3WNIA

1.50 a resolution crystal structure of dioxygen bound copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Crystallographic evidence for side-on dioxygen trapped on type 2 copper in copper-containing nitrite reductase
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
total genus 98
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wniA00
1JZGA 1JZJA 1L9QA 2CJ3A 4BWTA 3RYMA 2I7SA 2R7EB 1JVLA 4EF3A 2W8CA 4AI7A 2CUAA 3OMIB 3FU7A 3NJHA 1PNDA 2GC4C 5B7EA 2X88A 2BP8B 5B7FA 2DWTA 1NPNA 2H5UA 2MRYA 4PAZA 3HEIB 4KOCA 4UF7C 2PPEA 1JZEA 1XB6A 3PAUA 3S3DB 2IDSA 1AZRA 2YAOA 3WNIA 2UXGA 4DP5X 4GP4B 3T71A 4JKNA 1J5DA 2UXTA 2YAMA 1ET8A 3SBQA 1J9QA 1E5YA 4KNSA 4M3HA 3ZIYA 2QDWA 2PPFA 2PPAA 1ZV2A 1AANA 1KYAA 1AG6A 2FQFA 1GY1A 3EHBB 3PAVA 2VSKB 3FU7B 3S3CB 4MFHA 3ASNB 1HAWA 3PAZA 1OE3A 5I6PA 3FPXA 3IBOA 1GS8A 3NJKA 5PCYA 3T6XA 3WKPA 1ASQA 1JZFA 1L9TA 2UXFA 3CZUB 4HHWA 4A2DA 1ILSA 4YSRA 3X1NA 2YARA 2I7OA 3KW8A 5AZUA 1IKOP 4AZUA 1ZDSA 2FT8A 3QJUB 4G7QB 5AFAA 4M4RB 1NDTA 1AS7A 3SQRA 3AZUA 3WNJA 5D4HA 4HALA 5I6OA 1GS7A 1F56A 1X9UA 3ABKB 4NAJA 1L9OA 1JXFA 1NINA 1A3ZA 5I5MA 2HZHA 2WO3B 1YLBB 2X87A 3SBRA 3QJTB 1PLAA 3OM3B 2YQBA 1ETJA 3UADA 3T6VA 4AKOA 1NPJA 4DP8X 2EIJB 1PY0A 5I28A 2BW5A 4FA7B 2CBPA 3FPYA 1HAUA 3FQ1A 1SF5A 3AG1B 1SFDA 4PCYA 4A2HA 1OF0A 4KO9A 5FC9A 4DP9X 2YAHA 2HX7A 2XV3A 3QJQB 4N4YB 5B1AB 2DV6A 3UACA 1GSKA 5B1BB 2J57A 3QQXA 2Q5BA 4W1TA 3FSWA 4DP6X 1SNRA 3TBCA 4HCGA 1CURA 1BXUA 1PZBA 2IWFA 1QHQA 3WI9A 2GC7C 3V9CA 2R7EA 1KCWA 4ENZA 4HCIA 4DP4X 2EILB 1BXAA 5I6KA 2DYSB 2IAAC 2BP8A 4YSPA 2YXVA 3AW5A 3BQVA 1TEFA 5EHFA 2PP7A 1KCBA 3TBBA 7PAZA 1M56B 1OE1A 5I6NA 2IDFA 1N68A 1A4AA 3S8GB 4P5SA 3DKHA 4F7KA 9PCYA 3HB3B 4HCFA 1JERA 1PLBA 3N55A 3X2QB 4RH4A 3NP4A 1AZBA 2IDUA 1X9RA 4QKTA 3FU9A 3ABLB 1KBVA 2VN3A 2YXWA 2IDQA 1J5CA 4YSTA 3TU6A 1BQKA 1JZHA 1PCSA 1E30A 1OV8A 2A3TA 3D12B 4A2FA 4E9VA 3QJRB 3X1EA 2XV0A 3MBWB 3CVCA 4FAAB 1ET5A 2ZXWB 1OCOB 3CG8A 4CSZA 1ADWA 1KGYE 1M9WA 1PAZA 2PCFA 1CYWA 1GYCA 4NB7A 2FT7A 4YSDA 1SHXA 2UXVA 2GB2A 1BYOA 4N8UA 3GXUB 1E5ZA 2XUWA 1SDDA 4A2EA 4Q8BA 4BK5C 5I6LA 2AZUA 1RCYA 4HAKA 4P5RA 4GYBA 2B08A 2LLNA 3UABA 4DP0X 8PAZA 5I6MA 1E67A 1IC0A 1WAEA 1ASOA 3FYEB 5A7EA 1IBZA 3QPKA 2PP9A 1WA2X 3PLYA 1IUZA 3NSYA 1W8EA 2PP8A 3CVDA 3NSFA 4YL4A 7PCYA 1PLCA 2VSMB 2GBAA 1NWPA 4G71B 1GR7A 4GY4A 4F2FA 1L9SA 1SF3A 1NIFA 4G7RB 4DPAX 3JT2A 1SDDB 4DPBX 1W6WA 1E65A 1FWXA 1WS7A 2HLEB 1TEGA 2PPDA 3ASOB 4Q89A 2XXGA 5B1JA 4A66A 4YSSA 1CUOA 2DYRB 3FT0A 4JHUA 1PF3A 4BDVB 1ID2A 2P80A 3ABMB 2YAPA 2BWIA 1VLXA 5I5IA 5E9NA 1J9RA 2XX0A 2XWZA 4YSCA 1BYPA 3H4FA 1PZCA 2FT6A 1V54B 1NICA 1URIA 1MG2C 1XMEB 4X4KA 2EIMB 2GIMA 3NJJA 4DP2X 2JFCA 4A68A 3ZDWA 5LDUA 4E9QA 2P80D 2TSBA 3CDZA 1R1CA 1MZZA 4G72B 1W6LA 2HRGA 2FQDA 2QDVA 1ASPA 2JKWA 1M57B 1AS8A 2QT6A 3QJSB 3NJFA 4BWWA 4UAHA 1NWOA 1AIZA 1NIBA 3H56A 4KOBA 2IDTA 2Q9OA 4BWUA 5IY5B 5B3SB 5D4JA 3ABGA 2BZ7A 2BZCA 1JXGA 1A4BA 1ZIAA 4K9JA 5TK4A 2YAFA 3OMAB 2AZAA 2VW4A 2VMJA 5B7MA 3EH4B 3V9EA 1GY2A 2B3IA 3ZBMA 1OE2A 2BW4A 3NJIA 3CDZB 2IWEA 5B1KA 1V55B 3BVDB 2BWDA 2MTAA 4CSPA 3DIVA 3C75A 1AACA 2Y69B 1AZCA 1NIAA 2BO0A 1OOWA 2VM3A 4G7SB 2EINB 2GI0A 3QJVB 4NERA 1PNCA 1RKRA 5I5JA 2PPCA 2ZONA 4HZ1A 1WA1X 4KO6A 4WKXA 1DYZA 2CALA 4L0PB 1AAJA 4HHGA 2HXAA 4DPCX 4AX3A 3GDCA 1CYXA 2DY2A 4YVUA 1V10A 1WS8A 2XV2A 1SFHA 3GYRA 2XX1A 3WIAA 1EZLA 3NSCA 2QPEB 5TK2A 1ILUA 2J55A 2VW6A 1CC3A 4A2GA 4ZK8A 1OCRB 2UX6A 1UATA 2W88A 1AS6A 4A67A 2I85A 1XB3A 3U25A 3NP3A 4E9XA 4DP7X 6PCYA 2IH8A 2CCWA 3FSZA 2GHZA 4GXFA 4KNUA 3TA4D 3FQ2A 1KBWA 4BDVA 3EH5B 2OCCB 1SHWA 2FTAA 3WG7B 1GW0A 2FQEA 1AR1B 1AZUA 1KDIA 1I53A 3IN0A 1MG3C 2IWKA 3NJGA 1J9TA 1BQ5A 1XB8A 1JZIA 3KW7A 3T6WA 1ZDQA 1BEXA 2WSDA 4HIPA 1T5KA 1KV7A 3N2JA 3PCYA 3X1BA 3SBPA 5F7AA 6PAZA 3L45A 3AG4B 2BP0B 3OMNB 3T6ZA 2GSMB 3DTUB 3PXLA 3IN2A 3X1FA 2XVBA 2FWLB 3FYIB 1HFUA 2FNWA 2VW7A 2XXFA 3FU8A 3NJMA 4GP8B 2OV0A 1RZPA 2TSAA 2VM4A 2WO2B 3TASA 1JOIA 3G5WA 3CVBA 2J5WA 1N70A 1GS6X 2H3XC 1BAWA 2HX9A 4QLWA 1BXVA 4JHVA 3AY2A 2XU9A 3T9WA 3OQRA 4KNTA 3AG3B 1AZNA 4YSAA 2ZWNA 4AKPA 1B3IA 2HX8A 3FS9A 1PZAA 1AOZA 4TXVB 2UX7A 2HRHA 3FQYA 1J9SA 1SJMA 2AANA 3JTBA 4G70B 4YVNA 4DP1X 1NIDA 1DZ0A 1IBYA 3UAEA 3EF4A 4YSQA 1EHKB 4W9ZA 1TU2A 3AG2B 2YAQA 1TKWA 2FJSA 1ZPUA 3NSDA 3PPSA 5PAZA 3NT0A 2CAKA 3ERXA 1WA0X 1MZYA 2H47C 3FSAA 3EH3B 1JVOA 2Y1AA 2JXMA 1L9RA 3S3BB 4YSOA 4BXVA 4E9SA 3MX0B 4E9YA 1AQ8A 4GP5B 4BXSV 2OJ1A 2XLLA 1RZQA 1ZIBA 5AKRA 2XYBA 1NIEA 1QLEB 1FFTB 1AG0A 3NJNA 2EIKB 2ZOOA 1QNIA 4AKQA 2IH9A 2PCYA 3IE9A 1OCCB 2AFNA 1ET7A 5B1JC 4F2EA 1MDAA 4E9WA 3UGEA 2DWSA 3X1GA 1FA4A 2FQGA 1L9PA 1JXDA 4E9TA 1BQRA 2BHFA 3OD3A 2AVFA 1NZRA 2N0MA 2RACA 4UANA 3UAAA 5F7BA 3S8FB 3WKQA 1OCZB 2E86A 1A65A 5I26A 1PMYA 4WTQA 3NJLA 2NRDA 5ANHA 1KDJA 3H4HA 3NYKA 2QPDB 3ZX1A 4E9RA 5D4IA 2YAEA 1A4CA 4YSUA 2J56A 4KO5A 4KO7A 4YSEA 1NTDA 2BP0A 2PLTA 3IEAA 1A8ZA 3FSVA
chains in the Genus database with same CATH superfamily
3DJTA 1U0QA 3S37H 1MI5D 2P24A 4QOKD 5LDSA 4J4PA 4P5TC 4X8JB 3PP4L 1CFQB 4OCXH 3DGCR 1AO7B 4LVOB 5TQ2H 4NO2B 1WDAA 1E4XI 3SE3A 3W11C 4RWYH 5C3TA 2V3DA 3QDHA 2CJUH 2XPGA 2EDKA 1MI5E 4QOKE 3ZTJH 3VFSB 3GSOA 3QPQC 4PAZA 4QOKB 4Q7DA 1LVEA 1KZYA 2OJZH 4JFYB 4W9CC 3AXLB 4ZAKC 1KBBA 1QTYT 3OKMA 3ARDD 1Q9WA 2BNRA 2H32A 2OMWA 2YUWA 5JO5A 5C70A 1JZ6A 3V7AG 3PWUA 5D4QA 1K5WA 1D5ZA 4NXSA 2XBDA 3QWRD 3MJ7B 5JPMA 2I69A 3UP1A 1JFQH 1S5IH 1QLEL 3ARDB 3PP3H 4PTUB 1UTDA 1TJHH 1INDH 3QZWA 3S36X 4QTIH 3DIFB 3KJ6L 4FQQA 1OSZB 3RWHA 1UHVA 3ASNB 1IGCL 1H3UA 4UAOB 3T2NH 5I6PA 1HOEA 1DE4B 4KPHL 3VD4A 3V79C 3OHXC 5CD3B 3T6XA 1AMXA 5DYOB 1R3JA 1X5FA 4PBVC 5AL8A 1E9OB 1KTDB 2RD0A 2ZUQC 4HCRA 1P7KB 3Q5YA 2CLVA 3VYNA 1ODUA 1E3XA 1LNUA 3L5XH 4RMUA 3X1NA 3Q13A 2DN7A 3ZLQC 4QXGL 3CGTA 2UZYA 3SPGA 3SGEI 5D7HA 4PRAA 1SEQL 1S78C 2QTEA 3ESNA 3QCTL 2AGJH 2L0DA 2E7BA 4F9PC 1U2CA 3AM8A 4M6MH 1BWWA 3VFVB 4OIFA 3T0BA 2ORBL 4HWBL 1F5WA 1JWMA 1U91A 2X3CA 3A0OA 4XNZC 4Y2DD 4Z7IA 3SYPA 4YS4A 1BOGA 2WO3B 2FJHB 1OB1B 1UM6L 2M26A 3QVAA 4MQXC 3KVPA 3G6DL 3A67H 1JN6B 1KFAH 2V9RA 4PJBE 1YEFL 5HGHB 2OX5B 4Y2DB 4FA7B 1UGNA 1U8HA 4JFTA 1L7TH 4F7PA 4JZJB 3N9GL 2ZWSA 2J21A 1A1NA 1JGUL 1MFMA 1MFDL 4XXDB 3H3PL 4PVMA 2WXQA 3KDMB 5B1AB 5DR5L 4OR1A 2Q76B 3VD5A 3FQUB 5I0VA 1OQOA 3WXWL 1IO4C 1BJ8A 1TZGL 3BAKA 2W95A 4OLYL 3LN5B 2J4WH 2NOYA 4IRZA 2VXTL 4NQDB 2WKOF 4XOAA 3IVKB 5B22A 3DX6A 1K72A 1EH9A 5D7IE 2JQAA 2CKNA 1NCTA 2NY5H 2WLJA 3EJPA 1OAQL 1UXMA 1WGOA 4OV6F 1PZUB 1WFTA 4WI6A 2BSDA 1KXTA 1W72B 1CXEA 4X6DB 5JXAH 2H6OA 3VFUA 5BQ7B 4LF3B 5H2BA 2NY1D 4P5SA 3W39A 5FKPA 5CNHA 2IG2L 5HVGB 3NDYE 3PJSA 4I9WD 4W6WB 3K81A 1MNUL 4RAHA 4KJQC 1GZPB 4ZMTA 5IHZB 2OTPA 1RUQL 5E1HB 5JUEH 4XNAA 1FIEA 1QFWI 2DQJL 3EOTH 4NZDA 3HZVB 3SGJA 4I9WE 4YPGB 4J39A 1PG7X 4ZFFA 3W2DH 2A3TA 2GCYB 2WYIA 4IYKA 2Z31C 1X4XA 4Q9CA 3SPJA 1F3JA 1UH4A 2BM3A 2X2HA 4X0NA 5G4MA 3IM1A 3OC8A 4GSUA 5HHQA 4JY6B 4QGTA 4CSTA 1XX9C 2HWZH 3BN3B 2XWTA 4Z78B 2XJLA 3GSRA 2FIKA 3PV7A 3TA3D 4HH9B 5EZOL 3SOBH 1V3MA 4JR9H 2VKXA 4ZUWB 3WFHA 2GB2A 3OG6B 5G55A 4HXBL 3BDXA 4M62H 4P2RA 2PR9A 2CUMA 2FR4A 2DWEB 3IF1B 2R2HA 2VYRE 1G9NL 2ALWA 4OIIH 4EN3D 2XNAB 3ATFA 4QRRB 3EH1A 1GGCL 1LP9F 2JQMA 3I50H 5FA3A 4RGNC 5IW1B 3ZTNL 1WAEA 4H44C 2VJXA 2P47B 1IAIL 1VEPA 4Z77B 3Q6GL 3D2UB 3CSFA 1UD8A 1WCQA 3QEGH 4M03A 3RJQB 5HXMA 2WLYA 1JVKA 4HJIA 2FAUA 4PGBB 4HS6A 4OJDH 4EN3B 4CBPA 5AW3B 4FG4A 1RJYA 2V2WA 1HSAB 1UH3A 3A6BL 1G7LA 4PJDA 4LL4A 3GK8H 4YH6A 4NHUA 3FOMB 4G9DA 4K23H 1NIFA 1XZWA 3BW9A 3GHPA 3JT2A 4G8EB 1SDDB 1CLYL 3ULVH 1OHZA 2UY7A 2HLEB 3N0AA 4A66A 4OD3H 5EMYA 3FONA 3LKSB 1MFCH 3B2VL 3MTXA 4UU9B 2DIAA 3O3DA 4RCAA 1AXSB 4WO4B 3WY2A 3IXAA 4DGVH 3SKOA 1BEYL 1J9RA 1NCWL 4ZDHB 4CUCA 3P4OA 3BESR 3MXWL 3UTZA 5ESVA 3HAEB 5AW1B 4BKTC 4NO0D 4BKLA 4X8XA 2O61A 2ID5A 2BLFA 3ZYIA 3NIGF 4ODVH 4IOIA 1JL8A 4LU5L 43CAA 5AZEL 4LSSL 1V7NL 2WQAA 5ALBL 3EBGA 1UENA 4TQIA 1W6LA 5EA0H 1JPEA 2FQDA 4OCWL 1IKFH 3A4FA 4OCSL 3TT3L 5BXFB 2VWEE 2JKWA 2QT6A 1YPZF 2OQJA 3PIQB 1F42A 3VO0A 1NIBA 1TOXA 4JRXA 2ARWA 3TFKC 4XB8A 1O6SA 5AYQA 3MROA 1HCYA 1J05B 1MQKL 3DMMA 3I6GB 3MLYH 3GI9L 3NVQA 3E2HB 2QL1A 2AEQH 5EH1A 1XL4A 3EH4B 3OPZH 4PH8A 4KMTH 3M7OA 1EDHA 1AQMA 4MNGB 4WU7B 4PJEA 2YD7A 3X12A 3ZKNC 1U8NB 1UWXK 3VSQA 3ILQD 4KQ0A 3NJIA 2VDRL 2IWEA 4XVSL 4YHZH 2XICA 5E1AB 3MACL 4GUQA 3MU3A 3V5DA 2WHVA 3NPZB 4ENED 1MNNA 5AW2B 2V5RA 2R4SL 4GAJL 2QGEA 3ASWA 3BVDB 4R8WL 3F8UB 4TSBH 3TX4A 5KBLA 2VABA 3SIKA 1I3RB 2Y69B 4HOWA 2NXZB 2VDQH 1OOWA 3KXFA 4O00A 2G0LA 4FLHA 4G7SB 4XP5H 3X14B 1DSFL 1NUNB 4MB5A 4YHYB 1PNCA 2H1PL 2WGNB 3FB8A 5KANI 5LWYL 1JHLH 2YMXL 5TJWK 2XQYA 3S5LA 2KZKA 4O4YH 1J87A 4ATTA 4TUJA 1WGVA 3NH7L 4W9EC 1G1KA 1R4XA 2OZNA 3VI3B 4Z7QF 3MRQB 1HDMB 2AAAA 2FWOA 1IM9A 4M9PA 2QKIC 2AKRB 3MV7B 2FGZA 4HA1A 4M00A 4UQ9A 4F7MA 1P69B 1M7XA 4B7IA 5L8LB 4C59B 4QY8B 4GRLD 3E3QC 3MZTA 6PCYA 4KUZH 4UZGA 1S9KC 4B5ZA 4KNUA 1UASA 2AABL 2K8MA 3L6FB 2NYKA 1JFHA 3WDJA 3ZZQA 4QJ4B 2Y2YA 3FT4A 3MLZL 2D4FA 4A6YA 1RUMH 4M8RA 2DIEA 5C3IA 5FYJD 4HIPA 1KIQA 3OAUL 3FQTB 4DTGH 3HNSL 1TQBC 2X4QA 3MRFB 1KXQA 3SBPA 3HS0B 3KEDA 3K6SA 2AEPL 2ADGB 4MYPA 3T6ZA 5IBLC 1DR9A 4WO0A 1TQSA 4L1SA 5FYJE 4KZEL 4PJXF 4Y8AA 3MN8A 3U6XA 4WW2C 3LB6C 4WWKB 1BVKA 1EBAA 2YSTA 1HL9A 3BH8B 1QSFA 3IFLL 3D85B 5CLZA 4LL1A 4Y4FA 2VLRB 1BA9A 1FL6B 1GS6X 5KYUB 3MGAA 1ZHKA 2OMZA 3QNXB 3MLRH 4KNTA 1INQB 2A9NH 2EO1A 3FS9A 4ZO8A 3O4LD 4IRSC 3O2VH 1RK0B 4H0LC 4LHUA 2UX7A 3FQYA 1J9SA 2J20A 3MKKA 4Z7OE 1KCRL 4Z7OB 3UG4A 4DK5A 5C86A 2PWGA 1VHPA 2OZ4L 1FO0A 4FYTA 3MDJA 5CGYC 1HH6A 3O4LE 1P6FA 4MRCA 1EHKB 1GC1C 2HP4A 5HPOA 3AG2B 3RNKA 3GZOA 3QXWA 1RIUH 3GMQB 1PZDA 1ZPUA 3HG1D 1T1YA 5F21B 1DDHA 2VXUH 2ITFA 3GMLA 3TJEL 3LIZH 3MRMB 3BHBB 2Y1AA 1ZVHA 4Y5YC 2B4CC 3FUEA 5T1JA 3HG1E 1HSBA 3NIFF 4PJ7F 1D5BA 1RJCA 2FJGA 3QIWC 1GJIA 4MDIB 5JOEA 3P11L 2V5YA 2IOIA 5BPPA 3CHQA 4ZMZA 2H2SC 1JPTL 1X5HA 1KGIA 4AKQA 3APDA 4Z7UB 2KH2B 4NQED 4YX2L 1D2OA 3QIUD 2YRZA 5B1JC 2Y1ZA 4RQQB 4KTEH 4L5FH 4JO1H 4WHYG 2IPKA 4NZJA 1B90A 3IDXH 4NQEE 3DRQA 2FQGA 1VKXA 4BH7B 2OL3H 2P48B 3L3DB 1PKQA 2VR7A 3BKCL 4PGZA 2BHFA 4LRIC 1UD3A 2E7DA 2IPTL 4K3HA 3O2WL 4ODBD 2XN9A 1UQSB 3HBGA 4Q0XL 4WQOA 5DD0H 5DRZA 3WLBB 2EYSB 2PYFA 2EXWC 1XGRB 1N3NA 3D4YA 1M4KA 3D0LA 4G1MA 5ANHA 1U58B 4F80A 2NY4C 3BZEB 4EZMA 3QO0B 2VXSL 2MCAA 1UJ3A 3UBGA 1A4CA 3QS3A 5DEFB 5E4OA 4LLAA 4PPTA 2Y23A 4GKZA 2X3AA 3MOAL 4YDLB 1TZ8A 1FV1B 3DROA 3NEXA 4PN6A 2BIIA 4O58L 5KVMC 3QK0A 4JHWH 5J11B 5ICZB 2DM7A 3FBKA 1G7JA 2CUAA 5D71L 5JIPA 3V4VA 3O11A 5ICUA 2VLLA 3TZVB 2D4DA 5AVZB 3GQFA 1ZTXL 2VC2L 5K9KB 4E68A 2MRYA 2ITCB 3CVIL 2GFBA 3U1SH 1F4XH 2C7UB 1MELA 1TYJA 1IAII 2UYLB 1YY9D 2XSKA 3QUYB 3T2PA 1JZEA 3VQ2C 3K71B 3BUPA 3PAUA 4LSRL 2B7DT 2DDQH 4XP9L 2K6WA 1AZRA 3QG7H 4NN5B 5D93C 5KSAA 4HJGB 1CFBA 3QXAA 4TQEH 4ZS6D 1J8KA 5EBLB 2C9PA 2XFXB 2AQTA 3TURA 3VQLA 2UXTA 2GTWB 4W9IC 1LQSR 1R24A 3N1FC 3UTOA 3ZL2A 1WD9A 1P7QB 3PGCA 2CHXA 2NY6D 2QDWA 4I3SL 4MJJA 1YSOA 3TOPA 1KYAA 3QRLA 3PAVA 5J13C 4XAWL 5EU5B 3RVTD 4KHXH 2XZZA 1HAWA 3EJRA 5AYTA 2NY3C 2WXHA 3QH3B 3V0WL 4DGWC 2VUOA 4WCYL 2EEFA 4YDZA 2C9XA 3KLSA 5EDXA 3F12A 3VFWB 2P8PA 3GMPB 3OSVA 4DEPC 3MLWH 4XTRC 3QULB 4U7MA 4GLRH 1BXXA 4J23A 1I31A 4JFQA 4R90H 3BZ5A 3IGFA 1P5UC 3RAJH 3VD0A 5IROA 1CI3M 2ZOKA 4FULA 4E41A 4AZUA 1A0QH 4MAZA 5IHWA 2BY3A 5AFAA 1NM9A 1UT1A 2E56A 3MPCA 4Q97A 1NAMB 2AP2A 1NDTA 4TNWK 5J12C 1BJ1H 1FH2A 3SQRA 3TWCL 1ULVA 5FUCC 3BH9B 2CBOA 1SYVA 1E43A 1CMOA 5LGKA 2Y7QB 4JE4B 2ATAA 1ZPLA 1A3ZA 2JELH 1ZLUH 2E9BA 3O2DH 1C9SA 3C5ZA 3C8KB 4IS6A 1KLUA 2X89A 2AJVH 3FO1A 3I75B 4Y88A 3O9WD 3BVVA 2XV6B 1PPIA 4GSQA 4OBSA 5KJRH 3TBTB 1L9MA 3PWPA 1UZ6E 3FC8A 4IRZL 3FXIC 4GG6F 4GAGH 4PCSA 2A99A 2ZCHH 2WZ0A 1LEKA 2DIBA 3O9WB 5CWSA 4XN5A 4KITB 4N2GA 5KN5B 3DURB 3QISA 4G8FB 4Y4KB 4ZW6A 4EXPX 3CCHA 5F7DA 3ZTJG 3LN9A 4EDWL 5E6YA 1BXUA 5DD6A 5K1JA 4OFVA 4JFXB 4N0YH 4UQIM 4MXVE 1FNGA 1GAFH 5DXWA 4V33A 4HCIA 5L8JB 4R4NC 3SDCB 4A55A 2DYSB 4CU6A 3KMDA 3BQVA 5E4EB 3L3HA 1KLGA 3RZCD 1YEEL 4XHJD 1XSOA 1F3RB 12E8H 4WF7A 2VQUA 3S8GB 3ARZA 1JZ3A 3NABL 3PDGA 4LQFL 4Q6KA 2Y9RT 4PRDB 4OFYA 4YFEA 2DBJA 5C9JB 5T1KD 4OGYL 5K39A 5T1LA 5IIEB 4MXWL 2DMCA 1WTLA 3LQMA 3L4UA 2AK4A 4A2FA 1S5HA 1I1AD 3QXTA 3H0TA 3AU1B 1MVUA 1N0LB 1SXCA 5L4IA 3UJTL 3WKYA 2ILLA 5T1KB 3M1CA 1FP5A 5EO0A 4CSZA 1M9WA 1U21A 2BY0A 2MTPA 2QSCL 4K7FB 3WUZA 1T04B 2F54A 4Y0GA 3KPRD 4NSKA 1EJOL 1I1AB 1YYCA 4GAYA 5I1IH 4NRZA 1PD1A 2W91A 4K9EC 3ZUNC 4M7KH 4WJKB 4XC1L 3NZ8A 2VH5L 2EO7A 3AB0C 4Q8BA 1HK6A 3N44B 5HDQH 1DCLA 2HVKB 3VQMA 4HKZA 2WAHA 4L05A 3KPRE 2BCKA 1EJ6A 3UABA 3TBYB 3KPRB 3QYMA 1QFUL 4ONFL 2XTJB 1YQVH 1CG9A 2AXJA 2D31B 5A7EA 1T2QL 5E5UB 2PP9A 1I7TB 1CIUA 1M71B 1QO3A 1TENA 3RWGB 5CZRA 3UBXI 2WINB 4KUCD 3RDTA 2I25N 2LW3A 3CFTA 4JY4B 2ADIB 4HBCH 3CMOH 3U6RB 4J2XA 1P4UA 1LK3H 1E5BA 4UNTA 3U83A 4LOUC 4JZNA 5HSFA 3DX8B 3EO1A 5IEHB 2LU7A 5KYYA 3DBSA 3W9EA 3WY1A 2CQVA 4LKCB 1T2JA 2C7FA 1QX1A 4XPBL 3OKOB 4JPQA 5KYNA 2GSGB 2VRAA 5CFAA 2EDFA 3BOVA 4O51B 5EZJA 5I1KH 3GUFA 5MP6L 4HIQA 2DYRB 5EF3A 1ZE3H 5E00B 3FTGB 3VXUB 3QHTC 5CZVL 1N2RA 1IU1A 2GYSA 5D55A 2ZOUA 4YO0B 3B9AA 1EFXA 2VL5B 2VR5A 2FO4B 1YYMH 4NKMA 5ITBH 1OGAB 4WUUB 1F3DJ 5I0DA 2A83B 1GPOL 3ZU8A 1QR1A 1FZMA 2BVOA 4Q6IB 4FNQA 2BS71 2FYYB 4BFIA 1VZHA 4A68A 5K1VA 3OJMB 4ZPTA 4E9QA 2HG0A 3PHOA 3G5VB 1MZZA 2JCCB 3EGSB 3M46A 4JFZL 1SVCP 3WIFA 2WXJA 1U3HD 1QFOA 5A3IC 1I7ZA 4J5VA 1AIZA 4PCTA 3BSGA 4FQ2L 5HYJD 3V55A 3ZKSD 2BZ7A 3MLUH 2EDRA 3EYQC 1AD9A 4WEBH 2OP4L 3D4ZA 2IALB 4JJ5A 4LSTL 4MVBC 2AZAA 3X13A 5JORA 4A63A 1XF4A 1KTKE 3LS5L 1WSST 1EPFA 3QXDA 4HPYH 4JG1H 5HYJE 4CW1B 1DVFD 4DFHA 1LTXA 5F9JA 5GS0H 4M5YH 3MLSL 4XOBA 2PWHA 2OXGA 3WKMH 1CBVL 4R0LB 3VI4E 4FXKB 2WWKO 5FKAB 2GITA 2FBJL 3QQDB 2J1WA 3HUJF 2WVSA 4O2CB 2HG5A 2WY3B 5DHYB 1MUJB 2J8OA 3D52A 1VGKA 2K45A 2ZF9A 1WYJA 3J07A 3GRBA 3LZRA 1PYWA 4MMXA 4G83A 4WFHE 4DH2A 2BO0A 2XIBA 3OG4B 1TTRA 4FJZA 3WMSA 2E7LA 2ZXQA 3DHJA 5IQLA 2VIRB 3W1ZA 3NFNA 5E2WH 2FGWH 4TPRL 3GSXB 2Z8VC 2HFFB 2HKHH 5F1IB 3ALPA 5LBVA 1D5RA 4NNXA 3VG0H 3ORJA 1YJDC 2GK0A 3NCXA 1UM4L 5CMAB 3A24A 5DMKA 2VLKB 3GSNA 4P59H 4Y4HA 3C2SA 1DQQB 1FQ9C 1QHOA 4A6YL 4MZRA 3VG9C 3VXMA 2Y24A 1CC3A 5HD8D 1YY8B 3WXVH 5HHVL 4L4TA 1UATA 5LNDA 3QAZC 2Y36L 4Z0XB 1W0VB 2IDCA 4F3FA 4P05A 3H2WA 4E9XA 3FUHA 4KQ4L 2MJWA 4LEOB 1IRAY 1CLZH 5DEZA 1GIGH 2IH8A 4NLAA 1Q0XH 1RZGB 1XFPA 2GJ6D 2Q3XA 4FQXC 1G7IA 5D9SB 5T3XL 3OKNB 1SHWA 2YPLB 1P5VA 3EJYC 3QRBA 3S35L 3L3IA 3L95A 3T6WA 2GJ6E 5IWLC 3FH7A 1Z9SB 5DDHB 3P77A 5KS9F 1JGDB 4HEPA 5I1DA 4JJHA 1WFOA 1U8JA 3VXNA 4Y16D 4BQ8A 4D7BA 2BSTB 2YEVB 4OZHB 4I48A 3F7YB 3QUHA 4EVNA 5C08D 1RIVL 4UT7L 3SD2A 5I1CL 3IGKA 1NEPA 3EYUL 2FX9L 4MMZA 4LCIH 2P8LB 2HTLD 1YECH 4GS7C 1A22B 1FAIH 1JWSA 4JCWA 3L3OC 4GKSB 4X9GA 5C08E 3VFGH 2J5WA 4KZDH 1EA9C 2LGNA 3TVMC 5LNGA 4K8RH 2WWNA 1Y6NR 1QPXA 2EP6A 3ARWA 1PZAA 3HFMH 4X6FB 4F8PA 1MY5A 1MCEA 1MFAL 1ZA6A 1BM3H 1OTSC 2A9DA 4LIQL 5GRYA 4CJ0A 2CDGA 1PJ9A 3F04A 3AROA 1A2YA 1ZEAL 2WQXA 4L9LA 4XOCA 1I7UB 1CU4H 4JRYA 2OSXA 3ULVD 2IQ9H 3ARQA 4IBSA 3NSDA 2PXYC 3G5XA 2ICWA 2R4RL 2HT2D 3QJZA 1GGBH 1ZLDA 2PCPA 3NT0A 1COBA 2CAKA 4JLRB 5I1JL 5KUKA 1WA0X 3P30H 4MA1C 1BD2D 3ULVE 2ITDB 2EH7H 3H54A 4J8QA 3GKZA 2R56L 1CFVL 5L88L 3ARGB 2Z3FA 3HNTH 1ETB1 3UZQA 5JIMA 3WTTA 1YG9A 2ZCKL 3ALXA 1BD2E 1RK1A 5A2FA 4PWHA 3A6OA 4Y1TA 6CGTA 1KIRB 2EXTA 1QABA 3QFJB 5IR1B 3G6JF 4KZ0A 1PW3A 1D7CA 1OSPH 1CR9L 2CIIB 3LDBB 4PYHA 2JTDA 4E36A 5L2JA 2ZX5A 4AJVA 4XT1C 2B2XH 2RH0A 4D3CL 2KQMA 3PYCA 5ICXA 3U9WA 3IU4H 4TSAH 1I4FB 5ECJE 3QW9A 4M48L 3VH8G 3UL4A 4RIRB 5CCJA 1VACA 1BVLA 3EYOB 4F58H 4NQSA 2PN5A 5EU4B 4HIEA 5LHDA 2ZJSL 4LASL 3JTSA 1IM3A 4P2QA 3V4VL 3ZE1F 3HBZA 1MW0A 3FUJA 2AW2A 1P7BA 5DC4B 2NRDA 3FH5A 4P57B 3EDKA 1AQDA 1KUMA 2W92A 4Z8FL 4ZFOB 5D4IA 1E2ZA 2BRQA 4GRWH 4KO5A 4OFKA 1MJUH 3RA7H 4OLVH 1HKLL 4PJ8D 2WZAA 4BFEA 1M1XA 4QRBA 3IS0X 2GY7B 3WFBL 4F15B 1X7QA 1RSYA 4DESA 5BZZA 3IPEA 3NK3A 4PJ8B 3LPOA 5ISZD 1TCRA 2HCZX 4XVJL 4FFZA 1BSIA 2OTWA 1BF5A 1CDBA 2VDQB 2PPEA 5DRXA 3RGVA 3MV9A 2MQCA 3IS1X 4OGAD 5IHUL 1ETZB 2MOQA 2AJYL 1U8CB 4BFJA 5ISZE 1NLBL 1MRCL 4MZIA 1J9CT 5B8CA 4GP4B 4FG6D 4AQ8C 5FECA 4M3HA 1A6AA 4OLXL 5LCVA 2COVD 2CUHA 4E5XA 5E4AA 3BVWA 3DVNA 4NM4L 4K73A 1IEBB 4OI8A 4NZTL 2VSKB 5HDWA 1W9XA 3I6SA 3FRPG 3IDGA 2NUPB 1CE6B 1MCWM 3CX5K 3O8XA 2ZKHL 4QXWA 2X6AA 4M6NH 5CLXA 2ZUTA 4FC3E 1QOKA 3GC3A 4ZXBA 1MWOA 4YAQA 1L9TA 4GRMA 4AYFB 5BRPA 2Y7LA 2MHAB 2R2EB 4XE0A 2O6PA 2EDXA 1KEMH 1XR8B 1EUUA 3DXAD 5ID1A 2ZKWA 3MZGB 4JDEB 3BFQG 4GMTH 3RWDA 5KG9A 4WV1B 2Y06L 4K7PH 3G5YA 3BEWB 2ADJB 5DMIL 1DQIA 3BMWA 2JKIS 3HE7D 4PJIF 2BPBA 3QSKB 3DXAE 3REWB 3VH8B 3UTTE 1A7PH 3B8YA 4YHNA 3HR5B 1TCMA 2HRPL 5IQ9A 5I30H 3IDIA 1F56A 4OQ1A 1T1XB 5J6HA 2VLJD 3C60D 1BIIB 3HE7B 3APNA 1Q38A 1A21A 3BDYH 1HYSC 2R1XB 4ADJA 3HC0A 3ZE0E 2LFEA 5I1EL 3LN4A 3ZE0B 5AWNH 5FGBA 3N5AA 2VLJE 3HRZA 4Y1AB 4PVBA 1CD1A 1B0GB 3C60B 4OZGA 1GVIA 3NFSH 4PY8J 1TEYA 1BZ7B 5JLZB 2R0WL 1QBAA 1SFDA 3ULSB 3EGDA 4BZYA 2EACA 3K6FA 3QDME 4DO6A 2EE6A 3MC0A 5EZLB 1Z5HA 2GBVA 2QSQA 2XRAL 2DQIL 4JY5H 4LLWB 4I3GA 5D5MA 1U33A 1EEZA 1KJMA 2GIYA 1RZ8B 4PJCE 2E3VA 3RVWC 2X44D 3FHEA 5EOCH 3IKCB 5LBGA 4OM1L 4X8JA 2W07A 1U2HA 3T6QC 1MCIA 1KCWA 5CO1A 3ZE2F 1AO7A 3WTUA 1T80A 4NO2A 2FH8A 1BQHG 1LO0H 3MJGX 4IU2B 2NY7L 5DD3L 1Q4NX 4KMLB 1ZLSH 2KS0A 1KYOJ 3TT1H 3VFOB 3M86A 3PFQA 4JFYA 4NQVA 2BNUB 2WQWA 4DSYA 3AXLA 1CTOA 1NFAA 3GSVB 3V6FB 5C2BL 3UAJD 1L3WA 4GUPB 4AC4A 3T65B 1JERA 5E95B 1WBZB 3E9TA 4PRPB 3TESA 2XZCL 2ATPB 1GGIH 3FRPB 3MJ7A 3BLKA 4A7GF 3ARBB 5GS1B 2VN4A 3MI6A 2J8UA 3HN3A 2FHBA 2P5WA 3LSOB 4XP1H 5L2KB 3ARDA 4PTUA 2B1HL 3LQAH 3ARUA 4HV8A 1R46A 5TE4L 4ZZKA 4L5FE 3DIFA 5EUKB 1OSZA 2A74B 2ED9A 5I6XC 3IJSB 2AK1L 1S7TA 3MBWB 1KELH 5JA8B 1FYTB 3CVHB 3F7PC 1OM3L 5CD3A 1KCLA 1OCOB 2QMKA 5I8KL 4AM0A 5DZOA 5DYOA 1ADWA 2YGNA 1IGFH 2OL3B 3OR6A 4ERSL 3LZFH 2D0GA 4J6RH 4NB7A 3SD5A 1E9OA 1KTDA 2P52A 4OTXL 3SJVD 1GZQB 1P7KA 3LKQB 5GPRA 2X4NB 4H8UA 1S9YB 3TO4A 3GLZA 3S36H 2OKMA 1WFIA 3MGOB 4G6AD 4TNVK 5DT1H 3JQOB 2YJQA 3MV8B 4Q4EA 3SJVE 4D7PA 2XN1A 5C09D 3WYRA 3SJVB 2B08A 2LLNA 5GGVY 2J6EA 1THAA 3VFVA 2X53A 1HEZA 1D9KD 1J7VR 3MCLL 1S3RA 3BPLB 3ETTA 2FJHA 1OB1A 5C09E 3O6KL 3GKWH 3SGDI 3NN8A 2JB6B 1JN6A 4ABQA 4KNQA 3POCA 2QQKL 5FV1L 5LNEA 2VSMB 4I18B 4G71B 5HGHA 2OX5A 3FQRA 3EFDH 5HI3D 2K1MA 3KPNB 3TBVB 3AQZA 4GQQA 4MQ7B 1EHNA 1JNHB 5I19H 2F53B 3H7LA 3NOIA 2V5MA 4XXDA 4HOZA 3TA3C 4ZS7H 4DPBX 2KERA 3KDMA 5IJDC 4L37B 4J4PC 2EDLA 2Q76A 4F7TB 3FQUA 1E6JH 3Q8EA 3TV3H 3NIDF 2NDFA 4HAFA 1NL0L 4KRPC 1G0DA 2FEDC 3GJFB 3L3JA 4PJ5B 1BQHB 5TDNA 3K6NA 3LN5A 1S7XB 1N8OE 2ZT9C 3H4FA 5JOPD 4UQAA 4NQDA 1E3ZA 1RZ7L 2X42A 3IVKA 4ZMOA 3FUIA 1SMDA 1U6AH 5ADOL 3QIBD 2JFCA 4N0UA 5FO7B 2AJZA 1ZV9A 3E6FB 4PWEA 5JOPE 4XC3H 5JPMC 2C3GA 5C7XL 3L13A 5FGCB 3CDZA 1NOAA 2L7UA 4JM2D 4X6DA 1JI1A 1I7RA 5EEWA 1X6NA 4J6IA 4LF3A 3QIBB 4HQQL 5H94B 5FM5O 5IVXE 2R1WB 3TLRA 1R3IH 3NJFA 5J6GB 3KGSA 1GZPA 5IHZA 2DQEL 4BWUA 4OF0A 5D4JA 1JCKA 2BJMH 2BZCA 1CFTB 1XAUA 3HZVA 4KK6D 1MFNA 2CRZA 3FT3B 1A3RH 2GCYA 3T0WA 4B97A 3ZT5A 1N10A 1QI3A 1IT9H 3CIQA 1HWHB 4AIXA 5C6TH 1GA2A 1ZD6A 1PTZA 3KEHA 1CTMA 4JY6A 3ETSA 4KFMA 1GY2A 2BNQD 2K9FB 2B3IA 4Z78A 4FYQA 1UXWB 5CILH 3D0AA 3AM8C 4N2FA 4ZO6A 2VWEC 4HH9A 1HI6B 4ZUWA 4NKIH 3RKPA 4P2OB 2Y07L 2ENSA 2YHGA 4KDTA 3ESPA 2BNQE 3CC5A 4NENB 1CDCA 1FL5B 4X2UA 2YFOA 2DWEA 1XTMA 1KTBA 3IF1A 1KXHA 4XI5D 1LO2L 2XNAA 4QRRA 3Q8CA 2ZPKL 3K80A 1AGFA 3D69B 2J7LA 1BMWA 4G80B 3D7PA 2NQDA 1MF2L 3QJFB 2ZOLB 5JYLA 1UWYA 4Z77A 3D2UA 3K8MA 5DVOA 2B1AL 4PGBA 2MPVA 3V0FA 4EN3A 4X98B 4IGBD 4MA8H 1UJTA 2V9QA 2WKGA 4H26B 1HSAA 3QZPA 1UD4A 4A7QA 3EGXB 2NT0A 3EUDA 4QRQB 3ULAB 4J3OC 4WEEA 3FOMA 5E99H 2NYYD 5D2LA 4EQ3A 1WHOA 4G8EA 3T3MF 1K8DB 4GFTB 5DK2B 4ENEC 5INDB 1WUZA 1DVZA 2FLRT 5GRJH 3BAEH 3LKSA 4Z95H 5B39G 1U8PB 4JZOA 3BRFA 1DJZA 4UU9A 3GMMB 1NQBA 2JB5L 4YZWA 1TJMA 3WS3B 4FA6A 4K3JH 4R5TA 1E9QB 1AXSA 4WO4A 1I53A 2DH3A 1ML0A 2IWKA 4UDTB 4ALAL 4ZDHA 1V5JA 2UVEA 3GS0A 3N3EA 3UPRB 2R8SH 5IVZA 3ARPA 3HAEA 4M43H 4OJEH 4OM0L 2G9KA 3IGAB 2EEDA 1RUAH 2FEJA 5J1TC 3DBXA 4TVPL 1NCGA 2CLRB 4GPVA 1T1WB 5GZOA 1VEMA 2VDLH 1GGUA 1KCSH 5EEUA 1A7NL 1QUPA 2EDJA 4S1RL 5BXFA 3E80A 3SGJC 1YEJH 1HXMB 1OSEA 3FUMA 3NIGB 3PIQA 1BAWA 4M93B 5GGVL 3TJPA 1RZJH 2F8XC 3AG3B 2MPAH 4H0HB 4YSAA 4LLUB 1J05A 5I73B 3I6GA 2A77L 4H20H 2CHWA 5IBTL 1N4XH 3KR3L 3ZRFC 1Z2KA 3JV6B 4MNGA 4IBYA 1IBYA 5BOJA 2OR9H 1U8NA 2G4GA 3TH4T 2I9LB 5B3JF 1GMEA 1RIHH 5IG7A 3FO0L 4TNGA 4HT1H 4N85A 2YAQA 5E1AA 2EE2A 1SUJA 5FLUA 1D5XB 5BQDA 1X5ZA 3PG2A 4HUWB 4MASA 5F3BB 5KVFL 2JNZA 1Q9KB 2D7TL 2X6MA 1PAMA 3HHSB 1I3RA 3I9GL 5F70A 2JQZA 1CE1H 5LGJB 3X14A 4JPWH 4X80H 7CGTA 4B95C 2XDHA 5J5EA 4YBQC 3AS2A 5DJ2B 1S3KL 5ID0B 4KHTL 1MJ7L 1CVSC 4KVCH 3W9DB 1AY1H 3MXVL 4YE0A 1QYGL 3HHMA 4K0OA 4ZQKB 2BDNH 3R7RA 1KMGA 4WHDA 2Q8AL 2YZ1A 1BCIA 4DUXA 3WY3A 3GI8H 3IE9A 3VI3A 1ET7A 2FX8L 1I8LA 3MRQA 2YD0A 1P2CA 3FRUA 3WNLA 3FTUA 3ZDXF 4J28A 4YDVB 4E9WA 2AKRA 5CU5A 5B39B 5KEZA 2Z64C 2DWSA 3MV7A 2B20A 1NC4D 5FO9B 4FNLL 3P0YH 4QXUH 1JXDA 4BHUI 3H7BB 3THML 2DKUA 5HPMB 3BN9D 4X8GA 2RACA 5T5NF 1RMFH 3QZOA 4HKBA 5DUJA 2H0PA 1JNLL 1AQKH 3L6FA 1IGYB 1NC4B 4Z76A 5E8NB 1YC7A 2JWYA 1PMYA 5FV2A 4IKNA 4JFFD 3NJLA 1EZUA 1JP5A 5GS0D 2E76C 2IGFL 4FFZL 3NYKA 4NFDA 5E7BA 3BSZL 2IMMA 3FQTA 3SKMB 3ZX1A 3C09C 2A9BA 1EDYA 2LABA 2RBLA 1MFBL 3FCBA 3MRFA 4JDZB 3HS0A 5IKCB 4P9HL 1DQJB 3QORD 4JFFE 2ADGA 3NZHL 5EC1B 3SZ6A 1X44A 2Y3NA 3ZKMD 4JFFB 1SRDA 4ONHB 4XPGL 3TNNA 3U0PB 4HLEA 3BP6B 2I07B 3I6LD 4NWTH 3BH8A 4WWKA 2X7LA 5DJAB 2OMTB 1PNDA 3WNMA 3D85A 1IEAB 1OAKH 3MCG1 1KBGL 3ZZSA 4XNDA 2VLRA 5LCVL 1KB9K 1FL6A 5KYUA 3T4AC 1EUTA 3QNXA 2AQNA 2YPVA 1IBDA 3WUWA 3I6LE 4D0BB 3W38A 1INQA 2VQ1B 5DYFA 1RK0A 3GBML 5MHSD 4N0RA 4WFFE 3KPSE 4C4KT 1IQWL 3RVXD 4AYBA 4G1EB 4DP5X 1FNSH 2VR4A 2W81C 1XF1A 4YFDB 1IARB 1NLDL 1MAMH 5MI0C 2J6WA 1CL7L 1MRFH 5MHSE 1GYVA 1JRHL 4TUKH 1SXNA 1P4IH 25C8H 3GMQA 4QNPE 1WIOA 5CD5C 1AE6H 1F41A 2YA2A 2EDHA 5IFHH 2BX5A 2VQ4A 3SDXE 3MRMA 1MAKA 3BHBA 5K59E 1SOKA 3GHBL 3K74B 5CCHE 4XCEB 3VSVA 5IV2B 2WLMA 4LCWD 1OTTC 2X4SB 1F6FB 4MDIA 5E7FA 2GJJA 2ZD0A 1YY9C 4WFED 3KW8A 4UTBH 4WUKH 3F62A 1WF5A 4XPFL 1F90H 3HG4A 4Z7UA 4LCWE 2FB4L 3MFGB 4FEMA 2B16A 3IBEA 4ZS6C 5DVLA 4YEEA 2KLTA 2XOTA 4U1MB 2N1KA 4PJ7B 4RQQA 4WFEE 1OP3H 3V4PL 4GMSL 2QHRH 3C08H 4YQXH 3D30A 5I5MA 1O7VA 4FFYL 4AEIL 3QGVA 2NY6C 4V1DB 3KYOB 5HDBF 2CKBH 1DFXA 4AENB 4BH7A 4MXQD 2VDPH 3L3DA 1MCHA 4K8RD 5HJBA 1UACH 4URTB 2RCSL 4Z23A 1UQSA 4NHCL 4ODSH 4GSDH 2EYSA 4KZCA 4S10A 4MX7B 1XGRA 4J1UA 1D7BA 2JI3A 1W8NA 5FWRA 5EUOF 3T0DA 3MAWA 1YMME 1U58A 2YQ3A 1QFHA 5GGSB 4DVBA 2EVGA 1KWGA 2ZUUA 2E9WA 3BZEA 3QO0A 4K3EL 5GJTH 1NUDA 5I1GL 2X40A 5ITFB 3FSWA 4M7JL 2BIQA 5DEFA 2VAAB 4GNKB 1C8PA 3VJ6B 3DX0A 3FTXA 2VDOH 4Z5RA 5F6HJ 1QHQA 1FV1A 4WZ9A 1EWHA 2HKFH 2V3EA 4YDIL 5ICZA 5AZ2L 4YZFE 1VB9A 5C0ND 4ZUUB 1PLGL 2XC8A 3IRZA 4FJ6A 2V2TB 3UZEA 1RFDL 4WSGA 1RP9A 3TZVA 4R26L 4I0PD 1N5YH 1N6QL 3RWEB 5K9KA 3DUSB 3VGFA 2ITCA 3N91A 4OZ4B 4XVUC 1LXMA 1KCBA 4LPUA 1XEDA 1MY7A 3ULUC 2C7UA 2UYLA 2HMIC 3QUYA 3BRDA 5KANG 1H8OA 2W0LA 4GKLA 3B9KD 1AR2A 5M95B 3FO9B 4RDQG 1Y07A 4X99B 4XR8C 1NCOA 1R75A 4HJGA 2C9QA 1YNKH 3CJJA 4HCFA 4I0PB 4XCYB 5EBLA 1KLFB 4LCUB 2XFXA 3EJZC 2VDKB 2BOBB 2GTWA 2PTUA 3NP4A 2HJLB 3ZMRA 1FPTH 4U1HB 1P7QA 3B9KB 1F4WH 2OULB 1F6AA 1WWAX 1W80A 1CICB 3VGAC 3MSPA 5HP5A 5EU5A 2L7QA 2J6EL 3QH3A 5JMRA 1L4IA 4YHML 1AFVH 1PX4A 1QATA 2FHFA 3GBNH 1RUKH 5AW8B 3VFWA 3GMPA 2CO4A 2DPKA 4Z7VE 5DK0B 3DSFL 3QULA 3SPCA 1FLTX 3FF7A 5JQ6H 3FQWB 2Y2TA 2IH1B 2XUWA 5CZXD 5HVFB 1J1OL 3WAJA 1NAMA 3SQOH 4DP0X 3MHZA 1PDKA 3WJMA 3BH9A 1BPLB 3CPLB 4GRWE 2Q6WB 2Y7QA 5KYXB 4XAKD 2FZ3B 1LMKA 3T0EB 1DO5A 3NGBC 3D25B 3C8KA 1WA2X 1K4CB 2DTML 2ED8A 2QPUA 3OXRB 3I75A 5DMJB 5BOZG 3NSFA 3R06B 4JHBA 1JIBA 2APFA 2YN5A 1PLCA 4HMDA 4XAKE 4ODHL 4JPVH 3TBTA 2WNKA 2X1PA 4FMVA 4F2FA 1VGEL 1W91A 1DBJL 3VXRD 4H0IA 4NYLB 1DQLH 1XSKA 5K69A 2P45B 1LEGB 3WHXB 1FWXA 4YSSA 4Q89A 4ZW7A 4AGOA 3DURA 5KN5A 4G8FA 1FCGA 3BWUF 3GJFK 2CO3A 4LLVA 4Y4KA 1W72L 4N2CA 1KBKA 3STZB 3VXRE 3EJQA 5F9OH 2IBGA 2W65B 2F7IA 4RFOH 4U6XB 3RTQB 1BZ8A 1KJ2L 4BRJA 2XWZA 5GJSL 4AWJC 5KWYC 4AEHL 1HL8A 1LE9A 2E7HA 4J3BA 4NP4L 3SDCA 3NJJA 4ZPVB 1E28B 2X1QA 5KSAC 3ZDWA 1T7VA 4AUUA 1OPGH 5F44A 1P84J 4MA7H 4WJG3 3D0VB 2EH8H 3C6LB 1XGTB 2EKSB 3VM7A 1T03L 1RPKA 1ID5I 1NSNH 2PETA 1ES0A 1WIUA 2E6QA 4B9YA 1WQVT 1H3WM 1RHHB 2BSED 2ENJA 1GZHA 5E2TH 4UV7H 4HHAB 4PRDA 1OK8A 3RU8L 1XMWA 4HGKC 1EANA 2V8MA 1JGLH 4HMEA 3UBFA 5C9JA 1A6VL 3OHMB 1THCA 5IIEA 4UQ3B 1HYRC 4GIPD 4BJLA 5HI5C 4JX0A 3CC1A 3V9EA 2ZAIA 4WHTA 5EEVA 3AU1A 1N0LA 3LCYA 1PU0A 3P9LB 4I0KA 1BJ1J 5FB8A 5T1KA 4YIQB 5B3NA 3NCJH 1MCFA 1HIML 3CFKB 1OTUC 4WGVB 4K7FA 1NCUA 1T04A 2YKKA 3ATDA 3CPUA 3VNYA 3E8UL 1AP2B 1I1AA 4W4NA 1GHFL 1QI5A 4DQAA 1S9XB 4UM9B 4N8VG 1JG9A 4X5WB 4XXWC 4KAQH 5D7EA 4DGYL 3CSYB 2HVKA 3C5ZC 4M7LT 2GI0A 3RY5A 3SDDD 2VN7A 1UKQA 4GAFB 5KBDA 3TBYA 3DIDA 3NSJA 4PLKC 4NJAH 2N7BA 1EHLL 4HZ1A 1HNFA 4N8CH 3K2KA 2D31A 3K6IA 4HHGA 4JO2H 4GT7A 2XZQH 4DAGL 4RWHA 1DVXA 1SJEB 4UTAH 1J1XL 3DJRA 5C8JA 1I7TA 2G60H 4AX3A 1M71A 2VDNH 1IIIA 3RWGA 2WINA 2DY2A 3U6RA 2BSBA 4FQLH 1U8KB 2ADIA 4JY4A 2XX1A 4XVTL 2WQRA 2NX5E 3GTVA 5IEHA 3N0PB 4YC2C 1U30A 2C3WA 1GYWA 2YQGA 2I85A 1XB3A 1AR1D 5DF0A 1P9MA 3OKOA 5DWUL 2GSGA 4G42B 3UAFA 3B9EA 4YN3A 2FDBP 2PUQT 4O51A 1CL7I 4GXFA 4QAMB 3APMA 1KBWA 4YK4B 1A3LH 4H7VA 3TL5A 4OAWB 4X4YB 1AR1B 5E00A 3FTGA 3VXUA 1BHGA 5FFLA 4HJUA 4YO0A 1XGYL 2VL5A 3DC0A 2WSDA 3QRGL 2FO4A 4BA0A 3TBWB 5AVYB 2HVBA 3NEEA 1OGAA 2DEYX 3QQ4B 4WUUA 3TCLB 2A83A 5L9DH 4XNQB 1FIGL 4P3DA 4JGJA 3HG0A 2B5IC 3FU3A 1TZIA 4Q6IA 4PHZA 5KVGH 2FECI 2FYYA 4KRNA 5LXGL 3AG4B 3JVGA 3R19A 5FFGA 4TQPA 1I1YB 5EDSA 4DZ8B 3IMBA 4OCYL 4XN1A 4XPTL 1J88A 4H8QA 3G5VA 2BHYA 3QDJE 5IUSA 2OCJA 2XVBA 2JCCA 2Z91B 3EGSA 1RD6A 2NXYC 2QVMA 3UC2A 2ZP9A 3N42B 3OKEB 2Y4SA 5TFSL 4M1DL 4QLWA 2W1NA 2NY2D 4LB8A 3ZDYF 4FQJL 4YHIB 1SVBA 3OQRA 4AL8C 1SN0A 3OAZK 3OPUA 3Q48A 3CFJA 4YEFA 3VW3H 2IALA 3BKJL 5TQ0H 1EAPB 2OMBA 3FUNA 4XX5A 2IFFH 4EIBA 3F58H 3JV0A 3MOQA 4HFUL 3ME0A 4CL7A 3MLTB 1D6VH 3KG5A 1FC1A 3GFUA 2R0LL 4R0LA 1DJIA 5FKAA 4MCYB 3QQDA 4Q58C 4HWZB 2FJSA 1N6VA 2VO8A 4O2CA 3VMPA 3N1GC 4O2FB 4ZFGL 4I4WB 2E8YA 1G4MA 3OZ9H 1NKGA 5DHYA 1MUJA 5AYUL 3WBDA 5FYKH 1MFUA 1T89A 4YHLH 5F8QC 2H47C 2DQGL 3B7SA 5IJKA 1N26A 2VIRA 3MX0B 4WI0B 1AQ8A 3RDTC 3BO8B 2XZAL 3ECVA 1OARL 4R4FL 3GSXA 3V4UL 1OQXA 3HUJB 2HFFA 5F1IA 4PJFE 1OK0A 2BVPB 1ZT4B 3OV6A 5DS8A 5B38B 3CZFB 4XWGL 3TBSA 4QXTA 4YHPB 1MIEL 4N9GB 5E9AA 5CMAA 4AGQA 2HJFB 2VLKA 1W0YT 1A1MB 1XEUA 4LSPH 2KT6A 3K2UL 1OCWH 3L1FA 4H8WC 2WNWA 3MCYA 3GPEA 2OMXB 3EOBB 3LXUX 3HZKB 4FLOA 3SE8H 3GBEA 4H88L 1YY8A 4UWQB 4PRNB 5ABZA 4X5RA 2F58L 1FGVH 2MNJB 1W0VA 4Z0XA 2D03L 3B7YA 3TYFB 1H3TA 1ZANH 3EYSL 2FL5B 4GQZA 4MAYB 2NW2A 4LEOA 5DFVC 3C8DA 3TYGL 2EYTB 5D9SA 4FZ8H 3BAYA 3K7UA 3OKNA 2YPLA 3GS7A 4LSQH 3UAAA 1CLOL 3N85L 4X6CB 4PJGF 2BXYA 4N8PA 3MNDA 3QE5A 1WISA 1XGPB 4O9HL 3KYMB 3WIIH 1Z9SA 3I3BA 1PX8A 3PV6B 1N64L 3LRLA 4IBZA 5DDHA 2YPVL 3JTTB 4N20A 1R17A 1JGDA 5BZXA 1BQSA 5C0AD 3U9PL 2BSTA 3FSVA 4OZHA 5FK9A 4LLQB 2CJ3A 1NCCL 2OMYB 2VXVL 4EF3A 2YOCA 2P7TB 4P23C 1CQYA 4N2IA 5C0AE 3QR2A 2KMWA 2P8LA 1U8OB 2VXQH 2VR6A 5KS9B 1Z3GH 2JCWA 4GKSA 3NCBB 2C5DC 3MRIB 3GZKA 3OAZH 2P5ED 3CLWA 3S8WA 3CLEH 1T3FB 2OMUB 2X2IA 3FK3A 1UOVA 4R4BB 2FWSA 4ELDA 1BQLH 1GC1H 1C8QA 1KGUA 3PRZA 1L6PA 1OAUH 3PF2A 3LMJH 4LCCC 3M8OL 1OP5H 3C8HA 3S3DB 5LN4A 4LAQH 1Z66A 2P5EE 4F92B 2DWXA 2PO6B 1QA9B 3QJXA 4MMXC 4OIAA 4ZTOH 1QRNB 4OGXH 3UBXG 2OM5A 1I7UA 4KKRA 3ZIYA 2E7LC 2B4CH 3RB7A 2WBXA 2ZAHA 4Z7NE 2CR3A 3RBGA 4GAAA 3HMXH 3IDMB 4ZUSB 3FU7B 3IDYB 1AIFB 5DQDH 4MFHA 2QVFB 3VXSD 3PAZA 4JLRA 3ZHFA 5SWQB 2ITDA 1SJHB 2Q8BL 1JZFA 4D9QE 1SMAA 2Y3AA 2OI9B 4GW1B 4NZUH 3ARGA 4Y4HC 3VXSE 5DJZB 2LE9A 4FOMA 5AOZA 3OQ3B 4OSUL 4FGMA 4PI0A 1JYWA 3FQ4A 4U6TA 1AJ7L 1KIRA 2J12B 5GISL 4JB9H 1JTOA 4KDWA 3QFJA 5IR1A 1NAKL 4K94L 5FYLH 3JWNC 1LHZA 1MHHB 2CIIA 4OKVB 4LBEB 4P46B 3HOGA 3IETA 4GBXA 4JM0A 3ZSSA 5I75B 2HZHA 2KPWA 3SBRA 5AVSB 4FNTA 1I4FA 2UY6B 3VA2C 4HIIB 2DJSA 2EIJB 1NC2D 3VYOA 3BKYH 4RIRA 5I0XA 4XZUB 5DU7A 1M2VA 3CH1B 3G6JB 1DO6A 2K78A 3EYOA 5B4MD 2RMNA 4RX4D 5EU7E 1B2WH 4FTVA 1OAYL 1H6TA 1C16B 2ADYA 4P57A 5DD1L 3ABZA 1PQZB 4QMEA 3NCMA 4N4YB 5GHWL 2WXGA 4ONGH 5ACMA 2E8ZA 4MMZC 3H8NA 1H3XA 5JZ7C 4IBWA 4N90D 2XN2A 2GEEA 4HJJL 4LVHC 2XG4B 1IGML 4AW4A 1UD5A 4NGHH 3GMNB 2CBMA 5IW3A 3FMGH 2WYZA 4YL9A 1DUYB 3EUUA 4N90E 2DQUL 2F7OA 3I74A 4W93A 5I6KA 2ZXDA 4PJ8A 1E6OL 2YXVA 1L7IH 2DD8H 5E4IA 4YHOL 4HC1H 1SLVA 2H2PD 1QASA 4NXKA 1CDGA 1XO8A 4L9LC 3UBXB 1P4LB 1BECA 4WI9A 1BBDH 5D1QD 1ETZA 2ARJQ 4XCFL 3F01A 1U8CA 3QS2A 4F7KA 4PD4J 1XZ0B 2VMEA 5AEAA 3KWWB 1SHMA 4JPSA 2Z8RA 3B6SB 3RRQA 2CSPA 4HU8A 3GO1H 4IU3A 2JV6A 3A6CH 1YEIH 4XNBA 5D1QB 5DUML 2ZX6A 2YXWA 3ZDZF 4Y9FA 4MJ4A 5F0JB 4XCCH 2CDFB 2GABA 5IB3B 1KPUA 1NAML 5D1ZD 1YC8A 2NUPA 1CE6A 5I76B 3Q1SL 4ZYKB 1NGYB 3OGCB 4L2YA 3HBQA 4HS8H 2NQCA 2MHAA 2R2EA 1OAXL 4OZGF 4QYOB 1XR8A 4YNYB 5D1ZB 4JDEA 2UXVA 4LLYB 3RKDD 4WLCA 3ROLB 4HSAC 3V6OA 4WV1A 4AG4H 5IOKA 4PSRA 3BEWA 2ADJA 2CMRH 5E2VL 4KROD 4PJHF 4QCIB 4UT9H 3N1PC 1KEGH 4QRPB 4AQ1B 5D5MF 3REWA 3VH8A 4G2AA 3HR5A 3LIUA 4DKAA 5BO1L 3SDAB 2M1KA 3FTZA 1T1XA 2F5AH 3WHE0 2EEXA 3ZGHA 1BIIA 3HE7A 4UCFA 4I0CC 5BVJB 1XV8A 3VGHA 5SX4I 2R1XA 4FCHA 4P5MB 4Y19E 3VXTB 6FABH 1MCJA 2X9WA 5D72L 1W8EA 2PP8A 5LG1A 1TJIH 3QHFL 3WTVA 3TCTA 2WUCL 3HC4L 1G9ML 4I1NB 2PCFB 4Y1AA 1QSVA 5I8OH 1B0GA 2LT9A 4FKEA 4PEEA 5KVDL 1CLVA 1BZ7A 3ULSA 5C97A 3ZHNA 1GKEA 4HUMB 4PW9A 4TKWA 3Q5OA 3ZO9A 5C71A 3V52H 2JKRM 2VISA 5JDSB 1WS7A 4IOSD 1TEGA 5EZLA 5F89B 4PLNC 4AITA 3FUFA 4LLWA 2VSDA 3MUJA 5IQ7H 3MYZA 3FT0A 1ZSDB 2YBRB 2RAMA 3OWRA 1RZ8A 2YAPA 4JCLA 1PCXA 5FDYA 3WENA 3IKCA 4TF4A 4LRNH 1D9KC 1LO3H 3D51A 4LSDA 1KB5B 1XMEB 2WBJD 4PGJA 1U9KA 2WVTA 4HXAL 3AVEA 2GG1A 5IM7B 4KTDH 4RA3A 4DP2X 4KKLD 4PYGA 3KM2A 4IU2A 4XO4A 4GW5B 3VFOA 4B7LA 1IGIL 3RX7A 1GMIA 1K3ZA 5D1XD 3GSVA 2WBJB 3V6FA 4CN4A 1JYNA 2UZXB 3MJ9L 5FIEA 1DQKA 3GS4A 4GUPA 1DQDH 4FXGC 5HYIA 1WHPA 3PL6B 1WBZA 1ZXQA 4HK0B 5FM5M 4PRPA 2ATPA 3FRPA 4UV4L 5D1XE 3O45B 3ARBA 1J8RA 5GS1A 3LSOA 4UUJB 1LL1A 4ZXBC 5L2KA 1PG7W 2Y7MA 4IOFD 1ONQB 3D34A 2YAFA 3QO1B 1KTRL 3CZKA 4FG0A 4R97C 5BZDB 2EUVA 2W80C 4IMKA 4UZUA 1MWAB 5EUKA 4X9IA 3T77B 4K9EH 3OXSB 3QUZD 3IJSA 3MBWA 4I3RH 1MHPL 4TUUA 1FYTA 2A4ZA 3CVHA 3QPXL 4Z3FA 2L7EA 5KW9H 1D5MB 1GH7A 3KPLB 4PJBF 4WNJA 2OL3A 3TF7C 1GGTA 4P5TD 2N1TE 1GZQA 2ITEA 3LKQA 3OLIA 1G4RA 3ZR6A 1K85A 5B1KA 3S37L 3QUZB 5DTFB 2X4NA 4OQTA 1NBZB 1V55B 4D0DB 4JM2C 1L0YA 2BWDA 3FFCB 3W11D 3MGOA 2NY0C 2YS4A 1WZ1H 3MV8A 4YXKL 3TN0D 4XCNB 1C7SA 3CXHJ 4ZAKD 2OW6A 5FGBC 2ZONA 1Q0YH 3ZQWA 2OJZL 3HRZC 2WZ6A 5JA9A 2V7HB 5FO8B 1BPVA 1J12A 3WDIA 1KT2B 3U36B 3V5KB 1JGVH 1D6EB 3AS1A 4N2AA 3F6JA 3MREB 2CHNA 2JB6A 4NC0B 3VGDA 4YVUA 1HWGB 1KN4L 2O5XH 2CWRA 4I18A 3WIAA 1G5AA 4F2ME 1JF1B 2QPEB 3KGTA 4A2GA 3KPNA 4HBQA 2ZYIA 2Z7UA 4JFDD 1JNHA 1TJHL 1Z5YD 4YMPA 1INDL 1M05B 4X6DF 4A67A 2F53A 1ZHNB 2ZYHA 3NP3A 2X6CA 4QTIL 4NLHA 4L37A 3T2NL 4F7TA 4JFDE 5GRZA 3EH5B 2V3FA 1SZNA 3GJFA 4U7KA 4PJ5A 1BQHA 3W57A 3R8BB 1V8HA 3OHXB 4O02B 2VZ1A 3INOA 3O4OB 1S78D 3BLBA 3D39D 4U1SB 3GNMH 1L5GB 5A43C 4MD0A 3QWNA 5F7AA 4M6ML 8CGTA 1WITA 1F18A 1O6TA 5FO7A 4N68A 3E6FA 2GSMB 5FFOA 4UOZA 3D3VE 3ZR5A 1DJGA 4L4JA 3D39E 3TEXA 1DEDA 3NA4A 1MCLA 2RTTA 4EPSA 1FBIH 3LZQA 1KFGA 1RPQA 3UYPB 2KBGA 1P1ZB 3QUMH 5H94A 4XNZB 2R1WA 5CBAB 5J6GA 4Y9BA 2ARJB 3QUGA 2C9AA 5BV7C 4UAOC 3T9WA 4MAUH 3MBXH 5ABDE 4I9XA 1L7TL 1CFTA 2PABA 4AKPA 3PAYA 1JGEB 1G7QB 4OJAA 1IGCH 3FT3A 4ODTH 4KPHH 5I0YA 2AC0A 3GZPA 2RGSA 2HH0L 3TO4C 2GKIA 5DJYB 1A25A 1QG3A 1B4RA 4RBPK 3HKFA 4K2UH 3FQXA 3U30C 2KKQA 3BZ4B 3T0AA 4G6FD 3O6MH 1MCNA 5F6IB 1UXWA 4G43A 5E6IA 2G3MA 3F84A 1HI6A 2B59B 1H6FA 4HUUB 4P2OA 1MCBA 1XDTT 3ARSA 3QCTH 5CCGE 1SLWA 2YR3A 4NENA 1FL5A 4I5BB 3FSAA 2C9RA 2NY5L 2ORBH 4E9YA 4ZW5A 3D69A 2NSXA 4HSQA 4S1SL 1EBPA 4GP5B 4BQBA 1UM6H 3PGDB 4X9HA 3QJFA 1NIEA 1FFTB 5FX3A 5JXAL 3NCYS 3WCYA 1QNIA 3PGFH 1AD0A 4X98A 3SBWA 5C2UB 3V4LA 2CHZA 3S6CA 4H26A 5I9QC 3VWKD 2FE0A 3EGXA 1OL0A 1D7DA 4QRQA 1FGNH 5JUEL 5A2JH 2AJUL 3LKNB 1IVLA 4LK4A 3BP4B 3EOTL 4R7NB 4X4ZA 2Z31D 5T5FA 1OO2A 4U1JB 1K8DA 3Q2NA 4W9JC 5DK2A 1UOLA 5INDA 3WXWH 1UZGA 1TZGH 1PJWA 1U8PA 4OLYH 4ZI8A 3EO9L 3I6KB 3WS3A 5AVXB 2Z31B 3HIZA 4F8QA 3L4YA 4UDTA 2J1ZA 2HFGH 1FVEB 4JR9L 3UPRA 2ZUYA 4GEIA 4ZOBA 2WD0A 4M7ZB 4AY0A 3IGAA 3E0GA 2DS4A 4JFED 4RGND 2CLRA 4XO5A 3TWYA 1IEHA 3LX9A 3FQNB 5GGTA 1K9TA 1T1WA 4PY8I 1FH5H 1G6RB 3BMVA 2J5LB 2IG2H 5SWZD 2PCXA 3VA6A 3QEGL 3OMIB 4O5LL 4JFEE 1B0IA 3L4WA 4RGNE 1J0IA 3L5JA 4JM4H 3H9SB 3K5SA 4JFEB 4RGNB 5CGTA 2BINA 2X88A 4FQCL 1HXMA 2NSMA 1J1PL 5C0DB 3C5JB 3B1TA 2DQJH 3BN9C 5SWZE 5SWZB 1FZJB 3RY6C 2XA8H 4K23L 2L4OA 4ABUA 4JVUA 3C5SB 4M8QB 1S9WB 4RSVA 4Y9EA 2WOYA 4KDTC 1JDAA 3EDEA 3GZQA 3I2CH 3JV6A 3ZW3A 4OD3L 4NUQA 3VI3F 4G9FE 1MFCL 2VDNB 2I9LA 5EZOH 3HHRB 1K8IB 3GXDA 3QORC 5FUZH 4JRWA 4KVNL 1JMZA 4HXBH 1AANA 1NGWB 2FIRT 1OEZW 1D5XA 3NPSC 2FQFA 3QUKA 2WANA 3QNZA 2F68X 4A7UA 5F3BA 3C6EA 1G9NH 1Q9KA 5ENWB 3WSQH 4BA8A 1J5OH 3HHSA 4HIXH 2EDTA 5LGJA 1ASQA 4U33A 4ODVL 3ZTNH 1UB5B 3KPOB 5DJ2A 5EG6C 1HXKA 5ID0A 1NBQA 1NCDH 1YEDB 3W9DA 2ZXCA 3FB7B 4JN2B 4POUB 3H85A 3H1ZA 4F57L 1TTUA 4FABL 1IKFL 2BHZA 2KPNA 2OJEB 2YA1A 4ZQKA 5AZUA 4FA8A 3IMTA 3A6BH 5GS2H 1QVOB 1VCAA 4MJ6B 1RLBA 4XE5B 1MCPL 3RVXC 8FABB 3TFKD 3WE1A 5CJXA 2ZSWB 4EI0A 2C4XA 4B9GA 5KVGE 1OGTB 4XBGB 1SBSH 3F05A 5KBPA 2Q0ZX 5B39A 4YDVA 1JXFA 5A2CA 1CLYH 3MLYL 4HOXA 3QJTB 3IKKA 4ZFOL 4WO4C 2YQBA 5FO9A 3ZRCC 2YXMA 2ADFH 1YRKA 1UD2A 3H7BA 3LH2L 2ESVD 2QLYA 4HUKB 4YHKH 1YZZA 3GSWB 3KHOA 3L4VA 4AYEC 2CO6B 4KMTL 3C12A 3GDBA 1CD9B 2DLHA 5I71C 3V0VB 2VMDA 4RAVB 3FPYA 3PS6A 1Q1JH 1QPPA 4LDEB 1IGYA 1BEYH 1NCWH 1U4FA 2ESVE 4QRFA 5E8NA 3ZDXB 4BUGA 1V7MH 1D5IH 1IB5A 2APTA 2BCMA 3MXWH 1NGPL 5G4OA 4YHZL 3WO4B 5DJXB 5FC9A 5BS0A 4JKLA 4YXHH 5CHNB 5GZOC 1YHPA 1MXGA 2YLHA 4G8GA 4TSBL 3QRFM 4U1KB 4CMMB 1PS3A 3SKMA 4Z7OF 4LU5H 1ZS8B 5B1BB 4DKEL 4JDZA 5IKCA 2VDQL 2WW8A 2Y7NA 4LSSH 4XP5L 1DQJA 1V7NH 5EC1A 4BCZA 5ALBH 1CCZA 5LBSA 4WI3A 2XY2A 4JFFA 4RDBA 4ONHA 3DJSA 2ZX9A 4X4XB 5FYKD 3U0PA 4GEJA 4OLUH 4OCWH 4OCSH 4O4YL 1OM9A 3BP6A 2J73A 2CGZA 5DJAA 3E2HC 5BMFL 5GRWA 4UQDA 3VWJC 1QACA 2P42B 5FYKE 2IV9A 5CM1A 2H45A 3BJLA 4E2OA 5FHBH 4MWFB 4U2YA 3P54A 1MQKH 3GI9H 1AC0A 3HKZA 3S96B 4D0BA 1IX2A 2VQ1A 1MH5B 2IDFA 3O6FB 4EZKA 3M6DA 1X5MA 2BSRB 9PCYA 4G1EA 5EF0A 1LP9E 3GXPA 2QKIB 4KUZL 4Z7UF 3QFDB 3KL0A 4C4KO 4EE2A 2VDRH 1U3JA 2CO2A 2NZ9D 3E3QE 3MACH 2NXZC 2R1YB 5AB9A 4NFBA 3HVDA 2IDQA 1UFGA 4R8WH 3FUDA 3BUIA 3ZOAA 1RUML 3ZIMA 4JQIH 3IDJA 1DVQA 1SM3H 2XV0A 2KZBA 4NUMA 3T3PE 1DSFH 1U8IB 3T3PB 3DETC 2H1PH 3TC9A 5IBLD 1HH9B 5EEZA 2YMXH 4LCVA 4XCEA 5IV2A 2X4SA 1TQBB 3CDGB 3LB6D 3NESA 4I1PA 1ZT7A 2GVYA 1A7QL 3NH7H 3MUY1 2NZIA 2FJFB 3SCMB 5LKNA 4MNHB 5D7JB 3DX9B 4BK5C 3TEYA 1RCYA 2DQ6A 3RB5A 5AUMB 4AOFA 2MNWA 4Q9RH 3MLRL 4PJ7A 1A64A 4U1MA 1XVSA 4LCYB 4L3ED 4PG2A 3RFZB 3L7EB 2Z8SA 3QDGD 3O2VL 4V1DA 4PR5B 3KYOA 4YDKH 4TULH 1V27A 2IOOA 5L4MA 5CGYD 1NCNA 1I9IH 1E4HA 2AABH 3ZXAC 1N8ZB 2ATKB 4L3EB 4IRSB 3QDGE 1NM4A 4ZMPA 1ZLVK 4QKXB 4TMPA 4PRID 4MX7A 5LGHL 1YPZE 5HDBB 1KYDA 2QVKA 3HNSH 4X4ME 5GGSA 3AS0A 3ASOB 3GEFA 5HHOB 2VXUL 1JWUB 1CUOA 5CZXC 4JGNA 4Z6AT 4WWKC 3LIZL 4PRIE 1N59B 4CMHB 4QHLB 2VZVA 4U0RB 2VAAA 2HAZA 4PRIB 1F1GA 4C47A 2Q3ZA 3QIWD 4L4VE 5F0PB 3ARFB 2TRYA 2EDWA 4Y7OC 4NFCA 2H2SD 3IFLH 1XQ4A 2ICES 4Y5YB 5EUOB 4HJSA 2K6ZA 2WJ7A 3Q44A 3ETBJ 4ZUUA 4DEUA 5JIIA 2DB8A 1XH2A 2V2TA 4HG4J 2EIMB 3QIWB 4ZMLA 3HVNA 5DHVH 3RWEA 4QAWA 2C9UA 3DUSA 4OZ4A 1TETH 2K8QA 4LOEA 1LE5B 2ETWA 1BM7A 3CVHL 4N6RB 5FYLD 3PWVA 3FO9A 4MNQD 4X99A 5KSVB 2OZ4H 2YZ8A 4I0PA 4MCZB 4XCYA 2OL3L 4LGSB 3ZJAA 1KLFA 4G3YH 3BWSA 5DD0L 2BOBA 4PV9B 4UQCA 2EXWD 4OQTL 2WQVA 4U1HA 5FYLE 4MNQE 4LP4A 1CFNB 4IKJA 1CICA 4UYQA 2NY4D 1IAKA 1DTUA 2AAVA 4EDXB 5AW9B 1ZCRA 3TJEH 4Z7QE 4BZ1A 2OYLA 4FQ1H 4QJ5B 5A2LH 3FCUB 2GAZB 5E5MB 3I9AA 1E42A 3P0VH 3ZBMA 1R3KB 5KZCB 1IFGA 2NY4B 1UZ6F 3P11H 5IEKA 4U6VH 1WZLA 3FQWA 2IH1A 4DQOH 2MKLC 4JHWL 5HGDB 4YX2H 4U1LB 2IAMA 1ND0B 1NIAA 5DZAA 1X5AA 1MREH 1EERB 1TVBB 3OJDB 4NERA 1USZA 2EZ0C 2FLBT 2EXYD 1JSYA 4ZSOB 2Q6WA 4Z3JA 1S6NA 4MBRA 3U1SL 1U8QB 1S7VA 3L1GA 1IGTB 1MJ8H 2FZ3A 3QCVH 4ZFQA 3UYRL 3T0EA 2HXAA 2YJLA 3GLAA 4MXVF 2E7CA 2JJTC 5C0CD 3BKCH 3N50A 3D25A 4X5XB 1K4CA 2IPTH 4A1RA 3OXRA 1DVSA 3R06A 5JIKA 2GPZA 2TRHA 5DO2C 3U0TA 4CRPA 1EZLA 4BYHA 2X4TB 4G6KH 3W0WD 5AALA 4XODA 5C0CE 5C0CB 2Y5QA 4NYLA 3WGUB 1AS6A 1BMGA 3U25A 1LEGA 2NY3D 3RG1C 3W0WE 3WHXA 4D9LL 2EDQA 5FA4B 4C4BA 2AQRA 4NRYB 5TDOB 1G87A 2JKTM 1T4WA 3PQYB 3STZA 4XTRD 3TA4D 3MOAH 2UWEE 5J13B 3UZEC 3MGTA 2W65A 3TZVC 3MLWL 4O58H 5AD0B 4U6XA 3LEYL 2NY3B 4F20A 1ZT1B 2X0WA 3RTQA 5D71H 2PKDA 5EC2A 5EFIB 3WJLA 3QUYC 2J1YA 1RURL 1A0QL 3NJXA 2VRQA 1R19A 3AJ7A 1E28A 3CVIH 2QGDA 3DGGB 3OMNB 1DJYA 1LWHA 3RBSA 3KS0H 2MCG1 2W5PA 1Y0LB 2JELL 3D0VA 2FWLB 3C6LA 1XGTA 2EKSA 3AWGA 4R9HA 3ZTDC 5J12B 2AQPA 4DN3H 4HGMA 2OA9A 4HCRH 4APQB 3QZMA 2NR6A 4KXZH 2AJVL 2WO2B 1RHHA 3N44F 3NIFE 1T5XB 2PF6A 1WFJA 2ODHA 1FSKB 2V2XB 2WKLA 2ZP8A 3IJ9A 4HHAA 4HWNA 4I3SH 4XMLH 5J6SA 1WBYB 3PDDA 5A7BA 5IFAH 1TNNA 3CHPA 3NRPA 3KD4A 4GAGL 3GXFA 3A4AA 4UQ3A 4XAWH 2BC4A 2ZCHL 4HX1B 1FDLL 1P4BH 3DHPA 1P0SE 1RULH 1CDUA 3CK0L 3JTBA 4G70B 3FCGA 4PWFA 3ZKXB 4PRHB 1UCBL 3P9LA 1CGUA 5E9DD 5H37G 3PNWB 4OD2B 1W2KT 4HDIB 4YIQA 1SN2A 3CFKA 3SYOA 4Z3TA 1II4E 1TMQA 3RLSA 2EIZB 1AP2A 3S98A 3WTSA 3CFCH 2DBLH 5E9DE 4UM9A 1S9XA 3B1UA 3P3SA 2X4UA 4X5WA 4KUCF 4AV5A 4JANB 1N67A 3F7VB 3CSYA 4ZNCD 3TH2T 4P07A 1V05A 5T5FL 5JQIB 5DQ9A 2BP5M 2NY2C 1ZIBA 4XP4L 1SHSA 4J3OH 5GGUB 4X9BA 4A2MA 1SJEA 4HWBA 1IC5H 1O5PA 3MFFB 4L0ZA 4OZIB 5C0RL 2IAND 2W94A 3HTLX 1U8LB 2JKLA 3I9IA 4IRZH 5F9AC 3MRGB 4HLZH 4RZKA 2WXMA 4Y4KC 3WELA 1HVXA 4QRUA 5HY9B 2UUDH 1XF5B 2WZ5A 3FFDA 1H3PL 3QUXB 2IANE 2JCCF 1UB6A 1G9MC 5EU6A 3K0YA 1FCCA 2E7MA 2IANB 5C0JB 2BS9A 4G42A 3AU0A 5F9WC 5GGTL 4F33B 3FH8A 2YGPA 4OFPA 4KI5C 4EDWH 4FP8L 5DSCB 3RE0A 3SDCC 4Z9KB 4X4YA 5JHDB 1Q90A 3PABA 4FMKA 4EOWH 2K4AA 1NCJA 2XKSA 5SX5K 3ARYA 4W9KC 3KGRA 4PJAB 2AQ2A 2IVFC 2PYEB 3QQ4A 3TCLA 4XNQA 5TH2B 3KPPB 4KO7A 3RTLA 3VMOA 4PJ9D 1GZHC 1I1YA 4UIMA 5GGSY 1A5FL 1MW2A 3AB0B 2EICA 3PHSA 2R7EB 4RMTA 2Z91A 4LQFH 1EV2E 2JJVA 4GXVH 5A2IH 1B4LA 4XMZA 2C9VA 3RJOA 5B7FA 3OKEA 5IP4A 4LOUD 4HBCL 3RY4A 3CHSA 4OGYH 5TE7L 1LK3L 4IEFB 3CMGA 1YYLL 4YHIA 2AV1B 4LOVA 4MXWH 3V0HA 5F6HI 1EAPA 3CN0A 3MUGB 4X6EB 1NCIA 3VSTA 1Q72L 2DMBA 4S1DD 1ZOXA 2YAOA 2F08A 3WNPA 2V8LA 5I1KL 3T71A 3MLTA 2OMNA 2QSCH 2I27N 3SBQA 4JUSA 1E4XL 4MMYB 2XQYK 5DC2A 4W6XB 3HE6B 4BCXA 1EJOH 2ZOWA 3GGWB 1N0XH 4XC1H 3ML9A 1HL4A 5AAMC 3BGFB 1YYML 2F2HA 5D7LD 4GG6E 1X5JA 1KB3A 3MX0A 4WI0A 4N2NA 3Q01A 1CFSB 3BO8A 1S7UA 1T2QH 3DJZA 1TQVA 3HUJA 2BVPA 4ZMVA 1ZT4A 5J1AB 3DHMA 2YARA 5D7LE 5B38A 5CP7B 3CZFA 1T0OA 2V37A 5T33H 2XVLA 3B2MA 4YHPA 4N9GA 4B9JA 3DK0A 5A3ID 1P9MC 1A1MA 1AHWB 4QHKJ 5ANMB 4X5QA 1MLBB 3MKGA 3MBEB 2R2BB 1ACYL 5TPWH 1E4KA 1JPST 3AZUA 5D4HA 3EYQD 2OMXA 3EOBA 1X9UA 3HZKA 3ABKB 3WIHA 5CFHA 4MVBD 4PRNA 4WEBL 4F7CB 1YLBB 3BE1H 3HC3L 2HFTA 1NGXB 2YD5A 3MYJB 3TYFA 1ORSB 4NUPA 3ZT6A 3GMRB 2FL5A 3M1BB 4JFPB 4MAYA 5LBSL 4JG1L 5AG9A 2JTYA 5GS0L 4M5YL 4LPCA 3QUMB 3WKML 4ZNEA 3FQ1A 4Q6IC 3JXAA 4X6CA 1CXFA 1HC1A 3LHAA 2DYPB 3WMQA 1OPOA 1XGPA 4ONOA 1GPOH 3KYMA 3G5ZB 3PV6A 2DV6A 4KKNA 2RIKA 4N2LA 4FMFA 5EOQH 2YKLH 3Q2VA 1JMXA 3KHQA 3O6LH 2FGWL 5E2WL 5FM4A 2ALAA 3DX7A 4MA3B 4OZFA 4PJGB 5DJ6B 4DNLA 3DOSB 4IQHA 2AF2A 4JFZH 2OMYA 1WZKA 5JXED 3VG0L 2P7TA 2W60B 5EU7C 3IGLA 2JJWA 2NT1A 5KS9A 5CIPB 4FQ2H 3JYCA 4UBDC 5CCKH 1FLRH 3MRIA 4C56E 3ULVF 1UC6A 2OP4H 2BSCA 2MIZA 2EYRB 1T66D 2OMUA 4LSTH 4R4BA 2VZSA 3WXVL 5CBEB 7PAZA 5J56B 5H4ZA 2QR0B 3AUWB 4R7DB 1BLIA 1A4AA 1A9BB 1HHIB 4UILH 2C3VA 1HHHB 5D2NB 3VG9B 3P4MB 1CBVH 4FQXD 1GIGL 1S7SB 4FFWC 5FDWA 1T89C 1Q0XL 1QA9A 2FBJH 2PO6A 2MNUA 3QAZB 3QYCA 3D50A 1AZBA 1QRNA 2XXMB 3EJYD 4QKTA 1M3JA 5IQNA 5E6SB 4XZ4A 7TAAA 2Z92B 1DP0A 1F4HA 3IDMA 4ZUSA 2YPKB 5SWSB 1AIFA 2Y5EA 4PB9H 1YEHH 1M3IA 1I9JH 5SWQA 3LY6A 2OYMA 4X9FA 4A04A 1SJHA 4GB9A 2ZWKA 4HJ0D 3E1F1 1CYWA 4GW1A 2FT7A 1WWBX 4GLRI 1NGQH 5EWIH 1BFOB 4IRJD 2AXWA 3HNVL 1SPDA 1D2PA 1UM4H 3GINA 4FXTA 4AZ8B 5DVPA 2QADD 4N8UA 4EI5B 1E5ZA 3P2TA 1T7XA 4XX1E 2WC7A 3TO2B 1FAIL 3OB0K 3TVMD 2NNXA 3OLDA 4A6YH 4KZDL 3GXNA 3VFGL 1MHHA 1TITA 2CR0A 4G5ZH 4K8RL 4F27A 5CEXA 3AFLA 4X7TB 2CHDA 3OAYH 4P46A 1I3UA 4GS7B 3W5NA 2ZUWA 4JHAL