9A 1RT7A 4FJ9A 1MWKA 4KI4A 2BUPA 2YHXA 2GBZA 4YFUA 5HRPA 4FPBA 2UUCK 3LWMA 3V1QA 1Z26A 4BWMA 1RCHA 3MEGA 3O9TA 4MDAA 5KPRA 1NK7A 3C7NA 4UY8O 4Z4EA 4Q5VA 3KD1E 3SJHA 5HL7L 3LL3A 2P9LA 1C1AA 4FJKA 4C8LA 2UU9K 2GUIA 4DTPA 3LANA 2HNYA 2XHBA 4DQSA 1GLEG 3ZT3A 2B5JA 2RF2A 2OPSA 4MDBA 4OO1J 1Z6RA 3AO3A 1BWFO 3MCAB 3MK6A 3HL8A 2IVNA 3AVCA 1L3SA 1C0MA 3WEEA 2VQFK 3HSCA 1ASUA 4CESA 2EWSA 3AA3A 4OPAA 5LMUK 1DTTA 4FJXA 3QBXA 2ITMA 3R8EA 4H5NA 4CJ3A 4K0KK 4K42A 2QW9A 1DLOA 2OZMA 3K2PA 1K73O 2O8DA 3B6PA 4CGJA 1IBLK 3S9HA 3PX6A 1Q9YA 3L6QA 4TSXA 2O8EA 3SMSA 3OBWA 3A5LC 3CCQN 3H08A 1E4FT 1Q8IA 4ISGA 4DR1K 4CF9A 2FSJA 4I6MB 4M7YA 5AQYA 3VGKA 2P9SA 3ATUA 1NGCA 4CJEA 4DFMA 2QWLA 4RTFD 1M1KO 3CQYA 3E9PA 1MA9B 3LDNA 4O4GA 4CF1A 1YT3A 4JHDB 1RILA 2P9UB 3VGLA 3LAKA 4OJRA 4UQGA 4GKJK 4JI7K 3KLHA 5I42A 3WNHA 4CZHA 4E3SA 4I2QA 4RW6A 4DSIA 1SL2A 1MU2A 1J5EK 1ZBSA 2GTDA 2O8CB 3T3FA 2IC3A 2KKZA 1N36K 3DJCA 3THWA 3SI6A 4I7FA 3DAWA 3ALYA 4IEEA 2NRRA 3O4NA 1S6PA 3EZ5A 1J9AA 2FBVA 4BGBA 4BQZA 3PLAA 4CJQA 4W5TA 1R59O 5AQRA 1Y97A 2F9WA 2GEMA 4H0OA 2ZD1A 3P1GA 1H1VA 3EN9A 4DV0K 1HJOA 2VG6A 3S3MA 1U49A 2YV0X 3ATVA 1KC8O 4JS4A 3HM9A 2XRIA 4CZIA 5CYMA 3PIOL 3CFPA 3CMAN 4Q0BA 1VSEA 3OYLA 3LWLA 4C1NK 1QE1A 1JCFA 1S9GA 4AQYK 2Q97A 2EX3A 1WUAA 2HHHK 4KFBA 2F8SA 3RMDA 1KLMA 1VQPN 2Q0UA 1NMNA 4BRNA 5AQVA 2E2QA 2KHOA 5SWMA 2HW3A 2O8FA 1G15A 1EO1A 4C8OA 2D0BA 1B9DA 2GELA 2ATQA 4Z4CA 3A5MC 4AHSA 4FJ5A 2X6NA 1KTQA 2ZWHA 2E4LA 2IIRA 1RTDA 5E41A 1KVBA 4PWDA 1HNIA 4CBXA 3NCIA 4WFAL 1ZBUA 5KQDA 4XIUA 1OVQA 3KKRA 3LP2A 1GLJO 3TAPA 2FBTA 3SQ1A 3QNOA 3RR7A 2W41A 2HBLA 4WE1A 2ASOA 3QEXA 1IO2A 3NF8A 3ZSOA 1QHTA 4MLHA 4BG9A 3AVBA 1KAZA 2PAVA 4QCLA 1U4BA 3AVKA 3VTIA 4WFBL 3AARA 4H5VA 1CLQA 4H4OA 1NGIA 4NXMK 4JI2K 2HMPA 1NJXA 3VF2A 3OYAA 4DTSA 1T44A 3O3HA 3I0RA 3V4IA 1TYQB 1QVGM 3D2EB 2QWRA 3ZCMA 3K0SA 2E2OA 3N4PA 4FJJA 2O4GA 1FK9A 1XQSC 4PHTX 1WSJA 2ZJQL 4CJVA 3SK3A 1XUPO 2Z1HA 2B4JA 3A8YA 3AVNA 1C6VA 5AQOA 2OPQA 4CFDA 4BC3A 1VQMN 3TAGA 1WSHA 3VOVA 2O4IA 1RNHA 1RTJA 4FWQA 4EZ6A 5BRHA 3RVCA 1D9DA 4K41A 4B1WB 1IBMK 1EP4A 5C2DA 2IVPA 1BIZA 3AO4A 1RGIA 4RWTA 3LP1A 4AHVA 2IAJA 5AQPA 4DR7K 2QXLA 2P1JA 3TAMA 1NMDA 2YNGA 1TK8A 1Q82O 1L3UA 4C8NA 4CFAA 1IKVA 5BPLA 1NKCA 2YI1A 4ILHA 1BL3A 3CJAA 4ISEA 4C1NI 1KVCA 3CFOA 1L3VA 4JEPA 4YNQA 3CJ7A 4YOTA 3VQ4A 4Z94A 1LW2A 1NG9A 4A61A 4NCGA 3KLIA 1ZBHA 3RRHA 3HT3A 2GX9A 1YF5L 4HTLA 1J53A 3WNEA 4DG1A 2W6KA 1WOQA 2KFNA 3THYB 4C23A 3GBTA 3AVJA 2O8BA 3V1OA 1K8KA 1KLNA 3MEDA 5LJWA 1HYVA 4N47A 4CEQA 2P9KB 4YY3K 3ZSYA 3A2FA 3FFKB 1CXUA 4CHOA 3C65A 4JKFA 2G8UA 4KHWA 1NNEA 4JKHA 4BDPA 1QS4A 3QESA 5MLCQ 4DR2K 1I3AA 4FLUA 1D8YA 1GOAA 2P51A 2V7YA 3L4IA 3UKUB 4FSVA 4CBUA 2Q1NA 2UYTA 4IBNA 4CK3A 3PY8A 5CZ1A 4DQRA 4PUOA 2WONA 4OGCA 3SUNA 4JS5A 4ILGB 4IOCL 2ASMA 3CC2N 3ASMA 2NRTA 3AVAA 3TAEA 4KHYA 3FZHA 4FW2A 4OLAA 2GV9A 3K9JA 3D0PA 2QI2A 1RBUA 4QS9A 5IT9O 4X64K 1S3XA 2Q3SA 3FE1A 2FF6A 5GAGP 3M8SA 5BRFA 2VQEK 3LZJA 2ZJRL 1GOCA 2HHWA 5GINA 4QOZB 3A0IX 4FWPA 3HZ6A 1RBTA 4LFCK 1SQKA 3I8BA 1FKPA 2OPRA 2ZQBA 4XH5A 3OYMA 1QSLA 1SS6A 2YNFA 4CHYA 2CH5A 4YOUA 4JNEA 1NK4A 5AQKA 1A5XA 3VEVA 4JI0K 3AAPA 1RDUA 1J6ZA 3CMEN 1C0UA 1HJRA 1QVFM 3VTHA 2PY5A 4B1YB 3EEQA 3J80O 3TPQA 4M3UA 1E3MA 4Z4IA 3P5JA 3U9ZA 4LD0A 2IS3A 5BR9A 2XY7A 1VSLA 1GLLO 1KD1O 1EWRA 2ZGYA 4JKGA 4LSNA 1W97L 3DXMA 3KJVA 5AQWA 3AVFA 1XWLA 1BQMA 1JKHA 3PX4A 1KAYA 4JK8A 5GIOA 2KLAA 4KTZA 3OYBA 3EE8A 1IJJA 4IO8A 1NK6A 4W5QA 1GLDG 5F2RA 3CCJN 1T03A 1ZBFA 2E8AA 2IGIA 1KVAA 1EX4A 4DFPA 4KH4A 3M1FA 2X6SA 3OA9A 2P9NB 1TUYA 2ZJPL 1RT5A 1YTAA 2WUSA 3TANA 2P9KA 3H45C 5F1XA 4GKKK 2HHUA 1C1BA 3J8AA 1U47A 1Q7YO 1XNRK 3MMVA 4JI5K 3JS6A 2WBNA 3WXIA 5BREA 2G8HA 4WCEL 3PSIA 4ISFA 1HYZA 3SZ2A 3L3UA 1K6YA 5FRNA 3K58A 1TKDA 1VAZA 4EHUA 3L2QA 4B3OA 3FLCO 5EY4A 4BRQA 5KGWA 2VG5A 1JXBA 4CIGA 1DT9A 3DLHA 3NHGA 1KFDA 5GAEP 1HQEA 4DTUA 1R0AA 4FZYA 2JLEA 3DXKB 2VG7A 4IDKA 1LV5A 4HWIA 2WOMA 4KBOA 4CZFA 4B3RK 1S6QA 1BI4A 4IZ9A 3MXJA 1QZ6A 4BRKA 4CGFA 3DLLL 2FBXA 3HYFA 3SBTA 2HF3A 3HJFA 3F5TA 2HHTA 4EZ9A 3J7YP 1W7AA 1W0HA 2A1SA 2VWBA 4PY5A 4KH5A 3NF6A 4IG3A 2W42A 1LAVA 3IFRA 1ATNA 2NRZA 2GWKA 3VENA 2YHBA 3K5LA 3SNNA 1WNSA 1EQYA 3GE1A 1LWCA 2I5JA 3P83D 2F4VK 5KI6A 5AQHA 3HO1A 2Q2RA 1NJYA 3QO9A 4A2AA 5AQUA 3LP0A 1GLCG 1YUWA 1RT2A 2WTUA 3SPYA 4IFEA 3QIPA 3ZYYX 4CW7B 3Q7BA 1BUPA 4IO9L 3QFUA 3LPTA 3VQDA 4BACA 4EIAA 5JLHA 2AA4A 5AJ3K 4O5BA 3CCSN 3GL1A 4FJIA 3M8RA 4A62A 2HHSA 3THXB 3ZETB 4CJLA 4FLWA 2I7NA 3DRPA 5KGXA 3HK2A 5LL6Z 1T7PA 1SL1A 3UB5A 1NWKA 2P9NA 3CIPA 4JN4A 1NGAA 4Y1DA 3RSEB 3SUPA 1TV6A 3ZLJA 3ZT2A 3HVTA 3DOLA 4E7LA 1U45A 1DKGD 4FOEA 4J2AA 3VA0A 4DTOA 3WNGA 2HMIA 1RT3A 4HUEA 1NLVA 1NGJA 1NJWA 4QS7A 2HOEA 1CZBA 1U2VB 2DFEA 4CZGA 3VGMA 1HR0K 1HUXA 3DLGA 2IDOA 5KRTA 3AO1A 5DK5A 4BC2A 2OCEA 4JRQA 4K43A 1NKBA 4R5PA 4BROA 1NGHA 4IG0A 4FWLA 1L5UA 5C15A 3GOIA 1SKWA 4FJHA 4CJFA 3LM9A 4DHYA 4BE0A 3ZSWA 2A5XA 3VEOA 3VQ9A 4BRPA 4E7KA 1RDBA 2HNZA 2Q36A 1JCEA 3HRGA 1RBVA 5AR0A 2HBMA 4OKEA 4CJTA 3T1YK 5HP1A 3QETA 4CF2A 3SQ2A 4CBWA 4H0XB 1YI2N 3ZX3A 1YXQA 3NMUA 1J5OA 4AH9A 3M3ZA 4CIEA 3JYTA 1V4SA 2P9IB 3QIOA 2OYQA 3D2FA 2VWJA 1TAUA 4O0JA 4FJMA 5HRSA 2I7PA 1YTUA 2NLXA 3ZT4A 4PL7A 1KQSM 3T69A 3E1YA 3KK2A 3ID8A 3CF5L 3IAYA 4DQ8A 2UXBK 4X65K 1A5WA 4H0TB 3V9WA 4CJ7A 5H1SQ 3NAEA 3OS2A 3DLEA 3AY9A 4EAHD 2YHAA 1UAXA 2E2NA 5CZ2A 3NVKA 1J54A 5J2MA 4M41A 1HYSA 3CG7A 1IG9A 1ILYA 1VQNN 2ASPA 5GADP 3D45A 3NGZA 2PZSA 1WSEA 1YJ9N 3EE9A 1UA0A 4MFBA 5JLFA 5SZTA 5HROA 1N6QA 4AHRA 4BRMA 3VETA 3ULEA 4E1JA 4LY7A 4F2RA 4M42A 2BTFA 4BRCA 1VQ8N 5B8HA 1Z25A 2AJQA 3KK3A 4W5RA 3DI6A 1QSYA 5EU7A 3QMLA 3HVRA 1QQMA 1LCUA 2W40A 2RKIA 4DMNA 1TAQA 4H4MA 5TKWA 2A40A 4BG8A 3P39A 4X66K 4FCYA 3R6MA 4GV6A 5BR8K 4JK7A 4GMJB 1GLBG 3LZIA 1BG3A 3LPUA 4DSJA 3KWIA 4KTWA 2HHQA 2PYLA 4YOXA 4QAGA 4FPAA 4BDYA 4CFBA 5AZJB 3DYAA 3OS0A 1YIJN 3DOKA 3DMJA 2OZSA 4OPHA 4ZTFA 3NF9A 3MN7A 4E1NA 4ELUA 3OY9A 4DFKA 3T7ZA 3QFPA 3R9PA 3OYJA 4DU1A 1OH8A 5DM7L 4FL9A 3BDPA 4E1MA 3MEEA 3DM2A 4DQPA 3H6EA 2Z1IA 3TU5A 4CD3A 2KFZA 4DV4K 4YDUC 1XI1A 4GW6A 2NNWA 4N41A 4RW9A 1T8EA 4H5RA 4Z4HA 2NZTA 3VQPA 3DLRA 2RN2A 3QEVA 3O08A 3T19A 4CJ4A 4DFJA 5BPNA 1VQON 4A2BA 4W5NA 2X74A 4I9LA 3E01A 3CCEN 3SAFA 1S1WA 2BANA 4I6MA 5AQGA 4J8FA 4DUZK 3RRGA 4YOWA 4H5TA 1HKCA 3V9SA 3AAQA 1VQ6N 4J2BA 4WQ4A 2D0AA 3WXLA 3TTFA 1OH5A 5HRRA 1X9SA 5M1KA 2UXDK 2E20A 4N5SA 4DV5K 3DLBA 4KHQA 3ENHA 3QB0A 3GDQA 3UKRB 4DV7K 1S1XA 2YKNA 3EYZA 4JHDA 2P9UA 4M45A 4E7HA 4AHTA 2WFBA 4CZJA 3TI0A 3FZLA 4DTMA 4Z4GA 3ZX0A 2Y1JA 1RDWX 3AVIA 3EKSA 4BQLA 2G8FA 2O8CA 3EZWA 3MN5A 2ZM6K 2GWJA 4CEZA 1N34K 3VQ8A 5C25A 5FPEA 5AQSA 1NKEA 4GNIA 4PKHA 4BR2A 2PFUA 3SBGA 5AQQA 3KIOA 4C8MA 1Y64A 3L2UA 1VSMA 3E66A 3TSUA 3K9KA 3NH1A 1CXQA 4FJ8A 1BOTO 4FLYA 4KAZA 3VQ7A 1XHXA 5AQIA 5FLXO 3U6FA 3LAMA 4G1QA 2B6AA 1BA0A 4AM6A 1LAWA 5AZIB 1ASWA 1ZXOA 3QEIA 3VESA 3PV8A 4CEEA 4O5FA 3H1VX 2HB5A 3C0BA 3W0LA 4CD1A 3KTQA 2G8WA 4RCHA 4RG8A 1N5YA 2BE2A 2UXCK 3H46O 1HNXK 3LDOA 3AVMA 5C12A 4B3TK 4JYAK 3TARA 4AHCA 5EOYA 3QLHA 4BE2A 4ZHRA 3U3GA 4O44A 3FFIA 4DB3A 3CPEA 5C10A 2D0OA 3S41A 4CF0A 4BC5A 4DSFA 4CJ5A 1W2BM 4FZXC 4JD2B 5EXWA 2VGMA 3TR8A 4E19A 2P5OA 1VQ9N 2X78A 3AO5A 3KWGA 1KFSA 3G10A 1XC9A 1RT4A 4OKJA 1NGEA 4CFCA 2RPIA 4B8AB 5JMVA 1VQ7N 1UA1A 4B1ZA 4DTXA 4IXCA 4ELVA 4OVLA 1P8ZA 1HRHA 4DR4K 3QNNA 2E6LA 4FO0A 3P4IA 4HCCA 4G9ZA 1LWFA 1QQOA 4DWIA 1VSFA 3CCUN 1IBKK 2G8KA 1I39A 1TK0A 5AQFA 4CEOA 4E89A 1TYQA 3M6GA 1U48A 2FXUA 3TTCA 3D2EA 3A5NC 1VK0A 3DWLA 5HRNA 2HVIA 4BVPA 3VQEA 1GLFO 5ELZA 2HNDA 1JLCA 1B92A 2H3GX 1JXEA 4Y0WA 3M8QA 1Q81O 2HHVA 4JKBA 3O1BA 5AQZA 2W6LA 5HOOA 4CK1A 3R3LA 4FW1A 1WB9A 3DRSA 4CJWA 3HSTB 3WUHA 4LH4A 2DY4A 3ZSVA 4ILJA 3KK1A 2D4WA 2P9PB 4NCBA 4LC9B 3VMFB 3EY1A 3NFAA 2OPPA 3I33A 3V1RA 3SYZA 3V81A 3VF4A 3CETA 1T05A 2QK9A 2KQ2A 4CJSA 4CEAA 3HI0A 3QBWA 3NE6A 3MN9A 1NK8A 3LP3A 4CHPA 3WXMB 4B08A 3H3OB 1JLEA 4DKWA 4DTJA 1C0TA 4HVJA 1RBSA 5LY3A 3VQ6A 1VRUA 3H3NO 3LDSA 3VEWA 1NK0A 3DRRA 3L0QA 3VEZA 3THVA 5E84A 4M7XA 4CJRA 4H0YB 3ZT1A 1KSPA 3D6RA 1HKBA 3HTVA 3IDHA 4NLBA 4WQ4C 4BVOA 4IFYA 4E0DA 5CR4A 2XY5A 4A5BA 1WAFA 1DTQA 3ENOA 5FROA 3THYA 2LSNA 3ZSXA 3R1XA 3RMCA 2HF4A 2HBJA 2D0CA 5C24A 5M1QA 1TKXA 1CZAN 3W3DA 3CQXA 4BR0A 4BRAA 4KI6A 4L8RB 1GLAG 2QWMA 4MO5A 2FF3B 3T1HK 3V6DA 4O55A 3I8DA 3UKUA 4LSLA 3K5MA 1S1UA
chains in the Genus database with same CATH topology
3RMDA 4IG0A 4CGDA 1L5UA 2KZZA 1KLMA 4FK4A 4ID1A 5FDLA 5SWMA 1SKWA 2HW3A 1G15A 4FJHA 4C8OA 1VRTA 2D0BA 4CJFA 1BQNA 1VSKA 4CCHA 1B9DA 4F4KA 4BE0A 2ATQA 3ZSWA 1VSDA 2BGGA 3DLKA 4Z4CA 3SQ0A 4AHSA 4FJ5A 2X6NA 1KTQA 3VQ9A 4F8RA 2E4LA 4J2DA 4E7KA 1RTDA 3SJJA 5E41A 1KVBA 1RDBA 2HNZA 2QKKA 4FK0A 4PWDA 1HNIA 1U04A 1RBVA 3O3GA 4FVMA 4OKEA 4Z4FA 3NCIA 4CJTA 3RMBA 5HP1A 3QETA 1ZBUA 1HPZA 4CECA 4XIUA 4CF2A 1ZYQA 3SQ2A 3LP2A 3KKRA 3TAPA 2FBTA 3SQ1A 3QNOA 4CHZA 2DFHA 3AVGA 3RR7A 1J5OA 4AH9A 3JYTA 4CIEA 1SL0A 3QIOA 4F3OA 2OYQA 4WE1A 3V9XA 3QEXA 1IO2A 3NF8A 3ZSOA 2VWJA 1QTMA 4F3TA 4FXDA 4O0JA 1TAUA 4FJMA 5HRSA 3ZSZA 1YTUA 1QHTA 3ZT4A 3WNFA 3JSMA 3AVBA 4FYDA 3KK2A 4QCLA 5C42A 3PX0A 4DSJA 5JS1A 3AV9A 1FKOA 3IAYA 4HCBA 1A5WA 1U4BA 3V9WA 3AVKA 4M3YA 3SCXA 3NAEA 3OS2A 4PA1A 4DLEA 3VQ5A 3DLEA 4H4OA 1CLQA 2HHXA 4LH5A 2YHAA 3QEPA 1UAXA 4CGGA 1TK5A 4FJ7A 5CZ2A 1J54A 3F73A 5J2MA 2KZMA 3OVNA 1C1CA 4M41A 1NJXA 3CG7A 3OYAA 4DTSA 1HYSA 3O3HA 3I0RA 3HP6A 3V4IA 1IG9A 4ID5A 4RW7A 4N56A 1BI4B 2IOCA 3HPHA 3OYEA 1HQUA 4NCAA 3D45A 4KREA 3ZCMA 3OYCA 1RTIA 3QERA 3NGZA 2PZSA 1WSEA 4FJJA 1HNVA 1RT1A 2O4GA 1SUQA 1UA0A 4MFBA 5SZTA 1FK9A 1EKEA 1NOZA 4M3RA 5HROA 4AHRA 1X9WA 1N6QA 1WSIA 1WSJA 3ZSRA 1IKWA 4LY7A 1TKTA 4CJVA 3V9ZA 4F2RA 4M42A 2Z1HA 2B4JA 4CJPA 1D5AA 3OYNA 3AVNA 1Z25A 1C6VA 3SV4A 4KHSA 2AJQA 2XO7A 2OPQA 4KB0A 1S5JA 4CFDA 4EP5A 3KK3A 4W5RA 1BGXT 4B9TA 3F9KA 3DI6A 1QSYA 3OJUA 3TAGA 3OYGA 5EU7A 4KKOA 3HVRA 3RTVA 1WSHA 3SUQA 2O4IA 1RNHA 1RTJA 4EZ6A 2RKIA 4DMNA 1TAQA 1D9DA 4H4MA 2OA8A 4CF8A 4B9UA 4M3TA 1EP4A 4FCYA 1BIZA 3AO4A 1X9MA 2FC0A 4GVMA 4JLHA 3CQ8A 3G0ZA 3C6TA 4GMJB 1BIUA 4DSLA 1KRPA 4CJKA 3LZIA 3LPUA 5I3UA 3NH0A 2XY8A 4B9MA 3AA2A 3LP1A 4KTWA 1VSIA 4AHVA 1BCOA 2IAJA 4EP4A 2PYLA 2HHQA 4C8KA 2P1JA 4QAGA 1BISA 4BDYA 3LALA 3ITHA 3TAMA 4CFBA 2YNGA 3DYAA 1TK8A 4CGHA 1SKRA 3VN5A 4C8NA 4CFAA 1IKVA 3OS0A 1L3UA 1ZBIA 2G8IA 4FLXA 1NKCA 3VA3A 3KKSA 3DOKA 4CEDA 4KPYA 1BL3A 3C6UA 3K5NA 4BWJA 1ZBLA 4KTQA 3DMJA 2OZSA 3NH2A 5KTQA 2A1RA 3UIQA 2Z1JA 1YVUA 4ZTFA 3NF9A 1REVA 4O0IA 3AVLA 1KVCA 4E1NA 3MECA 2F96A 3CFOA 2G8VA 1L3VA 4ELUA 3OY9A 4FM1A 4DFKA 4YNQA 3HPOA 1S9EA 3VQ4A 3OYJA 2JGUA 1LW2A 4DU1A 3VQAA 3VQQA 4NCGA 3KLIA 3O4QA 5J2PA 3BDPA 4E1MA 1ZBHA 4DTNA 3RRHA 3HT3A 3MEEA 1Q9XA 1RT6A 4KHUA 1XHZA 5K14A 3AO2A 1J53A 3DM2A 1JLFA 3WNEA 2Z1IA 1RDDA 4CGIA 4DG1A 4ICLA 4DQPA 2KFNA 2KFZA 1JLGA 2KTQA 4DF4A 4CE9A 5FRMA 1XI1A 3AVJA 4E7JA 4GW6A 4N41A 3V1OA 4RW9A 1T8EA 4JRPA 1A5VA 4DSEA 1KLNA 4Z4HA 1VSJA 3MEDA 1HMVA 2ETJA 1HYVA 4N47A 3VQPA 3DLRA 2RN2A 3QEVA 4KO0A 3T19A 4DFJA 4CJ4A 4CEQA 3SPZA 3ZSYA 3A2FA 1WAJA 1CXUA 4FLVA 3S3OA 4CHOA 4W5NA 2Z1GA 5CYQA 4B8CA 2G8UA 1WSGA 1WLJA 2X74A 4I9LA 4KHWA 4HHTA 3OYIA 4BDPA 4RW8A 1ASVA 1W9HA 4W5OA 2XY6A 1QS4A 3QESA 3E01A 1L3TA 4FM0A 1I3AA 1S1WA 2BANA 4FLUA 1GOAA 2P51A 1D8YA 3RRGA 3VQBA 4AHUA 4FJGA 1F21A 3OYKA 3V9SA 3K57A 4DQQA 4IBNA 4CK3A 4J2BA 3PY8A 2PYJA 5CZ1A 4DQRA 2D0AA 3SUOA 4PUOA 2WONA 4PQUA 1RTHA 3I0SA 1NOYA 4OGCA 5HRRA 3L3VA 4CK2A 3SUNA 4DF8A 4JS5A 4IFVA 1X9SA 3NGYA 4DSKA 4N5SA 3IRXA 3VQCA 5DMRA 5J2NA 3DLBA 4KHQA 3ASMA 5J1EA 3AVAA 3TAEA 1TL1A 1IKXA 1S1XA 2YKNA 3EYZA 4FJLA 4I9QA 4KHYA 4FW2A 4OLAA 2GV9A 4M45A 4IKFA 3HP9A 4AHTA 3D0PA 3NDKA 4E7HA 4F2SA 3TWHA 4BE1A 1QQCA 3TI0A 3KLGA 5T7BA 1RBUA 4DTMA 1NK5A 4CEFA 4Z4GA 1JL1A 2Y1JA 4M3ZA 3SQ4A 4KHNA 3AVIA 2Q3SA 1O1WA 3M8SA 2G8FA 3MXIA 2Y1IA 4CEZA 4DTRA 3VQ8A 5C25A 3LZJA 1GOCA 3MAQA 3ISNC 2HHWA 4CERA 4QOZB 3OYDA 1NKEA 4CEBA 1RBTA 1TVRA 1FKPA 2OPRA 2ZQBA 3OYMA 1QSLA 1UOCA 3CM6A 4MQ3A 3KIOA 3QEWA 3PO5A 1JL2A 2YNFA 4C8MA 4CHYA 3L2UA 3OYFA 1JLAA 3L8BA 1VSMA 1JLQA 3NF7A 3NH1A 3SV3A 1NK4A 1CXQA 4FJ8A 1A5XA 4FK2A 1SKSA 1RDAA 3RWUA 2YNHA 4FLYA 4KAZA 3VQ7A 4HUFA 4FM2A 1WN7A 1XHXA 1C0UA 3AA4A 1HJRA 1TGOA 4CJUA 2E6MA 3U6FA 2PY5A 3LAMA 4G1QA 2B6AA 4M3UA 4AILC 1LAWA 1LWEA 1UWBA 1QSSA 4Z4IA 3P5JA 1ASWA 4LD0A 3V9UA 2IS3A 4DS4A 2XY7A 1VSLA 3T1AA 1FXXA 4LSNA 3QEIA 1KCFA 3PV8A 4CEEA 3KJVA 3CYMA 3AVFA 3M8PA 1XWLA 2F8TA 2HB5A 1JLBA 3KLEA 1BQMA 1JKHA 4NYFA 3AVHA 3QINA 4E7IA 3PX4A 3KTQA 4K8XA 2G8WA 4DQIA 4KTZA 3OYHA 4FLZA 4RG8A 1WSFA 2KW4A 3OYBA 4DS5A 1N5YA 1IH7A 5KRSA 2BE2A 4I2PA 2QKBA 1D9FA 4FZZA 3L2RA 1NK6A 4K8ZA 4W5QA 3AVMA 3ZSQA 3TARA 4AHCA 3QLHA 3OJSA 4BE2A 4B9NA 1LW0A 4ZHRA 4OKKA 4O44A 1EXQA 3U3GA 3FFIA 1ZBFA 2IGIA 4ZTJA 1T03A 3KD5E 4Y1CA 1KVAA 1SV5A 1EX4A 2R7YA 3AA5X 4DFPA 3IS9A 2X6SA 5FRNA 4CF0A 4DSFA 1RT7A 4CJ5A 4FJ9A 4H8KA 4KI4A 3S3NA 1RT5A 3TAQA 1YTAA 4FZXC 2GBZA 2HVHA 2P5GA 3TANA 3TR8A 4YFUA 4E19A 5HRPA 3CFRA 3C95A 2X78A 3AO5A 4HUGA 2P5OA 3LWMA 3V1QA 1Z26A 1C1BA 4BWMA 1KFSA 2HHUA 1U47A 1RCHA 1EETA 3G10A 1XC9A 3MEGA 3HXMA 4B9SA 1NK7A 1BCMA 5D3GA 1RT4A 4OKJA 4CFCA 4Z4EA 2RPIA 4Q5VA 2G8HA 3KD1E 4BDZA 4B8AB 4KB1A 2FBYA 1NJZA 1HYZA 1UA1A 3SZ2A 1C1AA 1K6YA 3L3UA 4OPKA 3K58A 4DTXA 4C8LA 4FJKA 2GUIA 2ZE2A 4ELVA 1TKDA 4OLBA 4DTPA 3L2QA 4B3OA 4KRFA 1RBRA 3ULDA 1TKZA 3HPGA 3LANA 5KGWA 4OVLA 1HRHA 2HNYA 2VG5A 3ZT0A 2E6LA 1JXBA 2XHBA 4DQSA 3QNNA 4CIGA 4HCCA 3ZT3A 3DLHA 2B5JA 3CM5A 1B9FA 1LWFA 2RF2A 1KFDA 2OPSA 1HQEA 3NHGA 4DTUA 1R0AA 2JLEA 4DWIA 4FZYA 2QXFA 1S1VA 3AO3A 1ITGA 1VSFA 2VG7A 4IDKA 3KLFA 4DU4A 1LV5A 2G8KA 2WOMA 3HL8A 3AVCA 4CHNA 1I39A 1TK0A 1L3SA 4CEOA 1C0MA 4E89A 1S6QA 1U48A 2D5RA 1BI4A 3MXJA 1ASUA 4CESA 4CGFA 3AA3A 1VK0A 2FBXA 5HRNA 3HYFA 3MXMA 2HVIA 1DTTA 3HJFA 1X1PA 3VQEA 5CY4A 4EZ9A 4FJXA 4M3WA 2HHTA 2DTUA 4RW4A 1VSHA 1W0HA 2HNDA 5HBMA 1JLCA 1GOBA 2A1SA 4CJ3A 1B92A 1JXEA 4PY5A 3IG1A 1DLOA 3M8QA 2OZMA 3K2PA 3NF6A 4IG3A 2W42A 1LAVA 3RMAA 2HHVA 2ITGA 5HLFA 4HTUA 2DFFA 3B6PA 4CGJA 4CK1A 2YHBA 3K5LA 3TABA 3SNNA 4FW1A 5JS2A 1WNSA 3PX6A 3S9HA 1Q9YA 4CIFA 3DRSA 4TSXA 1LWCA 2I5JA 3P83D 4CJWA 3L2WA 3HSTB 4B9LA 5KI6A 4LH4A 3PUFA 3HO1A 1NJYA 3O3FA 3H08A 2DY4A 3QO9A 1Q8IA 1TL3A 3ZSVA 4CF9A 3LP0A 3NBPA 3KK1A 4NCBA 3OS1A 1RT2A 3EY1A 3NFAA 2OPPA 1RDCA 3TAFA 4CJEA 3SPYA 4J2EA 3V1RA 3SYZA 4DU3A 3QIPA 4DFMA 3V81A 1T05A 2QK9A 2KQ2A 4CJSA 3RR8A 4CEAA 3NE6A 3LPTA 4Z0UA 1NK8A 3VQDA 4BACA 3LP3A 4O4GA 4ELTA 4CHPA 1IKYA 4DLGA 4CF1A 3NGIA 4B08A 1YT3A 4O5BA 3C94A 2YNIA 1JLEA 1RILA 4DTJA 3LAKA 4OJRA 4OGEA 4UQGA 1C0TA 4HVJA 4FJIA 3M8RA 4FLTA 4CHQA 3KLHA 5I42A 1RBSA 3VQ6A 3WNHA 1VRUA 3LDSA 2HHSA 4E3SA 1NK0A 4CJLA 4B9VA 3DRRA 4FLWA 4I2QA 4RW6A 3THVA 3DRPA 5KGXA 1MU2A 1SL2A 4DSIA 3HK2A 1T7PA 2VWKA 4CJRA 1SL1A 3T3FA 2IC3A 3ZT1A 4OPJA 1KSPA 4NYNA 4KV8A 4Y1DA 3SUPA 1NK9A 4IFYA 1TV6A 3SI6A 2YKMA 4I7FA 3ZT2A 4E0DA 2XY5A 3ALYA 1WAFA 3DOLA 3HVTA 4E7LA 1DTQA 4FJNA 1U45A 3O4NA 3K59A 1S6PA 5FROA 4J2AA 2LSNA 3ZSXA 3EZ5A 1J9AA 3VA0A 2FBVA 4DTOA 3WNGA 2HMIA 1S1TA 1RT3A 2NUBA 4HUEA 4CJQA 3K5OA 4W5TA 2BDPA 3RMCA 1Y97A 2ZD1A 1BHLA 3B6OA 3P1GA 4N76A 1NJWA 1CZ9A 2D0CA 5C24A 1CZBA 1TKXA 2DFEA 3U3YA 2VG6A 3S3MA 1U49A 2YV0X 4JS4A 4M3XA 3HM9A 3DLGA 2IDOA 5KRTA 3AO1A 4KI6A 3BGRA 5DK5A 2XRIA 5CYMA 3CFPA 3PO4A 4L8RB 4JRQA 5J2QA 3L2VA 1NKBA 4R5PA 1VSEA 3OYLA 2EHGA 3LWLA 4Q0BA 1QE1A 1S9GA 3V6DA 4O55A 2EX3A 3I8DA 4KFBA 4LSLA 2F8SA 3K5MA 1S1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMD A;  4IG0 A;  4CGD A;  1L5U A;  2KZZ A;  1KLM A;  4FK4 A;  4ID1 A;  5FDL A;  5SWM A;  1SKW A;  2HW3 A;  1G15 A;  4FJH A;  4C8O A;  1VRT A;  2D0B A;  4CJF A;  1BQN A;  1VSK A;  4CCH A;  1B9D A;  4F4K A;  4BE0 A;  2ATQ A;  3ZSW A;  1VSD A;  2BGG A;  3DLK A;  4Z4C A;  3SQ0 A;  4AHS A;  4FJ5 A;  2X6N A;  1KTQ A;  3VQ9 A;  4F8R A;  2E4L A;  4J2D A;  4E7K A;  1RTD A;  3SJJ A;  5E41 A;  1KVB A;  1RDB A;  2HNZ A;  2QKK A;  4FK0 A;  4PWD A;  1HNI A;  1U04 A;  1RBV A;  3O3G A;  4FVM A;  4OKE A;  4Z4F A;  3NCI A;  4CJT A;  3RMB A;  5HP1 A;  3QET A;  1ZBU A;  1HPZ A;  4CEC A;  4XIU A;  4CF2 A;  1ZYQ A;  3SQ2 A;  3LP2 A;  3KKR A;  3TAP A;  2FBT A;  3SQ1 A;  3QNO A;  4CHZ A;  2DFH A;  3AVG A;  3RR7 A;  1J5O A;  4AH9 A;  3JYT A;  4CIE A;  1SL0 A;  3QIO A;  4F3O A;  2OYQ A;  4WE1 A;  3V9X A;  3QEX A;  1IO2 A;  3NF8 A;  3ZSO A;  2VWJ A;  1QTM A;  4F3T A;  4FXD A;  4O0J A;  1TAU A;  4FJM A;  5HRS A;  3ZSZ A;  1YTU A;  1QHT A;  3ZT4 A;  3WNF A;  3JSM A;  3AVB A;  4FYD A;  3KK2 A;  4QCL A;  5C42 A;  3PX0 A;  4DSJ A;  5JS1 A;  3AV9 A;  1FKO A;  3IAY A;  4HCB A;  1A5W A;  1U4B A;  3V9W A;  3AVK A;  4M3Y A;  3SCX A;  3NAE A;  3OS2 A;  4PA1 A;  4DLE A;  3VQ5 A;  3DLE A;  4H4O A;  1CLQ A;  2HHX A;  4LH5 A;  2YHA A;  3QEP A;  1UAX A;  4CGG A;  1TK5 A;  4FJ7 A;  5CZ2 A;  1J54 A;  3F73 A;  5J2M A;  2KZM A;  3OVN A;  1C1C A;  4M41 A;  1NJX A;  3CG7 A;  3OYA A;  4DTS A;  1HYS A;  3O3H A;  3I0R A;  3HP6 A;  3V4I A;  1IG9 A;  4ID5 A;  4RW7 A;  4N56 A;  1BI4 B;  2IOC A;  3HPH A;  3OYE A;  1HQU A;  4NCA A;  3D45 A;  4KRE A;  3ZCM A;  3OYC A;  1RTI A;  3QER A;  3NGZ A;  2PZS A;  1WSE A;  4FJJ A;  1HNV A;  1RT1 A;  2O4G A;  1SUQ A;  1UA0 A;  4MFB A;  5SZT A;  1FK9 A;  1EKE A;  1NOZ A;  4M3R A;  5HRO A;  4AHR A;  1X9W A;  1N6Q A;  1WSI A;  1WSJ A;  3ZSR A;  1IKW A;  4LY7 A;  1TKT A;  4CJV A;  3V9Z A;  4F2R A;  4M42 A;  2Z1H A;  2B4J A;  4CJP A;  1D5A A;  3OYN A;  3AVN A;  1Z25 A;  1C6V A;  3SV4 A;  4KHS A;  2AJQ A;  2XO7 A;  2OPQ A;  4KB0 A;  1S5J A;  4CFD A;  4EP5 A;  3KK3 A;  4W5R A;  1BGX T;  4B9T A;  3F9K A;  3DI6 A;  1QSY A;  3OJU A;  3TAG A;  3OYG A;  5EU7 A;  4KKO A;  3HVR A;  3RTV A;  1WSH A;  3SUQ A;  2O4I A;  1RNH A;  1RTJ A;  4EZ6 A;  2RKI A;  4DMN A;  1TAQ A;  1D9D A;  4H4M A;  2OA8 A;  4CF8 A;  4B9U A;  4M3T A;  1EP4 A;  4FCY A;  1BIZ A;  3AO4 A;  1X9M A;  2FC0 A;  4GVM A;  4JLH A;  3CQ8 A;  3G0Z A;  3C6T A;  4GMJ B;  1BIU A;  4DSL A;  1KRP A;  4CJK A;  3LZI A;  3LPU A;  5I3U A;  3NH0 A;  2XY8 A;  4B9M A;  3AA2 A;  3LP1 A;  4KTW A;  1VSI A;  4AHV A;  1BCO A;  2IAJ A;  4EP4 A;  2PYL A;  2HHQ A;  4C8K A;  2P1J A;  4QAG A;  1BIS A;  4BDY A;  3LAL A;  3ITH A;  3TAM A;  4CFB A;  2YNG A;  3DYA A;  1TK8 A;  4CGH A;  1SKR A;  3VN5 A;  4C8N A;  4CFA A;  1IKV A;  3OS0 A;  1L3U A;  1ZBI A;  2G8I A;  4FLX A;  1NKC A;  3VA3 A;  3KKS A;  3DOK A;  4CED A;  4KPY A;  1BL3 A;  3C6U A;  3K5N A;  4BWJ A;  1ZBL A;  4KTQ A;  3DMJ A;  2OZS A;  3NH2 A;  5KTQ A;  2A1R A;  3UIQ A;  2Z1J A;  1YVU A;  4ZTF A;  3NF9 A;  1REV A;  4O0I A;  3AVL A;  1KVC A;  4E1N A;  3MEC A;  2F96 A;  3CFO A;  2G8V A;  1L3V A;  4ELU A;  3OY9 A;  4FM1 A;  4DFK A;  4YNQ A;  3HPO A;  1S9E A;  3VQ4 A;  3OYJ A;  2JGU A;  1LW2 A;  4DU1 A;  3VQA A;  3VQQ A;  4NCG A;  3KLI A;  3O4Q A;  5J2P A;  3BDP A;  4E1M A;  1ZBH A;  4DTN A;  3RRH A;  3HT3 A;  3MEE A;  1Q9X A;  1RT6 A;  4KHU A;  1XHZ A;  5K14 A;  3AO2 A;  1J53 A;  3DM2 A;  1JLF A;  3WNE A;  2Z1I A;  1RDD A;  4CGI A;  4DG1 A;  4ICL A;  4DQP A;  2KFN A;  2KFZ A;  1JLG A;  2KTQ A;  4DF4 A;  4CE9 A;  5FRM A;  1XI1 A;  3AVJ A;  4E7J A;  4GW6 A;  4N41 A;  3V1O A;  4RW9 A;  1T8E A;  4JRP A;  1A5V A;  4DSE A;  1KLN A;  4Z4H A;  1VSJ A;  3MED A;  1HMV A;  2ETJ A;  1HYV A;  4N47 A;  3VQP A;  3DLR A;  2RN2 A;  3QEV A;  4KO0 A;  3T19 A;  4DFJ A;  4CJ4 A;  4CEQ A;  3SPZ A;  3ZSY A;  3A2F A;  1WAJ A;  1CXU A;  4FLV A;  3S3O A;  4CHO A;  4W5N A;  2Z1G A;  5CYQ A;  4B8C A;  2G8U A;  1WSG A;  1WLJ A;  2X74 A;  4I9L A;  4KHW A;  4HHT A;  3OYI A;  4BDP A;  4RW8 A;  1ASV A;  1W9H A;  4W5O A;  2XY6 A;  1QS4 A;  3QES A;  3E01 A;  1L3T A;  4FM0 A;  1I3A A;  1S1W A;  2BAN A;  4FLU A;  1GOA A;  2P51 A;  1D8Y A;  3RRG A;  3VQB A;  4AHU A;  4FJG A;  1F21 A;  3OYK A;  3V9S A;  3K57 A;  4DQQ A;  4IBN A;  4CK3 A;  4J2B A;  3PY8 A;  2PYJ A;  5CZ1 A;  4DQR A;  2D0A A;  3SUO A;  4PUO A;  2WON A;  4PQU A;  1RTH A;  3I0S A;  1NOY A;  4OGC A;  5HRR A;  3L3V A;  4CK2 A;  3SUN A;  4DF8 A;  4JS5 A;  4IFV A;  1X9S A;  3NGY A;  4DSK A;  4N5S A;  3IRX A;  3VQC A;  5DMR A;  5J2N A;  3DLB A;  4KHQ A;  3ASM A;  5J1E A;  3AVA A;  3TAE A;  1TL1 A;  1IKX A;  1S1X A;  2YKN A;  3EYZ A;  4FJL A;  4I9Q A;  4KHY A;  4FW2 A;  4OLA A;  2GV9 A;  4M45 A;  4IKF A;  3HP9 A;  4AHT A;  3D0P A;  3NDK A;  4E7H A;  4F2S A;  3TWH A;  4BE1 A;  1QQC A;  3TI0 A;  3KLG A;  5T7B A;  1RBU A;  4DTM A;  1NK5 A;  4CEF A;  4Z4G A;  1JL1 A;  2Y1J A;  4M3Z A;  3SQ4 A;  4KHN A;  3AVI A;  2Q3S A;  1O1W A;  3M8S A;  2G8F A;  3MXI A;  2Y1I A;  4CEZ A;  4DTR A;  3VQ8 A;  5C25 A;  3LZJ A;  1GOC A;  3MAQ A;  3ISN C;  2HHW A;  4CER A;  4QOZ B;  3OYD A;  1NKE A;  4CEB A;  1RBT A;  1TVR A;  1FKP A;  2OPR A;  2ZQB A;  3OYM A;  1QSL A;  1UOC A;  3CM6 A;  4MQ3 A;  3KIO A;  3QEW A;  3PO5 A;  1JL2 A;  2YNF A;  4C8M A;  4CHY A;  3L2U A;  3OYF A;  1JLA A;  3L8B A;  1VSM A;  1JLQ A;  3NF7 A;  3NH1 A;  3SV3 A;  1NK4 A;  1CXQ A;  4FJ8 A;  1A5X A;  4FK2 A;  1SKS A;  1RDA A;  3RWU A;  2YNH A;  4FLY A;  4KAZ A;  3VQ7 A;  4HUF A;  4FM2 A;  1WN7 A;  1XHX A;  1C0U A;  3AA4 A;  1HJR A;  1TGO A;  4CJU A;  2E6M A;  3U6F A;  2PY5 A;  3LAM A;  4G1Q A;  2B6A A;  4M3U A;  4AIL C;  1LAW A;  1LWE A;  1UWB A;  1QSS A;  4Z4I A;  3P5J A;  1ASW A;  4LD0 A;  3V9U A;  2IS3 A;  4DS4 A;  2XY7 A;  1VSL A;  3T1A A;  1FXX A;  4LSN A;  3QEI A;  1KCF A;  3PV8 A;  4CEE A;  3KJV A;  3CYM A;  3AVF A;  3M8P A;  1XWL A;  2F8T A;  2HB5 A;  1JLB A;  3KLE A;  1BQM A;  1JKH A;  4NYF A;  3AVH A;  3QIN A;  4E7I A;  3PX4 A;  3KTQ A;  4K8X A;  2G8W A;  4DQI A;  4KTZ A;  3OYH A;  4FLZ A;  4RG8 A;  1WSF A;  2KW4 A;  3OYB A;  4DS5 A;  1N5Y A;  1IH7 A;  5KRS A;  2BE2 A;  4I2P A;  2QKB A;  1D9F A;  4FZZ A;  3L2R A;  1NK6 A;  4K8Z A;  4W5Q A;  3AVM A;  3ZSQ A;  3TAR A;  4AHC A;  3QLH A;  3OJS A;  4BE2 A;  4B9N A;  1LW0 A;  4ZHR A;  4OKK A;  4O44 A;  1EXQ A;  3U3G A;  3FFI A;  1ZBF A;  2IGI A;  4ZTJ A;  1T03 A;  3KD5 E;  4Y1C A;  1KVA A;  1SV5 A;  1EX4 A;  2R7Y A;  3AA5 X;  4DFP A;  3IS9 A;  2X6S A;  5FRN A;  4CF0 A;  4DSF A;  1RT7 A;  4CJ5 A;  4FJ9 A;  4H8K A;  4KI4 A;  3S3N A;  1RT5 A;  3TAQ A;  1YTA A;  4FZX C;  2GBZ A;  2HVH A;  2P5G A;  3TAN A;  3TR8 A;  4YFU A;  4E19 A;  5HRP A;  3CFR A;  3C95 A;  2X78 A;  3AO5 A;  4HUG A;  2P5O A;  3LWM A;  3V1Q A;  1Z26 A;  1C1B A;  4BWM A;  1KFS A;  2HHU A;  1U47 A;  1RCH A;  1EET A;  3G10 A;  1XC9 A;  3MEG A;  3HXM A;  4B9S A;  1NK7 A;  1BCM A;  5D3G A;  1RT4 A;  4OKJ A;  4CFC A;  4Z4E A;  2RPI A;  4Q5V A;  2G8H A;  3KD1 E;  4BDZ A;  4B8A B;  4KB1 A;  2FBY A;  1NJZ A;  1HYZ A;  1UA1 A;  3SZ2 A;  1C1A A;  1K6Y A;  3L3U A;  4OPK A;  3K58 A;  4DTX A;  4C8L A;  4FJK A;  2GUI A;  2ZE2 A;  4ELV A;  1TKD A;  4OLB A;  4DTP A;  3L2Q A;  4B3O A;  4KRF A;  1RBR A;  3ULD A;  1TKZ A;  3HPG A;  3LAN A;  5KGW A;  4OVL A;  1HRH A;  2HNY A;  2VG5 A;  3ZT0 A;  2E6L A;  1JXB A;  2XHB A;  4DQS A;  3QNN A;  4CIG A;  4HCC A;  3ZT3 A;  3DLH A;  2B5J A;  3CM5 A;  1B9F A;  1LWF A;  2RF2 A;  1KFD A;  2OPS A;  1HQE A;  3NHG A;  4DTU A;  1R0A A;  2JLE A;  4DWI A;  4FZY A;  2QXF A;  1S1V A;  3AO3 A;  1ITG A;  1VSF A;  2VG7 A;  4IDK A;  3KLF A;  4DU4 A;  1LV5 A;  2G8K A;  2WOM A;  3HL8 A;  3AVC A;  4CHN A;  1I39 A;  1TK0 A;  1L3S A;  4CEO A;  1C0M A;  4E89 A;  1S6Q A;  1U48 A;  2D5R A;  1BI4 A;  3MXJ A;  1ASU A;  4CES A;  4CGF A;  3AA3 A;  1VK0 A;  2FBX A;  5HRN A;  3HYF A;  3MXM A;  2HVI A;  1DTT A;  3HJF A;  1X1P A;  3VQE A;  5CY4 A;  4EZ9 A;  4FJX A;  4M3W A;  2HHT A;  2DTU A;  4RW4 A;  1VSH A;  1W0H A;  2HND A;  5HBM A;  1JLC A;  1GOB A;  2A1S A;  4CJ3 A;  1B92 A;  1JXE A;  4PY5 A;  3IG1 A;  1DLO A;  3M8Q A;  2OZM A;  3K2P A;  3NF6 A;  4IG3 A;  2W42 A;  1LAV A;  3RMA A;  2HHV A;  2ITG A;  5HLF A;  4HTU A;  2DFF A;  3B6P A;  4CGJ A;  4CK1 A;  2YHB A;  3K5L A;  3TAB A;  3SNN A;  4FW1 A;  5JS2 A;  1WNS A;  3PX6 A;  3S9H A;  1Q9Y A;  4CIF A;  3DRS A;  4TSX A;  1LWC A;  2I5J A;  3P83 D;  4CJW A;  3L2W A;  3HST B;  4B9L A;  5KI6 A;  4LH4 A;  3PUF A;  3HO1 A;  1NJY A;  3O3F A;  3H08 A;  2DY4 A;  3QO9 A;  1Q8I A;  1TL3 A;  3ZSV A;  4CF9 A;  3LP0 A;  3NBP A;  3KK1 A;  4NCB A;  3OS1 A;  1RT2 A;  3EY1 A;  3NFA A;  2OPP A;  1RDC A;  3TAF A;  4CJE A;  3SPY A;  4J2E A;  3V1R A;  3SYZ A;  4DU3 A;  3QIP A;  4DFM A;  3V81 A;  1T05 A;  2QK9 A;  2KQ2 A;  4CJS A;  3RR8 A;  4CEA A;  3NE6 A;  3LPT A;  4Z0U A;  1NK8 A;  3VQD A;  4BAC A;  3LP3 A;  4O4G A;  4ELT A;  4CHP A;  1IKY A;  4DLG A;  4CF1 A;  3NGI A;  4B08 A;  1YT3 A;  4O5B A;  3C94 A;  2YNI A;  1JLE A;  1RIL A;  4DTJ A;  3LAK A;  4OJR A;  4OGE A;  4UQG A;  1C0T A;  4HVJ A;  4FJI A;  3M8R A;  4FLT A;  4CHQ A;  3KLH A;  5I42 A;  1RBS A;  3VQ6 A;  3WNH A;  1VRU A;  3LDS A;  2HHS A;  4E3S A;  1NK0 A;  4CJL A;  4B9V A;  3DRR A;  4FLW A;  4I2Q A;  4RW6 A;  3THV A;  3DRP A;  5KGX A;  1MU2 A;  1SL2 A;  4DSI A;  3HK2 A;  1T7P A;  2VWK A;  4CJR A;  1SL1 A;  3T3F A;  2IC3 A;  3ZT1 A;  4OPJ A;  1KSP A;  4NYN A;  4KV8 A;  4Y1D A;  3SUP A;  1NK9 A;  4IFY A;  1TV6 A;  3SI6 A;  2YKM A;  4I7F A;  3ZT2 A;  4E0D A;  2XY5 A;  3ALY A;  1WAF A;  3DOL A;  3HVT A;  4E7L A;  1DTQ A;  4FJN A;  1U45 A;  3O4N A;  3K59 A;  1S6P A;  5FRO A;  4J2A A;  2LSN A;  3ZSX A;  3EZ5 A;  1J9A A;  3VA0 A;  2FBV A;  4DTO A;  3WNG A;  2HMI A;  1S1T A;  1RT3 A;  2NUB A;  4HUE A;  4CJQ A;  3K5O A;  4W5T A;  2BDP A;  3RMC A;  1Y97 A;  2ZD1 A;  1BHL A;  3B6O A;  3P1G A;  4N76 A;  1NJW A;  1CZ9 A;  2D0C A;  5C24 A;  1CZB A;  1TKX A;  2DFE A;  3U3Y A;  2VG6 A;  3S3M A;  1U49 A;  2YV0 X;  4JS4 A;  4M3X A;  3HM9 A;  3DLG A;  2IDO A;  5KRT A;  3AO1 A;  4KI6 A;  3BGR A;  5DK5 A;  2XRI A;  5CYM A;  3CFP A;  3PO4 A;  4L8R B;  4JRQ A;  5J2Q A;  3L2V A;  1NKB A;  4R5P A;  1VSE A;  3OYL A;  2EHG A;  3LWL A;  4Q0B A;  1QE1 A;  1S9G A;  3V6D A;  4O55 A;  2EX3 A;  3I8D A;  4KFB A;  4LSL A;  2F8S A;  3K5M A;  1S1U A; 
#chains in the Genus database with same CATH topology
 4CGD A;  2KZZ A;  5M1O A;  4FK4 A;  2QWN A;  5FDL A;  3JAM O;  1VRT A;  1BQN A;  4CCH A;  4F4K A;  2F9T A;  2BGG A;  1NGF A;  1VSD A;  2IVO A;  3SQ0 A;  4JV5 K;  3BUZ B;  4PKG A;  4PKI A;  1DEJ A;  4YHH K;  4F8R A;  3SJJ A;  3CCM N;  2QKK A;  4FK0 A;  3J7Z O;  1KXP A;  2JWL A;  2E1Z A;  4LF9 K;  4CHZ A;  4NXN K;  3AVG A;  3PIP L;  4B3S K;  4GV3 A;  1N32 K;  3C7N B;  1SL0 A;  1QTM A;  4JI3 K;  5DM6 L;  4KHP K;  4R79 A;  3SMP A;  3ZSZ A;  2P9L B;  1NBW A;  4CZM A;  4YOR A;  3WNF A;  3JSM A;  4YOY A;  1HNZ K;  3VEX A;  1NGG A;  3PX0 A;  1JJ2 M;  4MLE A;  3J81 O;  4HCB A;  3SCX A;  3CCL N;  4DLE A;  4CVN E;  1YIT N;  2HHX A;  4LH5 A;  4WQ5 A;  2JWK A;  1DGK N;  1O13 A;  3F73 A;  1C1C A;  3HP6 A;  5BRD A;  4ID5 A;  4RW7 A;  3WEE B;  5M1N A;  3HPH A;  4LFB K;  1HQU A;  4KRE A;  2VCP A;  1MDU B;  2CH6 A;  3OYC A;  1D4X A;  1RT1 A;  1SUQ A;  5BN9 A;  1KAX A;  1X9W A;  1NOZ A;  3IKM A;  4M3R A;  5LJV A;  4H0V B;  2BH1 A;  3V9Z A;  1TKT A;  4CJP A;  3OYN A;  2FSN A;  1WBB A;  4DCH A;  2XO7 A;  4WF9 L;  1S5J A;  1N8R O;  4KB0 A;  2O8D B;  1BGX T;  4H03 B;  4B9T A;  3F9K A;  3OJU A;  3OYG A;  4DR5 K;  4KKO A;  2O8E B;  4CI6 A;  4X62 K;  3CC7 N;  5FPD A;  2OA8 A;  4B9U A;  1YVN A;  4M3T A;  3A5O C;  3ZEU B;  2NRV A;  1X9M A;  3BZC A;  3LDP A;  4JLH A;  3N4Q A;  3CQ8 A;  2P9S B;  3G0Z A;  4LF8 K;  1BIU A;  1BU6 O;  2A41 A;  1KRP A;  3BEX A;  4CJK A;  5I3U A;  4B9M A;  3NH0 A;  3AA2 A;  1VSI A;  1BCO A;  2QM1 A;  1BIS A;  2V51 B;  4KH6 A;  4V19 S;  1T6D A;  3ITH A;  5CE3 A;  3U8X A;  1D9F A;  5ADX A;  1SKR A;  3SAG A;  3VN5 A;  2G8I A;  4FLX A;  3KKS A;  3OTO K;  1FW6 A;  5KPZ A;  4KPY A;  3C6U A;  3K5N A;  4B1X B;  4BWJ A;  4KTQ A;  4B3M K;  2Z1J A;  1YVU A;  4O0I A;  2FSK A;  3MEC A;  2F96 A;  4FWS A;  3DXK A;  2G8V A;  4FM1 A;  2QWP A;  4DR6 K;  4CZE A;  2JGU A;  5AQL A;  3VQA A;  3VQQ A;  2QWQ A;  3THW B;  3O4Q A;  5J2P A;  4F9O A;  4DTN A;  4XEI A;  1Q9X A;  3AO2 A;  3AGK A;  1RDD A;  4ICL A;  3BF1 A;  2KTQ A;  4GY2 B;  4CE9 A;  4DUY K;  5FRM A;  4E7J A;  2F7T A;  5LMN K;  4IEI A;  4DSE A;  2OAN A;  1HMV A;  2ETJ A;  5BN8 A;  2NRX A;  1WAJ A;  3S3O A;  4BR5 A;  3OYI A;  4RW8 A;  3LDQ A;  2YJE A;  3CD6 N;  2J4R A;  4W5O A;  3FZF A;  2A6A A;  4NO7 A;  3KZB A;  3OYK A;  1XNQ K;  3K57 A;  3LDL A;  2PYJ A;  3O6W A;  4JAX A;  3O5B A;  4PQU A;  1RTH A;  3I0S A;  1NOY A;  2O8F B;  4CK2 A;  3L3V A;  4BRL A;  4DF8 A;  4IFV A;  3NGY A;  1OKJ A;  3IRX A;  3VQC A;  5DMR A;  5J2N A;  2CGL A;  5A2Q O;  3IUC A;  5J1E A;  4A57 A;  1IKX A;  2HST A;  3SAH A;  3O80 A;  3WQT A;  2QWO A;  4F2S A;  4YOV A;  3TWH A;  4BE1 A;  1QQC A;  3THX A;  3KLG A;  3ZET A;  5T7B A;  1NK5 A;  4CEF A;  1JL1 A;  4AF1 A;  4M3Z A;  3MWP A;  3SQ4 A;  4KHN A;  1O1W A;  3MXI A;  2Y1I A;  2ZGZ A;  4JI4 K;  3BF3 A;  3ISN C;  3RSE A;  3OYD A;  1TVR A;  3P38 A;  3ZEU A;  1K9M O;  5GAH P;  4GVE A;  1UOC A;  3CM6 A;  3QEW A;  3PO5 A;  1V4T A;  1NM1 A;  1JLQ A;  3NF7 A;  5AQX A;  3SV3 A;  4FK2 A;  1SKS A;  4CZL A;  4FM2 A;  1RFQ A;  3CJ1 A;  2E6M A;  1VQ5 N;  1U2V A;  5I9E B;  1QSS A;  4JKD A;  3G25 A;  4DV2 K;  1XMO K;  3V9U A;  4DS4 A;  3T1A A;  1SZ2 A;  1FXX A;  4JKE A;  1HKG A;  1KCF A;  5EVZ A;  3TTD A;  2A3Z A;  3M8P A;  1BO5 O;  4FWO A;  4FWR A;  2V7Z A;  4NYF A;  3AVH A;  4E7I A;  3OBY A;  4DQI A;  4JKC A;  4FLZ A;  4LFA K;  4IJA A;  1IH7 A;  5KRS A;  4I2P A;  3HBT A;  4FZZ A;  4K8Z A;  4WFN L;  4IJN A;  1VQ4 N;  3MX5 A;  1C0G A;  4A5A A;  1LW0 A;  3TSQ A;  1EXQ A;  4BR4 A;  4ZTJ A;  3MWT A;  4WQ5 C;  3KD5 E;  4Y1C A;  1YAG A;  3KK7 A;  4OX9 K;  4H8K A;  3S3N A;  3TAQ A;  3KHY A;  2HVH A;  2P5G A;  5CHI A;  3CFR A;  3C95 A;  4AM7 A;  4HUG A;  2WC9 A;  1OH7 A;  1EET A;  3HXM A;  2UUA K;  4B9S A;  1BCM A;  5D3G A;  2P9I A;  3UE5 A;  3U4L A;  2YHY A;  3CER A;  4BDZ A;  4KB1 A;  2FBY A;  1NJZ A;  3WT0 A;  3EO3 A;  3CCR N;  4OPK A;  3CJ9 A;  3FZK A;  4OLB A;  2ZE2 A;  4KRF A;  1RBR A;  3ULD A;  1TKZ A;  3HPG A;  4DV3 K;  3MX2 A;  5JVH L;  3ZT0 A;  1MWM A;  5C2F A;  3CM5 A;  1B9F A;  2RHK A;  2QXF A;  1S1V A;  5IWA K;  1ITG A;  3KLF A;  4DU4 A;  2YHW A;  4CHN A;  3G6E N;  4BRH A;  2D5R A;  1OVY A;  3CCV N;  2E88 A;  3O9Q A;  3CJC A;  3MXM A;  2DTU A;  1X1P A;  5CY4 A;  3FR0 A;  4M3W A;  4RW4 A;  4DV1 K;  2O8B B;  1VSH A;  5HBM A;  4BRE A;  1K8K B;  1GOB A;  4BRF A;  3VER A;  3E9O A;  3IG1 A;  4BGA A;  1K8A O;  5FPM A;  5GIP A;  1ESV A;  3RMA A;  2ITG A;  3D7E O;  5HLF A;  4HTU A;  2DFF A;  3TAB A;  5JS2 A;  4CIF A;  3MN6 A;  3L2W A;  4B9L A;  3U9D A;  5AFU H;  3PUF A;  4JI6 K;  3O3F A;  1TL3 A;  2PBD A;  4BR9 A;  3NBP A;  2E2P A;  3FGU A;  4BR7 A;  3OS1 A;  3GG4 A;  3ZX2 A;  1G99 A;  1RDC A;  3TAF A;  4J2E A;  2DPN A;  4DU3 A;  3RR8 A;  4Z0U A;  5AZJ A;  3MCP A;  1IKY A;  4DLG A;  3NGI A;  3C94 A;  2YNI A;  4OGE A;  4FLT A;  4CHQ A;  4O8K A;  3WXJ A;  4B9V A;  1HNW K;  1Z05 A;  3B8A X;  2VWK A;  4LF5 K;  3KVG A;  4OPJ A;  4NYN A;  4A59 A;  5ADX H;  1QHA A;  4KV8 A;  3C6A A;  1NK9 A;  2YKM A;  3CPW M;  3O9U A;  1XC3 A;  4FOI A;  4FJN A;  3K59 A;  2QTD A;  1QQN A;  4JI8 K;  1HX1 A;  1S1T A;  2NUB A;  2BDP A;  3K5O A;  5C0Y A;  3B6O A;  1BHL A;  4N76 A;  1CZ9 A;  2OTJ N;  1QZ5 A;  3U3Y A;  3BP8 A;  3VEY A;  4M3X A;  4U7B A;  1Q86 O;  3BGR A;  2RE2 A;  4JKG B;  3PO4 A;  3DXM B;  3NVM A;  5J2Q A;  1IG8 A;  3L2V A;  4BY9 C;  3HOT A;  2EHG A;  3EL2 A;  1T3V A;  4JI1 K;  1X3N A;  3CI5 A;  3SLC A;  2FLO A;  4C8K A;  1L3T A;  3O1W A;  4BC4 A;  2YCH A;  3CXC M;  4ID1 A;  5AQN A;  1TUU A;  1VSK A;  4IOA L;  3DLK A;  3UKR A;  5F0X A;  3BY5 A;  4J2D A;  3CHW A;  4WYB A;  1U04 A;  4IWV A;  3O3G A;  3HOS A;  4FVM A;  2ZF5 O;  4Z4F A;  3RMB A;  4CEC A;  1HPZ A;  1ZYQ A;  1X9J A;  4B9Q A;  2DFH A;  4FWK A;  5TKY A;  4B1U B;  4F3O A;  2OTL N;  3V9X A;  4FXD A;  4F3T A;  1X3M A;  3G4S N;  3VF6 A;  4FYD A;  4XH4 A;  5C42 A;  4BRD A;  5JS1 A;  3AV9 A;  1FKO A;  3AGR A;  1NGD A;  1M90 O;  4BRI A;  4MO4 A;  4PA1 A;  3VQ5 A;  3BZK A;  5AZI A;  3QEP A;  3QDK A;  4CGG A;  1TK5 A;  4FJ7 A;  1NJI O;  3EKU A;  2NRH A;  3O8M A;  3F9M A;  1ATS A;  2KZM A;  3OVN A;  1NGB A;  4L3Q A;  4O8U A;  4N56 A;  1BI4 B;  2IOC A;  1S72 N;  3HM8 A;  3OYE A;  4NCA A;  4LF4 K;  2HBK A;  5AQM A;  1RTI A;  3QER A;  1WBD A;  1HNV A;  1U6Z A;  1EKE A;  5JIC A;  4GV9 A;  1WSI A;  2E1Y A;  3ZSR A;  1IKW A;  3O4W A;  1D5A A;  3SV4 A;  4KHS A;  4U67 L;  4EP5 A;  3I56 N;  2QEX N;  3RTV A;  3FZM A;  3SUQ A;  1BA1 A;  4B1V A;  1ZC6 A;  1E4G T;  4JD2 A;  4CF8 A;  5AQJ A;  2VYP A;  4IOX A;  3WXK A;  1NU0 A;  2AP1 A;  1YJW N;  1EWQ A;  4H5W A;  2FC0 A;  4GVM A;  3C6T A;  4DSL A;  4EFH A;  2Q0R A;  2XY8 A;  4EP4 A;  2D0P A;  4JKA A;  5M1F A;  3P31 A;  3LAL A;  4CGH A;  3J7A P;  1ZBI A;  3VA3 A;  4CED A;  2E5L K;  1ZBL A;  3NH2 A;  5KTQ A;  2A1R A;  3UIQ A;  2Q31 A;  1IV0 A;  1REV A;  2QA4 N;  3AVL A;  4QS8 A;  1N33 K;  1OH6 A;  3F2K A;  3TSP A;  3CJB A;  3HPO A;  1S9E A;  4LF7 K;  3H1Q A;  4EHT A;  1JCG A;  1C0F A;  1S22 A;  4LF6 K;  4FVU A;  1RT6 A;  4KHU A;  1XHZ A;  5K14 A;  1JLF A;  4CGI A;  1YJN N;  5KQ8 A;  3G71 N;  1JLG A;  4DF4 A;  5BPM A;  4JRP A;  1A5V A;  1VSJ A;  4DV6 K;  4KO0 A;  3SPZ A;  3VPZ A;  4NLC A;  4FWM A;  4FLV A;  2Z1G A;  1VQK N;  5CYQ A;  4B8C A;  3OW2 M;  1WSG A;  1WLJ A;  4HHT A;  1VHX A;  1ASV A;  5FPN A;  1XMQ K;  1W9H A;  2XY6 A;  3M5R A;  4JK9 A;  4FM0 A;  4XH1 A;  1VQL N;  2P9P A;  3VQB A;  4AHU A;  1T6C A;  1I94 K;  4FJG A;  1F21 A;  4DQQ A;  3SUO A;  2VGN A;  4DSK A;  3Q7C A;  3IMX A;  1TL1 A;  4I9Q A;  4FJL A;  2V52 B;  5E26 A;  1P90 A;  1BDG A;  4IKF A;  2A42 A;  3HP9 A;  3NDK A;  3E9L A;  5M1P A;  3O9S A;  3OHR A;  3MDQ A;  5KPT A;  4DTR A;  4H0P A;  2YJF A;  5AQT A;  3MAQ A;  3L4Q A;  5AFU A;  4CER A;  3I55 N;  4CEB A;  3D2F B;  2CGJ A;  4NB4 A;  4MQ3 A;  1JL2 A;  4IDH A;  3WQU A;  3OYF A;  1JLA A;  3L8B A;  4BRG A;  1LOT B;  5JVG L;  4DR3 K;  3QIC A;  1RDA A;  3RWU A;  2YNH A;  4HUF A;  1WN7 A;  3AA4 A;  1TGO A;  1HLU A;  3JXU A;  4CJU A;  1YHQ N;  4YDU A;  2YX6 A;  4AIL C;  1LWE A;  1SAZ A;  1UWB A;  3ENB A;  3ID6 A;  3LM2 A;  5EX5 A;  4PL8 A;  3O9R A;  1HPM A;  3CYM A;  4CZK A;  2F8T A;  3KLE A;  1JLB A;  2CGK A;  3QIN A;  4K8X A;  2D1K A;  3PSF A;  3OYH A;  1FJG K;  4FWN A;  1WSF A;  1ATR A;  2KW4 A;  4DS5 A;  4M63 C;  2GUP A;  2QKB A;  3CC4 N;  3L2R A;  2UUB K;  3ULE B;  3ZSQ A;  2NRW A;  4K25 A;  1Q18 A;  4ELT A;  3OJS A;  4B9N A;  3C6H A;  4OKK A;  4M3Y A;  1SV5 A;  2R7Y A;  3AA5 X;  3IS9 A;  1RT7 A;  4FJ9 A;  1MWK A;  4KI4 A;  2BUP A;  2YHX A;  2GBZ A;  4YFU A;  5HRP A;  4FPB A;  2UUC K;  3LWM A;  3V1Q A;  1Z26 A;  4BWM A;  1RCH A;  3MEG A;  3O9T A;  4MDA A;  5KPR A;  1NK7 A;  3C7N A;  4UY8 O;  4Z4E A;  4Q5V A;  3KD1 E;  3SJH A;  5HL7 L;  3LL3 A;  2P9L A;  1C1A A;  4FJK A;  4C8L A;  2UU9 K;  2GUI A;  4DTP A;  3LAN A;  2HNY A;  2XHB A;  4DQS A;  1GLE G;  3ZT3 A;  2B5J A;  2RF2 A;  2OPS A;  4MDB A;  4OO1 J;  1Z6R A;  3AO3 A;  1BWF O;  3MCA B;  3MK6 A;  3HL8 A;  2IVN A;  3AVC A;  1L3S A;  1C0M A;  3WEE A;  2VQF K;  3HSC A;  1ASU A;  4CES A;  2EWS A;  3AA3 A;  4OPA A;  5LMU K;  1DTT A;  4FJX A;  3QBX A;  2ITM A;  3R8E A;  4H5N A;  4CJ3 A;  4K0K K;  4K42 A;  2QW9 A;  1DLO A;  2OZM A;  3K2P A;  1K73 O;  2O8D A;  3B6P A;  4CGJ A;  1IBL K;  3S9H A;  3PX6 A;  1Q9Y A;  3L6Q A;  4TSX A;  2O8E A;  3SMS A;  3OBW A;  3A5L C;  3CCQ N;  3H08 A;  1E4F T;  1Q8I A;  4ISG A;  4DR1 K;  4CF9 A;  2FSJ A;  4I6M B;  4M7Y A;  5AQY A;  3VGK A;  2P9S A;  3ATU A;  1NGC A;  4CJE A;  4DFM A;  2QWL A;  4RTF D;  1M1K O;  3CQY A;  3E9P A;  1MA9 B;  3LDN A;  4O4G A;  4CF1 A;  1YT3 A;  4JHD B;  1RIL A;  2P9U B;  3VGL A;  3LAK A;  4OJR A;  4UQG A;  4GKJ K;  4JI7 K;  3KLH A;  5I42 A;  3WNH A;  4CZH A;  4E3S A;  4I2Q A;  4RW6 A;  4DSI A;  1SL2 A;  1MU2 A;  1J5E K;  1ZBS A;  2GTD A;  2O8C B;  3T3F A;  2IC3 A;  2KKZ A;  1N36 K;  3DJC A;  3THW A;  3SI6 A;  4I7F A;  3DAW A;  3ALY A;  4IEE A;  2NRR A;  3O4N A;  1S6P A;  3EZ5 A;  1J9A A;  2FBV A;  4BGB A;  4BQZ A;  3PLA A;  4CJQ A;  4W5T A;  1R59 O;  5AQR A;  1Y97 A;  2F9W A;  2GEM A;  4H0O A;  2ZD1 A;  3P1G A;  1H1V A;  3EN9 A;  4DV0 K;  1HJO A;  2VG6 A;  3S3M A;  1U49 A;  2YV0 X;  3ATV A;  1KC8 O;  4JS4 A;  3HM9 A;  2XRI A;  4CZI A;  5CYM A;  3PIO L;  3CFP A;  3CMA N;  4Q0B A;  1VSE A;  3OYL A;  3LWL A;  4C1N K;  1QE1 A;  1JCF A;  1S9G A;  4AQY K;  2Q97 A;  2EX3 A;  1WUA A;  2HHH K;  4KFB A;  2F8S A;  3RMD A;  1KLM A;  1VQP N;  2Q0U A;  1NMN A;  4BRN A;  5AQV A;  2E2Q A;  2KHO A;  5SWM A;  2HW3 A;  2O8F A;  1G15 A;  1EO1 A;  4C8O A;  2D0B A;  1B9D A;  2GEL A;  2ATQ A;  4Z4C A;  3A5M C;  4AHS A;  4FJ5 A;  2X6N A;  1KTQ A;  2ZWH A;  2E4L A;  2IIR A;  1RTD A;  5E41 A;  1KVB A;  4PWD A;  1HNI A;  4CBX A;  3NCI A;  4WFA L;  1ZBU A;  5KQD A;  4XIU A;  1OVQ A;  3KKR A;  3LP2 A;  1GLJ O;  3TAP A;  2FBT A;  3SQ1 A;  3QNO A;  3RR7 A;  2W41 A;  2HBL A;  4WE1 A;  2ASO A;  3QEX A;  1IO2 A;  3NF8 A;  3ZSO A;  1QHT A;  4MLH A;  4BG9 A;  3AVB A;  1KAZ A;  2PAV A;  4QCL A;  1U4B A;  3AVK A;  3VTI A;  4WFB L;  3AAR A;  4H5V A;  1CLQ A;  4H4O A;  1NGI A;  4NXM K;  4JI2 K;  2HMP A;  1NJX A;  3VF2 A;  3OYA A;  4DTS A;  1T44 A;  3O3H A;  3I0R A;  3V4I A;  1TYQ B;  1QVG M;  3D2E B;  2QWR A;  3ZCM A;  3K0S A;  2E2O A;  3N4P A;  4FJJ A;  2O4G A;  1FK9 A;  1XQS C;  4PHT X;  1WSJ A;  2ZJQ L;  4CJV A;  3SK3 A;  1XUP O;  2Z1H A;  2B4J A;  3A8Y A;  3AVN A;  1C6V A;  5AQO A;  2OPQ A;  4CFD A;  4BC3 A;  1VQM N;  3TAG A;  1WSH A;  3VOV A;  2O4I A;  1RNH A;  1RTJ A;  4FWQ A;  4EZ6 A;  5BRH A;  3RVC A;  1D9D A;  4K41 A;  4B1W B;  1IBM K;  1EP4 A;  5C2D A;  2IVP A;  1BIZ A;  3AO4 A;  1RGI A;  4RWT A;  3LP1 A;  4AHV A;  2IAJ A;  5AQP A;  4DR7 K;  2QXL A;  2P1J A;  3TAM A;  1NMD A;  2YNG A;  1TK8 A;  1Q82 O;  1L3U A;  4C8N A;  4CFA A;  1IKV A;  5BPL A;  1NKC A;  2YI1 A;  4ILH A;  1BL3 A;  3CJA A;  4ISE A;  4C1N I;  1KVC A;  3CFO A;  1L3V A;  4JEP A;  4YNQ A;  3CJ7 A;  4YOT A;  3VQ4 A;  4Z94 A;  1LW2 A;  1NG9 A;  4A61 A;  4NCG A;  3KLI A;  1ZBH A;  3RRH A;  3HT3 A;  2GX9 A;  1YF5 L;  4HTL A;  1J53 A;  3WNE A;  4DG1 A;  2W6K A;  1WOQ A;  2KFN A;  3THY B;  4C23 A;  3GBT A;  3AVJ A;  2O8B A;  3V1O A;  1K8K A;  1KLN A;  3MED A;  5LJW A;  1HYV A;  4N47 A;  4CEQ A;  2P9K B;  4YY3 K;  3ZSY A;  3A2F A;  3FFK B;  1CXU A;  4CHO A;  3C65 A;  4JKF A;  2G8U A;  4KHW A;  1NNE A;  4JKH A;  4BDP A;  1QS4 A;  3QES A;  5MLC Q;  4DR2 K;  1I3A A;  4FLU A;  1D8Y A;  1GOA A;  2P51 A;  2V7Y A;  3L4I A;  3UKU B;  4FSV A;  4CBU A;  2Q1N A;  2UYT A;  4IBN A;  4CK3 A;  3PY8 A;  5CZ1 A;  4DQR A;  4PUO A;  2WON A;  4OGC A;  3SUN A;  4JS5 A;  4ILG B;  4IOC L;  2ASM A;  3CC2 N;  3ASM A;  2NRT A;  3AVA A;  3TAE A;  4KHY A;  3FZH A;  4FW2 A;  4OLA A;  2GV9 A;  3K9J A;  3D0P A;  2QI2 A;  1RBU A;  4QS9 A;  5IT9 O;  4X64 K;  1S3X A;  2Q3S A;  3FE1 A;  2FF6 A;  5GAG P;  3M8S A;  5BRF A;  2VQE K;  3LZJ A;  2ZJR L;  1GOC A;  2HHW A;  5GIN A;  4QOZ B;  3A0I X;  4FWP A;  3HZ6 A;  1RBT A;  4LFC K;  1SQK A;  3I8B A;  1FKP A;  2OPR A;  2ZQB A;  4XH5 A;  3OYM A;  1QSL A;  1SS6 A;  2YNF A;  4CHY A;  2CH5 A;  4YOU A;  4JNE A;  1NK4 A;  5AQK A;  1A5X A;  3VEV A;  4JI0 K;  3AAP A;  1RDU A;  1J6Z A;  3CME N;  1C0U A;  1HJR A;  1QVF M;  3VTH A;  2PY5 A;  4B1Y B;  3EEQ A;  3J80 O;  3TPQ A;  4M3U A;  1E3M A;  4Z4I A;  3P5J A;  3U9Z A;  4LD0 A;  2IS3 A;  5BR9 A;  2XY7 A;  1VSL A;  1GLL O;  1KD1 O;  1EWR A;  2ZGY A;  4JKG A;  4LSN A;  1W97 L;  3DXM A;  3KJV A;  5AQW A;  3AVF A;  1XWL A;  1BQM A;  1JKH A;  3PX4 A;  1KAY A;  4JK8 A;  5GIO A;  2KLA A;  4KTZ A;  3OYB A;  3EE8 A;  1IJJ A;  4IO8 A;  1NK6 A;  4W5Q A;  1GLD G;  5F2R A;  3CCJ N;  1T03 A;  1ZBF A;  2E8A A;  2IGI A;  1KVA A;  1EX4 A;  4DFP A;  4KH4 A;  3M1F A;  2X6S A;  3OA9 A;  2P9N B;  1TUY A;  2ZJP L;  1RT5 A;  1YTA A;  2WUS A;  3TAN A;  2P9K A;  3H45 C;  5F1X A;  4GKK K;  2HHU A;  1C1B A;  3J8A A;  1U47 A;  1Q7Y O;  1XNR K;  3MMV A;  4JI5 K;  3JS6 A;  2WBN A;  3WXI A;  5BRE A;  2G8H A;  4WCE L;  3PSI A;  4ISF A;  1HYZ A;  3SZ2 A;  3L3U A;  1K6Y A;  5FRN A;  3K58 A;  1TKD A;  1VAZ A;  4EHU A;  3L2Q A;  4B3O A;  3FLC O;  5EY4 A;  4BRQ A;  5KGW A;  2VG5 A;  1JXB A;  4CIG A;  1DT9 A;  3DLH A;  3NHG A;  1KFD A;  5GAE P;  1HQE A;  4DTU A;  1R0A A;  4FZY A;  2JLE A;  3DXK B;  2VG7 A;  4IDK A;  1LV5 A;  4HWI A;  2WOM A;  4KBO A;  4CZF A;  4B3R K;  1S6Q A;  1BI4 A;  4IZ9 A;  3MXJ A;  1QZ6 A;  4BRK A;  4CGF A;  3DLL L;  2FBX A;  3HYF A;  3SBT A;  2HF3 A;  3HJF A;  3F5T A;  2HHT A;  4EZ9 A;  3J7Y P;  1W7A A;  1W0H A;  2A1S A;  2VWB A;  4PY5 A;  4KH5 A;  3NF6 A;  4IG3 A;  2W42 A;  1LAV A;  3IFR A;  1ATN A;  2NRZ A;  2GWK A;  3VEN A;  2YHB A;  3K5L A;  3SNN A;  1WNS A;  1EQY A;  3GE1 A;  1LWC A;  2I5J A;  3P83 D;  2F4V K;  5KI6 A;  5AQH A;  3HO1 A;  2Q2R A;  1NJY A;  3QO9 A;  4A2A A;  5AQU A;  3LP0 A;  1GLC G;  1YUW A;  1RT2 A;  2WTU A;  3SPY A;  4IFE A;  3QIP A;  3ZYY X;  4CW7 B;  3Q7B A;  1BUP A;  4IO9 L;  3QFU A;  3LPT A;  3VQD A;  4BAC A;  4EIA A;  5JLH A;  2AA4 A;  5AJ3 K;  4O5B A;  3CCS N;  3GL1 A;  4FJI A;  3M8R A;  4A62 A;  2HHS A;  3THX B;  3ZET B;  4CJL A;  4FLW A;  2I7N A;  3DRP A;  5KGX A;  3HK2 A;  5LL6 Z;  1T7P A;  1SL1 A;  3UB5 A;  1NWK A;  2P9N A;  3CIP A;  4JN4 A;  1NGA A;  4Y1D A;  3RSE B;  3SUP A;  1TV6 A;  3ZLJ A;  3ZT2 A;  3HVT A;  3DOL A;  4E7L A;  1U45 A;  1DKG D;  4FOE A;  4J2A A;  3VA0 A;  4DTO A;  3WNG A;  2HMI A;  1RT3 A;  4HUE A;  1NLV A;  1NGJ A;  1NJW A;  4QS7 A;  2HOE A;  1CZB A;  1U2V B;  2DFE A;  4CZG A;  3VGM A;  1HR0 K;  1HUX A;  3DLG A;  2IDO A;  5KRT A;  3AO1 A;  5DK5 A;  4BC2 A;  2OCE A;  4JRQ A;  4K43 A;  1NKB A;  4R5P A;  4BRO A;  1NGH A;  4IG0 A;  4FWL A;  1L5U A;  5C15 A;  3GOI A;  1SKW A;  4FJH A;  4CJF A;  3LM9 A;  4DHY A;  4BE0 A;  3ZSW A;  2A5X A;  3VEO A;  3VQ9 A;  4BRP A;  4E7K A;  1RDB A;  2HNZ A;  2Q36 A;  1JCE A;  3HRG A;  1RBV A;  5AR0 A;  2HBM A;  4OKE A;  4CJT A;  3T1Y K;  5HP1 A;  3QET A;  4CF2 A;  3SQ2 A;  4CBW A;  4H0X B;  1YI2 N;  3ZX3 A;  1YXQ A;  3NMU A;  1J5O A;  4AH9 A;  3M3Z A;  4CIE A;  3JYT A;  1V4S A;  2P9I B;  3QIO A;  2OYQ A;  3D2F A;  2VWJ A;  1TAU A;  4O0J A;  4FJM A;  5HRS A;  2I7P A;  1YTU A;  2NLX A;  3ZT4 A;  4PL7 A;  1KQS M;  3T69 A;  3E1Y A;  3KK2 A;  3ID8 A;  3CF5 L;  3IAY A;  4DQ8 A;  2UXB K;  4X65 K;  1A5W A;  4H0T B;  3V9W A;  4CJ7 A;  5H1S Q;  3NAE A;  3OS2 A;  3DLE A;  3AY9 A;  4EAH D;  2YHA A;  1UAX A;  2E2N A;  5CZ2 A;  3NVK A;  1J54 A;  5J2M A;  4M41 A;  1HYS A;  3CG7 A;  1IG9 A;  1ILY A;  1VQN N;  2ASP A;  5GAD P;  3D45 A;  3NGZ A;  2PZS A;  1WSE A;  1YJ9 N;  3EE9 A;  1UA0 A;  4MFB A;  5JLF A;  5SZT A;  5HRO A;  1N6Q A;  4AHR A;  4BRM A;  3VET A;  3ULE A;  4E1J A;  4LY7 A;  4F2R A;  4M42 A;  2BTF A;  4BRC A;  1VQ8 N;  5B8H A;  1Z25 A;  2AJQ A;  3KK3 A;  4W5R A;  3DI6 A;  1QSY A;  5EU7 A;  3QML A;  3HVR A;  1QQM A;  1LCU A;  2W40 A;  2RKI A;  4DMN A;  1TAQ A;  4H4M A;  5TKW A;  2A40 A;  4BG8 A;  3P39 A;  4X66 K;  4FCY A;  3R6M A;  4GV6 A;  5BR8 K;  4JK7 A;  4GMJ B;  1GLB G;  3LZI A;  1BG3 A;  3LPU A;  4DSJ A;  3KWI A;  4KTW A;  2HHQ A;  2PYL A;  4YOX A;  4QAG A;  4FPA A;  4BDY A;  4CFB A;  5AZJ B;  3DYA A;  3OS0 A;  1YIJ N;  3DOK A;  3DMJ A;  2OZS A;  4OPH A;  4ZTF A;  3NF9 A;  3MN7 A;  4E1N A;  4ELU A;  3OY9 A;  4DFK A;  3T7Z A;  3QFP A;  3R9P A;  3OYJ A;  4DU1 A;  1OH8 A;  5DM7 L;  4FL9 A;  3BDP A;  4E1M A;  3MEE A;  3DM2 A;  4DQP A;  3H6E A;  2Z1I A;  3TU5 A;  4CD3 A;  2KFZ A;  4DV4 K;  4YDU C;  1XI1 A;  4GW6 A;  2NNW A;  4N41 A;  4RW9 A;  1T8E A;  4H5R A;  4Z4H A;  2NZT A;  3VQP A;  3DLR A;  2RN2 A;  3QEV A;  3O08 A;  3T19 A;  4CJ4 A;  4DFJ A;  5BPN A;  1VQO N;  4A2B A;  4W5N A;  2X74 A;  4I9L A;  3E01 A;  3CCE N;  3SAF A;  1S1W A;  2BAN A;  4I6M A;  5AQG A;  4J8F A;  4DUZ K;  3RRG A;  4YOW A;  4H5T A;  1HKC A;  3V9S A;  3AAQ A;  1VQ6 N;  4J2B A;  4WQ4 A;  2D0A A;  3WXL A;  3TTF A;  1OH5 A;  5HRR A;  1X9S A;  5M1K A;  2UXD K;  2E20 A;  4N5S A;  4DV5 K;  3DLB A;  4KHQ A;  3ENH A;  3QB0 A;  3GDQ A;  3UKR B;  4DV7 K;  1S1X A;  2YKN A;  3EYZ A;  4JHD A;  2P9U A;  4M45 A;  4E7H A;  4AHT A;  2WFB A;  4CZJ A;  3TI0 A;  3FZL A;  4DTM A;  4Z4G A;  3ZX0 A;  2Y1J A;  1RDW X;  3AVI A;  3EKS A;  4BQL A;  2G8F A;  2O8C A;  3EZW A;  3MN5 A;  2ZM6 K;  2GWJ A;  4CEZ A;  1N34 K;  3VQ8 A;  5C25 A;  5FPE A;  5AQS A;  1NKE A;  4GNI A;  4PKH A;  4BR2 A;  2PFU A;  3SBG A;  5AQQ A;  3KIO A;  4C8M A;  1Y64 A;  3L2U A;  1VSM A;  3E66 A;  3TSU A;  3K9K A;  3NH1 A;  1CXQ A;  4FJ8 A;  1BOT O;  4FLY A;  4KAZ A;  3VQ7 A;  1XHX A;  5AQI A;  5FLX O;  3U6F A;  3LAM A;  4G1Q A;  2B6A A;  1BA0 A;  4AM6 A;  1LAW A;  5AZI B;  1ASW A;  1ZXO A;  3QEI A;  3VES A;  3PV8 A;  4CEE A;  4O5F A;  3H1V X;  2HB5 A;  3C0B A;  3W0L A;  4CD1 A;  3KTQ A;  2G8W A;  4RCH A;  4RG8 A;  1N5Y A;  2BE2 A;  2UXC K;  3H46 O;  1HNX K;  3LDO A;  3AVM A;  5C12 A;  4B3T K;  4JYA K;  3TAR A;  4AHC A;  5EOY A;  3QLH A;  4BE2 A;  4ZHR A;  3U3G A;  4O44 A;  3FFI A;  4DB3 A;  3CPE A;  5C10 A;  2D0O A;  3S41 A;  4CF0 A;  4BC5 A;  4DSF A;  4CJ5 A;  1W2B M;  4FZX C;  4JD2 B;  5EXW A;  2VGM A;  3TR8 A;  4E19 A;  2P5O A;  1VQ9 N;  2X78 A;  3AO5 A;  3KWG A;  1KFS A;  3G10 A;  1XC9 A;  1RT4 A;  4OKJ A;  1NGE A;  4CFC A;  2RPI A;  4B8A B;  5JMV A;  1VQ7 N;  1UA1 A;  4B1Z A;  4DTX A;  4IXC A;  4ELV A;  4OVL A;  1P8Z A;  1HRH A;  4DR4 K;  3QNN A;  2E6L A;  4FO0 A;  3P4I A;  4HCC A;  4G9Z A;  1LWF A;  1QQO A;  4DWI A;  1VSF A;  3CCU N;  1IBK K;  2G8K A;  1I39 A;  1TK0 A;  5AQF A;  4CEO A;  4E89 A;  1TYQ A;  3M6G A;  1U48 A;  2FXU A;  3TTC A;  3D2E A;  3A5N C;  1VK0 A;  3DWL A;  5HRN A;  2HVI A;  4BVP A;  3VQE A;  1GLF O;  5ELZ A;  2HND A;  1JLC A;  1B92 A;  2H3G X;  1JXE A;  4Y0W A;  3M8Q A;  1Q81 O;  2HHV A;  4JKB A;  3O1B A;  5AQZ A;  2W6L A;  5HOO A;  4CK1 A;  3R3L A;  4FW1 A;  1WB9 A;  3DRS A;  4CJW A;  3HST B;  3WUH A;  4LH4 A;  2DY4 A;  3ZSV A;  4ILJ A;  3KK1 A;  2D4W A;  2P9P B;  4NCB A;  4LC9 B;  3VMF B;  3EY1 A;  3NFA A;  2OPP A;  3I33 A;  3V1R A;  3SYZ A;  3V81 A;  3VF4 A;  3CET A;  1T05 A;  2QK9 A;  2KQ2 A;  4CJS A;  4CEA A;  3HI0 A;  3QBW A;  3NE6 A;  3MN9 A;  1NK8 A;  3LP3 A;  4CHP A;  3WXM B;  4B08 A;  3H3O B;  1JLE A;  4DKW A;  4DTJ A;  1C0T A;  4HVJ A;  1RBS A;  5LY3 A;  3VQ6 A;  1VRU A;  3H3N O;  3LDS A;  3VEW A;  1NK0 A;  3DRR A;  3L0Q A;  3VEZ A;  3THV A;  5E84 A;  4M7X A;  4CJR A;  4H0Y B;  3ZT1 A;  1KSP A;  3D6R A;  1HKB A;  3HTV A;  3IDH A;  4NLB A;  4WQ4 C;  4BVO A;  4IFY A;  4E0D A;  5CR4 A;  2XY5 A;  4A5B A;  1WAF A;  1DTQ A;  3ENO A;  5FRO A;  3THY A;  2LSN A;  3ZSX A;  3R1X A;  3RMC A;  2HF4 A;  2HBJ A;  2D0C A;  5C24 A;  5M1Q A;  1TKX A;  1CZA N;  3W3D A;  3CQX A;  4BR0 A;  4BRA A;  4KI6 A;  4L8R B;  1GLA G;  2QWM A;  4MO5 A;  2FF3 B;  3T1H K;  3V6D A;  4O55 A;  3I8D A;  3UKU A;  4LSL A;  3K5M A;  1S1U A; 
#chains in the Genus database with same CATH homology
 3RMD A;  4IG0 A;  4CGD A;  1L5U A;  2KZZ A;  1KLM A;  4FK4 A;  4ID1 A;  5FDL A;  5SWM A;  1SKW A;  2HW3 A;  1G15 A;  4FJH A;  4C8O A;  1VRT A;  2D0B A;  4CJF A;  1BQN A;  1VSK A;  4CCH A;  1B9D A;  4F4K A;  4BE0 A;  2ATQ A;  3ZSW A;  1VSD A;  2BGG A;  3DLK A;  4Z4C A;  3SQ0 A;  4AHS A;  4FJ5 A;  2X6N A;  1KTQ A;  3VQ9 A;  4F8R A;  2E4L A;  4J2D A;  4E7K A;  1RTD A;  3SJJ A;  5E41 A;  1KVB A;  1RDB A;  2HNZ A;  2QKK A;  4FK0 A;  4PWD A;  1HNI A;  1U04 A;  1RBV A;  3O3G A;  4FVM A;  4OKE A;  4Z4F A;  3NCI A;  4CJT A;  3RMB A;  5HP1 A;  3QET A;  1ZBU A;  1HPZ A;  4CEC A;  4XIU A;  4CF2 A;  1ZYQ A;  3SQ2 A;  3LP2 A;  3KKR A;  3TAP A;  2FBT A;  3SQ1 A;  3QNO A;  4CHZ A;  2DFH A;  3AVG A;  3RR7 A;  1J5O A;  4AH9 A;  3JYT A;  4CIE A;  1SL0 A;  3QIO A;  4F3O A;  2OYQ A;  4WE1 A;  3V9X A;  3QEX A;  1IO2 A;  3NF8 A;  3ZSO A;  2VWJ A;  1QTM A;  4F3T A;  4FXD A;  4O0J A;  1TAU A;  4FJM A;  5HRS A;  3ZSZ A;  1YTU A;  1QHT A;  3ZT4 A;  3WNF A;  3JSM A;  3AVB A;  4FYD A;  3KK2 A;  4QCL A;  5C42 A;  3PX0 A;  4DSJ A;  5JS1 A;  3AV9 A;  1FKO A;  3IAY A;  4HCB A;  1A5W A;  1U4B A;  3V9W A;  3AVK A;  4M3Y A;  3SCX A;  3NAE A;  3OS2 A;  4PA1 A;  4DLE A;  3VQ5 A;  3DLE A;  4H4O A;  1CLQ A;  2HHX A;  4LH5 A;  2YHA A;  3QEP A;  1UAX A;  4CGG A;  1TK5 A;  4FJ7 A;  5CZ2 A;  1J54 A;  3F73 A;  5J2M A;  2KZM A;  3OVN A;  1C1C A;  4M41 A;  1NJX A;  3CG7 A;  3OYA A;  4DTS A;  1HYS A;  3O3H A;  3I0R A;  3HP6 A;  3V4I A;  1IG9 A;  4ID5 A;  4RW7 A;  4N56 A;  1BI4 B;  2IOC A;  3HPH A;  3OYE A;  1HQU A;  4NCA A;  3D45 A;  4KRE A;  3ZCM A;  3OYC A;  1RTI A;  3QER A;  3NGZ A;  2PZS A;  1WSE A;  4FJJ A;  1HNV A;  1RT1 A;  2O4G A;  1SUQ A;  1UA0 A;  4MFB A;  5SZT A;  1FK9 A;  1EKE A;  1NOZ A;  4M3R A;  5HRO A;  4AHR A;  1X9W A;  1N6Q A;  1WSI A;  1WSJ A;  3ZSR A;  1IKW A;  4LY7 A;  1TKT A;  4CJV A;  3V9Z A;  4F2R A;  4M42 A;  2Z1H A;  2B4J A;  4CJP A;  1D5A A;  3OYN A;  3AVN A;  1Z25 A;  1C6V A;  3SV4 A;  4KHS A;  2AJQ A;  2XO7 A;  2OPQ A;  4KB0 A;  1S5J A;  4CFD A;  4EP5 A;  3KK3 A;  4W5R A;  1BGX T;  4B9T A;  3F9K A;  3DI6 A;  1QSY A;  3OJU A;  3TAG A;  3OYG A;  5EU7 A;  4KKO A;  3HVR A;  3RTV A;  1WSH A;  3SUQ A;  2O4I A;  1RNH A;  1RTJ A;  4EZ6 A;  2RKI A;  4DMN A;  1TAQ A;  1D9D A;  4H4M A;  2OA8 A;  4CF8 A;  4B9U A;  4M3T A;  1EP4 A;  4FCY A;  1BIZ A;  3AO4 A;  1X9M A;  2FC0 A;  4GVM A;  4JLH A;  3CQ8 A;  3G0Z A;  3C6T A;  4GMJ B;  1BIU A;  4DSL A;  1KRP A;  4CJK A;  3LZI A;  3LPU A;  5I3U A;  3NH0 A;  2XY8 A;  4B9M A;  3AA2 A;  3LP1 A;  4KTW A;  1VSI A;  4AHV A;  1BCO A;  2IAJ A;  4EP4 A;  2PYL A;  2HHQ A;  4C8K A;  2P1J A;  4QAG A;  1BIS A;  4BDY A;  3LAL A;  3ITH A;  3TAM A;  4CFB A;  2YNG A;  3DYA A;  1TK8 A;  4CGH A;  1SKR A;  3VN5 A;  4C8N A;  4CFA A;  1IKV A;  3OS0 A;  1L3U A;  1ZBI A;  2G8I A;  4FLX A;  1NKC A;  3VA3 A;  3KKS A;  3DOK A;  4CED A;  4KPY A;  1BL3 A;  3C6U A;  3K5N A;  4BWJ A;  1ZBL A;  4KTQ A;  3DMJ A;  2OZS A;  3NH2 A;  5KTQ A;  2A1R A;  3UIQ A;  2Z1J A;  1YVU A;  4ZTF A;  3NF9 A;  1REV A;  4O0I A;  3AVL A;  1KVC A;  4E1N A;  3MEC A;  2F96 A;  3CFO A;  2G8V A;  1L3V A;  4ELU A;  3OY9 A;  4FM1 A;  4DFK A;  4YNQ A;  3HPO A;  1S9E A;  3VQ4 A;  3OYJ A;  2JGU A;  1LW2 A;  4DU1 A;  3VQA A;  3VQQ A;  4NCG A;  3KLI A;  3O4Q A;  5J2P A;  3BDP A;  4E1M A;  1ZBH A;  4DTN A;  3RRH A;  3HT3 A;  3MEE A;  1Q9X A;  1RT6 A;  4KHU A;  1XHZ A;  5K14 A;  3AO2 A;  1J53 A;  3DM2 A;  1JLF A;  3WNE A;  2Z1I A;  1RDD A;  4CGI A;  4DG1 A;  4ICL A;  4DQP A;  2KFN A;  2KFZ A;  1JLG A;  2KTQ A;  4DF4 A;  4CE9 A;  5FRM A;  1XI1 A;  3AVJ A;  4E7J A;  4GW6 A;  4N41 A;  3V1O A;  4RW9 A;  1T8E A;  4JRP A;  1A5V A;  4DSE A;  1KLN A;  4Z4H A;  1VSJ A;  3MED A;  1HMV A;  2ETJ A;  1HYV A;  4N47 A;  3VQP A;  3DLR A;  2RN2 A;  3QEV A;  4KO0 A;  3T19 A;  4DFJ A;  4CJ4 A;  4CEQ A;  3SPZ A;  3ZSY A;  3A2F A;  1WAJ A;  1CXU A;  4FLV A;  3S3O A;  4CHO A;  4W5N A;  2Z1G A;  5CYQ A;  4B8C A;  2G8U A;  1WSG A;  1WLJ A;  2X74 A;  4I9L A;  4KHW A;  4HHT A;  3OYI A;  4BDP A;  4RW8 A;  1ASV A;  1W9H A;  4W5O A;  2XY6 A;  1QS4 A;  3QES A;  3E01 A;  1L3T A;  4FM0 A;  1I3A A;  1S1W A;  2BAN A;  4FLU A;  1GOA A;  2P51 A;  1D8Y A;  3RRG A;  3VQB A;  4AHU A;  4FJG A;  1F21 A;  3OYK A;  3V9S A;  3K57 A;  4DQQ A;  4IBN A;  4CK3 A;  4J2B A;  3PY8 A;  2PYJ A;  5CZ1 A;  4DQR A;  2D0A A;  3SUO A;  4PUO A;  2WON A;  4PQU A;  1RTH A;  3I0S A;  1NOY A;  4OGC A;  5HRR A;  3L3V A;  4CK2 A;  3SUN A;  4DF8 A;  4JS5 A;  4IFV A;  1X9S A;  3NGY A;  4DSK A;  4N5S A;  3IRX A;  3VQC A;  5DMR A;  5J2N A;  3DLB A;  4KHQ A;  3ASM A;  5J1E A;  3AVA A;  3TAE A;  1TL1 A;  1IKX A;  1S1X A;  2YKN A;  3EYZ A;  4FJL A;  4I9Q A;  4KHY A;  4FW2 A;  4OLA A;  2GV9 A;  4M45 A;  4IKF A;  3HP9 A;  4AHT A;  3D0P A;  3NDK A;  4E7H A;  4F2S A;  3TWH A;  4BE1 A;  1QQC A;  3TI0 A;  3KLG A;  5T7B A;  1RBU A;  4DTM A;  1NK5 A;  4CEF A;  4Z4G A;  1JL1 A;  2Y1J A;  4M3Z A;  3SQ4 A;  4KHN A;  3AVI A;  2Q3S A;  1O1W A;  3M8S A;  2G8F A;  3MXI A;  2Y1I A;  4CEZ A;  4DTR A;  3VQ8 A;  5C25 A;  3LZJ A;  1GOC A;  3MAQ A;  3ISN C;  2HHW A;  4CER A;  4QOZ B;  3OYD A;  1NKE A;  4CEB A;  1RBT A;  1TVR A;  1FKP A;  2OPR A;  2ZQB A;  3OYM A;  1QSL A;  1UOC A;  3CM6 A;  4MQ3 A;  3KIO A;  3QEW A;  3PO5 A;  1JL2 A;  2YNF A;  4C8M A;  4CHY A;  3L2U A;  3OYF A;  1JLA A;  3L8B A;  1VSM A;  1JLQ A;  3NF7 A;  3NH1 A;  3SV3 A;  1NK4 A;  1CXQ A;  4FJ8 A;  1A5X A;  4FK2 A;  1SKS A;  1RDA A;  3RWU A;  2YNH A;  4FLY A;  4KAZ A;  3VQ7 A;  4HUF A;  4FM2 A;  1WN7 A;  1XHX A;  1C0U A;  3AA4 A;  1HJR A;  1TGO A;  4CJU A;  2E6M A;  3U6F A;  2PY5 A;  3LAM A;  4G1Q A;  2B6A A;  4M3U A;  4AIL C;  1LAW A;  1LWE A;  1UWB A;  1QSS A;  4Z4I A;  3P5J A;  1ASW A;  4LD0 A;  3V9U A;  2IS3 A;  4DS4 A;  2XY7 A;  1VSL A;  3T1A A;  1FXX A;  4LSN A;  3QEI A;  1KCF A;  3PV8 A;  4CEE A;  3KJV A;  3CYM A;  3AVF A;  3M8P A;  1XWL A;  2F8T A;  2HB5 A;  1JLB A;  3KLE A;  1BQM A;  1JKH A;  4NYF A;  3AVH A;  3QIN A;  4E7I A;  3PX4 A;  3KTQ A;  4K8X A;  2G8W A;  4DQI A;  4KTZ A;  3OYH A;  4FLZ A;  4RG8 A;  1WSF A;  2KW4 A;  3OYB A;  4DS5 A;  1N5Y A;  1IH7 A;  5KRS A;  2BE2 A;  4I2P A;  2QKB A;  1D9F A;  4FZZ A;  3L2R A;  1NK6 A;  4K8Z A;  4W5Q A;  3AVM A;  3ZSQ A;  3TAR A;  4AHC A;  3QLH A;  3OJS A;  4BE2 A;  4B9N A;  1LW0 A;  4ZHR A;  4OKK A;  4O44 A;  1EXQ A;  3U3G A;  3FFI A;  1ZBF A;  2IGI A;  4ZTJ A;  1T03 A;  3KD5 E;  4Y1C A;  1KVA A;  1SV5 A;  1EX4 A;  2R7Y A;  3AA5 X;  4DFP A;  3IS9 A;  2X6S A;  5FRN A;  4CF0 A;  4DSF A;  1RT7 A;  4CJ5 A;  4FJ9 A;  4H8K A;  4KI4 A;  3S3N A;  1RT5 A;  3TAQ A;  1YTA A;  4FZX C;  2GBZ A;  2HVH A;  2P5G A;  3TAN A;  3TR8 A;  4YFU A;  4E19 A;  5HRP A;  3CFR A;  3C95 A;  2X78 A;  3AO5 A;  4HUG A;  2P5O A;  3LWM A;  3V1Q A;  1Z26 A;  1C1B A;  4BWM A;  1KFS A;  2HHU A;  1U47 A;  1RCH A;  1EET A;  3G10 A;  1XC9 A;  3MEG A;  3HXM A;  4B9S A;  1NK7 A;  1BCM A;  5D3G A;  1RT4 A;  4OKJ A;  4CFC A;  4Z4E A;  2RPI A;  4Q5V A;  2G8H A;  3KD1 E;  4BDZ A;  4B8A B;  4KB1 A;  2FBY A;  1NJZ A;  1HYZ A;  1UA1 A;  3SZ2 A;  1C1A A;  1K6Y A;  3L3U A;  4OPK A;  3K58 A;  4DTX A;  4C8L A;  4FJK A;  2GUI A;  2ZE2 A;  4ELV A;  1TKD A;  4OLB A;  4DTP A;  3L2Q A;  4B3O A;  4KRF A;  1RBR A;  3ULD A;  1TKZ A;  3HPG A;  3LAN A;  5KGW A;  4OVL A;  1HRH A;  2HNY A;  2VG5 A;  3ZT0 A;  2E6L A;  1JXB A;  2XHB A;  4DQS A;  3QNN A;  4CIG A;  4HCC A;  3ZT3 A;  3DLH A;  2B5J A;  3CM5 A;  1B9F A;  1LWF A;  2RF2 A;  1KFD A;  2OPS A;  1HQE A;  3NHG A;  4DTU A;  1R0A A;  2JLE A;  4DWI A;  4FZY A;  2QXF A;  1S1V A;  3AO3 A;  1ITG A;  1VSF A;  2VG7 A;  4IDK A;  3KLF A;  4DU4 A;  1LV5 A;  2G8K A;  2WOM A;  3HL8 A;  3AVC A;  4CHN A;  1I39 A;  1TK0 A;  1L3S A;  4CEO A;  1C0M A;  4E89 A;  1S6Q A;  1U48 A;  2D5R A;  1BI4 A;  3MXJ A;  1ASU A;  4CES A;  4CGF A;  3AA3 A;  1VK0 A;  2FBX A;  5HRN A;  3HYF A;  3MXM A;  2HVI A;  1DTT A;  3HJF A;  1X1P A;  3VQE A;  5CY4 A;  4EZ9 A;  4FJX A;  4M3W A;  2HHT A;  2DTU A;  4RW4 A;  1VSH A;  1W0H A;  2HND A;  5HBM A;  1JLC A;  1GOB A;  2A1S A;  4CJ3 A;  1B92 A;  1JXE A;  4PY5 A;  3IG1 A;  1DLO A;  3M8Q A;  2OZM A;  3K2P A;  3NF6 A;  4IG3 A;  2W42 A;  1LAV A;  3RMA A;  2HHV A;  2ITG A;  5HLF A;  4HTU A;  2DFF A;  3B6P A;  4CGJ A;  4CK1 A;  2YHB A;  3K5L A;  3TAB A;  3SNN A;  4FW1 A;  5JS2 A;  1WNS A;  3PX6 A;  3S9H A;  1Q9Y A;  4CIF A;  3DRS A;  4TSX A;  1LWC A;  2I5J A;  3P83 D;  4CJW A;  3L2W A;  3HST B;  4B9L A;  5KI6 A;  4LH4 A;  3PUF A;  3HO1 A;  1NJY A;  3O3F A;  3H08 A;  2DY4 A;  3QO9 A;  1Q8I A;  1TL3 A;  3ZSV A;  4CF9 A;  3LP0 A;  3NBP A;  3KK1 A;  4NCB A;  3OS1 A;  1RT2 A;  3EY1 A;  3NFA A;  2OPP A;  1RDC A;  3TAF A;  4CJE A;  3SPY A;  4J2E A;  3V1R A;  3SYZ A;  4DU3 A;  3QIP A;  4DFM A;  3V81 A;  1T05 A;  2QK9 A;  2KQ2 A;  4CJS A;  3RR8 A;  4CEA A;  3NE6 A;  3LPT A;  4Z0U A;  1NK8 A;  3VQD A;  4BAC A;  3LP3 A;  4O4G A;  4ELT A;  4CHP A;  1IKY A;  4DLG A;  4CF1 A;  3NGI A;  4B08 A;  1YT3 A;  4O5B A;  3C94 A;  2YNI A;  1JLE A;  1RIL A;  4DTJ A;  3LAK A;  4OJR A;  4OGE A;  4UQG A;  1C0T A;  4HVJ A;  4FJI A;  3M8R A;  4FLT A;  4CHQ A;  3KLH A;  5I42 A;  1RBS A;  3VQ6 A;  3WNH A;  1VRU A;  3LDS A;  2HHS A;  4E3S A;  1NK0 A;  4CJL A;  4B9V A;  3DRR A;  4FLW A;  4I2Q A;  4RW6 A;  3THV A;  3DRP A;  5KGX A;  1MU2 A;  1SL2 A;  4DSI A;  3HK2 A;  1T7P A;  2VWK A;  4CJR A;  1SL1 A;  3T3F A;  2IC3 A;  3ZT1 A;  4OPJ A;  1KSP A;  4NYN A;  4KV8 A;  4Y1D A;  3SUP A;  1NK9 A;  4IFY A;  1TV6 A;  3SI6 A;  2YKM A;  4I7F A;  3ZT2 A;  4E0D A;  2XY5 A;  3ALY A;  1WAF A;  3DOL A;  3HVT A;  4E7L A;  1DTQ A;  4FJN A;  1U45 A;  3O4N A;  3K59 A;  1S6P A;  5FRO A;  4J2A A;  2LSN A;  3ZSX A;  3EZ5 A;  1J9A A;  3VA0 A;  2FBV A;  4DTO A;  3WNG A;  2HMI A;  1S1T A;  1RT3 A;  2NUB A;  4HUE A;  4CJQ A;  3K5O A;  4W5T A;  2BDP A;  3RMC A;  1Y97 A;  2ZD1 A;  1BHL A;  3B6O A;  3P1G A;  4N76 A;  1NJW A;  1CZ9 A;  2D0C A;  5C24 A;  1CZB A;  1TKX A;  2DFE A;  3U3Y A;  2VG6 A;  3S3M A;  1U49 A;  2YV0 X;  4JS4 A;  4M3X A;  3HM9 A;  3DLG A;  2IDO A;  5KRT A;  3AO1 A;  4KI6 A;  3BGR A;  5DK5 A;  2XRI A;  5CYM A;  3CFP A;  3PO4 A;  4L8R B;  4JRQ A;  5J2Q A;  3L2V A;  1NKB A;  4R5P A;  1VSE A;  3OYL A;  2EHG A;  3LWL A;  4Q0B A;  1QE1 A;  1S9G A;  3V6D A;  4O55 A;  2EX3 A;  3I8D A;  4KFB A;  4LSL A;  2F8S A;  3K5M A;  1S1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...