3WNIA

1.50 a resolution crystal structure of dioxygen bound copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic evidence for side-on dioxygen trapped on type 2 copper in copper-containing nitrite reductase
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 98
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wniA00
1AIZA 2TSBA 1GY1A 7PCYA 2XYBA 2CCWA 1JERA 3OMIB 2VN3A 3S3DB 1AACA 1ZIBA 1OCCB 3H4FA 1JZGA 3IBOA 1J9SA 1OE2A 3PAZA 4BWUA 1NZRA 1AOZA 4A2FA 1SF5A 3BVDB 3FSAA 3TBBA 4Q89A 4YSSA 5I6KA 3ZIYA 4KO7A 3TASA 2BW4A 3SBRA 4YSOA 2YAQA 1BQ5A 1AANA 1TKWA 2HZHA 4KNTA 1ASPA 2BP8B 2FWLB 1PZAA 3NSDA 4CSZA 3WIAA 1FWXA 2PLTA 3U25A 3OMAB 1BYOA 2PP9A 2J5WA 3SBQA 1NWPA 3CDZB 1A3ZA 1PMYA 2YAPA 2YQBA 1E30A 2I7SA 2RACA 4QKTA 3T6VA 4FAAB 5AFAA 1DYZA 1ZV2A 4F2FA 2VW4A 2GC4C 2BP0A 3NJNA 1W8EA 2FQDA 4GP5B 3NT0A 3QJVB 3X2QB 1PNDA 1I53A 1A8ZA 3WNIA 3X1GA 1M56B 2YAMA 4BXVA 2IDQA 1ZPUA 3TBCA 4GP4B 3KW8A 5IY5B 3AG2B 3MX0B 1KBWA 2VW7A 4DPAX 2NRDA 4ENZA 1IC0A 3NJIA 2EIMB 1OE3A 5I5IA 1OCOB 1KBVA 4A67A 1CURA 2XV2A 2CJ3A 2YAFA 3PLYA 3T6ZA 1EZLA 1NICA 1SHWA 3FT0A 2ZWNA 2LLNA 4ZK8A 1JXFA 1ASQA 2EIKB 3NJLA 4G71B 4HZ1A 1CC3A 3OQRA 3FU7B 1ET5A 1JZIA 1NDTA 1NPNA 3ABLB 3GDCA 2J57A 3UABA 1FFTB 4E9SA 4DP4X 5B7FA 1J5CA 1JVOA 2XU9A 5B1JC 4YSDA 2H5UA 2FT8A 2VW6A 1WA2X 3ZX1A 2XXFA 5ANHA 2DYRB 1OV8A 3NP3A 4DP0X 1OF0A 2CALA 1IUZA 2UX6A 5B3SB 1ILUA 2FTAA 3ASNB 4N4YB 2ZONA 1RZPA 2IAAC 2W8CA 3X1NA 3AG3B 4YSQA 1N70A 1SJMA 2PPEA 5I6LA 1PLCA 1J9RA 5F7BA 1ET8A 2R7EB 2UXFA 4W9ZA 1QNIA 4DP9X 2H47C 4A2HA 3T9WA 2UXTA 3X1FA 2YAEA 1A4BA 2XV0A 4DPCX 4A2EA 3TA4D 4UAHA 1AAJA 3ERXA 3FSVA 2BP0B 4YSRA 2WO3B 5TK4A 4X4KA 3BQVA 1BAWA 7PAZA 5PCYA 1N68A 3UACA 1JVLA 5B1AB 3CVBA 3FQ2A 1AZCA 3FU8A 1ZDQA 3DTUB 4F7KA 1RZQA 1RCYA 4G7RB 2BZCA 2YARA 3OD3A 3AZUA 4K9JA 2B3IA 5FC9A 4P5SA 2HXAA 5F7AA 3IN2A 1XB6A 3NJHA 1L9RA 1OOWA 2FQGA 2P80D 5B1KA 3FU9A 4BDVA 2BHFA 4E9RA 3NJGA 4F2EA 1SNRA 3HEIB 1SDDB 1PCSA 2FJSA 1MZYA 1B3IA 4KO9A 2I85A 2HX8A 1GSKA 2H3XC 4P5RA 3QJUB 1NIDA 4RH4A 4BK5C 2GIMA 2EIJB 3SQRA 4DP8X 1T5KA 3EH3B 4N8UA 2GBAA 3H56A 1NTDA 2AANA 4KO6A 3QJQB 1BQKA 4KNUA 2JFCA 2UXGA 4DPBX 1A4CA 2XX0A 1SHXA 4JHVA 1KDJA 4UF7C 4DP7X 1BXVA 3KW7A 1MZZA 4KNSA 4YSAA 4E9XA 4AKPA 1KV7A 4DP5X 2WO2B 2GB2A 4GP8B 1W6LA 1HAWA 2QPEB 2PP7A 3NSYA 5AZUA 2FQFA 2PPCA 4HALA 3ABKB 1L9QA 4PCYA 3UGEA 6PAZA 1E67A 4YL4A 2ZXWB 4DP2X 1OCZB 3T6XA 4W1TA 4A68A 5D4HA 2E86A 1CYXA 1ZIAA 1V54B 4MFHA 4AI7A 2BZ7A 1ADWA 2QT6A 1M9WA 2DY2A 2QPDB 1SFDA 2QDVA 1ASOA 1W6WA 3JT2A 3V9CA 1X9UA 2VM3A 5I5MA 1AR1B 1JZEA 2X88A 2HRGA 2I7OA 4GXFA 3FQ1A 4GYBA 1WS7A 3NJKA 3H4HA 1URIA 4KOBA 5B1JA 2VM4A 1BEXA 1JZHA 1GS7A 2GSMB 4FA7B 3T6WA 4M4RB 1PAZA 1RKRA 3N2JA 3S3BB 1IBYA 2IWEA 3CG8A 1PZBA 1AZUA 1TU2A 1L9SA 5LDUA 1MG3C 2BO0A 1AZBA 1GS6X 3NSFA 1GW0A 2VSMB 5E9NA 2YXWA 2PPAA 2XUWA 4CSPA 1ILSA 1XMEB 4BWTA 1EHKB 3RYMA 2MTAA 1IKOP 3FYEB 1PLAA 3V9EA 2Q5BA 2IDTA 3FPXA 1WS8A 2BWIA 4L0PB 3S3CB 4YSPA 2J56A 5I6NA 3WI9A 1CYWA 1M57B 1A65A 1PY0A 3ABMB 2IH9A 1NIBA 1XB8A 3ABGA 3EH4B 3FU7A 2PP8A 1J9QA 2HLEB 1KGYE 4YSEA 1F56A 1JXDA 2XVBA 3EHBB 1ID2A 3NYKA 2Q9OA 4JHUA 1TEGA 3DIVA 3NJMA 3NJJA 4UANA 2PCYA 1AZNA 2XV3A 1BXAA 3L45A 1IBZA 1AZRA 4EF3A 3QJSB 3FSZA 1X9RA 1PLBA 2GI0A 1OE1A 4HCIA 5I5JA 2MRYA 1NWOA 3IEAA 1SFHA 4AKOA 3WG7B 1WAEA 4HCFA 1V55B 3N55A 3WKQA 2AZAA 3FS9A 3PAUA 1PZCA 3CVDA 3UAAA 3SBPA 1AG6A 4JKNA 4YSTA 2Y69B 2WSDA 4AZUA 1MG2C 5I28A 3FPYA 1UATA 1PNCA 2AFNA 3NJFA 1DZ0A 4KO5A 3T71A 5I6MA 3OMNB 1NIEA 2QDWA 3DKHA 4GY4A 1WA1X 3MBWB 1NPJA 3NSCA 2IH8A 4G7SB 1GYCA 3EH5B 1KYAA 2IWKA 1VLXA 2XX1A 3CVCA 4DP6X 2JKWA 2YXVA 2A3TA 4YSUA 1AQ8A 2DWSA 1AS8A 2GC7C 2VMJA 1HAUA 1A4AA 3ZBMA 3IE9A 5AKRA 3C75A 1NINA 3ZDWA 1WA0X 2FQEA 1GR7A 2CAKA 2PPDA 3CZUB 2OCCB 5D4IA 2DV6A 3FYIB 2UX7A 3S8FB 5I6OA 3PCYA 4E9YA 8PAZA 4WKXA 1SF3A 2IWFA 3PXLA 4PAZA 2EILB 2N0MA 3FSWA 4M3HA 5I6PA 1GS8A 2IDUA 3WKPA 1JXGA 4Q8BA 2XWZA 5A7EA 3FQYA 1L9PA 4A2GA 3GXUB 1PF3A 2J55A 1E5ZA 2VSKB 1YLBB 2BWDA 3AW5A 3CDZA 1AS6A 4A66A 1R1CA 4E9VA 1BXUA 1E5YA 3PAVA 5I26A 5TK2A 2FNWA 2TSAA 3D12B 3WNJA 2OJ1A 4KOCA 4NB7A 2HX7A 3QPKA 4E9TA 2UXVA 9PCYA 2FT6A 1ET7A 4YVNA 1QHQA 4WTQA 3PPSA 5PAZA 1QLEB 2CUAA 1E65A 1HFUA 2Y1AA 3QQXA 2EINB 2YAOA 1JOIA 5B7EA 3GYRA 1KDIA 3UAEA 2IDFA 1XB3A 2DYSB 3OM3B 2B08A 1JZJA 3ASOB 1OCRB 4YVUA 4G72B 4YSCA 2GHZA 2DWTA 5B7MA 5B1BB 4HHWA 2PPFA 4HCGA 2AZUA 3HB3B 5EHFA 2FT7A 3QJRB 1NIAA 1MDAA 4HAKA 4BWWA 3S8GB 4E9QA 3AG1B 4AX3A 1TEFA 4NERA 2YAHA 4QLWA 1J5DA 2XLLA 3X1EA 3G5WA 4HIPA 4G7QB 3IN0A 2BP8A 4DP1X 2HRHA 1ZDSA 2R7EA 1CUOA 1V10A 3NP4A 2OV0A 3AG4B 3EF4A 3JTBA 5D4JA 3X1BA 2BW5A 2X87A 2PCFA 4NAJA 1BYPA 1FA4A 3TU6A 1JZFA 2CBPA 4G70B 4AKQA 3UADA 2IDSA 2XXGA 1KCBA 2ZOOA 1SDDA 1L9OA 1BQRA 1AG0A 1NIFA 3QJTB 1KCWA 1J9TA 1ETJA 4BDVB 1AS7A 2AVFA 2JXMA 4A2DA 2HX9A 2P80A 4HHGA 6PCYA 4TXVB 4E9WA 2W88A 4BXSV 1L9TA 3AY2A 1GY2A
chains in the Genus database with same CATH superfamily
1T03L 2GK0B 2A7BA 4HXAL 4ZFOA 5LLIC 2BY2A 1M3JA 3U46B 2GUOB 1AIZA 1ZSDB 4POZC 5C0NC 4L4JA 3T4AB 2NXZD 1CFNA 1R5WA 1ZVHA 3BP5A 1N0LB 2BJMH 4B97A 4K9EH 5E5LA 1RIVL 1XF3A 4MB3A 1ADQA 4NZFA 4WENB 1DSFH 4RNRB 2WXRA 5IHLB 4JGNA 2EDNA 5KVGE 3KLDA 1G7PA 4YC2C 4FFWD 5DQ9A 3SDAD 3B2MA 2V9UA 4ODSH 1KXQA 1WE5A 4YSSA 4Z5RA 4LCUB 1RZ7H 5IMMB 4WZ9A 5TDNA 4R4BB 3ARUA 5I1KH 2BW4A 4M3JA 4AQ1C 5CCKL 1CE6A 4W9CC 2EDJA 1Q38A 4KNTA 2YD5A 1J18A 5JHBA 3NGBC 3UAJC 1XGPA 3RX5A 2PR4H 1T66C 1A7QH 2X9YA 4I8DA 4FTVD 2Y3NA 4TQHA 4UIKL 1LTXA 4FNLL 1LVEA 1FNEA 2IDCA 2OR8A 4G6AC 2O5ZH 2WQXA 3GI9H 2FO1A 1FN4A 3DROB 1IZJA 4N68A 5E08H 1XEDA 4GAFB 5LKNA 4U3XA 1BFVL 4CADB 3VXUB 4Y16A 3DTXA 5CJXA 3RWDB 3MNZB 5HGHA 1TZOA 1FZKA 3HG3A 2WZ6A 2Q2LA 3MBXL 4KITB 2VT0A 4XPFH 4BM7A 3BPOB 3H42L 4PTUA 4NQUA 3D0VB 2CZNA 3PU7A 4K2UL 1M56B 1A6WH 3DX4A 4XWOD 2HKFH 3AABA 3N0PB 2PUQT 1HXYA 1YJDC 2YRLA 2NRDA 4I88A 1LILA 5KSAD 4QRUA 2XWEA 2G3MA 4ODUA 3DPBB 4JQVC 3OKDB 5D7JC 1OIOA 5HHOA 5LUMA 1FCGA 1BXXA 2OMWA 3PXHA 2OXGA 3TO4B 3GPSA 3ILQC 1XTLA 1HHIA 4HC1A 2R0WH 4NUMA 4YHPB 3VFOA 2DQMA 2W65A 2Q8AH 1CC3A 1YY9C 4MB5A 4O2EA 2A4EA 1T0NB 4KKAC 5DSCA 4U0RC 2HP4A 5B38G 5B7FA 5IQ9B 2NY4D 2EYTB 1MCFA 2OULB 1G9NC 2IQAB 3ZSTA 2FJGA 2ZOUA 4F57H 5B1JC 4JFZL 3BP7B 4I18B 3X3GH 3CFTA 2NX5A 3N06B 2V6HA 2H5UA 1Z1WA 1YNTB 1E43A 5E6RB 1CXEA 3ZSSA 1A7BA 2K70A 3KAAA 2XXFA 3OZ9H 4JN1L 4L9DA 1J8KA 5DZAA 4N4YB 1JS4A 4JY4A 3B6SA 2VERN 4B60A 1TJXA 5TH2A 5EU5A 1IVLA 1RFDH 4WFEE 5T5FA 1BGXH 3L2MA 4N0UE 2J43A 4NRYA 1T83C 25C8L 4M1DL 2HWZH 4W9ZA 4WNSA 1XF3B 2YHGA 3ZDYF 4L1LA 5ALCH 1BQHA 2WTRA 1ADQH 2H2PC 2XV0A 1KJMA 3LB6D 3KLHD 3IGKA 3HA0A 3DX6B 4CMMA 5HDBB 4X7SL 3RTQC 3SGDH 2LABA 2JQAA 2W0KA 1IGTB 4G1EB 1NOAA 4XB8A 2HFFB 5DUPL 2X05A 5GRXG 3CK0L 4FTVB 3FRUA 3HTLX 4PJ7F 2FEDD 5FYJU 4FHKA 1RZQA 3QEQB 1HH9A 1G7HA 5E00B 3OD3A 3QEQE 4O02B 5I76A 2DM7A 4P5SA 2PF6A 1IFRA 1XB6A 2FQGA 1R3HB 4JHBA 4X80H 3AUWB 1JRHH 2LE9A 4KVPA 3KYNB 4G80A 4LSDA 5AYUL 2Z8VC 5ICYA 7FABH 4DF9A 4PP2A 4UQ2B 3PXJA 4Z3FA 3CBRA 1ZXQA 1CK0L 5AUMA 1DVUA 1SYSB 1YPZE 1JGDB 4BRVA 4IRJA 1MHHB 5IR1B 4KMQA 3ECWA 4DP8X 4PV1C 3CWGA 4N8UA 1OAQH 3BZFA 3INOA 4KRNA 4HX1A 4F7TA 4XP1L 1M53A 4F9PC 4KNUA 4GG8B 1KGCE 4Y2DA 3DYMA 1PGRB 5I8KH 1A4CA 5CILL 2XV6B 4CU8A 4N0UA 3VWKB 5DZOA 4RZCB 3BOVA 5H4ZA 2AW2A 4B41A 4HWEL 4BHUA 4KVNH 1MZZA 4JQIH 4DN4H 2OR9H 4UOW0 3DETD 3MRNB 3NIGF 1SZNA 1I3VA 4NQTA 4U7SA 3V6ZB 5B39G 5FEBA 3M07A 3WOVA 2EDQA 2VDRB 3PJNA 4Y5XB 2A74C 4AQEB 2CLRB 3EJUA 2PP7A 1G0DA 2WLIB 3IWVA 5AZUA 4XCCL 2GTWA 2XTSA 3RZCC 2B1AL 1V7NL 2K7QA 4JS7A 4YHOL 3SJVD 3ZZLA 4ATTA 5HDOA 2KDYA 3OHXC 5FDWA 5GZOD 2H6UA 2R29A 4Y2OB 5IM7B 1KG0A 3V5KA 4QO1B 2VDKL 1NMAH 3CPLB 3US0A 3CPUA 1AY1L 3GBLA 4JFEB 4HJEA 4F8PA 5F3HA 1KJ2A 2VM9A 2P24A 3SDDD 1PSKH 1SFDA 4GSUA 2FB4L 4LLAA 5FM5O 1PQZB 4X6DB 3VQLA 3P11H 1KB9J 4OB5L 4UOJA 2VM3A 5ETUB 3AS1A 1VEPA 1U93A 2AV1A 2F53E 3FTZA 4OQ1A 5IIEB 1PG7W 1MLBA 4Y4KC 1KJVB 3MA9L 2DMKA 1TFHA 1WS7A 1MFBL 4GKSA 4ZOAA 4LPVA 2AQQA 1OAXL 2GJ6A 3OF6D 5D7LB 2GFBB 4P06A 3TO2B 2BHUA 2X89A 2CJUH 4G6MH 2ODIA 5KBLA 1NGXA 5KSVA 2VLRA 3DXAD 3Q9QA 1O75A 3NABL 4R7VA 5E8DL 5K39A 1F8TL 2X4UB 3D50A 5LBSA 2ADGB 1F0LA 3ECBA 3B2VH 5DMIL 3WS3B 4RX4A 1KMGA 5DS2A 3VXNB 3DVFA 1I7UB 3MMEB 3RLSA 2CJUL 2PETA 3RWIB 4PJ9B 1EHKB 4G7VL 1D2OA 2G5UA 5FK9A 4U1IA 3V9EA 2BSTA 2VLLA 3ZKMC 5FGCB 3GUTB 1C08A 2WJ5A 3QI9B 2J56A 3F7VA 1S9YA 3WI9A 1M6OA 2VR3A 4CSTA 2CM5A 1XB8A 3ABGA 4HULB 3U6RB 4MQ7A 5F9OL 3DX1A 3VX1A 1KGYE 4D9LL 1KNOA 5EBLA 2QKSA 5E03A 4AGOA 4JVWA 4QR7A 3O6FA 4IRZA 1MCPL 3VFRA 3MRBA 2R0KH 4RMTA 5C0GB 4EBQL 4JKWA 2GI0A 2FIKB 4AJWA 1ZCRA 2CDGA 3DRTB 4WUKH 1MW0A 5KYYA 1AC0A 3ARDB 4P4RA 1RZFH 3CVDA 4JM2C 4RDQG 3S35H 4DW2H 3H9SE 4MNQD 3LZRA 4MASA 3PHQA 2X0VA 5GGRB 2YGPA 4WFHE 2I9TA 3DVNA 3LX9A 5SWQB 5JO5A 3T71A 3PREA 4FULA 5FW8A 2L7UA 5K1JA 1P4IH 1CFSB 1VZHA 3LPFA 4JRXB 1AGDA 1MWOA 2UYLB 3SGDI 3WNNA 1XD0A 2Y5EA 3K46A 2FEEL 3G6JA 3OX8B 3WDHA 2WBJA 4JZJB 5EUOA 3OZKA 3CFKB 3WE6A 3IETB 4HUUA 4LBEB 4DN3L 1A4JB 4JKMA 2V5YA 2WBXA 1XGZA 5I1HH 1QBLH 4MXWH 1SGKA 3Q2LA 3V10A 3T2NH 2CAKA 5DVKA 5F1OB 4JHAH 5IVOA 5I1DB 5K9KB 2CCLA 4UTAA 3FYIB 1Y0LB 3NEXA 4PJFF 4RAUB 2CGZA 4FFVD 5AW6B 2PCFB 3JWNG 2YOAA 4EAEA 1F2QA 3P3YA 4FFYH 3DX3A 4L0ZA 1EVTC 3IK2A 2YEZB 1Z9MA 1NGQL 3ARFA 5D1XA 1CR9L 2KKQA 1N19A 2PTTA 4G3YH 1FGNL 5J8OA 4BYHA 3WO3B 4APQA 2K6WA 3QNYA 4W93A 1LNUA 3L3HA 3IAPA 4TS6A 1JZ4A 1B0WA 1FBIL 1KCSL 1Y6MR 2GJ6D 2BWDA 1FL3B 4OI7A 1S46A 1BF2A 3OR6B 1BD2D 2V2WB 1KYFA 1KCKA 1OK0A 2BVOB 2FNWA 2RGSA 4IU2B 4RAHA 5DFTA 2OJ1A 3QDGB 4TVPL 4GJTB 1AVAA 3APMA 2VLKA 1MFMA 3V8OA 1Q4NX 1X5GA 3II2A 4H4NA 3OKKB 3QJFB 2HT3D 1BZQK 1I9EA 4QOKE 4JM0A 1SXNA 4I18C 3TIDA 1WZ1L 3QRBA 2Y1AA 2A9DA 2GAZB 5CZXC 3KBEA 3RB5A 1ETB1 2WHVA 2NY1B 4YDZA 1MCSA 5I71B 4MVBD 4TVUA 4HJTA 1C8PA 3I02B 2B08A 3DJRA 3HZKA 4OJYA 1DEEB 4YSCA 3V55A 1FJ1A 4FLOA 4NAQA 4RMUA 3DOHA 4XCCH 3MRDA 5TGBB 1W0YT 3RKDC 3FAXA 5I18H 3LIUA 3M88A 4NOBA 4CU7A 2ISDA 2HA1A 5T8IA 3C08H 3WN5B 5C09B 2J8UF 4ZI8A 5E1IA 2C9PA 3T1WA 4WHTB 5D7SL 1WAAF 4F8LA 5D70H 1PS3A 4CVXB 4JO4L 5EIIG 3D8MA 3FCUB 2DLHA 1BFSA 1CUOA 1X5KA 4M5ZL 2GUYA 2XA8L 4GIPD 5D1QB 4PB0H 4NAJA 1XZ0B 2GITB 4UM9A 1M2VB 4QRBA 4K7PH 4XVJH 1MCBA 3TYFA 3DGGB 5E2UH 2W0FA 2QR0B 3BAEH 5BO0D 3AT8A 1F13A 3DUUB 3DXAA 4XP6H 5CBEA 2MCMA 2KI6A 3MTXA 4R97C 1E7UA 4AIZA 2B4CC 4JHWH 4AQ1A 1YMME 2W88A 4XVJL 2C26A 1EAOA 1GY2A 5GS2D 4Z7UA 4F9PA 3FQTA 3N9GH 3TT1H 2Y25A 5DYFA 3S5YA 3K5RA 4JO1L 4ZQKA 3REWA 5JW3H 1RK1A 4WSGA 3EJYD 3S3DB 2E9JA 5HI3C 1RULL 1A3LL 2B5IB 2Y7OA 3ARSA 1EJFA 3I75B 1AGEB 2ZICA 1OE2A 4D3CL 4KZCA 3S88L 3SYCA 4UDUA 1CLZH 2NSQA 4HW6A 4UM9D 4WNQB 2ZF9A 4D94A 2I5YH 4P4KD 1X4XA 2NZIA 3TEWA 1GYVA 4ZMWA 3MRLA 4I77H 1GZPA 2WW8A 4YSOA 1BQ5A 1XSIA 2V9RA 3GSNH 3IBEA 1IAMA 4OFYA 3F7LA 4X9GA 2VMEA 1KN2H 2HN7B 1HZKA 1U8IB 4M00A 3KBFA 2ZYSA 2YD9A 3B3BA 1TVHA 2PP9A 3L1FA 4YHIB 4I77L 4MQTB 2F15A 1UASA 4IRSD 5T3ZE 1QWUA 1E6OH 1NWPA 3O8XC 2PCPA 1AD9B 3CVHL 4M93C 1PMYA 2YQBA 4Y4HD 1E30A 5IW1A 3WXWL 5IBLD 1WHPA 3RP1A 5L2KD 5B21A 4JGMA 1G5GA 3QJZA 3D9AH 1YCSA 5I9QC 1SQMA 4GP5B 4R4FL 3Q0HA 3Q6FA 1ZWIA 3X11A 2GIXA 2ZKXA 1JWMA 2FATH 5D7IA 5EN2B 3ZRSA 2OJEB 1RAMA 3U0TB 1P6AB 1P6WA 3QIWD 4G7YH 1I3RA 2NY4C 1IM9A 5D1ZI 1T5WA 2WLHA 4EI6A 2F1AA 4F1ZA 3G04A 1BZDA 1Y07A 5J0BA 4DEUA 5JHDD 4KGJA 4XI5D 3MXVH 3VA6A 3ZE2F 1JNNL 2P5ED 4KJWC 2OK0H 4C4UA 4F58L 4OSUH 5IFJB 3GJFA 3M1CA 4WUUD 3QIUD 3QGVA 4OZIA 5I0YA 4TF4A 3QCVL 4G9FB 3NJLA 2WJ7A 5BVJA 3H7BA 5MERB 3UG3A 4CGTA 5EF0A 5C0IB 1P6FA 1T21B 1TITA 4ETQA 2O6DA 5AKVA 2VZTA 3VE0B 2FEEI 1J5CA 3BAYA 4X7TB 2ZE0A 2VDNB 4JPIB 3A0OA 1GL4B 3LNIA 4XOCA 4YSDA 1DCLA 3BPLB 4XCFH 1O7VA 1E27A 2FJFA 3FCBA 1BVKB 1JE6A 3ARVA 3T3MF 3TNNB 1EUTA 1NH6A 1WA2X 3CFBB 4Y4FA 2F54A 3MLWH 3MRCB 1R34A 3VXME 4FQ2L 5J5EA 3NFSL 4PJGB 5DK2B 1CZ8H 1U91A 2EXYC 1GTFA 1J05B 1KPUA 3TWCH 4NWUL 5C0DB 3G3LA 1F1GA 1IBFA 4DJMA 1TDQA 1MN4A 1OGAB 2UUDH 1QVOB 3CSFA 4Y4HB 3BEVB 5KBPA 4Y19A 2V2TA 3G6JB 2BXYA 3HHSB 1QUPA 1R24B 3B5TA 3ULAB 1IEAB 2XWRA 4P3WA 3VDCA 4MS8C 3R18A 2DQGH 3D33A 3DPDA 4XVSL 4Y9GA 3N1QC 5C9KA 4X4KA 5KVFL 7PAZA 4J3BA 2J44A 3K7UA 1XGTA 3QUKA 2EXSA 5FKPA 3GJEB 2H3NA 1IFHL 4FABH 5KVDH 1NCWH 3DTUB 2ADIB 4F7KA 5FOBA 2YMXL 4EZLA 4LFHD 4ZTOL 2IBGA 3V4VA 5ICXA 2J6WA 4A2LA 5BZDA 4JG5A 1L9MA 3NZSA 3BKJH 3FU9A 5DHXB 3QPQD 1DANT 4NJ9L 3E8VA 1EERB 1LP9A 4F2EA 4LEXH 1QR1B 3QG7H 3TNMA 4FLQA 2ENPA 3QFDA 3DETC 4WW2B 3RWHB 1EHLH 2Z8SA 5F7WC 1GGYA 5HHPB 5FUZH 1TQCC 1G43A 4HDIA 1Q72L 4QHLB 4NI6A 3S34L 2QHLA 1LWHA 3UZQA 2UY7A 4AMXA 3ZTDC 4CA4A 1N5YH 3PWVA 3K72B 4NP4L 2GTQA 3VSQA 3PUCA 3I9AA 1Q1JL 1EHLL 1E8WA 3HR5A 4XN1A 3WTVA 4E5XA 3F7VB 3ARGB 1T0OA 5E2VH 2LAGB 4QRRB 4WJG3 3KW7A 4PLKC 5C0IA 5GZOC 1MJJA 1RUPL 3LKOA 3O3DA 4YO0B 2GJRA 3BEWA 3ESMA 2GB2A 4HJJL 2EYRB 3VGAB 1QTPA 5ABZA 2UZIH 1F8TH 4D7BA 1ND0A 2J1WA 5IOPB 2ESVA 4QJ5B 5C3TA 1HH6A 3BHBA 3NSYA 1W8OA 5L7XL 5EUOE 1KPVB 3K0WA 3SSGA 4J3OH 2IO5A 4PYGA 1I9IH 1MQKH 2D7TL 5EEYA 3X12B 2Z1PA 2GCYA 5C09D 1MAMH 3HRPA 3BKYH 3IU3B 2WOYA 4K5OA 3O6ML 5T3XL 5BV7H 2EIDA 2OZ4A 3ULVH 4TQIA 3BGMB 4FE9A 1U93B 2AV1B 2Q10A 2PR4L 2H8PB 1VGEH 4FFZA 1V54B 3AMLA 5D2LF 3CZJA 4J2QA 4MFHA 4OCMC 2GY5A 3QO0B 4LQFH 5F3HB 4MZ3A 3QPXL 4AEEA 1X9UA 1MCPH 1UD6A 2E6PA 4LHUD 4JKPL 1JF5A 4XXWC 5G5DB 1XGRA 3EJPA 4P99A 2YGNA 1TTRA 1KCRL 3F2LA 2NLJB 4KK9C 5HVWA 1G5AA 1UWEL 1M05A 3KLKA 2PYED 3WELA 2XN2A 1CFTA 3MV7E 1PAZA 3CZGA 4RWYH 5AW3B 3GINA 1SVBA 3G5ZA 3QNFA 2DOCA 4PJ7E 4KK8C 1GGCL 5IMKB 3P0VH 4XVOA 2YD4A 4P57A 1WHOA 3LXUX 3MRJB 2NY3D 1A2YB 5D7JA 3HOGA 4KZDL 3EJYC 4BQ6A 3U4AA 3D3VA 4AQ8C 2X4NB 1RHHB 2K6ZA 1HCVA 2KDGA 1ZV5A 5I6NA 5AYUH 3RUGB 1M57B 4ZW5A 4JM2A 4NQVB 1DBAL 3DSNA 1XEUA 4M29A 4O2EB 4P4KC 1MIEH 5TQ0H 2YBRB 2HLEB 2CRIA 4AUYA 3T8XB 2R23A 2YJLA 1B2WH 2XT1B 2XVBA 4ZS6D 1ID2A 1PJ9A 5FA3A 4UANA 2G4EA 1IFHH 4LLWA 3L45A 2FWOB 3BAWA 3LXCA 1XCWA 4EF3A 3ZY7A 2QVFB 5E9DB 4ZMZA 5KW9H 2Z31D 1MCIA 2D73A 4Q74A 3IXTA 3HG0A 2COVD 4WW1A 1AP2A 3SEPA 3HE7D 4HCFA 4P3CL 2WBJC 4JFOB 4PFEA 1RZGA 1U21A 1E3ZA 3LN5A 1JZ2A 3A4DA 1BVKA 4X7FC 4ABWA 3ZYZA 4YSTA 1UA7A 3TJHD 3M8OL 1TZHB 1QG3A 4WK2B 3RWDA 3W0WD 4AL8H 4EN3A 3ARYA 1LE5A 3NJFA 3TWCL 2ZWZA 3MC0A 2F58L 2G30A 5ALCL 5FHAH 1FN4B 3ZTNL 4OGQC 4NKMA 3BT2L 3OV6A 2E6QA 4MJ2A 5EU4B 5F1IA 2Q7YA 4BFBD 5K93A 5I66B 3VD1A 3RL2B 2HVKA 1ZJAA 2JKWA 5ACMA 2J6EA 1KBBA 2Z93B 1CG9A 2H41A 3B6SB 4M7KL 4NQQA 5EA0L 3NACL 3WEOA 3W5MA 4IM8A 2KQNA 1MFNA 2WYHA 3V6FA 3S8FB 1DL7L 4I18A 2NTSP 3BP7A 2AP2A 4OLUH 2FD6H 3SDXE 2BVTA 4M3HA 3AGVA 3ZYOA 1DN0A 2J8OA 3WKPA 2HG0A 2VDQB 1R5WB 2YGQA 1OT2A 1MVUA 2YD6A 3FN3A 1DBKH 1YPZA 5AVZB 5DC2A 5IB5A 4MVBC 1E5YA 4LSVL 5BVPH 3VFOB 2ZX8A 4H25B 5LGYA 2CA4A 2ZXBA 1FH5H 3OAYK 3TH4T 3KNBA 3CFCL 4E9TA 3W5NA 2AJZA 4NSKA 3TVMD 2H1PH 2JI3A 2X6UA 5IVXF 3SZKC 2I9LA 1HYRC 2NDFA 3CSGA 5BXFB 2WQRA 1NMCB 2FATL 1BECA 4LHQB 3GBEA 3Q48A 1JZ6A 4TSAH 1HNGA 1YEIH 4BK5A 3HC2A 5K9JL 3EFDH 3GZOA 1YYML 4LHUG 4LSPL 5CM1A 1FZKB 2Z0BA 3A6BL 5FA3B 4NZ8A 3ZXAC 4NC2B 1LDSA 4HU2A 4UV4H 4PJEA 2OTWB 3WFEH 2DWTA 3R0MA 4PN6A 2OMVB 1AFVH 2Z92B 3CZNA 4JM2B 4Y7OC 2D31B 1XCQB 1HHKA 1YMMB 5IBTH 1CFSA 1OOAA 5DUPH 1YEGL 3MQIA 2CG9X 3RWFA 3RKPA 2YD8A 1ONQB 2H1LM 5IQMA 1S7UA 3EO9L 3A6BH 4M6ML 3RNQA 5M95B 5MEOB 2X4NA 4M9PA 3W1ZA 5EDXA 3S2CA 3RVUD 4NKQB 5CU5A 5D7JB 1WTGT 4M9OA 3TPKA 2KZWA 4D8PB 2NW3B 1FRGH 3ZPDA 1HS6A 2QR0A 1HZHH 4LLVB 5F70A 1HJBC 5I16A 4NZUH 2BW5A 3BLKA 3B2UD 1A6VH 4J1UB 2EEBA 1L6XA 2IDSA 3NMEA 2X0WA 4LARH 1CN4A 4P46B 4WW2C 4XAKE 4LCIH 5F89A 5T1DH 4OAWA 3MLZH 4FQXA 4X83A 4JUSA 4C4KO 1DBBH 1HU8A 3DBXA 4HIXH 3BKCH 4U1MA 3QORB 2X9WA 1ETJA 4BDVB 1TJGL 2KPNA 3P9LB 5HHNB 4A2DA 3CHPA 2Y1YA 4HOMA 1UXSB 4HHGA 1MFDL 2IGFL 4LESA 5GPRA 2R1YA 1T04B 1BZ8A 3AY2A 3QWOA 4ALAC 4PJFE 3IKKA 5KYWA 5LCVA 3VO0A 2CGRH 4PB0L 2C9QA 3B2XA 1XAKA 2JJSC 4X98B 1J10A 4K5PA 1T6BX 3LS4L 5LXGH 1AQHA 2L4OA 4UAOB 2DJUA 5H94A 1KTCA 3IU3A 4FQXD 3BQUB 4XBEL 1RZKC 2VLLB 4J8QA 5I15L 4GUQA 1NCIA 3IBOA 2CCVA 1P84K 5DJZB 5E4EB 1U8OA 3PGDB 2XQYA 1QR4A 3S9DB 2MOQA 5DR5L 4E41D 3FO0L 5IQ7H 3BVTA 3T1FB 4GG6E 3HI1A 2BNRD 4RMSA 1AANA 2HVJA 5DMJB 5C08E 1JFHA 1A1NB 3C5JA 2ZXGA 2GW5A 2AI0L 4P5MA 5DHYA 3OPZH 1JPSH 2ED6A 2ZZUT 3A4FA 1EJOH 4YGAB 5K1VA 3SHSA 3QXTA 4HS6B 5DWPA 5ENWA 1EFXA 3SY0A 5BJTB 2YPKA 1YAZA 1OSPL 5JXEC 1KJVA 3PL6A 3AITA 5EPMA 3FOMB 2IOIA 3KYMB 2NOYA 1H8NA 4B9ZA 4IOIB 4MB4A 1QRND 3EDKA 3IJHB 1PQZA 4Q9BA 1BSIA 3IAQA 3VFMA 5DF0A 1HK6A 5EEZA 2FSEB 5CKAA 1QLFB 2CD0A 4TNFA 2BP0A 2OMZA 4GEJA 1QSFD 4OQTH 1N5AA 2G9HA 2NY3C 1JWSA 1PNDA 2BVPA 1BM3L 5G4MA 5EU6E 4LCCA 4HJJH 1QNZL 1JI2A 2AF2A 2OP4H 1INDL 4IRZH 4OLZH 4FQXB 1ZPUA 1KXVA 1DJSA 2IAMB 3FKUS 2MNUA 3UC0L 5BO1H 1MJ8L 3KZ8A 4DPAX 2AQNA 3NJIA 1WT5A 3VTMA 5IJKC 2FVNA 4XO3A 3TT3H 4P2RB 5AW5B 3L3GA 3OR7B 5DVPA 1IAOB 4N0FB 3T2OA 1KGXA 3QUYC 1BW8A 1XIWD 1EZLA 3MFGB 3MJ7B 4K0OA 5HY9A 4YXLL 4ZUSB 3ZQ9A 1RVFL 3Q06A 3MGOB 2EIKB 5FCUL 1ZT1A 4RESB 2VR8A 4AQ8A 4HIHB 4IIZA 5J1TC 4QHKJ 1D5MA 3TO4D 5FO7A 2QHRL 1NC4D 3AS2A 4UYPA 3RPKA 4E9SA 4ILDA 1ZS2A 3F8UB 1VGKA 4OZHF 5SWQA 1BOGB 1IEAA 2AJXL 3J27A 4YPJA 4WY7H 1GGBL 4I2XE 1G7LB 1UM6H 4BZ1A 1FVCA 2EH8L 1QVOA 4Y4HA 1FYTD 2XWDA 3TA3D 2OL3B 1ZV9A 4X2UA 1I75A 1E4WL 1J05A 4GKOA 2R9HD 1MJ8H 2CDGB 3GK8H 3B7UX 1OF0A 2UX6A 4WHCA 3UPRA 3ASNB 2W60B 4OFIA 5TDOA 3VRIA 5C0GA 2W8CA 2QPUA 1PZDA 3ZUNC 3SPJA 1LO4L 5D7KE 1IAIL 4M48H 2FO4A 2Q8BH 4HT1H 1H3GA 3EGSB 3T3PB 1UH4A 3S96A 3EYOA 1KTRL 1MSPA 2VISA 2R2BB 2WXLA 2NY6C 2CKBL 2AKRA 3E6HB 3FB5B 3L4UA 4ETYA 4HD5A 1JFQL 4A2EA 4XXCC 3TA4D 2EVHA 1TETL 1JTPA 1KBKA 2F9BT 2JJSA 3FSVA 4GI6A 4RWHA 1G6RA 1I1RA 2J1KA 3IJHA 4X0KA 4KRPC 3I6SA 4G9FA 4KTYA 3HBPA 3UACA 5LO7A 5FS5A 4B53A 4YHYC 3WEAA 2P7TB 3UBXG 3FQ2A 4RISH 1UXSA 4KDTC 3KGTA 1BQHB 2HH0L 4X8JA 1Z5YD 4KTGA 4NQED 4GUOA 4P5MB 5GJTH 4D0BA 1U92A 3AMKA 3ZE1B 1EEUA 5ISZE 1T1WB 4NPYB 1N10A 2P5WA 1OOWA 4P46A 1PFCA 4IBZA 4I9WE 4YDVA 3KGSA 4ZMPA 3WDIA 2FWUA 4PJ8B 3DUSB 4MA8L 2Y07L 3IXAB 4PLKD 2FDBP 5GSVA 3WTYA 3ZN6A 2D03H 4OCXH 2Z4QB 5GRZA 4UQIM 1JHTB 4IMKC 1BQSA 1VCBC 2EYSB 2J8UB 4ZPTA 4DEWA 4Z7NF 3GM8A 4QTIL 4AOFA 4C47A 5GS2H 1J8SA 1AO7E 4OGAC 3BYYA 2NUPB 4RETB 2FJGB 4J4PD 4HLZH 3L3KB 4FKEA 4YBLC 5IQ9A 1AD0A 4PJGE 1B2YA 4UF7C 1BXVA 1JG9A 2F58H 5HJBA 1KZQA 2EDEA 1NAKL 3GMPA 5DK0B 4U6VH 4CVZA 3EGXA 3P9LA 1GC1C 2AITA 1N4XL 4CC1A 1OGAD 5IM7A 3SD2A 4N9OB 3RFRA 3Q13A 4NDMB 4Y88A 1HKFA 2QKIB 3EYUH 5L8LB 4AEHH 4JFFB 3ZHFA 5SWSA 4DKDC 4IIQB 4H1LG 1MCDA 2MQ3A 2YGVA 3H2PA 2X1QA 4MD4B 1PPIA 2W81C 4BIKA 1RJZA 3M1OA 2DQDH 4K8RD 3OAYH 3LCYA 1RZIA 2QKIA 1K4CB 3RVUC 2R83A 1TF4A 3EYUL 4EIUA 3BPNB 2WXKA 4HUXB 3K6NA 3SYPA 3MRNA 4DH2A 5J7CC 5DJAA 2FHBA 1F6FB 4I13B 4E2OA 3IFNH 1EJ8A 1FV1A 1I1FA 3JV6A 4K3EH 4Z7VA 4NKIH 3CCHA 1T5XB 2DTSA 1T1ZB 2FJHB 3JT2A 4RDQF 3L4VA 4FMFA 4WUUB 1FSKB 2XN9A 2Z1KA 3ABZA 3X13A 4ZMOA 4DKEL 5JW5B 1BD2A 3R1GL 1FZMB 1XCTA 1VZIA 2ZWLT 3SO3C 1NAML 4PV9A 3ZQXA 3C60B 5CBEB 1BMWA 1UOVA 1JGDA 1N64L 5TDPA 2OTPA 3GSOB 2C1OB 2D8KA 1MNUH 5IVNA 3VFGH 4UQ2A 4OF8A 1M2VA 2O93L 4U1NB 2E27L 4JANA 2E56A 4WHYH 2ENJA 2BO0A 1V3JA 5E9DE 1WWWX 1ZXKA 3KMDA 2O30A 1R3HA 4IKIA 1YRKA 1KBGL 2EVIA 1B6DA 2DWYA 2PPAA 1S3KL 4FC3E 5KYUA 4Q6YA 4JQIL 4YN3A 1F3JA 2VDRH 3FCTA 4FQHB 2CJSA 3OAUL 1NBCA 3OG6B 3VXUE 1D9KC 1MW1A 4BFIA 5EA0H 4B3VA 4L0PB 1J1PH 1HE8A 1UM5L 4YSPA 2BS8A 3S7GA 4P23B 2NY3B 1RLWA 3ALPA 1MVUB 2WBJD 3WHXA 4UCFA 4Z7WB 1QA9A 4ZFOB 1KEML 3L16A 3VSTA 1WWAX 2XQBL 2QZ5A 1DEEA 3EOTH 5GGUB 4GW5B 4NQDA 4YHNA 1I1AA 4LB8A 1MCHA 4N8CL 4YXKH 3S4SB 4DTGH 4JO2L 2F74B 4FHBD 3S96B 1MIML 3UERA 4XVTL 2P43B 4HXBL 5JOEA 3IFLL 2RFXA 4NFDA 4PGBA 3NVQA 3HZ3A 3GTVA 3HBZA 1WTLA 2LU3A 2FRGP 1HXKA 3MV9A 4AV5A 1J5IA 5MEPB 2OCJA 3CLEL 5KJ4A 4WTZA 5CJ5A 2Y69B 3DECA 2RD0A 1OM3H 4I5BA 1YEJL 4ADIA 2OZ4L 2EYRA 3CX5J 3IKCA 3IE4A 1OSYA 4KJPD 4N6QA 3CZFB 3UBHA 3GO1H 4QDGA 4PRHE 4WQOA 3N41B 1Q9KB 3CHQA 1NPJA 4XODA 4FXKA 3Q05A 3ULVD 3RDTA 2OZ4H 4J3XA 5I17B 3MU3A 2DIBA 1RSFA 4FGMA 3GXPA 4O51A 5T33L 2Z6FA 5FDYA 3MJ7A 5HY9B 2R29H 3KLHC 2WAHA 4HDIB 2VRKA 4WU7A 2ZCKL 4X4YB 5DA4A 2A73A 1HXYB 1CS6A 5GSRA 3HNVH 4B27A 5EUKA 2UVFA 3FN0L 3U0WL 2ITEA 2UX7A 1ZRUA 4ABVA 1P5UC 2XBDA 3MX0A 4GBXB 2CBMA 4IBSA 4U49A 2F68X 2CRYA 2NY0C 2DKUA 3P4LA 1X5FA 3SE4A 3MCYA 4PWIA 2WXJA 3V4VB 4PG2A 2EILB 5ESQA 3U7YL 1HQRA 1S5HB 1M42A 1NCWL 4CADA 3FU6A 2BSEA 3EGXB 2EJ1A 1MPAL 3LQAC 2ARWA 1UZ8B 5TQ0L 5FKPB 1KCSH 3DSNB 4BZ1L 3DIFB 2QSCL 2BCMA 2W91A 3NK4A 3R7QA 4AWJC 1J5OL 4AYEC 1KELH 1E5ZA 2DDQL 1XT5A 1R1CA 1EXGA 3OAWA 3U6XS 3QEHB 1JMXA 3QK0A 4HK0A 5TK2A 3VDAA 4H88L 3BUQA 1BVLB 5J6HA 2BNQB 1ORQB 4UT9L 3P9MA 5I74C 2J71A 4L0YA 3RGBA 1NGPL 1AJ7H 4EJ1C 2ITDA 2UZXB 3P73A 5L2KE 1NSNH 4FS0A 1F1DA 2GCYB 4YVNA 4P9ML 2NY6D 5I1EL 5GRJH 2BSCA 2WNXA 4ZDHB 4UINL 5C3LD 5D2LA 6CGTA 4FYQA 5KVEL 1KPVA 4KHXL 2WINA 4C4KT 1HT6A 3L3IA 1G9MC 4W4OA 5I82A 3QR0A 3QUXA 1H6UA 4N2BA 3COOA 1D9KA 4JRYA 4MJIE 5GRJL 2OCFD 4P23C 3KL3A 2GHZA 5ITBH 5E8EB 4N26A 5EIIB 5CR8A 4IGBB 2P5EE 2RIKA 2ZCHL 1T4WA 2CKNA 5FGCE 3WSQH 1Q0EA 2PPFA 4HCGA 2ZOKA 1HCZA 2GUOA 1IV8A 3RZCD 4JG1L 1P0SE 2DQTL 2WMPB 2O61A 4Z7VE 4X98A 5J9PA 3L1EA 1TO5A 3TIEA 4KMTH 5JMRA 2JJUA 3WXVL 4QLWA 4PJ9A 4YUEH 2FLBT 5JW4Q 1ZLVK 3EOYG 2JJTA 4Y1AA 2G60H 3QJHA 4PVNA 3VACA 2VXUL 1X5IA 5HHNA 3ILPA 3VW3H 4ZTEA 1WBXA 2PO6B 3D1MC 3DOSB 3VMPA 4AH2A 2WYIA 5SWSE 4RZKA 3DA0A 1HIMH 2XI9A 4FL4B 5C0BD 1FA4A 1QR1A 4TNVK 4G7VH 3VXQA 3BHBB 3ELQA 3E38A 2Z8RA 3FO1A 4HIEB 3QB7C 3ZE0F 5EZLB 3D18B 4FDWA 3HAEH 2HX9A 2BM3A 3JQOB 2H3NB 4QD2E 2OX5B 4I4WA 3B8SA 4BXSV 2ALWA 4GG6A 1L9TA 1XSJA 1YEKH 1Z9OA 4M61B 3UC0H 3W82A 1KXHA 3HG1E 3IDUA 4H0HB 3TT3L 4O9HL 1CGUA 1HZLA 4G82A 1MHEA 3LIZA 1KLFA 1CQKA 1OTSD 2D31A 4LLMB 2ZAIA 2CUIA 3RTQB 3V7AE 1Z5HA 3QIWB 3MLZL 4UT9A 4PS4L 1AACA 2L7QA 3D4YA 3JSSA 3ZKMD 1RVFH 4ELDA 4ZUSA 2A99A 1SMOA 2BDNH 3QARA 2QV4A 2W07B 1ZGLM 3FTYA 1AIFB 1O5DT 4NUJB 2JB5L 3ZW3A 3I6KB 1AY1H 2B9BA 3QUXC 2Y06L 4LSPH 4A37A 3RFZB 3IB4A 3KPPB 2WXIA 3V9FA 5IKCA 1MI5A 4HBQA 4Y5XA 2HLFD 1SXCA 5MENB 2WKOF 5SX4I 3DHPA 3WNPA 3UMNA 2RQ8A 3WIAA 2X4RA 1MOEA 2PLTA 2PMZA 3L4YA 3K3QA 3O3UN 4XNUH 4Y9BA 3ZDXF 3MUHL 4TQEH 5GZNC 3EGDA 3AQYA 4RCAA 3ETTA 3BIKA 1PEZA 4PSPA 3KE0A 3QPXH 4NKDA 4P0DA 5D2NB 3WEXA 1KXQE 3QUML 1A3ZA 5LBGA 1SXAA 2I7SA 2EICA 1DLFH 4M7JH 4OF6A 4IOIA 1TPXC 4NYLA 1S5IH 1TJIH 1HYSC 1CXFA 2BSSA 2GC4C 3Q6GH 1YMHA 1MHHA 4H7VA 4I5BB 4UQ3B 2P8PA 3GSXB 4HS6A 3FT2B 5EU3A 3GIVA 1SRDA 2G5BA 3OPZL 4NI3A 4PJIF 3UBXA 1AQDA 3FO9B 3TO4C 3QUHA 2X2HA 4I3SH 2K9FB 1U8PA 4N2FA 4DVBB 2VQ1A 4KTDL 4JPWH 5D71L 2EIZA 2BRRH 3CXFA 2GKIA 2ZYIA 1UB5B 1XZ0A 1NMBH 3WNOA 1TSRA 3CC5A 5JIHA 1AQKL 4LPWA 3DDFA 4KK5C 4YDMA 1BAGA 4KRPB 4X8XA 3J8F7 2EEFA 4K94L 1XSOA 1CG9B 2Z93A 1CO1A 3QQ3A 5HYJD 1FFOA 3QCVH 2WWMC 3KWWB 3MNMA 2B1HH 3FCSA 4L4TB 2ADFH 3OQRA 1XCXA 5E51A 1ET5A 3LNDA 5DDHA 5AAMC 2AK4E 2PCPB 2W0LA 2WIMA 3OKEB 3QS2A 1GZQA 3GPEA 4EIBA 2Z3FA 3QUYB 4XNXL 1TQWA 3BWUC 1CDGA 5HHVH 1UWGH 4C57C 2X38A 2O6CA 3Q8CA 3V0VB 4YDJB 4BKLB 5JR1L 4GUCA 3O2VL 4N2CA 1G9MH 1YEDB 1A8JH 1RUKH 1S78C 1YNTF 4Z7OE 5IMLB 5AVVB 4OGXH 2F5BH 1O5PA 3MRLB 4L8DA 3ZOAA 5BOPA 2CR0A 1MFCH 1TU2B 3EZ8A 3MOBH 3RAJL 1TKWB 4IGBD 5EORH 4QRPE 4HJIA 2CHXA 5CD5C 3LEYL 4YSQA 3QHFL 3QFJB 2CXKA 3WXWH 1AGEA 5I1CL 3HVNA 1SUJA 4LF3B 3F7PC 4PS8A 3BWZA 4NRXA 1JAEA 2G5BB 5F1SA 1M3IA 3BLPX 3BD5A 4LKCA 3VFVA 5KVGL 1PSKL 3TLRA 1FH5L 3D4GA 1MJUL 1R46A 3MXWH 3FQUB 1AXSA 1R17A 4DPCX 2WNGA 2GY7B 4M6OL 4V1DD 4Z7UE 3EYQC 2BSSB 3ATEA 3QWRA 3CCHB 3JTSA 3M8OH 4MSWB 1YMMA 4OLWL 1SXBA 1B90A 1UWGL 3G9VA 2ATAA 3B7RL 4OJAA 4JO8A 4CDGC 3FQUA 4D0DA 1JPSL 3DMMC 1P84J 4U6HB 1ZD6A 1RHHA 2ZYRA 2HN7A 2XQBH 3U4EB 4ZXBD 4KHTH 4Q6IB 1E2WA 3ROOB 3VD5A 1ZA6A 4JM4H 3V0DA 4ZFQA 2WQVA 5DHDA 4IIQA 3CIQA 1AXTH 3SYAA 1E9QA 5D1QA 1VACB 4P8QA 5IHUL 4HISA 1KGCD 4PJCE 4KO9A 4PRID 4UQCA 1B3JA 2H3XC 2MOGA 1YEDA 2GIMA 4ZW7A 1U3HC 4S1RH 1CFBA 2W07A 1QI4A 2OK0L 4OIAA 3ETSA 5GJTL 4QRPB 4D7PA 1AD0B 4K3GA 3D25A 2CHNA 4RGOL 5C0CE 1A7PH 2LLLA 4LSVH 1CDCA 3L3KA 1H3PL 4EDWH 5JPMC 2W9DL 1TOXA 4JGUA 2IALB 3K71B 4E9XA 4AKPA 2BC4B 1XXFC 2Z0UA 4PSRA 3VFVB 1COBA 2WM0A 3RVVC 4HIXL 5FYLD 3IDMA 4PWFA 5FECA 1DJIA 4U0QB 3EYVA 4LHUA 1KCVH 1O9WA 1SY6H 2ZXDA 4KXBA 1BGXL 3PNWA 4HOWA 4PCYA 4BCYA 2D7TH 3FFDA 2Y36L 2P5WB 1I8MA 1GYAA 2MMXA 1NFDF 4JDZB 2IOMA 4I48A 4O2CA 1G4MA 5E0QA 4WFHD 5EZIL 2J6EH 2ZCLH 1KC5L 3P3SA 2RCSL 2A9MH 5JQHC 1W0VA 2GSGA 3V0VA 4KUZH 2NQ3A 3QZWG 4X7SH 4ZMXA 5ITFA 4XP5L 1YMHB 1A1MB 1ZIAA 2MNWA 2NXYD 2Z31A 1MHCA 3KEHA 1U8CB 2N7BA 3VQ2C 4PJXF 5A3ID 2ZUQB 3IVKA 3OKEA 2P44B 1ASOA 5DS8B 5T3XH 4DZBB 5BV7L 4O5LH 2P42B 1ZLSL 2XOTA 4MYWB 4XNUL 1CL7H 4NBYB 3JWOH 5CN3A 2DH2A 1FIGL 4YS4A 3C6LC 3NUKA 3OB8A 1MHPH 4B9IA 3BFQG 3S3BB 4QHLA 1UB5A 1E6JH 4DT2A 5JPMA 1L9SA 2VDPL 2GAZA 2WXFA 3BZ4B 3KPLB 3ME0A 2EACA 1PX8A 1S9VA 1ZA6B 2BK8A 4XZUB 1WH0A 2XUWA 3WE6B 4BWTA 3FU0A 1V7MH 4U6HA 1IC4H 4DQAA 5IVXB 3FPXA 1A6UL 4UTCA 1GGCH 1NEZB 2V2WA 4IU2A 1RPKA 2DS4A 3VI3E 4U1LA 1G1OA 4LEEA 3ABMB 4WFFD 4NPKA 5C7ZA 1LNUB 5DI8B 4JAMA 1TFPA 3IMBA 1ROCA 1IRAY 3UCRA 4PJ6A 3TH3T 3H9SA 2Q9OA 1GSMA 4FQLL 3NJJA 4LSSH 3B9DA 2R69L 3DX8A 4K23H 3KCWA 4YUEL 1WLHA 3MRJA 1L7IL 4PUBL 3RDTC 2CLZB 3VXOB 1V7NH 2V5TA 3QDJE 5D7IF 3KBPA 1OE1A 2JKLA 3DUHA 5HI4D 1JF6A 4L8DB 3SCMB 5I1HL 5EC2B 5L7XH 4X4ZA 4BK4A 1HYSD 2WN2A 4PJAF 3UZVA 1A64A 4K3EL 1Z66A 2E4FA 3V6ZA 3TBWB 3FPYA 4Q9CA 1XQ4A 2ARJQ 1QSEE 3CFJA 4R7NB 4RFEB 1DZ0A 1FORL 1PD1A 2DJSA 1UH2A 2H6PB 1QRNA 5C7XH 3VRLE 1E4WH 2IH8A 1HINH 4K15A 4CVXA 1CMOA 1LO2L 5SWZB 1EFXB 3SY0B 5BJTA 2N7AA 2X4TB 2H2SC 3C5SB 4KK5D 4RMWA 3LOWA 5J6SA 5C0JA 1ZLEA 4PUBH 4NHCH 1OF2B 2PWGA 5AKSA 5FFGA 2HT4C 5I1LA 1H3XA 1T22A 2WIIA 3UG5A 1PEWA 4XP4L 4PRPB 4I0PD 1RD6A 3G04B 4HWNA 1TSHA 4FL4C 5CEZE 3STZB 1TTGA 4JN2A 1NGXB 5I8OL 4WIQA 1O7SA 2V7HB 5CCJA 5GRUL 2ICES 1HDMA 3RJDA 2R56H 4ENED 4GKSB 1B2WL 2A83B 2BNRE 1O9VA 2B15A 3F6LA 1Z9LA 3X11B 3BEWB 1KFAH 1Z3RA 4X8GA 4L3FA 3W11D 5LN8A 1OT1A 4TUOA 5D8JL 4QI3A 1UYWL 3FRUB 5AVYB 1CIUA 2IH1A 2XWZA 3DC0A 3RZCB 2CA3A 3H53A 4PRIB 4XOEA 2QGEA 4R0LA 1PD0A 4R7DA 4LAJH 2D9CA 5IW1B 4JRLA 5K59F 1R3IH 3B4NA 5T1KA 2BIMA 1MJ7L 4PJDB 1QRNE 1RIUH 5FGSA 4OB5H 3UL4A 5JPNC 3LHPL 3MLXH 4NHCL 1LHZA 5D1ZD 1FVEA 2CQVA 3TBWA 1ZLWH 1FG9C 2R15A 3I9PA 1DVXA 3LRKA 4ELKA 3BJ91 3QVAA 2YKKA 4BFRA 2AAVA 3ZTCC 1ZLDA 2IPKB 3L3IB 1WT5C 3KJ4C 3QUGA 3L6FB 4FNTA 2GTWB 2H0PA 5D2LB 5CGYD 2ZKYA 3FF8A 3I2CL 4DN3H 3LXAA 3QYCA 1KLGA 4A6YH 3U1PA 2B16A 1VIWA 1IU1A 1CTOA 1NC2B 2OQJB 4OGYH 4BUHA 4JKLA 5ALBH 5M7QA 1K85A 1YDPB 5GISL 5ACZB 2MH4A 1KTDA 2BH0A 4AGMA 4OLXL 3EFDL 3RWFB 2QQNH 2YQGA 3C60C 5J12C 5DI8A 3OKLA 1PY4A 1NDGB 2HLAA 3C8DA 3N9GL 2HJKB 1FYTB 3TA3B 1VHPA 4HIPA 3SODB 4DP1X 1OTTC 4GBXD 2NYKA 2VN7A 4AEIL 3HHSA 3TP4A 3GMRB 4FQLH 5EU7E 2HTLC 3APFA 5J3HD 5AUMB 3NIDB 1LJMA 1YYLL 1BZ9A 5ICYB 3S88H 3APDA 1KYOK 4G70B 4QTHB 4YHKL 2ERJB 5J56B 3AB0C 1EHAA 1EEZA 4UNVA 1SDDA 2BIQA 4JQXA 2CO1A 4KGLA 4C55A 1F4AA 5CLXA 3WBDA 4XBPA 4YE4H 2DQEH 5LCVL 2HSIA 2VQTA 1YYLH 2V8LA 1QYGH 4FFWC 4H40A 1JP5A 1VB9A 4YDLB 1FL5B 2C9XA 5DXWA 4WW2F 5JZ7D 5JA9A 4AGNA 3PS6A 4EVNB 4NN5B 4P04A 3MJGX 1JF1A 3THML 3GD1C 3HNTL 1GMEA 4WCYL 5CP7A 4H5SA 4JVUA 4PJBA 4CC4A 1JERA 4EXPX 3KYKH 1IC4L 4F3FA 3MZTA 3C2AL 3UTOA 4OZIB 3DVGA 5GZND 4H8WH 5INCB 2CLVB 1FDLL 1S7QB 1IEBB 3QYMA 3CBJB 1W72L 2O5YH 1C5BL 1QFHA 3ATFA 2W0PA 3ZIYA 2Z91B 4OVVA 2PNDA 1QKZL 4IJ3C 2D2CC 3VFPA 3B9KD 3RGVB 5HGBA 1G7MA 2NXZC 1NAMB 4ZTPL 3OHMB 5FYKH 1G7QA 2FNBA 2VSDA 4HSAC 1X44A 3S4SA 3UDWA 4OD3H 2Q7YB 3U36A 4LLUA 3UTZB 1PFOA 1IBGH 2DM3A 3WGVB 3ZHLA 2IXQB 2WKLA 43C9A 1Y7VA 3RTLA 2APTA 3GSQB 3MV9E 2GT9A 5KSAC 3QHFH 3FB6B 3IFPB 1JRHI 3NCYS 3T6VA 4FAAB 3PFUA 2NY2C 3B9KA 2COQA 3U30C 4B9YA 3L3HB 1Q0YH 1YNKH 3NT0A 4AM0A 4IKKA 3D48R 4PY8J 3LHAA 3ZKND 2ADYA 3GXMA 5L4IA 3GRBA 1ZEAH 4XMVA 1CGYA 4HWBA 4ZO6A 2FSDA 2C9SA 1Z9NA 2R0LL 1GJWA 5I1DA 5K9KA 1VJSA 4JFSA 4U1NA 4TVPD 3UIZA 3IGUA 3M46A 4Z6AT 2DLFL 2D3LA 5IQOA 4GAAA 3KYOA 5C0AA 1YQVL 2RALA 2AQ1A 4UOQA 4O51B 4EOWL 1A4JA 2YBGA 1S9XA 1NICA 3F84A 3FUDA 1FFPA 3MO1B 3PPEA 4JR9H 3VXUA 4KQ3L 1Z6JT 3RIAF 4HZ1A 3WE1A 5KBDA 5GHWL 4K9EC 4D0CB 2E74C 2F1EA 4U1HB 4IHOA 5CKGA 3MNVA 5L88H 2D0GA 5CD3A 1JVOA 5DZJA 1NCCL 2OLDA 4TUKL 5SV3A 3WJJA 4FKKA 2HFTA 4S1RL 1R3JA 1HHIB 5AG8A 1N8OE 3OSKA 5D7JD 1G4RA 4FQ1L 1VGEL 8FABB 3UTQB 4P57B 5KBKA 3MV9B 1O6SB 4MTMA 4AEIH 1CXKA 3TTYA 4HU8A 3CK0H 1OCWH 2RFXB 4PGBB 2CALA 1MAML 3TYFB 5IEKA 3O0LA 5KYYB 2UWEF 4RRPM 4UOW1 5AW2B 2Q8BL 5FWQA 2PWEA 2XXCB 2Y7QB 5KBNC 1G7PB 4XZ4A 5DQ9B 1QZNA 3EW3B 1BYNA 4J3OC 2G0KA 4G5ZH 3F7KA 2CKBH 3D6GA 1A21A 4LCCB 2A6JA 4U2ZA 3ARPA 2YAEA 2JKNA 2IOOA 3L9EA 4N24A 3U9UB 4TQ8A 3ORJA 2BP0B 2OMZB 4GSQA 3E6FA 5GXBB 4ES8A 3ULSA 3WN5A 1TVDA 1G6RB 5EO0B 1TQCB 5FYJD 2MPVA 1EMTL 1FPTH 3MLTB 1X5YA 5FX3A 2XDHA 2PYEE 1DVQA 1IC1A 2H32A 3V52H 1GVIA 3PL6B 2WTPA 3MUGA 1FJ1B 2DWEA 3PWPB 5FC9A 2ZX7A 2HXAA 1A25A 3G5VA 3M1BB 4ENEC 4HXAH 3ULUL 3VRJB 2VC2L 1CFVL 2HKAA 2VZ3A 4DO6A 4EZMA 5CCKH 4YIQA 4LEOB 3K81A 3W11C 5B1KA 1XBDA 1TIUA 1W8NA 1WFJA 2Z91A 3B83A 3NJGA 5I0VA 2L04A 5ABAA 4A6YA 3WJJC 4DPRA 4WWKB 4I85A 2BFVH 4Z7NB 2H1XA 1ND0B 1GSKA 4P5RA 4X8CA 4RFNC 5JLZB 1JPTL 1YQ2A 1GGBH 2F7QA 3O8XB 2VJ8A 3LKRA 4NZTH 5ID1B 5B22A 4F3FB 3HIZA 3LKQB 5CIPH 1I7TA 1BBJA 3HC0A 4PWHA 3BSGA 4A63A 3FHEA 1XD1A 3BQUA 3MACL 4GLRI 1NBVL 4LK4A 4AC4A 3P0YL 2D03L 4OCXL 4KZEL 1E8XA 1KB5A 3OR6A 2O5NA 4DCQB 3HR5B 5I8EB 3L54A 1JZ5A 2VKXA 3WL9B 2UUDK 3HHRB 5I0DA 3VYPA 1IKNC 1R3KA 3TJEH 4FF9A 5CGYC 3GKZA 5KYWB 4UT7H 1YUKB 2WO2B 5CEXB 5DJDB 4JFEA 4JQXC 4K7FB 2AKRB 3SYQA 2ICWB 4MBRA 2YPLE 2ED7A 3V5KB 4E68A 4EZJA 1HAWA 5IJVA 2XN9D 3V4VL 3R8BB 2YUZA 1DQJB 2FQFA 1L9QA 35C8H 3LXBA 4NEHB 4JO5A 5DMGD 5AEAA 6PAZA 1UOKA 2CHWA 4NDMA 1GGUA 1UACH 1C16B 5C07B 3NRFA 4DQOH 1QSEB 3LD8C 5K1NA 2VXTL 1JGLL 1LMIA 3KPMB 3C6LD 5GZOA 5DK0A 4AC2A 2IF7A 2YPVH 4HPYL 4ZX5A 1EDYA 1LWRA 2QT6A 2WUCL 2A9NH 2DY2A 3BP6A 1NBZA 1S7UB 3GLDA 5I8EA 2ZG1A 1BZ7A 5EPMB 1CVRA 3GKWH 1OLLA 2HRGA 4Y2DB 1EXUA 1G9HA 4KDWA 1UD2A 4MB1A 1URIA 4L8SB 3QO1A 2V2TB 1I7TB 1MRDH 3HC0B 4CN1A 4G6KL 3IJ7A 1D5IH 1RPQA 3IJ9A 3ZMNA 4OF7A 4HUVA 4UMGA 4P9HH 3ARDA 4AQOA 5E0FA 5KTEL 1NLBL 1S9VB 1X9LA 2IAMC 4LDEB 3VXQB 4WWKA 1JDCA 3NSFA 2X1XR 4F15B 2IADB 4JL2A 2BNRB 5E9NA 3JV5A 2EO7A 4HGMA 4DGYL 4MYPA 1QOKA 2R0KL 4Y4KD 2MTAA 1IKOP 2IV8A 5DFVD 3DHMA 3O6FB 1H6TA 4X9BA 3GBMH 3MA9H 4RDBA 2XWJA 3P4MB 5EBLB 4JBSA 3ZE1F 2FUTA 4NN5C 2VLRD 4M5YL 4ZRGA 3U6RA 4K5MA 1MHPL 1MFUA 5EO0A 3EH4B 3TM6A 3WL9A 3NA4A 1CICC 1YPZB 2OSYA 2WUBL 3F7YB 5BVJB 1BQUA 1JTTA 1U8CA 2LTQC 1Q0XL 4OCYH 4OLYL 1X6NA 3SE4C 1UENA 2BVUA 2XHNA 1D6VH 1KIRA 1U58A 4YDNA 5EIIA 1HDMB 4Z9KB 2QTEA 3O8XA 1NUDA 1GGIL 1JV5B 4JG9A 4MA7L 2FX9L 2ITFA 3X3FH 3T0WA 2ZX5A 2HVJB 3F65A 4YHLH 3V8CA 3NJXA 3T3PF 1WZLA 5B8CC 5I1GH 3BE1H 4OIFA 1GGTA 3HUJE 3N55A 2A0LC 3FS9A 4ZMQA 1MFCL 5AKTA 5ESAB 2A9ML 3H6AA 3P54A 4YIQB 1JHLH 3WEMA 2J3SA 3DV6A 4GKZA 5D6CB 2MWCA 1BQLL 3T0BA 4KJYB 3W9EA 5FYKU 4XN8A 3MUGB 3RL2A 2BXZA 3OC8A 4IBYA 1MLBB 3JWDH 3ISWA 4PY7B 2VLJD 3CN4A 3L3DB 5IJDC 4GY4A 2YKLH 2C1PA 3NSCA 5GS0D 2H6PA 2ZAGA 4X5XB 1F11B 1ES0B 2TAAA 2I5YL 2X4PA 4JDTH 4XHJC 3ULSB 4TTGA 3JV0A 3I74A 3UP6A 4LCWA 4UNUA 4XCFL 5BVPL 2C3VA 2OTWA 2K4AA 2A3TA 5TF1H 1CGXA 1X7SA 4MA1C 3L48A 5IK3B 2Y7MA 3L5JA 1AS8A 2VMJA 5ESQB 2V5MA 1P7BA 1F45A 1VAHA 1UADC 2C3WA 3JWNE 4FQ2H 3DX7A 2JKXA 5DD6A 1X5JA 3U30B 4AMKL 3VI3B 5KWYC 5KN5A 3IDJB 4ODUB 1ERNA 1CICA 4UQEA 3UJIL 1T6VN 3MRKA 3TPUB 3BZEB 1HHGB 2VXVL 3CAFA 5DGRA 1U8LB 3M7OA 4HJGA 3SDXA 2BVPB 2NY5C 3HZMB 4JFDD 4ZJ9A 4E9YA 5I1AB 5IJVB 1EO8H 3PHAA 4GH7B 4XXCA 4JFHE 4YGVB 2A9AA 4F15C 2CGRL 3GNMH 3WHE1 4BH7A 5CEXA 1IC5H 2E9BA 1IMHC 5F6IB 5CEYA 3HLAA 2W94A 3HI6L 1F18A 1NOLA 4Z3GA 1KIUB 2FECI 3AC0A 4HUMB 1YLBB 3GTTA 5JHMA 1YC7A 1ZTXE 3EHBC 2VB5A 1A7PL 3KXFE 4XB3A 3S3PA 3GZQA 5I23A 1BF8A 4MAYC 2WBWB 1C1EL 1OZTG 5JIKA 2VLJA 4F7TB 2OMVA 5JXAL 1THAA 3BUTA 4LPUA 1DDTA 2NX5E 4JGJA 4OLVL 4YR6B 2FT6A 2HKHL 3ZYIA 4LOUD 4D9QE 4NKIL 3IJYA 2CO2A 5JMOC 5GRWA 2Y5QA 3HI1B 1ZHNA 5B1CA 3WD5H 4AZ8A 2FGWH 1E5AA 3GYRA 1U8OB 2J12B 4OZIF 4CRPA 2OMNA 4QY8A 3OM3B 3SDCB 3W39B 4EI0A 5HGAB 5F1NA 1EEQA 1IVTA 3PJSA 4MXVE 1YJDH 5H37H 3RHWF 1XGQA 1L0YA 1HH9B 5BRQA 3N1MC 4XMXA 5DJ2B 5EORL 5F9AC 4FXGC 2GK2A 5ADPL 4F8NA 4B9KC 5L9DL 1B4TA 2AZUA 5C09A 2EDKA 2BIHA 4Y5VA 4G1EA 3SOBH 4PJBB 4HAKA 4ZZFA 3NFNB 1YO4A 3UIYA 3VGGA 4OGZA 4XXWA 1FDLH 1PVHA 4LGRB 4QT5A 3QORC 2GIYA 5KUMA 4HC1H 4NERA 3QO0A 2FL5A 4LSQH 1NUFA 2WNKA 3KDMA 1FI8C 3DYPA 1FP5A 3EG9B 4HS3B 2DQIL 4XMKL 3PV6A 5EZIH 1BFOB 1WD8A 1GZHA 2OZNA 4KY1H 5M94B 1AZVA 3NP4A 3CZLA 3JTBA 3U0PB 1F3JB 3FCTB 3TT1L 3FFDB 4WGVB 3VG9B 4XBPB 5BOZG 5MP6L 1NAMA 3TU6A 6FABL 2OFQA 3MR9A 3EBGA 2PXYD 2V3DA 2DQFB 4LRIC 1OCWL 2NZ9C 4ICWA 1IEBA 5DA0B 2BOCA 4ODTL 1XF1A 1CDUA 2C8NA 1R33A 2YFNA 3IJYB 3FFCE 3G6AA 5HJGA 5AW4B 3S6CA 5KTEH 1Z9SA 3K71A 3VG0L 1VEOA 2BVOA 5EUOF 4ZSOA 4L8BB 2EVGA 3UYOD 3LRSB 1CBVL 2YBRA 3HVDA 3WFBH 3HZVA 1EAJA 1HHJA 2YRBA 1SLXA 4P2RD 3QNXA 1ZE3H 4QRPA 4YLBA 7PCYA 1UWYA 1MAJA 1JHKH 2EIBA 3FT1A 4M7LT 4JJ5B 4DNLA 1YZZA 3ML8A 4E41E 1U2YA 1H5BC 2GTZA 4JCMA 5AOJA 3WCYA 3U83A 3H55A 4HKJA 3QBTB 2C3XA 4LQFL 3IJSB 3BGFC 1THCA 2BIPA 2JSFA 4LU5L 4BWUA 3RA7H 3CZKA 3Q01A 5FHBH 5HDBE 2DLFH 2JTYA 3I6GA 2EKJA 1PTZA 4ELMA 2GPZA 3FUIA 3L5XL 3TASA 4L29B 1U36A 1IQWH 4DFHA 3QYNA 1M4KA 4AUUA 1FUNA 4NUJA 1CFQA 1NFDA 4FXGA 3U4EA 2JCCF 4NCC1 1PZAA 4IBQA 1CLVA 2FWOA 3VI3A 4F7MA 2R59A 3KNBB 4XNMB 3H6JA 4DKEH 3U25A 4CVWA 3O4LB 1G7IB 3VWJC 3EYSH 3WLBB 4PRIE 3IGAA 1DANU 5FOBB 3VI4E 3ZZQA 4MS6A 1M7IA 2MKWA 4LGSB 2R8SL 1E4HA 2A9CA 2FR4B 4M7JL 2HLAB 3LZQA 5E56A 3QSKB 5IB3B 2AAAA 3SO3B 4BSWB 5JDJA 3MLRL 4NQCD 5FLUA 4J4PA 5J11C 1B0RB 3QUMA 5ABDE 2FQDA 2OI9B 4R2GC 3X2QB 2QL1A 2NUPA 1K2DB 4BEIA 3LH2H 5D96C 4QHUA 5D5MA 5EZLA 3X1GA 3F62A 4AE1A 4OLEA 4BUQA 1EAPA 2JQZA 4HKXA 2OMXA 3KW8A 1JHTA 5TTRA 4JE0A 4B5ZA 3BQUC 4OFDA 4Z5RB 1HIML 1F1AA 4A2MA 1XGYH 1YN7A 2Y24A 5KSBB 4GQ9L 4IU3A 4MXQD 2JELL 5CJQH 4Y1AB 2A6KB 2IMNA 3VFUA 3O3DB 1UQSA 4YO0A 4MQ7B 1JWUB 3J2PA 5KS9A 1N0LA 1JZIA 1KFAL 3KR3L 4PLJD 4H5SB 2R2EA 2NCEA 1MCNA 1QHOA 5J89A 2O5XL 1UM4H 4E5XB 4UI2A 1H6EA 4HJ0D 3SPCA 3VE0A 4WHYG 3VVWA 4E41B 4K55A 1O6VA 2QQKL 3ARGD 1W0WA 3VAEA 2UY7B 1LEGB 4N0RA 3W81A 4KJWD 4ODVH 1UCBH 4QXUL 1G0XA 1ITBB 3PY9A 2VDKB 4JFOA 4RX4D 1M7DA 1TQTA 2DQTH 3FUNA 4YFLI 3GSRB 5E4AA 3IXTB 3UTSE 4DP0X 1TJMA 5DMKA 1J0HA 3DK0A 1UWEH 3C5XA 4LP4A 3S5LB 1U8PB 4DVBA 1DHKA 5AL8A 4KROD 1M1SA 3X1NA 4QAMB 4ZDHA 2WY3B 4MWFB 3O3EA 3QULB 4XHJD 5FFLA 1PLCA 4XC1H 1U8NB 1BQHG 2GJ6E 1X5LA 5I71C 4NCDA 5F7BA 1MFEL 5ECJE 4B0MB 1F4HA 4D2NA 4NN6B 4AQAB 4XMPL 3OGOE 4B9GA 5BW7A 2PWDA 3SGEI 3X1FA 4HHAA 3QPQC 5ALBL 1J87A 1FF5A 3QO1B 4X4XB 4RQQB 2QLVB 1KGJA 2VAJA 4UT7L 1QI5A 1EXUB 1OT4A 1BAWA 1FCCA 2Z65C 4FNLH 2QQNL 1ROWA 5C9JA 3BH8A 4DQOL 4HBCH 1AZCA 3FU8A 3V4VH 3RU8H 3BP6B 3PDDA 4N2DA 2JE8A 1QMUA 3GMOB 1GMIA 4KKPA 3SIKA 3QEGL 1MCWW 4QHNB 4YK4B 4P2QA 5F7AA 2WVTA 1ZLUH 4FMVA 4XCYB 3NJHA 3FQXB 4AG4L 4DUXA 2ADJB 3ZMRA 3RGHA 3L3GB 4WW2A 3RWHA 4MKMA 5BQ7A 3QFDB 4JFYA 4YC2B 4GAYB 4URTB 4AITA 1KWGA 5GGTL 3DX9A 4Z7QF 3SCMA 3HEIB 1MW2A 2IPTL 4M6AA 3BPCA 1R75A 1TCMA 1WCQA 5BZDB 5AAMA 4I3RL 1TTCA 2BDNL 4XCYA 2Y7SA 4IDLA 5JHLH 1RMFH 3MRQA 4TTDD 4Z3EA 1FVEB 12E8L 2FEJA 4LLMA 2HMIC 4X5PA 1GC1L 1JWSB 2AANA 4KO6A 2ERJC 2GQHA 3SQOL 1SXSA 4ZTOH 2V2XB 4EN3C 1OP3K 1RJYB 3KPRB 5IHUH 4NXSA 1UWXH 4JJ5A 3ZHDA 2FSEA 4KKRA 1WK0A 1Q9KA 2W9EH 4R4FH 5CP3A 1RMFL 5FM4A 2IH1B 3FQTB 2DIEA 4KI5F 3O9WC 4LASL 2DW5A 5L6YL 3IRPX 5B8CA 4HOXA 1Z7JA 5I73C 2AABH 2HRLA 2MHAB 1YEJH 3FFOA 4GP8B 3L9RB 1X5AA 2K78A 1Z9SB 3L08A 3WKMH 1EFXD 1HX0A 4AIZB 4EIZC 1W0VB 3U1SH 4BZ2L 1F2XK 1ZGLA 3QR1A 5CJBA 5DHYB 1KJ3H 5JHDE 3W2DL 2YXFA 5AYQA 1R3LB 4MCZB 1I8MB 4QJ3B 3RVXC 3UGEA 3P9WB 2DBJA 4LSRH 5I24A 2CR3A 2WKOA 3H7LA 5IOPA 3SKUD 4AVJA 1TCRB 2ZKWA 3NSJA 3PGDA 5T1LA 4DP2X 5JIQA 1CTNA 3KWUA 1KJ2L 1SY6L 2I60L 2NR6A 5CEZD 1CD0A 3CHRA 1L0PA 1P4LA 5FO8A 1P1VA 3PV6B 4POYA 1OTUD 3LDBB 1F90L 2XQYK 3QUXD 5SWZA 1B88A 2WMPA 4KK8D 4NIKB 1I8UA 4ZS7H 5CR1A 2O61B 1YEEL 3ESNA 2ATKB 2ZUTA 4N2HA 2UZPA 3MLVH 4GRLA 1A7NH 3V0WH 2R1XB 3OLEA 1JZEA 3Q8FA 2GJZA 3UX9B 3D25B 1E40A 1UQSB 1MHCB 2Z31B 1A1MA 5E9DD 1D9KB 4JRYB 4N2IA 4NRZB 4Z3TA 1EDQA 4MMYB 4O4YH 2A6JB 4QNPF 2A6IB 2IWEA 3LS4H 4ORGA 5DR5H 1U8MA 3FW6A 3QZBA 4HETA 1VACA 4URKA 1IGIH 4FEMA 1I3RB 4C56A 3GS0A 1P5VA 4HFWB 4S0HA 1YEHH 4I9WD 3H3BC 3Q9PA 4JVPA 2B1HL 4EZKA 1NJ9B 5BW7C 2ITDB 2UZXA 2B1OA 4PRHA 1Y18A 3ALWA 5C0RL 3TN0C 2IDTA 5L4FA 2ZXEB 1WS8A 4KK9D 4C56E 4AMKH 2YC1B 2HJLA 4TPRL 3ZT7A 2DMBA 5ECGA 1BFTA 2ICEC 4PP1D 1KGWA 1QD0A 1EGJA 1JRHL 1TMQA 3ECQA 4CAGA 3FU5A 1T0NA 4BFOA 5DSCB 4IEFA 1DQIA 1EZVY 3TCTA 5D7SH 5DZPA 4OFKA 1MFAL 2EE9A 5GS1C 3UJJL 4YOKA 4CC0A 4AQ1B 4M5ZH 3FBKA 3WV0A 3VG9C 4OCSH 4GMSH 4BH7B 5HI5D 1AZNA 3BKCL 4GRLD 1SM3L 3ZL4H 3RVTC 1T20A 4J28A 3A23A 4OT1H 4WI9A 3QJSB 4MD4A 2K3TA 4Z7QB 2BY3A 2YUXA 5FV2A 3SDXB 5LAXA 1IO4C 4UTAL 2ZCKH 1Z32X 4AKOA 5MP6H 3SB3A 5JPMB 4R7LA 3WKQA 5HYSG 2A6DB 4F9LA 2W80C 5BXFA 4G6JH 3VFGL 1QWHA 2BP5M 3DX7B 4NM8L 1E27B 4OD3L 5DRZA 4ZG1A 1WFUA 2XTJC 2GABA 2I07A 3DJSA 2CM6A 3ULVE 5I17A 5E8OB 3CSYA 3G08A 1PNCA 1UOWA 3GZPA 4KQ0A 4X7TA 1NDMB 5E7FA 4MMXC 1BP3B 1TQSA 4J3OF 5EOCH 5DJ8A 4N8VG 4ZYKA 4GKLA 1G6VK 5KVFE 1K5NA 3L1OL 1FNAA 4Q9RL 25C8H 1DVFA 4X4ME 4B5EA 5I1GL 3GSQA 5EZOL 2W38A 1ED3B 2X42A 3ZMEA 4XWGH 5DJ6A 4YSUA 5IWLC 1UJ3C 2XICA 3GB7A 2YC1A 2AQPA 4OT1L 2VJ0A 2VKWA 4F7CB 1F41A 2J8UA 1QTYT 5AKRA 4MHHG 4UTAH 5FYJL 1WA0X 5J57B 3CC5B 2EDXA 1YY9D 5C2BH 2VXQH 4H8WC 4EUPA 1XF2B 2AEOA 1A14H 1V3LA 3PFQA 3EOBA 1P5VB 5L8KB 4ZMLA 2NY1D 3PJLA 5FB8A 2BY0A 4RNRA 4WI0B 2X3CA 1AQDB 3FO9A 2YA1A 4KKBC 2YMTA 3ARGC 1CLOH 3MRBB 3D34A 3CX5K 3U4BL 1OPOA 4M93B 4ZFZA 5FCSH 1U2CA 4NRZA 5I66A 4UQ3A 5A7EA 1KOAA 2BCKA 1L9PA 4MHHI 4JHWL 3MFFA 1AD9A 4LSUL 2J1YA 1T7WA 1NBYA 3RVWD 1CGSL 1KLUA 3EYFA 1CI3M 1VFAA 1DQML 4APQB 4HZLA 3EOAA 1ODAA 3FCSB 1U95B 5J1SC 5E8OA 2UXVA 1DL7H 5KYUB 2OYLA 2BSTB 4JLRB 1TZHA 2IQ9L 2FO4B 1EEYB 4XE5B 1D6EB 1U9KA 4JHAL 3T09A 5MENA 3QQXA 2A6DA 5CNHA 3RJQB 4JKPH 1YA5A 3I2CH 1IGCH 2J8HA 4X6CE 4AZ8B 4HFUH 3AB0B 2DYSB 3VU2A 5HHXH 2ALAA 1P2CA 5LAXB 2NMSA 1C5DA 1R3LA 2VR5A 3QJFA 4GXUM 4JG0H 4YVUA 4G72B 4ZW3A 5FM5M 3GIVB 3I9GL 3MBEA 1QACA 3MLYL 4O02L 4QJ4B 1BD2B 5C3IA 1P4BH 1DZBA 3M86A 5FUOH 2YO3A 5INDB 2GJ6B 4OLXH 1JGLH 2JIXD 2LLGA 2LVCA 3G6JF 5I73B 1AGDB 1AHWB 2UYLA 4FLRA 1MDAA 3K2UH 4E9QA 2M2DA 5JO5B 4FYRA 3OKLB 3Q7JA 4AT6B 2I9TB 2F7IA 4WTXA 2EXTA 1XX9C 3BUPA 4QRFA 5EIQA 3S35L 4DW2L 4NRXB 3NH7L 4FZEL 4JPKH 1IAOA 3WYRA 4P59L 4RBPK 2MQ0A 2DJ4A 2PCFA 4ODVL 1NC2A 2OQJA 2ZKMX 4H8PA 4BFNA 2IAMA 3KGRA 2XQYG 2YFOA 4XP4H 3SCMD 4UT6L 3L6FA 3U48A 4G59C 4BUGA 1R3IL 3W57A 3QRGL 3E9TA 4ODWB 4XNQB 1G9ML 2JXMA 3JUZA 3MV7A 4MMYA 2Q8AL 3TCXA 5EUOB 2ICWA 2C3VB 5E8DH 4DIXA 3GMPB 4Y1TA 5E9AA 1A3QA 5DMIH 4Y4FC 5CGTA 3HG4A 4KKCC 5AW8B 2DWDA 3CVHB 4JPQA 4TSCH 3QRGH 4HZAA 1NLBH 3LH2L 3DJZA 1S9YB 2JWYA 2ZQKA 3IMTA 4W6YB 4P07A 3DVNB 4JCLA 1U6AL 5C0CA 1FFOB 1UJTA 4HX1B 3V2AR 3PHQB 2JH2A 1JZGA 1KCRH 5FO8B 3CH1B 4G83A 2BS9A 1KT2B 1XH3B 5EC1A 5FYLL 5LBSL 4U1KA 1AOZA 2EDYA 4XPTL 3QEUB 5B4MD 1FE8L 3LS5H 4YQXH 5MENE 5EMYA 2YD7A 3CN1A 4KO7A 1S7RA 1QAWA 4F8OA 3FXIC 4AG4H 3GRWL 2EDHA 5JOFA 4Z7NE 5CFHA 4PJ5A 3QJXA 3Q8AA 2VZOA 4I9XA 5DJZA 1A0QL 4ODXB 2VE6A 2VZSA 3B2DC 2NY7H 3W9DB 3O4LE 2H32H 1OF2A 1CGTA 4JG1H 2D7PA 4TYUA 3WY3A 5HI4C 4KKLD 1VZGA 3MGAA 1ACZA 3QIBD 1OL0A 3QEHA 4HK0B 4X0KB 1GIGH 2RACA 2F7PA 2H7WA 1VPOH 4U1GB 5AZEH 3QWOB 4YEEA 5CLYA 3DX6A 4GRWE 2R2BA 2VIRB 1UM5H 3LZFL 4QIRA 5DWUL 1BIHA 1I8IB 2DQJL 3MKGA 4NM4H 4KTEH 3SN6N 5JPNA 2A6KA 3VFUB 5GS0L 1V7ML 3OJDA 2YAMA 1FGVH 2IGLA 5CP3H 1DQLL 1JXKA 2GVYA 3IPEA 3MX0B 5F89B 2BPBA 2EDTA 3L4ZA 3BSZL 1MDTA 1DQDH 2EIMB 5EUKB 4M02A 5TQ2H 5EULV 1OCOB 2A73B 3BFOA 3UYRH 1AR1C 5D7LD 2JB5H 3TX4A 4X4YA 1CURA 3SPIA 3ZT6A 2XV2A 5AB2A 1AE6L 2DQIH 2OMXB 5E6ID 1FVCB 1YEKL 4G8EA 2GFBA 3FT0A 3ARFC 1M1XA 2F1BA 4JM2F 3QH3A 5HI5C 1JXFA 4OUUA 2Y0SA 4M5YH 3C5ZB 4M5SA 5BS0A 2VXQL 3SDDB 2VDMB 4TM9A 3VFTB 1PG7X 1BVLA 4H44C 3FO2A 4G1MA 4GSDL 2WCGA 3S36X 5ACLA 5C9JB 4N0UB 3D87B 2DEWX 3GGWA 4JAMB 3Q8EA 3BT2H 3FDWA 3JV4A 3MNVB 4ISVA 4WFGE 3TURA 4M61A 3MGOA 5L4MA 2XJKA 3VWKD 4AV4A 1UZ8A 4OVUA 3BZFB 4XNZB 1TNMA 1IFGA 5IR1A 4JKKA 3OR7A 3ZX1A 1VFOA 5IVXA 2ZG3A 4LKXB 5IW6B 1U8NA 3S4SG 4C83B 3MA7B 4GBXA 4JY5H 3VI4B 5KUKA 3D0AA 4XB7A 1K6QL 3FRPA 1CVSC 5KSBF 1BWMA 3D85D 3O2WL 3ZE0B 2JTDA 2PPEA 1CL7L 2WLIA 3E7JA 2A38A 3LKPB 4XP5H 1QKZH 2CNZA 2CLRA 1ECYA 2YQ2A 2F54E 5FGBA 3FQ4A 4PBXA 5CHNB 4S1SH 4ZMAT 1W15A 5FHBL 3HMXA 4HEME 4BQ9A 3HRZB 4PPTA 4UAHA 5D1XC 4AYDC 4PEEA 2AEPL