3WNIA

1.50 a resolution crystal structure of dioxygen bound copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Crystallographic evidence for side-on dioxygen trapped on type 2 copper in copper-containing nitrite reductase
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
total genus 98
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wniA00
2H47C 2HZHA 4KOCA 1A8ZA 4HIPA 1RZQA 1B3IA 3NSYA 2IH8A 1NWOA 1L9RA 4DP7X 4A2EA 3C75A 2XVBA 1MG3C 3PLYA 1WA2X 1XMEB 2DYRB 3TBCA 3IN0A 3ABMB 2YAMA 3PAUA 9PCYA 1CURA 1PLCA 1GYCA 1URIA 1QLEB 3H56A 3OM3B 3S8GB 2XV3A 1OCOB 3GXUB 3QJQB 4DP5X 4W1TA 1IBYA 4PAZA 4TXVB 2VM3A 5ANHA 2P80D 3AG1B 4HCIA 2X88A 3DIVA 3V9CA 4A68A 3OMAB 3NJIA 4CSPA 5I6NA 2Y1AA 1AS7A 4G70B 1L9QA 3PPSA 1OCZB 1CYWA 1XB6A 5B7MA 1J5CA 1DZ0A 4M3HA 2BZ7A 7PAZA 2WO2B 2YXWA 1IKOP 5A7EA 1BEXA 1AACA 1V55B 2TSAA 1CYXA 2BHFA 2BP8A 2HLEB 1JXFA 4F2EA 2Q5BA 3X1FA 3SQRA 4A2DA 3S3CB 1ASPA 1RZPA 2UXGA 1KBWA 2I85A 3NJKA 5B1JA 2MTAA 2W8CA 2AZUA 2IDQA 1JZHA 5I5JA 2YAQA 3ERXA 2UXVA 1NIAA 1GS8A 4NAJA 1NIDA 1JZIA 2FQGA 4F7KA 2PPEA 3OMNB 1UATA 1OF0A 3NJJA 5I6PA 3FYEB 3H4HA 2PLTA 1A4BA 1KDJA 4AKOA 1ZIAA 2BP8B 4F2FA 3KW8A 4BXSV 2YAPA 1L9PA 4N4YB 1KCWA 1E5ZA 5B1KA 5B7EA 1ZDQA 1ID2A 3S3DB 3WKPA 3EF4A 3T6VA 1E67A 2CUAA 1QNIA 4ZK8A 4WTQA 3WKQA 1JOIA 2CCWA 5B1AB 3UACA 4G7SB 1NZRA 4YSOA 3EH5B 3DTUB 4BWUA 1AANA 4NERA 3IBOA 5AZUA 3QJSB 3KW7A 4GXFA 1J5DA 2PCFA 1OE1A 2AZAA 4MFHA 2CBPA 1KBVA 2FT7A 1BQ5A 3NJLA 4HHGA 4BWTA 1WS8A 4E9XA 3T6WA 4AI7A 1NINA 1NWPA 4DP2X 1OCRB 1IUZA 4HHWA 5F7BA 1PZAA 1OCCB 3V9EA 1TU2A 3FPYA 3U25A 1AS6A 1J9QA 4KNUA 2BO0A 3MX0B 4E9TA 2I7OA 2XYBA 1X9RA 4KO9A 3ZX1A 3FQ2A 2JKWA 1MDAA 4YSUA 4CSZA 1KV7A 1SHXA 4FA7B 1JXDA 3X1NA 5B7FA 1I53A 2E86A 4YL4A 1GSKA 4Q89A 1KGYE 2ZOOA 1SF3A 3NP4A 4YSPA 4QKTA 4E9RA 1CUOA 1TEFA 2IWKA 3FPXA 1CC3A 3EH3B 3TBBA 2DYSB 3CZUB 4YSEA 1ILSA 1KDIA 3AY2A 2BZCA 3FSVA 2OCCB 3FSAA 1ET8A 3SBPA 1WA0X 4X4KA 5LDUA 2J5WA 1E5YA 1R1CA 2VM4A 3FS9A 1PY0A 4E9SA 5I26A 4BK5C 3NJHA 3FT0A 4EF3A 1VLXA 4A2FA 3ABKB 5TK2A 2I7SA 2YAHA 2B08A 1A4CA 1PF3A 2GC7C 2XV0A 3CVCA 4DP6X 2FTAA 1JZJA 2YQBA 3FU9A 1SFDA 4RH4A 2ZONA 3JT2A 5F7AA 2H5UA 3WNJA 1SF5A 3OMIB 1AZUA 1NICA 2VW7A 1PZCA 1AG0A 1A4AA 3CVDA 3G5WA 1T5KA 1JVOA 4GY4A 2J55A 4N8UA 1GR7A 3QJRB 2UX6A 5I28A 1GW0A 1MZZA 2A3TA 2GI0A 2IAAC 1HAUA 3QPKA 4A2GA 4KO6A 3PXLA 4L0PB 3FYIB 1DYZA 1A65A 3T71A 1AZCA 1JERA 2JXMA 4JHUA 5D4JA 1BXVA 3CG8A 1PNDA 3NYKA 4KO7A 4BXVA 4KO5A 4BWWA 3FSZA 2PPAA 1AS8A 1J9TA 3NJGA 4DP4X 2RACA 1AZNA 2VW6A 2X87A 2XXGA 1PLAA 4GP4B 3CDZA 1ASOA 1OE3A 4HALA 5FC9A 2XUWA 1AZBA 3MBWB 4P5RA 4HZ1A 1BQRA 1BXUA 2XX0A 2OV0A 2Y69B 1W6LA 3WG7B 1E30A 1IC0A 3BVDB 1JZEA 4UF7C 3TU6A 2GHZA 2PPFA 4KOBA 1NTDA 2ZXWB 2EIKB 5D4IA 4W9ZA 2GSMB 4AZUA 1E65A 3NT0A 2FNWA 5I6LA 3TA4D 3CDZB 5I6OA 2NRDA 1ZDSA 3EH4B 1A3ZA 3ZDWA 3SBRA 1AAJA 5IY5B 2FT8A 2AFNA 4ENZA 1OE2A 3ABGA 3NSCA 4G71B 1ADWA 1NIBA 1ZPUA 2HRHA 4DP9X 1RKRA 2QPEB 4AKQA 4FAAB 1WA1X 1AG6A 2PPDA 5TK4A 2GB2A 3QQXA 3FSWA 1WS7A 1YLBB 1NIFA 2IDUA 5B1BB 1L9SA 1AQ8A 1NPJA 1ILUA 2WO3B 3JTBA 1AIZA 4YSRA 2GBAA 4YSQA 1QHQA 2P80A 1OOWA 2HX7A 1EHKB 5I5MA 5D4HA 4PCYA 2VN3A 1ETJA 1L9TA 4YVNA 4A67A 2CAKA 2PPCA 2QPDB 3ZIYA 1FFTB 1X9UA 2GIMA 1M56B 1HAWA 3IE9A 2FJSA 4E9YA 1GY1A 1ASQA 2IWFA 3FQYA 1JZGA 2UXFA 2IWEA 2J57A 4K9JA 4P5SA 7PCYA 2HXAA 1L9OA 2BP0A 2BWDA 1ET7A 3IN2A 3FQ1A 1AZRA 3PCYA 2YXVA 4HCGA 3NP3A 3UADA 4HCFA 1M57B 4DPCX 1NIEA 3D12B 2CALA 3UAEA 1ET5A 2AVFA 3QJVB 4GP8B 2HRGA 4JHVA 3H4FA 3ZBMA 2MRYA 2BWIA 3UABA 1GY2A 3S3BB 3NJNA 1M9WA 4NB7A 2DV6A 2XLLA 3NSFA 4AKPA 1N70A 2BP0B 1N68A 1GS7A 3DKHA 3QJTB 2FQEA 1PZBA 2WSDA 5EHFA 5I6KA 1NPNA 2QDWA 4YSCA 2QDVA 1RCYA 2PP7A 2VW4A 1V10A 4A66A 5PCYA 3X1EA 1JVLA 3ABLB 4DP1X 1IBZA 2TSBA 3NJMA 1KCBA 4JKNA 4YVUA 1MZYA 3NSDA 2VMJA 4GYBA 2XWZA 1TKWA 2HX8A 2YAOA 1ZIBA 2CJ3A 3AG2B 3L45A 4AX3A 8PAZA 4YSTA 2FQFA 3TASA 4Q8BA 1NDTA 2IDTA 2UXTA 4DPAX 4E9WA 2PP8A 1PAZA 2ZWNA 1EZLA 4A2HA 1PMYA 2QT6A 2DY2A 1AOZA 3SBQA 4G7RB 2IDSA 4UAHA 1SNRA 3T9WA 1BXAA 3AG4B 4YSAA 5I5IA 2XV2A 1W6WA 2Q9OA 3T6XA 3CVBA 3EHBB 4BDVA 3AG3B 2W88A 3AW5A 3FU7A 5E9NA 1HFUA 3ASOB 3WNIA 4DP8X 6PAZA 4GP5B 5PAZA 2FWLB 3FU8A 2EIMB 1V54B 3X1GA 2FQDA 4YSSA 1BQKA 3N2JA 5I6MA 2J56A 1BAWA 2PP9A 1SDDA 2YAEA 4G7QB 3S8FB 2R7EA 1TEGA 2PCYA 2DWTA 4E9VA 2BW4A 1ZV2A 3X1BA 4BDVB 4QLWA 1MG2C 3FU7B 1OV8A 1WAEA 2XXFA 1XB3A 2OJ1A 4WKXA 1FA4A 1PLBA 2IDFA 1JZFA 4YSDA 3PAVA 3OD3A 1W8EA 3GYRA 2VSKB 3WIAA 5B1JC 4G72B 1J9SA 4M4RB 2EIJB 2VSMB 3ASNB 2HX9A 2EINB 5AFAA 3QJUB 1SDDB 2R7EB 3WI9A 1PNCA 2EILB 3N55A 3OQRA 1JXGA 5AKRA 5B3SB 1PCSA 3UGEA 3RYMA 4DPBX 1BYOA 3NJFA 2JFCA 1KYAA 4UANA 1BYPA 2BW5A 2IH9A 2LLNA 2H3XC 2XU9A 3AZUA 1SJMA 3X2QB 2AANA 2YARA 1J9RA 2UX7A 1SFHA 4HAKA 2B3IA 2XX1A 1F56A 1XB8A 2YAFA 4KNTA 3UAAA 1AR1B 3T6ZA 4KNSA 3IEAA 2DWSA 3GDCA 4DP0X 6PCYA 2N0MA 2FT6A 3BQVA 1GS6X 1SHWA 2GC4C 3PAZA 4E9QA 3HB3B 1FWXA 3HEIB
chains in the Genus database with same CATH superfamily
1PD1A 1NLBL 4Z0XB 3ZDYF 2MPAH 2OX5B 2P5EA 5C0CA 4HIPA 2VDPH 1B3IA 4P2QD 3VD5A 4EI6A 2EVIA 4UDTB 2ZX7A 2XKSA 5C2BL 2DQDL 1L7TH 2WXJA 3JWDH 1DSFH 4ONGL 3WEAA 1XX9C 5D7JD 1GJWA 3GHPA 1EHAA 5KSBF 4Z7NB 4FQIH 5IVNA 1HOCA 2P47B 1YMMB 1KJ3H 4ZOAA 3LSOA 1KXQE 4OCNC 4WUUE 4R4ND 3WTXA 4PRAA 3UBXB 2PCXA 3IRZA 3FU6A 4OFYA 4WWKA 3GXUB 2CSPA 2R1XB 3ARFA 2WTOA 1GOFA 1V3JA 4MDJB 3L1FA 1HK6A 3OHXB 4FG4A 4P3CL 1NBZA 2EH7L 1A14H 2P4AB 4TXVB 2XWTB 1RFDL 3CFBB 1A1NA 2YUWA 1F97A 2BSRA 2YN5A 4HOMA 3MRLA 4ZOCA 4WHYH 5DDHA 3M7FB 3B56A 1X6LA 2XY1A 4ONHA 3VH8A 5DRNA 3TFKD 2VXUH 1JNNH 5B7MA 5DHYA 4KUCF 3PV6B 2LR4A 4C59B 3KE0A 5DU7A 3TEUA 2Z4TA 3CZNA 1ECYA 1M71B 5JPNB 1D2PA 3BSZL 1L0YA 4XXDB 4I13B 3BP4B 5IB2A 1CGSH 4F8TA 4GPVA 4JFEA 5E2WH 3HI6L 1DSWA 4P23A 2R1WB 3F6IA 1WISA 3ARGD 3V8CA 4JMNA 5HI5C 3CHPA 3UJIH 3HAEB 4DKDC 1ZRUA 2CUHA 3ATBA 3HG1A 1R5WB 3HPJB 3VVVA 2OI9B 4TMPA 5D2LE 1PFOA 5KVMC 2VJ0A 2MJWA 1PZ3A 3H4HA 3GK8L 1UZ8A 3QEGL 3UJTL 1SEQL 1Z1WA 2V2WB 3U7YH 3N0PB 1HXYB 1OSPH 3FH5A 4N25A 3UC0H 3IAGC 4JBSA 3WJLC 2QQNH 3T6VA 1JK9B 2XN9E 1R3LB 2X6CA 5AEAA 3HE7B 4U3XA 2K6YA 2UY6A 2C9VA 3BP7A 4XH2A 3GJFA 3FUHA 3US9A 3QQ4A 4OBRA 1ZKAA 1TMCB 3HI1B 5AG9A 1HHGA 1DE4A 1QBAA 3TEWA 4MKMA 1NZRA 2D73A 1KJ2L 4NERA 1ZSHA 3FUDA 3MRDA 3UG3A 3QQDA 4Z3FA 4J3OD 1OE1A 3WTTA 3RDTB 1BQHA 2B59A 2BOCA 3OR6B 4JHAL 2J7LA 4NKMA 1E0OB 4OZFH 3W2DH 2OCJA 4KVNL 4EN3C 3O0RH 4H0GA 5L7XH 4F33A 3UJJL 5DK0A 3F01A 1JE6A 4QWWC 4EIBA 5D7HA 3ARRA 3PDOB 2X5PA 1B2WH 4GSUA 1I75A 1JV5A 3D34A 3ZRFC 1T89C 2ZG3A 3V4LA 3WL9A 3I74A 4RZKA 5IJVB 1HNYA 3FFDA 4J8RB 2ZSVB 3GKWH 3HS0A 3LRLA 5BXFA 2NSXA 5ERWB 1JHLL 1UTDA 3VGHA 4D0DB 3CVHB 1F45A 4TTDC 5AB0A 3F84A 4WWNA 2WJ5A 4OB5H 1Q9WA 1G5AA 3UZEC 2V37A 2CPUA 2WLJA 4GQ9H 1ZXQA 5E7BA 4PV9A 1CR9H 3OXRB 1WAAF 4QXGH 4ZDHB 1I7ZB 3SPHA 3CLFH 3V4PL 3GI8L 5EF3A 4JO8A 1RZ7L 1T1XB 3LN5B 5EV7A 2Q86B 4XR8C 4OKVB 2OCCB 4P4KC 1FIGH 3B3BA 4LL1A 4BZ1L 4HG4K 2OLDA 3FS9A 4HH8A 5D2LA 4M7LH 1EZSA 4R4FH 3CSBA 5INDB 3KYOB 4BCXA 1OB0A 1VLXA 5E95B 1OANA 1WF5A 4ANWA 5FYJH 1JV2B 1A4CA 4TRPL 1UYWH 4FXTA 5I1LA 2HT4D 5JW4N 4CJ1A 1G9ML 1XGYL 5J5EA 2X41A 5EG6C 4Y89A 1JD7A 3QI9D 2H26A 1IL1B 3LS5L 4ODHL 2E9JA 2QGEA 2UX6A 3GSNA 4FFTA 1SN5A 1HXMA 4OU3A 4B41A 4F7EB 3TJEH 3L95B 3A6CH 4NZUH 3DJ9A 1ECZA 1I8UA 4PCTA 3KR3H 4PY8I 3O6KL 3L5XL 3H7BB 3V7AG 2F08A 1HZHL 2ICWB 3ZKSD 4GSXA 1R3JB 3T1WA 4FI7A 2B1AL 4M1GH 1GZQB 2I26N 2HUHA 3CN2A 2RACA 4P2YA 4HSCX 5DK3A 1KSRA 1OB1B 1D6VL 3CH1A 5AVSB 2Z6FA 4ZSOA 1OGTA 2CRMA 4CVZB 1TVBB 3KL3A 5MEOB 3MBWB 5FGBC 2H32B 5GS1A 4L23A 1N59A 5ABAA 4XNBA 2OV0A 3BP5B 2BNRE 4WEEA 5IIEA 4HFWB 3KJ6H 4FADA 1XTLA 3HZ3A 3GGWA 4NN6C 4EDXB 1O9VA 2ZWLT 1OKEA 3G5YA 1M6UA 1LEIB 5EU5A 2R9HD 1O7SA 3BT2H 5AB9A 3WHXA 2GSMB 4EIGB 2ODHA 3CDZB 5EB9A 3WNNA 2ATKA 4B96A 1JF1A 1E4HA 2F7PA 2Y3AA 3FMGH 2KQMA 3LDBB 3VGAC 3MUGA 2WANA 4XB3A 2PCPA 4EN3B 5AW9B 5DURB 1JBJA 1AKJB 2R1YA 1D7BA 4H0IA 4QRRE 4I5BA 4NO2A 1WA1X 3CSTA 3ZKND 3AQZA 5F9AC 4LSRL 1FV1B 3ROOB 4YBQD 3GUTA 3HHRB 1YNTB 4AIEA 5HHOB 4R90L 2ZTBA 3PNRB 3FTXA 1HESA 3A22A 3LIZA 3X13B 1AIZA 1OP5H 3DJRA 4YSQA 2AQSA 4OIAA 4ZZFA 3V52L 1URLA 1BZ8A 1QBMH 5D1QC 1KGJA 2Y06H 1T7WA 4J23A 4N6RA 4DWHA 2QZQA 5EO1B 3NIGF 2X4QB 3QIWA 5CZVL 1FFOB 2H0EA 2ZT9C 3MRMB 5E8DH 4PREB 1EJ6A 2WTRA 2Z64C 4HF5H 3RY6A 3HE7D 3FUJA 3B9VA 2XKUA 3KLDA 5HYFA 5JZ7D 1Y6NR 1GVIA 3LNEA 5DUPH 1FN4B 4FLQA 1EUUA 2HN7B 4DF9A 2VR3A 3QB7C 2Q3XA 3ULUD 2J21A 5D93C 1H9DA 3BVTA 4P4KB 2HKFL 2QKSA 1ET7A 4LGPB 3FQ1A 1AZRA 2ICES 3PCYA 3KLHD 3C8KA 5IVZA 3RDTD 5IWLA 4W81A 3ES6B 5KS9E 4L3ED 3FO0H 2WZPA 5EBLA 4GKNB 4ZFOA 3MBXH 2I07B 4DO5A 4ODBD 3D69A 2HJKB 4JO3L 4WW1B 1MUJB 3H4FA 5C0BE 1B0GA 5DO2D 2YK1H 1BAGA 3MPCA 4WHDA 3UCRA 3WIFA 3GHEH 1MCOL 1YJDL 1I8KB 2CXGA 4WF7A 1VGKA 5GGUA 4QOKA 3WLBB 3UPRB 3MJGX 4KVPA 1BHGA 1E6OH 4MAYA 2XJLA 3OC5A 4DKTA 1FH5L 3LEXB 1WFUA 2V9QA 3FHQA 1V10A 4YDJA 2FRGP 5JOEA 1MJUH 1B90A 3Q43A 2XN1A 4ODSH 2ATPA 4Y9CA 4DP1X 2G5UA 2KYIA 4GSDL 2VXTH 4I0PA 4GYBA 2CBQA 4P9HC 5C8JB 1I8IB 1W72A 1Z5LB 3EFDL 3NEEA 5D5MA 3RTQC 5EO9B 1SXCA 3AWGA 4QRRA 3TA3C 1V3LA 1NDTA 4E9WA 3VXSB 5KVFE 2AXWA 3VFPA 1KTLA 3P77B 1VF5C 4IJTA 3MCG1 3PWVB 4JNXA 1EVTC 1XGQA 2WKOA 4UV4H 4XPHL 2CKBH 4NUMA 2N7AA 5AW1B 3U83A 1A7PH 2GQHA 5KG9A 2KPNA 5DC0A 1AXIB 1KEGL 3TO2B 1QTSA 4U6VL 5ICZB 3EOBA 4NN6B 3BRDA 2XQ0A 4RZCA 4K8RL 3B8YA 3NTCL 2CGYA 1JK8A 3VFSA 5LBSA 3J27A 1ZSDB 4QNPF 2HKHL 5EIVA 5BS0E 5EORH 4NNXB 4H8WL 5EIIA 4XPBL 4LLWB 2YD8A 4MJ6B 4MQ7B 3DIFA 1BQKA 4X42A 1FF5A 5KUMA 4P3DB 3RGVC 4TVPL 3R7RA 3VGAB 1OL0A 2Z91B 1NA8A 2E6JA 3DUSA 3I3DA 4OY9A 3MLRH 5IM7B 3F7VB 3QUML 1MN4A 5HI5D 4I3SH 4R7VA 4LSVH 1EEYA 3NN8B 1DCLA 3QDHA 1CBJA 3JWOC 4WUKL 1JZ2A 3DMMC 5IFHH 3L13A 1W8EA 5D1QB 1S9WA 1U3HC 5C0BA 4PVBA 3LXUX 4OCSL 4ZFFA 3NABH 4UIKH 5C0FA 4FQXA 4AYEC 3G6DL 3OF6D 1Z7JA 4RGNC 3D2UA 2NX5A 1N0XH 2NUTA 1PNCA 2BIQA 5TE4L 2P46B 2OMWB 3WIHH 5JHMA 3LRSB 3OQRA 1PX3A 4PGBA 4PY8J 4HJGA 2VLRE 4P5TA 4WK4B 1Z3GH 4BA8A 2BM3A 4X5WB 4N1HB 4FXKA 3NJFA 4PW9A 3UGEA 3V9FA 2CM6A 5H8DA 4CNIB 3C8DA 1XL6A 1JGEB 5D93B 5GISH 1AHWA 4N90D 2DD8H 4PJ8C 5D7IE 5CLXA 1MI5A 1JGVH 2EEFA 2ZP0T 1F56A 5CUSL 1OHQA 3QUKB 1BPVA 4L8DB 5ACLA 2BNQE 3KPPA 4TLSA 1SLVA 2V5TA 4L8SC 5I1KH 1AKJD 3KCPA 3O2VH 1FNHA 4QWWD 3K2IA 3W9EB 3WKML 4ES9A 1I3RB 1QAWA 2FIRT 1BECA 1HHJB 2H47C 2ORBL 5HHOD 4PS4L 4G8FA 1RK0A 1QHOA 1IAKA 1YN6A 2AJXL 3MU3A 4IS6A 3MO1A 3Q48A 1DEEA 5EOTA 3EUUA 2MNUA 3LZRA 4ATWA 3GZOA 3OGCB 4TTDD 1FZOB 1RULL 2V7HB 2YBRA 3KYNB 5J6GA 3O45B 1FLRH 1NBVH 3ABMB 5BS0A 1V7NH 9PCYA 1CURA 4GW5A 1C7TA 3ZE1F 2P42B 3B34A 1JUFA 5ESVA 5I5RA 1MCWW 4FYQA 3WS3A 1E9QB 3B2XA 2VTFA 5EC1A 4TF4A 5E1AB 3RTQB 1F11B 4HPYL 1I3GH 4JHBA 1TEYA 3DPBB 4P4KD 3TA3B 3KNBA 2AJVL 2BWQA 2GTZB 5DD1H 4AM0B 1T7ZA 1AS7A 1QOKA 2XDHA 5ILTL 3WFHA 1F4AA 4JG9A 3WEXA 1U8CA 3NESA 4FDWA 4HKJA 1BOGB 1PLGL 3DX6A 1EDYA 4FQLH 4N1CA 3DX7B 4Y4HC 4XCNA 1LM8V 3BYYA 3H3PH 3SGKC 4D0BB 3AT8A 2YXWA 4JX0A 4APXB 1JFHA 1IBGL 3SKUD 2UZXA 4R7NA 4FHJA 3FZUC 1CDBA 4RMRA 4TUOA 4IOSD 3WE1A 1PZ2A 1EMTL 2APSA 1DJZA 1N5AB 1QEWB 4OZFG 4QAWA 1XQ4A 1CTNA 1KT2B 3C6LC 3L4TA 5AVRB 3TYFA 2WXLA 3DGDA 3KXFD 1GAFL 3MV11 3HTLX 4NENB 2O4EA 4OLWL 1JPST 5AOKA 4WFFD 5ID1B 2EKSA 1J8KA 3VRIA 3GRGA 3P0VL 5D7IA 4LESA 1KGCE 4FZEH 4N2AA 2CDFB 5AL8A 4AL8C 2UVFA 1EJOH 2BNQA 5IFJA 4OQTL 3DMMB 3V0EA 3UYOD 4IBUA 1UB6B 4NQTA 5ESQB 2XWBA 4AYMC 3ORJA 3VXSD 3P4OB 3TBTA 4FI6A 3TL5A 1TNNA 1U3HB 4POZC 5L6YH 3B8SA 4HU2A 4ESKA 1IBDA 5JHLL 3WKQA 2AJUH 5C0JB 3DUHA 1QLFB 1OPGH 4RGNB 2APWA 2FO4A 2EDRA 3M17A 3ZTEA 3JWNE 4Q97A 2YEZB 2XG4A 4GXFA 3IXAB 3UTTB 3MOBH 3U7WH 3HN8A 1IM9B 1KBVA 5C70A 3BAKA 1BFVH 3KPLB 5D2LF 1QWUA 5E9DE 5FPIA 5FS5A 4LXFA 4PJ8B 5E8EA 3V5KA 1IUZA 2EC9U 1PSKH 2XVLA 4HT1H 2FZ3B 3FPYA 5B38B 4HFUH 5KVEL 3NCFB 2BO0A 1RPKA 1IAMA 2KL6A 4FLOA 3IPFA 2DF3A 3GXFA 3MREB 3QFGA 1DVQA 2EZ0C 2IGTA 4HWEH 4HLEA 3HHSB 2N3JA 4YIQB 5IF0B 5IMMA 3JWDC 2A38A 2EDFA 3FW6A 5IR1B 1QKZH 2VO8A 3KYKL 1CTMA 1OM9A 4YWGL 1REIA 4LHUD 5DQJB 3M46A 3N43B 4IOIB 2IC2A 1IGIH 3SD2A 5TDNB 1NLDH 3QORD 4Y4KA 5E2VH 2MNWA 4XP9H 3MUJA 2BS71 3NK3A 2GG1A 2BVEA 4Y4FC 3D30A 3B2MA 3K6DA 1J87A 3B83A 1NLBH 3QFJE 2VL4A 2PO6A 1E5YA 1R1CA 3MDJA 1G1KA 3MLXL 1WTLA 2X0UA 5LN4A 1AO7E 1LLAA 3NJHA 5C2BH 2DQDH 2EYSB 5EBWA 1E3FA 3TNNA 3VD4A 4ONGH 2A7BA 3ABKB 4LSUH 4XX1G 2E8ZA 1E9PA 1SVBA 2VDOB 3OMZA 4KROB 4BSWA 4MCZB 4FX5A 3UDWA 2BK8A 2R83A 3CHXA 4IRZH 3DLQR 3WNLA 2GHWB 1JGLH 4LOVA 4Y4HB 1FFQA 5MEQB 5SWSB 2QQLH 3QQNA 3IFPB 3KWXA 1YPZB 3HJ0A 4KMTH 4XXCC 2V9RA 3VMNA 5L4JA 1U2CA 2R2EB 3OX8A 2WWKT 4IDJH 3V6ZA 4LLQA 4MQSB 2C4FT 4P3CH 2GI0A 2ZKHL 4UT9A 2I24N 4GKZA 3BZDA 3OKKA 1RFDH 5EU7E 5T3ZE 5I8OL 4U1SB 3QEHB 3C6LB 3PWPD 5CKAA 4F7CA 4ENEC 4X0KA 1G6VK 2VZ1A 4BXVA 3C5ZC 2QVKA 3FSZA 4S1RL 1DANU 3FT3B 3O6FC 5ISZD 2VW6A 5BV7L 1VFAB 1MVUB 1MCNA 1E9OA 4XMLL 3T1FB 4Y2LA 2VAAA 3F6LA 4JFQA 3BSZH 4X80L 3LD8C 5TDOB 4PLJD 4W6YB 2KKQA 3RTQD 5IEKB 2CRIA 3HI6H 5GS3A 3DX3A 3KS0H 3MRJA 3TA3D 2A9NH 3GSRA 1I7TB 2ZUQB 3WS6C 3H53A 5KN5A 2VMCA 1JZEA 3KPSB 1AY1L 4EZJA 5A2AA 1G0YR 2EIKB 3UEQA 5IHZB 2F74B 1D7FA 2R29A 2YPLB 5AKVA 1IVLA 1CMOA 3FUMA 1U8IB 3LKRA 2H4EA 1P7KB 1H5BA 2BLFA 4ORGA 3T2PA 3VNZA 3GK8H 1VESA 4HIEB 3QEGH 1VEPA 1IGTB 1AAJA 5GSVA 4W9GC 4Z77B 4WFHE 1ZLWH 1KF9B 4O51B 3SDXA 1R17A 1RZIA 4XBEL 4ZMTA 2Q3AA 2CD0A 4WO0A 1U93A 1E4XL 5EDSA 3QFJA 3LRGA 4CC1A 1G9HA 4LASL 4AKQA 3ILPB 1H8NA 1TIUA 1GTFA 1O7DC 4MX7A 3F5WA 3RGVD 2Y7QB 2Z93A 5ITBL 2R27A 25C8L 1DDTA 1KN2H 1ILUA 1KJ2H 2WO3B 2BVPB 3LYRA 4FFZA 3GSUA 2OMZA 3GSXA 2ZXEB 2Y36L 5I5MA 2VDPB 3N44F 2B2XL 2OJEA 2X9ZA 4QTFA 2HP4A 4NDMA 3TTYA 1L9TA 1U8MB 3QNYA 4ZAKC 4KVNH 3TYGL 4A7UA 2AXGB 1F86A 4DTGL 5AWNL 3UJJH 3JZYA 1U3HD 2JJTA 5DS8A 5IMLA 2VN6A 3FRPA 2BCMA 5GPRA 3DYOA 2YC1A 2CO7A 3DO7B 3PNWB 2DQJL 4RGND 4AVHA 2FEEI 4OVVA 4E36A 3TCLA 4Y4FB 1JHLH 1XMWA 1SY6A 3LV3A 1JGUL 3QEUB 3UTTD 4N20A 3DDFA 1IM9D 3HS9A 1QX1A 2WKOF 2X4RA 4E5XA 1U8PA 1UGNA 1ZVNA 4W9JC 4B7LA 1YC7A 5HHME 4HZAA 4PJ9C 4Y19A 1DN0B 3HN5A 4P4RA 5FDWB 3DVFA 3RUGB 2CA3A 2N7SA 4X5RA 4IEFB 4JHVA 1L4IA 2AJZB 4CADA 3E8UL 1CWVA 4NN5C 4ZUWB 3NGBC 1PFCA 3GI8H 1OY3B 3NQKA 5DJAA 4XNQA 3V4PH 1AQHA 1FNAA 1RZ7H 1T6WA 2R0KL 4X4ME 2AXHA 2GI7A 3DIDA 3MUHL 2IFGA 1CYGA 2HT3C 2NSQA 4BZ1H 2NNAB 3CVIL 3DTDA 2WY3B 3E9TA 2PP7A 2NXZC 4X8JB 5JDSA 3IMSA 3PHQB 4LIQE 1ZGLM 4Y1TA 1JVLA 3B2VL 4TRPH 2Y1YA 3RY5A 2OR7A 2GEQA 5DZ9A 3EH1A 1F02I 4R84A 4CA4A 3C5ZB 5SWZB 1XGYH 3T77A 1GOHA 4IBWA 3O6FB 2Q8AL 2YD4A 1NCCL 2BSTA 4JPIB 2EADA 1P1ZA 3EOTL 4MTMA 1H9VA 5E03A 3LS5H 2DEWX 4ODHH 1NDMA 3PPEA 5DHEA 1F58L 1QFWH 3IGUA 4G6JL 4JGMA 3LD8B 1G6RL 2GSIB 4M7KL 5HSFA 1T2XA 1X7QA 2FYVA 3O3BB 3NEOA 3O6KH 5C7XL 2J1YA 3FAXA 1HZHH 3VFTA 5FYLL 3NACL 3WUWB 4HG4J 2A83A 3BZ5A 4HWZB 3CQQA 4NQDB 1A9EA 1KWGA 4OF3A 5I66A 4Y4HD 5KBNC 1D6VH 1JTOA 3N41F 1YYML 2Z8SA 4N0YL 3F83A 5CJ8A 3V6FB 1IT9L 3QUZC 4JEGB 4WI7A 2Q10A 4CBZA 4M6OL 4DNLA 1QWHA 5IV2B 3FZUD 4M4RA 5J7CC 4G1EB 5DRXA 5DMKB 4J6RL 1BAWA 2XICA 5M94B 1VRSA 1CCZA 5K93A 1FQ9C 2R8SL 5C3LD 3BDBA 2YKKA 5D9SB 3X1BA 2UWEA 1MG2C 4L3EA 3FB8B 1S7XA 3R1GL 3X12B 4AENA 3MLWL 4LCWA 1ORSB 3O4OC 3ZTJH 5GRWA 5EO0A 5I0VA 1P4BH 1SMAA 5HDLA 3G04A 3IGAB 4S10A 1JPTH 3WIAA 4PRHB 4LF3B 1J9SA 3FDWA 4MKTA 4ZAKB 4X4MA 3H9ZA 4QRPE 5ADPL 3EDEA 3AM8A 4TKWA 4DETA 1ULVA 4M8RA 5D6DC 4I7ZC 4FJZA 4XO8A 5DXWA 5F0LB 3MKKA 3BD4A 4F1SA 4POZD 4F9LA 4HS8L 3EBAA 2EILB 3KPSD 4LSRH 4JL2A 1NUDA 2FSDA 4R90H 3DSNB 1DP0A 4UYQA 2A74C 2YPLD 1WC7B 4RRPA 2ITDA 2A4CA 4NXSA 1BYPA 1BFOB 5AAMC 1BJ1H 4N68A 4NZDA 4XZUB 2V2TB 4X8XA 3UTPD 2OAAA 3U0TA 1ZWIA 1A4KB 4N2EA 5GZOA 4PU2A 3BMVA 1INQB 4AWJC 5F96H 1KJVB 4EUPA 5CO1A 5CZVH 3OSVA 4KNSA 3DPDA 4FQPA 2WCPA 4MJJA 4XPGL 5DJZB 3VTAA 1TQVA 2DWDA 2N0MA 3ZO9A 2JIXA 4MA8L 4X4XB 1I9RL 4UZGA 3T0VA 4J3UA 1WZMA 4NN5B 2W95A 2XZCL 3NGBB 1IKNA 2B39A 2N1TE 3LN9A 3PWNB 5DJYB 3LQAL 1UD4A 2HUEA 2HKFH 2UZYA 2EZ0D 4H25B 3NIFB 3ARPA 1KIPB 2CU9A 3WFZA 4HIJB 3OGOE 3CDYA 3SY6A 4DGYL 2BSSA 1LNUB 3MV9D 3WUZA 2R2BB 2NXZB 1C7SA 3DBXB 4BSVA 4UQ2B 4WI0A 3P3UA 5D7IF 4ELMA 4JO3H 2JKLA 1URIA 4M5ZL 4YNYB 1JZ8A 1NOAA 5FIEA 2Z4QB 1XXDC 2R39A 1RJZB 1YEDB 1YJDH 1A7QL 1I1FB 4Y4FD 2CHXA 2Y1VA 4MB5A 4N2KA 4Q74A 4UUJA 1F2QA 2JLPA 1MLBB 2OL3A 5KBDA 5EC2B 2NZIA 1FH5H 4C83A 5I2IA 3LKPA 5HJGA 1NUGA 1VGEL 3CSGA 3WFEL 4XN7A 1DQJA 2A6JA 4RSYA 4GSDH 4XBPA 3U0WL 2J2ZB 4NNYA 4JY4A 1FAKT 2MHAB 4BQ6A 5F3FA 3C12A 3VXOB 2YS4A 5A6MA 4KTEL 4POUB 1CD9B 5AKSA 4B9YA 3I9GL 1E8XA 1QHPA 2O6FA 2FH6A 3QUZB 2YA0A 3GFUA 3U7AA 2EUXA 3OAUL 3RWIB 4X6FB 1F6AB 2OMUB 1KIRA 2Z7WA 5KSVB 4TSBH 4JDEB 4XPHH 1TT6A 1MFMA 3SOTA 1KEGH 1JWUB 4KK8C 2NT0A 2ZF9A 4Y5VA 4YGVA 4ADJA 5BVJA 3RPIB 4GQZA 4U6VH 3OC8A 4B97A 2A77L 4V1DD 1DDHA 4NLHA 1JZIA 1OTUC 1T5XA 3H0TB 3LNIA 4K8RH 3SKNB 3OMNB 5DFTA 4ENED 2ZCKL 1H3XA 2YN3A 3C5ZD 3EUDA 4WHCA 5SWZD 3BH9A 4UM8A 1CFSA 1CLCA 4H1LH 4ZX6A 3O6FD 4U3CA 5HDWA 5LCVL 2HKHH 2YRPA 2VZUA 3MCKA 4M03A 4PR5A 4ZUUB 5F6IC 3PQYB 1QZ1A 4JFDA 4XO3A 3S3DB 3N91A 4YHIB 5BRZA 4TVPH 5BQ7B 4B53A 3KPOB 3RFRA 2C7UA 4GRWB 3GM0A 3J8F7 4PGEB 5EWIH 5JTWA 4XE0A 4NS0A 2YRLA 4XWOC 5CP3H 1EAQA 5AZUA 2QQKL 1X5KA 4N2BA 4IGBC 3IXTB 1ZLDA 1I1YA 2AZAA 4MFHA 4W9EC 2A74B 3HE6A 4RGMC 2ZOLA 5T1LB 2KDGA 2BVUA 2EE9A 3KL5A 1NJ9B 3L1OL 3NIDE 2FE0A 5GHWL 4BWTA 1ACCA 1X5GA 3L08A 4OCSH 1DQQA 3JVGA 3EGDB 1K8DA 2ADGA 3LRHA 4I0CC 4DIXA 4ZQTA 4BE5A 1XGRB 3BD3A 4KNUA 3G6DH 3L3GA 3GXNA 5TE4H 4XMKH 3U36B 1RUAL 3GI9H 3VD0A 3LTVA 3NZ8A 4YSUA 4UU9A 3OQ3B 3IGLA 1KCVL 3J07A 1QP1A 2WSKA 1I53A 2E86A 4HKXA 1KLGB 2CO6B 4PHZA 4MYWB 3NP4A 1P0SE 1AGFB 1T3FB 2AQ1A 1L0XA 4PGCB 5C0IB 4PRHD 1CBVL 1TU2B 1K4DA 3PJSB 2DI9A 4ZAKD 1CC3A 5E24E 1YEGL 3QEQA 4LLMB 4KXAA 4WRLA 2EE2A 1DBKL 5KUKA 1U3NA 1NGXB 3WKMH 4F9PA 3MLPA 5DRWA 4WWPA 4QHNA 3V7MA 3WJJC 2Y5TA 1OT2A 2ORBH 5CXPA 4PS4H 1NCGA 4AEHL 3ZKQD 1DZBA 2AJXH 2ADYA 1N64L 2AF2A 4OZGE 2WXNA 3VD7A 4N5UA 4G8EA 4UOW1 4B6ZA 4QPEA 3WDHA 1B2YA 2QV4A 2VJXA 2CKBB 3QA3A 2WZ6A 1GPOL 4R3SA 5DJCA 3NH7L 3W5NA 2Z31C 4PB0L 5FYJD 4IU2B 4O2FB 4PJ9D 1QSED 5F7AA 4JDVB 4L8CA 2M83A 1TJGL 2RB8A 2VC2H 4ATTA 4JAMA 1O9WA 3INUH 1YAZA 4L4TD 2LAGB 1PZUB 4M7ZC 2A4EA 2YOCA 1GR7A 3L6FB 5E99H 1INEL 2WXGA 5FA4B 2VUOA 4HPYH 3SDXF 2ZNXA 4BFGA 2AJVH 4PCSA 2HT3D 5CCKL 2TRYA 1CE1L 3MJ9L 3G9VA 5D4JA 1GZHA 1PD6A 5DUML 5ILTH 3CG8A 3QPXH 4S2SA 5IG7B 2NXZD 4L1TA 2FJHA 1CFBA 4HS6B 1PLGH 3CC1A 2HB0A 2PPAA 1I3UA 3NJGA 3CDGB 3IAPA 5LGYA 3A3YB 1OHZA 2Q76A 5FA3A 1IBGH 3ULAB 2BS9A 3MZGB 1L3WA 1KTBA 2EYRA 4XB8A 2P8PA 1AZBA 1FFPB 1EMTH 4JMXA 2BP3A 2G4EA 1S7VB 4DEPC 1MAKA 4AEIL 4JRYB 5F6IB 3F7PC 3WFCL 4FRWA 1WPCA 3WJMB 2XFXA 1G9NC 3MV8D 3HPLB 2A5UA 4OLWH 4X9IA 4PJ5A 4IIQC 5D4IA 1QA9B 1W80A 3P0VH 2WPGA 1UKSA 2OJZH 4X50A 3C6SA 1JCVA 1NEUA 1JTPA 4GIAA 4OKDA 5F3HB 2CDEB 1AGEB 3QULB 1ZDSA 4IGBB 4OCYL 5J9PB 2FD6L 4OQTH 4PJGE 2OA9A 3ZDWA 5HGHB 1NGQL 3QORA 4QXTB 4PBXA 4RGMB 5K9KA 4Q9QH 1A6PA 1DVYA 2ISDA 3VO0A 4AJWA 4FQCL 3QUZD 4WQOA 3UTQB 2Y2TA 3V7AE 4RETB 5IESL 5JHLH 3VI3E 3QWRD 2DQFB 1GW6A 1YUKB 3AQYA 4JCMA 3LHAA 4XCYB 3FHAA 4ZW7A 1FSKC 2DLEA 2VH5H 4QXVA 4JGUA 4PQXA 3WBDA 2ZJSH 4U1KB 4Q7DA 1HSAA 1OAUH 2I9LA 1JWMB 1PGRB 3FQNA 1QQDB 1HQRB 4XP1L 4HXAL 4YO0B 2WQXA 3PQYD 5GRJH 2BP5M 2C9UA 2QVTA 1X9UA 2ZAGA 1NKRA 1AD0B 4GT7A 2YD2A 3O3DB 4EQ3A 5CLTA 1IGJA 3CJJA 4GI9A 3FQYA 4Y1AB 2RD0A 3L3DB 3VFOB 1YDPA 3QYMA 3ECQA 4QGTA 4C54A 1T7VA 3X11A 3KPNA 4RDQF 1J8RA 4ABQA 1F3RB 4DPRA 1ZTXE 2EDQA 2FLBT 3MJ7A 2WVVA 4QHKI 1Q9OB 4HCFA 3KWUA 5T1LD 3RWJB 5AZ2L 4NQSA 5DF0A 3KYKH 3NRFA 4HOXA 5EN2A 1T1WA 1BJ8A 4H2CA 1CFVH 1HSBA 3ECBA 1WFJA 4Q6IA 4BQCA 5FO8B 3GMPA 3AS0A 4H5SA 1TCRB 5I0YA 2K7PA 3P4MB 3LIZL 5FYKE 2NCMA 2Z31B 3APMA 2BSED 2ZUXA 5FHBL 2V6HA 3B5TA 3ZHNA 1FNEA 4ZODA 5E0FA 3NSFA 4P2CG 1UENA 1IC4L 3FBKA 4PJEB 1GS7A 4Q2ZA 4M7ZB 2FLRT 3IYLW 3MLXH 3FF7A 4HS3A 4CBPA 3DV4B 5KJ4A 1J8HB 1M7DA 2Q1EA 2YEVB 2XWJB 5J13C 1F4WL 2KZKA 3NJMA 3V4VL 4ZFZA 4PJGA 4AZ8A 5HYQB 3ZL2A 1HH6B 1MZYA 3PABA 1X5XA 2GCYB 3JUZA 1MXGA 4XPFL 1XCTA 2YEQA 2CJ3A 1YN7B 3FK3A 1QYGH 1E28A 4IRSC 2IOOA 3CC5A 1T66C 3CXFA 4X4ZA 5B22A 2W60B 1SYVB 3BPNC 2Z35A 3ZOAA 2ZKHH 1CVRA 2WO4A 4JKPH 5I8OH 1SZNA 5EZJA 4G7RB 1M2VB 2OSLB 4DEPB 5TGBA 5DJ2A 2CRYA 3FT2A 3ASWA 4LPXA 4OCRH 3SB3A 3G6AB 3AG4B 6FABL 3HC2A 1LDPL 1N67A 2D2CC 2WYTA 3O4LB 4NFCA 4IIQB 4QF1A 4S1RH 2Y07H 3AW5A 1OGAA 2F6AA 5BV7H 3RL1B 3WHE0 4ODTL 4XMLH 4DP8X 4NO3B 4AJYV 4PV8B 4RMVA 2O5ZL 3MNZB 3CBRA 1B6DA 2AVGA 5DUJA 2VQ1A 4X80H 3ATAA 4A6YB 3WY3A 4UT6A 4J7RA 1JN6A 3MRQB 4AITA 1QUNB 1ES0A 1D5MB 2J56A 4JE0A 1HT6A 3ESUF 1A6WH 1I7UB 3Q5OA 4OLUL 1J1XL 1U2HA 1ETZB 1ZHBA 1U8OA 2E47A 3JV4A 5CD5C 3S8FB 1H0DB 3T0BA 1AY1H 1N2RB 4N22A 2BW4A 3TX4A 1ZV2A 4ZUVB 4C4KO 3A24A 3WEBA 4KK8D 2GY7B 4ALAH 5CBAA 1FSKB 4FNSA 4G8GA 1OTUD 1S7TB 3PAVA 2M2DA 2NY1C 5TDPB 3WHE1 3IDMA 2RALA 3ELQA 1CFNB 5D71L 2K3HA 2R2CA 5IK3A 5KYYB 4DN3H 4XBEH 1OAYL 1W0WB 3QPQC 1AJ7L 4JRYD 4LLUA 2VLLA 4XNMB 4OFIA 3FQUB 2QVMA 3MR9B 5GJTL 5J1AA 2X2YA 5LBSL 5ITBH 5EUOB 1FBIL 25C8H 1T6VN 5HJ3B 3AUVA 2KHAA 4XWOD 2QKIA 2E75C 3AZUA 1Q1JL 2Y36H 2B2XH 1Z9NA 4IGBD 3O9WA 1T22A 3CD4A 4BKLB 1YVLA 3SY0A 5MI0C 5MENB 1XB8A 4LPWA 1KCRL 5I0DA 3G5VA 5AWNH 4W6WB 4E0RA 2DWSA 4DP0X 2H0JA 1IM3D 2JJVA 4NZRL 5J6HB 2DQJH 3W81A 3L5WA 2CM5A 3MYJA 4HX1A 3ZL4L 3IPEA 4ETYA 1EH9A 5JR1L 2OMYB 1JF6A 4I2XB 2CR3A 5AVTB 4HETA 5G4MA 3MRHA 4JQVA 3C60D 3WTWA 1MH5A 1HILB 2DYRB 3STLB 4G6MH 5DYOB 2J3SA 4Y7OC 2HRLA 1IILE 5J13B 4HULB 4K4KA 3MLYL 3E8UH 2AQNA 2FL5B 1SMDA 3QR1A 2R0KH 1R3KB 2GBUA 3U6XS 2AXFB 2C3VB 4DZBA 4IRSB 2H6PA 1KJMA 2OYPA 4QHLB 3BPNB 4CSPA 1SJXA 3CVIH 4YHNA 4XMTA 1J10A 1F4HA 5KVFL 2ENYA 2FSEB 2Z7ZA 4I9WD 1QFOA 3LS4L 4AEEA 1NEZG 3MFFB 3IETB 1CI3M 5T1MB 2EXYC 4GLRI 1IQDB 2XV6B 4PJHB 4NBZB 4QO1B 4P3WA 4ABUA 2BZ7A 3W39B 4NQQA 1BIHA 1KB5H 3U4EB 4FKKA 4KX8A 2Z31D 4OFQA 5A7EA 2ICEA 2Q8AH 1V55B 1ZJAA 2TSAA 3TO4C 3TESA 4MASA 1NCCH 2W07B 3EOTH 5F44A 4J2XA 4Z7VB 2WQRA 2XBZA 1TJMA 4R5VA 3L4WA 4OLYL 3S3CB 5HBBA 2O30A 3I6GB 1JDCA 3CFMA 1RL1A 1ZY9A 2YRBA 1OP3H 3DROA 1J0HA 4M7KH 5AVXB 4XOCA 4XX5A 1A1MB 1J8HD 2X2IA 4AUUA 5C7XH 1X5JA 4Z1PA 2C9QA 4QHKJ 2NY5L 5FYLH 3NACH 5A2JH 5IT2L 5FUOL 1S7UB 1OF0A 3DX8A 4MGXA 1YMHB 2AAAA 1ZEAL 4QRSB 3CU7A 1KDJA 2Y9RT 5IQOA 3RI5F 5D4QA 3HJEA 4NRXB 1YYMH 4N0YH 1C9SA 3ZYZA 4MJHA 3E6FA 1ZDQA 3QZWB 2KLTA 3ECWA 3U79A 5B38G 2WBXA 2NY1B 1RLWA 2J8HA 1ETA1 2CUAA 3VJ6A 4F8OA 3J7HA 2DZEA 3KGRA 2ED9A 1YEFL 5B1AB 2E3VA 3CN4A 4PRPE 4Y9FA 5IB4A 4XNDA 5ETUA 2R4SL 1XXFC 3AQXA 1UZGA 4YQXH 3RILA 5DEGB 5SWQB 2R8SH 3TBWA 4AV5A 3QG7L 1SXAA 3O4LD 4TUUA 2X12A 4KQ4H 6CGTA 3MV9A 5E8PB 5CJXA 2PCFA 2D31A 3MNMA 3R1GH 3BWUC 3OZLA 3TCTA 3MLWH 2HT2C 3RZWA 2FT7A 2HPTA 5DVMA 1S7WA 3QWOA 4Z7UB 4NSKB 2XKNB 5HJDA 3P73B 3T6WA 5DEFB 4AI7A 1B4TA 1NSNL 2VLKD 1ITBB 2H7WA 2X70B 1KPVB 2O6EA 3NAAH 5ADPH 5MI0B 1KIQB 1FNSL 3UP6A 2I7OA 1RIVL 4M5TA 2UY7B 1H19A 4HS8H 3BISA 3AXLA 2DOCA 3KPMB 1MHCB 5SX5K 3RNKA 5E2TL 1LE5B 2EICA 2V2XA 1UM4H 4OLVL 2XC8A 5ACZB 2BNUB 3MROA 5I1CL 5JA9A 4N2HA 2IQ9L 1ZHNB 3V5DB 3APNA 4RMSA 2DJ4A 3QUXC 4UQEA 3C09C 2G0KA 3E0GA 2Y0SA 2R2HA 4PIRF 4YPGA 3R19A 3FOMB 5DVPA 4GQRA 1NUNB 1TXKA 1KOAA 2BIOA 3NIDF 1ZLSL 2NLJB 1Q0YL 5EF0A 4MA8H 4JN2A 1I9RH 1PPIA 2X89D 5CM1A 2XZCH 3D09A 1Z9OA 1YJDC 3HBGA 4Z5RB 3AU0A 3MODL 1LP9E 4JRXB 2BJML 3LQAH 5I26A 1QPXA 2C1PA 3HCVA 4A7TA 4U6XA 4V1DA 2HPOA 3W38A 4EXPX 4GIPD 4R83A 1QTYT 5A2CA 1K2DB 4A2FA 4DGYH 2YMXL 4RWYL 4NPJA 3OR7B 2B08A 2DBJA 3MUZ1 1JZJA 5MEND 1FNGB 3BDYL 1SFDA 1CICC 2FX7L 2NZ9C 1P5UA 4D3CL 2DJMA 2H5UA 1FUNA 4F58L 1CK0L 4O5LL 2FUQA 2VW7A 4JM2C 4M5ZH 4PJCB 1D5RA 4P57B 4IHOA 4TM9A 3THML 1WBYA 5I0XA 1A7QH 4FTDA 4PRPA 5T3XH 3TO4B 3D87B 1MCRA 3L2MA 4IU3B 4YE0A 5HPMB 3CV5A 5ITFB 3RL2A 3US0A 3FYIB 4UIMB 3BZEA 5JXEC 5CEYA 1ZD6A 4JHUA 4X7CC 1JHTB 3QO0A 4JVWA 4YXHL 3CU1A 1QD0A 2VRAA 4OZGF 4IQHA 2VCOA 4LK4A 4D8PA 1VGEH 3WFEH 5IB1A 4I85A 2EUZA 3DTXB 4K8RC 2AAVA 1GYUA 4DP4X 5JOPD 3U0WH 2X1PA 1WGOA 1HHHB 2X87A 2XXGA 3IJEA 3NDYE 4OZFA 1OP3K 3ULSB 4QXUL 2DH2A 1E4WL 2PWFA 3SO3C 4TNGA 1T5WB 3L3IA 2Y2YA 5HVGB 1OO2A 5F88A 4KTEH 3TJPA 4K9EC 3BLBA 4HK0B 2HLAB 3I9GH 4WWID 1NC4B 3ZKXC 4IRSD 5I8CB 2P5WE 4DCQA 2JTYA 2CDGA 3OAUH 4YL9A 1T83C 4XX1E 2R15A 4FYTA 2DDQL 3VA6A 3KL0A 5INCA 4OT1L 1QABA 2YZ8A 5LGJB 2JVUA 4MJ5A 1BG1A 4AUJA 1WT5C 4K2UL 5J4MA 1URZA 2ZCKH 2EIZB 3ARSA 5L4MA 3FQ4A 3ARWA 2PYEA 4M61B 4KPHL 3RY4A 1GIGL 3QJFA 3HG3A 3F12A 3F7YA 1UXMA 1ZANH 5CZRA 3A67L 4HJ0C 2EDJA 3D0LB 4OSUH 1PS3A 1S4IA 1LP9A 4FC3E 4TOYL 2CO2A 2QPUA 3S2AA 5J0BA 3ETBJ 3CZJA 4XPTH 3ZHDA 4HUWA 1QPPA 2IDUA 4JY6B 2NSMA 1Z9SA 5GRYA 5CD5D 3IDGB 3K4ZA 3V6OE 1FP5A 1Z3RA 2QQKH 1Z66A 1IEAB 1LMKA 1HCFX 1YUHA 4WTZG 3HBZA 5CBEB 3ROLB 5L88L 3VG0L 3LIUA 4IKJA 1ETJA 3EFOA 1ITCA 4LEOA 4MWFB 3VM5A 1DUZB 1TVHA 3QUXB 5GHWH 2X0VA 3PUUA 4L4TA 3C09B 2NY1D 3B1UA 3C5JA 4PJGF 5DD6B 3QPQD 3L4VA 1KY6A 5FM5O 1IIIA 3S6CA 1RU9L 2J57A 3RIAK 1U4EA 4NI6A 3VG9C 4YDVA 2GIXA 3CZFB 4P07A 1XZWA 2CRZA 3BI9X 1OT1A 5FK9A 5AAWA 1KCVH 2X4OB 2DMHA 3HRZA 3S96A 5DZOA 5HDOA 1ZA6B 3TPUB 1ZT1A 1E40A 3GJFH 4F5CA 3GMNA 4ISVB 3CMOL 1CBVH 5HYSG 2FJFB 4OZHB 4LSQH 1RPUA 4GP8B 4LBAA 1NCJA 3LJ3A 5BJTA 5FB8A 4PVMA 3QXTA 2A6IA 4ZS6C 1YEGH 5F70A 3UABA 4AGLA 1CICB 2AERT 1DBKH 3O8XD 5AALA 2VM9A 1GGUA 3QFDA 4AQ1A 2DV6A 5JLZB 2W0KA 4JM2B 4LT7A 1J0IA 1S9KC 1USQA 3STBA 3QJTB 4M00A 2VDLB 2WYHA 4AEHH 1N64H 4WJ5A 4AYID 2ZWSA 2JB5H 2W59A 3M1BB 3OG4B 4TNVF 4WU7B 1PY4A 5EOCJ 4MD0B 5TFSL 2YWZA 3VWJC 5BO1L 4K23L 5DUBB 5T3ZL 1NBYA 4L37A 4HLZG 3NH7H 4PB0H 4P2OA 4TSAL 1SY6L 4XBGB 3VFVB 1TJGH 4JM4H 5E8NA 3HR6A 4FEMA 1EXHA 1P84K 4NP4L 4U1HB 4AGMA 1EVUA 3SO3B 4JUTA 4G5ZL 4H1LB 1HX0A 1INEH 1EZLA 1KBPA 2JELL 3OKOB 4G7YL 4A2HA 4AW7A 4JRXD 4KXZH 1JNJA 4JB9L 1TTGA 2HG5B 1C5DA 2QADD 2SEBA 4LRIC 1AQDA 2C1OA 3IJHA 4HLJA 3M88A 4ZMLA 5JIIA 1TZ8A 3TS8A 3V6OA 2XTJE 5CCKH 1FZJB 3UTZA 1LEKB 1SNRA 5L2KB 3MJ9H 5DUMH 3OKEA 4O9HL 3N42F 1W6WA 2VERN 3FO9A 3KHQA 5FGCE 4N0UE 1QVOA 3OPZL 4ODXB 2EXYD 1WZLA 1OZTG 3QBTB 1U3JA 5DZJA 1OQOA 3I6LE 2CNYA 1ZT7B 2NQCA 3U1PA 4FKEA 1TQCC 4OCLC 1P9MC 3ZDXE 3HW7A 1UXWA 4PVNA 2Z9TA 3TO4D 4JGNA 2DQTH 3N2JA 4PI2A 4AEIH 5I17B 4CW1B 3Q9PA 3WFCH 2DYPB 1CGWA 4PJ7A 3B7SA 2Q8BH 2BOLA 1FFNB 3FKUS 4YZWA 4RA0C 3QCUL 1HHIB 3T8MA 1Z32X 3FOLA 3VXRE 3VGFA 3REVB 4AQ8C 3FB5B 3F04A 4Z7QB 4OCYH 2FD6H 3B3IB 3LKSB 1NGQH 1A1OA 4G72B 4MJ2A 1K8IA 4BH7B 5EEXA 5C09B 4ZMYA 1GRWA 3E1F1 4GS7C 5C0RL 3I50L 1JCKA 3M6DA 2GJ6A 3IU3A 1RUML 5JW5B 2YA1A 2PWEA 1MREL 3CZLA 3AGWA 4JCLA 1PDKA 1T2JA 3EYVA 4N6QA 4NRZB 1A6TB 4WEUD 1DBBL 4R7LA 2GIYA 3MNVB 3VG9B 2MWCA 4LLAA 2GK0B 4JFXB 4ZMPA 1J9RA 2CR0A 3MBED 5LUMA 4PG9B 3VE0A 2B3IA 1N3NA 4XP1H 2HT2D 5I1DA 4NO0B 4L4VD 4HXAH 2RCSL 4NZTL 1SOSA 2JK5A 5CJOH 5C08D 1QI4A 3GDCA 2XIBA 4FQJL 1TDQA 1UH3A 1PY9A 3ZZ1A 1NH6A 3HVDA 3EF7A 4KK9C 1H3VA 2CO3A 1JNLL 2VC2B 3VFUB 2AQ2A 3SDDA 3FT4A 3NPZB 1ZLVK 4NZJA 3DK2A 4D9LL 2F5BL 5BZWA 2J88L 5CEXA 3W9DA 3GBDA 3A4AA 4N0UA 3DUUA 5KBPA 2OTWB 4GRLC 5AZ2H 4RMTA 1BVNP 5FYJU 3QUXD 4L5FL 4BKTC 3B5GA 3IDJA 3LIZH 4LIQL 5BW7A 2WZ0A 2DJSA 4NUGL 1TJHL 3U0PB 3S34L 5C9JB 1BGXL 1DUYA 3HOGA 1IC4H 4RNRA 2VDQL 2GFBB 5D2NA 5K59E 1C16A 1S46A 1TF4A 3EO0B 4OIIL 4NKQB 4Z7NE 1GCYA 1MHEA 2BHUA 4G70B 1YMME 1I8MA 4DAGL 1UACH 1OAQL 5I74C 3PAYA 3SQBB 3FO2B 5I19H 3VXRA 4JVUA 3T8XB 1MVYA 1F4WH 4BQBA 1N8ZB 3A6BL 4EPSA 4U1MB 1DZ0A 4MB3A 2Z7YA 2YQGA 4XPFH 5BV7C 1AGCB 1CICD 2NZ9D 1RURL 4H8PA 4X5LA 1ZA3B 3ISRA 1KY7A 4QHMA 2VAJA 4X99A 3R4RA 4JM2D 3ALWA 1CLOL 2OULB 4FTVB 4LB8A 1ACYL 3MRCA 5GRVK 4U6HA 4A2DA 1L9NA 1TQCB 2JCCA 1S7RA 2BOBA 1ZE3H 2XQBL 3KEHA 4BUGA 4WY7H 3BWAB 3DJSA 3KPRB 3WIHA 1WWCA 1SDAB 4P48A 1GA2A 2A9BA 4KXCA 5IJKC 4FQ1L 3EOAB 2F19L 4JN1H 6FABH 5JXED 2BVOB 3LPFA 1LDPH 3D8MA 4A1RA 3DVGB 2CG9X 4QJ5B 1LMIA 4ALAC 3L1GA 3ZDYB 4ODVL 2D7TL 4K8RD 4AKOA 3LPWA 3ATDA 1JS4A 1E4XI 1IAIL 2IH1A 2O5ZH 3AB0C 2P1YA 1IM3A 5MEPA 1NAMA 1F3DH 3S5LG 1ID2A 3CFCH 5KYWB 1U3ZA 5DFAA 4XRCA 1FH2A 5I16B 4GS7B 4DZ8B 2H1XA 4OLUH 2O61A 2QSTA 1J1XH 5ICYA 1Q4NX 4F3FA 1QI3A 2MMXA 3MJWA 4TVPD 3VGBA 3TIDA 1W72H 2VB5A 1Z9MA 3IKCB 4R97C 3C60A 1G7IB 3AU1B 2V9UA 4G6KL 3UYRL 5IJDC 5HY9B 4MMXC 4Q6KA 4PP2A 1S9XB 1SLUA 5T1KB 2HVKB 3GSOB 3GIZL 1SOQA 4Z0XA 1OCRB 3C8HA 4LCYA 1ZHLA 2GUOB 3GMLA 1OAYH 2CIIB 4HEMA 1AJ7H 2EXWC 2AKRB 3F7RA 1JPGB 2VQUA 3HNTL 2DYPD 1CFTB 2R23A 3FU0A 4HJ0D 2R4RL 1U58A 3FQ2A 4U6YB 3BX7C 2PR9A 3CBKB 4DQOL 5GJTH 2E9GA 5LBSH 1DJYA 5GRUL 1YMMA 1FBIH 1H6UA 1JXDA 5IBTL 3X1NA 2L7JA 2R69L 4WJG3 4YLQT 3CX5K 4AEFA 1IE5A 1LEGB 1SMOA 3H8NA 4U3SB 4XC1L 2HSIA 2WINB 5DZVA 3IRCA 3KDMA 3QUGA 4F2MB 5IW1A 1HHKA 5F2FA 3QJHB 2I9TB 5LXVA 2P45B 3OHXA 4CSSA 2OYLA 1NUFA 1TEFA 5DC2A 5E6ZA 4GRLB 3VFWA 5C09D 1KCRH 3EYQC 2XWTA 4QMEA 5AVUB 3STZA 1PZDA 4C57C 3GM8A 3MLTA 5JW3H 2AITA 1BF8A 3RVUC 3D3VA 3TV8A 4O00A 3MCLL 4H88L 2PUQT 4XNUL 4NZRH 3KLKA 5F7UA 3EFFA 1OF2A 3UZVB 5DZNA 4E9SA 2ESVD 4OD1H 1C08A 3SBWA 3ZL4H 1QUPA 3ZZSA 5JR1H 4ANUA 3DX4A 3WD5L 3HIZA 5FF6B 4Y1SA 1H15A 4HAFA 4NO0D 4CDHA 1B0RA 1VACB 2FTAA 5EH1A 5I74B 2R1WA 1U8LB 3MA7A 5C8JA 3SN6N 1XSIA 5LNGA 3MLYH 1QI5A 1G7QB 3ARTA 5DJDB 3QSKB 1RZFL 4ZS6D 5BV7B 2GJZB 1RZGA 5MHSD 4UQAA 4IK7A 4TV3A 4NHCL 1VKXB 1DVTA 4JZNB 4WV1C 1MFCL 3MYZA 2DQUL 4L0PB 1VENA 1F18A 4BFOA 5CIPA 1IBBA 1JERA 1MCKA 2APFA 2EDMA 3LOWA 1HKLL 1BPLB 1MKFA 1LP9F 2V2WA 4H2AA 1UM5H 3GSQB 5KVFH 2ZSWA 3LS4H 1I1AC 2DQ6A 2VWEE 1QLEH 3HBQA 3BIKB 2OZ4A 3VWJD 3FO1B 2VLKA 3DRTB 5T5FA 1TENA 2QFRA 1PLAA 1R5IB 4LHJB 2V7NA 2M1KA 1QFUH 2P9RA 1ASOA 4K94L 1DTUA 3BKYL 4NQVA 2XUWA 2OXHA 5HYJA 3WNKA 4KTDL 1HI6B 3AB0B 3WO4C 5IJBC 4OLYH 4ZW8A 2A6DB 3IMWA 5TQ0L 2VLJA 4R7DA 4F80A 2YFOA 5DS1A 5TE6L 2E74C 2NR6C 4AC2A 2G5BA 4MJIB 2IANB 4JPVL 4N8VG 2E27L 2NY5H 4MB1A 3CUPB 3ZYJA 3H9SB 5B21A 1V7MH 5IT2H 5DHVH 2FNWA 1JPFA 3PDOA 1DBAL 3QG6A 4NQCE 1ZEAH 1MOEA 4ZYKB 4QTIL 5IKCB 4MMXB 4F7PB 4H0LC 1LD9B 3D18B 4I4WA 3RWDB 4N2FA 2EACA 3UTSE 4FTVD 5CINL 3DV6B 3L9RA 1Z0NA 3KPRD 4L2YA 5TK4A 2GB2A 2WWMC 1TZAA 3ARZA 1YLBB 2R4SH 1AQ8A 3MRKB 4LOUC 3Q1EA 2JE8A 1JXJA 4ZDHA 2MQCA 2XWXA 4CVXB 4EVNA 1P1VA 3QG7H 3G5XB 4LKXB 2ED6A 3EO1B 3NCMA 4Q0XL 2E56A 3OSKA 43CAA 1BVZA 1BZDA 1WZAA 4JFOA 2B16A 4UOJA 3RWGA 4MAZA 3DX0A 4PCYA 4U49A 5A40E 1XF3B 4BK5A 1NCBH 1MXDA 1TMQA 4L3CA 4DERA 3Q2LA 1NSNH 4OD3L 1SQMA 2DICA 5H37G 3HA0A 1BVKB 3P4NA 4YHKL 5HHOE 4LNRB 2DWEB 3P40A 4YHPB 3RBGA 1FNSH 4I1NB 3O81A 3OWEA 4X6BA 4ODUA 2DLHA 3HC4L 3L5JA 3IE4A 2ED7A 3EG9A 5GSRB 4GRMB 2YPVL 4JQXC 4ES8A 4OLVH 4I89A 5I1CH 3LQAC 4B9KC 3BZ4A 1WD9A 4OFPA 4OZIA 2IQ9H 3ML9A 4HCGA 1FYTB 3VWKA 1IGFH 2UYLA 5DK2A 4YE4L 5T1KD 1TTUA 2FK9A 4N24A 3S48A 1HNGA 1M7IB 4NPKA 3LPGA 4X6CB 2HRGA 3WAKA 2WV3A 2I60H 2ZOKB 3MRRB 1P4IH 1HCZA 1RJYA 4KDWA 2Q20A 4Z3IA 4ZXBA 1PYWA 1Q0YH 1M9WA 5E23A 2ICCA 2IXQB 3UTOA 5AW0B 4BUQA 1FL3B 1KB5B 4GOSA 3RE0A 3Q01A 4L9LA 4KK9D 4HJIA 3MODH 2WN3A 1BVLB 2BJMH 5E08L 4A04A 1DJWA 3V4UL 4ZG1A 1OB1A 2QDVA 2C4XA 4WV1B 5DQDL 3ZHKA 4NQCA 1TVBA 4FABH 4RWYH 1NPUA 1S7SA 1BD2D 3VQ2C 2H32A 3MRFA 4ZUSB 3ECUA 1ZGLA 4I18A 4J39A 1KCBA 4GRLD 1AGDB 3DETC 3BDYH 5TF0A 1R3HB 1I1AB 4OV6F 2C4FU 3FXIC 2NNXA 4D3CH 5K69A 3UTSA 2HX8A 3AG2B 4F58H 2AJ3B 1CK0H 4XCFL 1NCUA 32C2A 5EU6A 3V95A 1HWGB 3BHBA 1T2QL 3THMH 4H26B 4Z76B 4OV5B 1SLWA 4KRPC 4AVIA 3JVFC 3PJNA 4GUPA 5HJBA 4RA3A 4UQ3A 3BLPX 1EV2E 2IADA 3NIGB 3WO4B 3P9LA 1MFAL 1IRAY 1TOXA 2QSCL 1BZEA 1AVAA 2AEIT 1XGZA 3VXQA 4YXHH 3II1A 1BXAA 1WK0A 3T9WA 3FCTA 1P4LB 1WE5A 4PBDA 1LK3L 4KKNA 4YSAA 2UV3A 3IS1X 5I5IA 2F54B 5KAQG 4GAGL 4LCUB 4XVUC 4WWKC 3V0GA 2WB1A 1QZNA 1VERA 4L29B 4BDVA 1PTZA 3ARFC 1VIWA 5FOJA 2FBRA 3MI6A 2G3ZA 5DJXB 4QXUH 2YSTA 1E4WH 1XBDA 3WOVA 4GP5B 3JQOB 1U8NA 5PAZA 3SQOL 4G1MA 3X13A 3X1GA 4RMWA 4PEEA 4UQCA 1KCUH 4Z7WB 1W91A 2FHCA 4OFVA 4FQHA 3SPIA 3MLZH 2LTQC 2N01B 4X7SH 4POYA 4U1LB 3DX9B 3S4SB 2OS7A 3T0XA 2FJGB 2DDQH 1RSYA 5EO1A 5K5YA 4OT1H 5EU3B 1E7UA 3ESNA 3IU4H 4JJ5A 2D0FA 5DR5L 1U91B 2BFVL 1X5IA 4AQEA 4K2UH 2EDEA 3ET9F 4P23C 1QLRA 4DVBA 1RERA 2XSKA 1O75A 5C6WH 1U8JA 3JWNH 3MRGA 1NBCA 3O8XA 5D8JL 4KPHH 4OIBA 3W0WB 2XBTA 3PHOB 1GIGH 5AB1A 2ITEA 4CU6A 2X2JA 3V4PA 1V05A 3A67H 1SDDB 3F8UB 1IGML 1I31A 3ZDXF 2HH0L 1QEXA 3AWFA 3IB4A 2V8LA 4MJID 5H94B 3FTUA 2IAND 4GKNA 5AKRA 4A2MA 3Q3GA 4Z8FL 1THCA 2PW1B 3OKLA 1FVDB 4WW1A 5J6SA 4MNGB 4KKCD 4ZS7L 5D1QE 3GBNL 4CMMB 1SJMA 1T0NA 5EUKB 3DJZA 4WWOA 5L88H 3VG0H 4HAKA 3MXWL 2IF7A 1FI8C 4X5XB 5T1DL 3R0NA 1KGIA 2MOGA 4JLRB 1OK8A 4B9FA 5JMRA 4NPYB 1E4JA 4G5AA 1GS6X 4UMSA 2PNDA 5CWSB 3LEXA 5TF1L 4M8QB 1XBRA 2EXWD 3SDCB 1TFHA 2YQ2A 3WY4A 4G80B 3UO8B 3DURA 2WLYA 1RU9H 3BOVA 4ANXA 5FYKL 3SE9L 3TONA 1BX2B 4A2EA 4JPSA 4XN1A 3WNPA 2JCCF 5J56B 4MMZA 1QPKA 4W68A 3AUWB 5EO9A 1BDYA 4J3SA 5F89B 4DUWA 5JMOC 1N19A 2VDRL 5LXGH 3CMOH 1WICA 3K4AA 3FULA 8CGTA 3P77A 2WLIB 4NC0B 4MXQC 2JQMA 3HS0C 1LWRA 3EYQD 4FFZH 1ONQB 2YGOA 3TO2A 3RVUD 1L0PA 1OAJA 2P5EB 1TYRA 2WOBA 5C0CB 1QBBA 1UT2A 4EI6B 4EO5A 3B7TA 1RH8A 4PAZA 3GSVA 2OCFD 4OFKA 4ODWA 4JZOB 5DSCA 4HJJH 4KRPB 5F7NC 5HHNA 4XVJH 1GGTA 3LH8A 5JPMA 4MD4A 1HOCB 4HPOL 1CYWA 5ICXA 4LGSB 3LSOB 4PRAB 4K23H 5T3ZH 2V5YA 4M3HA 3RJDA 4WWKB 3WY2A 2WO2B 5JQIB 3FL7A 2WAQA 1SY6H 2B3RA 4M8UA 4NP4H 5B8CB 1FL6A 2VMDA 2HLEB 3BPOC 4G5ZH 3M86A 4YHMH 3I2CL 1OGPA 3VU1A 2JELH 2BSRB 4G7YH 4IBZA 4H4NA 4HUVB 3W1ZA 3MRLB 1I9JL 1KULA 2M8XA 1RZKH 1FCGA 3D25A 4HMCA 5AW4B 4ONHB 1ERNA 4KJYB 2LTQB 5D1QA 4KTGA 5K59F 3U4KA 3NCCB 5DHYB 4BHUI 2CBOA 2GUYA 4Z7NF 1QG3A 2X38A 3OPZH 4L4VA 1I1AD 3KLAA 5FYLD 3L3JA 3QT2A 2P24A 5IB2B 2Y5QA 4OLZL 3NG5A 4NKOA 4P23B 5K33A 3E6HA 2DKUA 4QRUA 4CNIA 3CHRA 1JGEA 3F2LA 4A55A 1A7NL 2Y1ZA 3WEOA 3HG1B 4CU7A 1P84J 3MX0A 5F7YC 3VFRA 1LE9A 1OAZL 3ZE1B 2DM3A 4N2IA 2YHGA 4HHAA 1P2CA 1BV8A 2F54D 3EYFA 2NR6D 2CLRA 3KW7A 5I1JL 4U0RC 1Z0MA 4B95C 1I8LA 4AJ0A 1XH0A 3QCUH 4MZIA 3WTSA 1VZIA 5GS1C 3UERA 4EBQL 4NKDA 1S7QA 4B3EA 1GC1C 2UY6B 5JORB 3BP7B 4XH2B 4EI0A 3GJFB 1A6ZA 5C0RH 1WO2A 3I50H 3QQ4B 5E4EC 4B3VA 1RUMH 1HHGB 1DE4B 4PD4K 3U9WA 1FZOA 1MREH 3VGGA 3KDPB 3E2HC 3KYNA 1HYSD 3MRDB 4RQQA 3QQDB 3UTTE 2WWMD 3D9AL 1HOEA 1DBBH 3QHFL 1A8JH 1CDJA 4OFDA 4JY5H 4FQQB 1BQHB 1Y1DA 2B59B 2XA3A 2WQSA 4LOUD 3FH7A 1ZV5A 1WV7T 5AVVB 2WGNB 2BY2A 4JFZL 4DW2L 3Q2CA 1WCBA 5IROA 4B60A 2FUTA 4E9RA 5DK0B 4XN2A 3VI4E 1KBBA 3W0WD 4NZTH 1F11A 2IWKA 1BA9A 2VDKL 1U36A 1PBYA 3SE6A 4G8IA 1JV5B 1UKTA 5EPMA 3V0FA 3WL9B 1PIGA 5IHBA 3HMXL 3FFDB 3HS0B 5BXFB 2J8OA 2BZCA 4IKNA 4N8CH 4F8NA 3QNZA 1JNLH 4LHQB 3OAYH 4JHZA 4MLIA 3GWJA 4X9YA 3WFDL 1TFPA 1Q9WB 2ZOUA 2VDML 2WVTA 4ZD3H 1LHZA 4D9LH 1WGVA 2F5BH 3QIWC 2J88H 4PV9B 5KOVC 3MRBA 4PMFA 5JIDA 3RY6C 1XR8B 1IV8A 5IQMA 5HDQL 1UWXH 4ZO9A 4YMPA 4G42A 3LH9A 4HH9A 4LIQH 3O3UN 3L3KA 3G5WA 4NUGH 1TJHH 2K70A 3SGEI 5CJ5A 3S34H 1JSYA 4B9CA 3VXPA 4HMDA 1GW0A 5IWLC 3GF8A 1NEZA 4N9GA 1CG9A 3BPOB 2CDFA 2EDYA 1ZE3C 5T3XD 4OIIH 1XO8A 3QUMA 3LX9A 1DBJL 1WEJL 1IJ9A 5DMJB 3IJ8A 3L5HA 1OAQH 5I1LB 4HQQH 3ZTNL 4IKKA 2YLKA 4WI4A 4BWWA 1L3NA 5SWSE 4XN4A 1YPZE 4HDIA 1AZZC 2WXOA 4X5QA 3UBFA 4LCCC 4FNLH 5DMIL 3S5ZA 3DETD 4DGVH 5E7FA 3GSNB 1I1CA 1RURH 1HXMB 2P5ED 3BMWA 1G1OA 4MAYC 5C0CD 2B0SL 4EIZC 2ENJA 4U1GC 1CLOH 1NCAL 3QUHA 1ACYH 3TBSB 4GMSL 3IXAA 1KYOK 2XQBH 4KRPD 4KXDA 5KANG 1E30A 3ZPDA 1E5UI 5IEHA 5KYXA 2YGNA 5GGTA 1NTDA 4I0PC 2K6ZA 1R24A 2ZXWB 4X7DC 2F19H 2QEJA 5DJ8B 4HW6A 5G2NA 1A3RL 3U6XA 3IDNA 4D7PA 3CH1B 3VI4A 1VFOA 1ZTMA 1D9KA 4OFYD 1OGTB 3MC0A 4WWKD 4XVUD 4ZSOB 2ADJA 1O7VA 2D7TH 3ARFD 4OZIF 2L8AA 2AV7A 1P5VA 3FC8A 2OL3H 5GS1B 1IAIH 2K78A 1N59B 3CFEA 3O6LL 4X0NA 2O93L 3ZU8A 3SGJA 4AOFA 4XOEA 4AH2B 3GGWB 2DAVA 4UYPA 3G5YB 2YPLE 2QFPA 2V5MA 1RJLA 5E4EB 4CL7A 2DMBA 3WHXB 3UROR 5DD0L 3JTBA 1N12A 2HFGL 3E2HB 4IOIA 1PVHA 2Q0ZX 3UTPE 2P80A 4UNTA 1OSZA 2VRKA 1IKFL 2ATKB 3MOAL 1JF1B 4G6KH 5CHNA 3UYRH 1YC8A 4GUOA 3VDBA 5D7SH 3FQTA 4A67A 4JFED 1CFQB 3MUGB 1NGWA 1MDTA 2PCPB 4LOFA 3L5IA 4K07A 4P23D 4NUJA 2G75A 4P59L 1G0XA 2Y22A 3RU8H 1UD3A 2R1YB 4PLKC 4RRPM 4I5BB 4NO2B 5F9WC 3RNQA 3UIYA 5JHBA 2AK4E 2WZ5A 5B3JE 4M5YL 3HNTH 1J7VR 3GUTB 4LSDA 4GEIA 3EGXA 2R4RH 5KVEE 4XMUA 4DQOH 2W0FB 4PGJA 5GRUH 1J05A 4FHBD 5IBTH 2R69H 2DB8A 2JCWA 3VXTB 1BBJA 4N6RB 3UADA 5MEQA 4FZ8L 1Q9KA 5SWSA 5A6IA 4M56A 1ODAA 1ZJBA 3RWEA 4DPCX 1GHFL 3CIAA 4XZ4A 2H6UA 2ZX5A 3QIWB 4FQXC 4AGNA 3IWUA 3B9KA 4Z7IA 1E5BA 2WTRB 5GS0L 1U41A 4UM9A 3EYOA 1BZ7A 4P5TC 2W92A 3PREA 4QY8A 4QHPA 1NKOA 3NFPA 1GY2A 4FXKC 1TTFA 2C7FA 2V4LA 4H88H 4XNUH 3FN0L 1KBGL 1AHWC 1UWXK 2CBMA 3BFQG 3GBLA 3CBJB 3C8KB 5IVZB 4BFBD 3BGFC 3L3HA 2X3BA 2GK2A 2YSSA 4WUUD 4D9RE 3T1FA 4ZFOB 3K91A 5EBLB 4CVUA 3D69B 5IEKA 3CX5J 2XG5A 2RFXA 4CN1A 4GG6A 1JYWA 1B0GB 4FI8A 5EA0L 1IAIM 4ZPTA 4O02A 4OQTA 1HC1A 3GSWA 5CLYA 1UD5A 3QCTL 2EYTA 4MXQD 4TQ8A 1MIMH 1RZFH 1VGKB 3CCHA 4LBEA 4QOKB 4XNAA 4LCCB 4K55A 4OJFL 5BMFL 2F74A 2Z8WC 3N44B 5F9OL 1EHNA 4MAYB 3S88L 2VO5A 2DY2A 4MXVE 4L0YA 1P7KA 1WWWX 4U1GB 3NCYS 5ANMB 2AQRA 4YDJB 2DLIA 4LLDA 2JI3A 2ATPB 1HKLH 3ZLQC 2XV2A 4O51A 2JB6B 2NY5C 4I0PB 1EHLL 3CZKA 4M43L 1W72B 4HV8A 1RK1A 3CMGA 3MQIA 5D5MB 3US1A 1F41A 4QXWA 4QRRB 4DGWC 1V5JA 4K94H 5KSBA 3BKYH 4OTXH 2AK4A 5HXMA 1SUJA 1EAPA 3VFPB 1KTLB 4KTDH 2VABA 4GW4B 1XGQB 1DO6A 5FLVA 5KG9B 1FNLA 4G3YL 5TQ0H 4FCHA 1ACZA 3EOBB 5TE6H 4D0CA 2Y5EA 4NQDE 2XETA 1TG8A 2IQAA 1JK8B 2PXYA 2E27H 4JPVH 4P0DA 3VFSB 4YUEL 1XIWD 1F0LA 2HFFA 1TVDA 1MW0A 1CZ8L 1DBAH 3SEPA 5KANI 2WUCH 2MQ3A 2B20A 3V79C 2D7NA 4QTIH 4U1IA 3PNWA 5EIIB 3VRJA 2YA2A 1AXTH 5GGSY 3ETBF 1XGPA 3BUQA 2FWOA 3L2LA 3DIFB 2VSMB 3DX2A 2HX9A 4YBHA 5CN1A 3DUSB 3QJUB 4JREC 3L48A 2OMXA 4J4PA 4WNJA 3GS0A 3O2WH 1HDMA 4WNSA 2D9QB 4LCIL 3VGEA 5FWQA 3N0AA 4WTZA 1TETH 1U0QA 2AEPL 2DN7A 1EEYB 4M9OA 3QH3B 1RZ8A 3SDYL 4IW4C 3L2NA 3T4AA 5CZXC 1P6WA 4X9GA 5BPPA 4NHUA 5J11C 1UXSA 2QL1A 3SPGA 4Q0XH 3E1ZA 4U4BA 4ZUWA 4BZ2L 1QBLL 1S9WB 4C55A 1F5WA 4ZFFB 2WSPA 3CZEA 2RTTA 4S11A 3WIIL 5C0FB 2LAAA 1EXUA 3D2UB 2NX5B 2NUTB 4NC1C 2ZUYA 3BQUA 4UI2A 4YHKH 3RURA 4HJGB 1FWXA 3COOA 3HEIB 1AZVA 3Q13A 2ZICA 3HC4H 4UWQB 1OXYA 4E41A 3D4GA 5C0EA 4M3KB 2DQEL 1QRNE 2YOAA 3N41B 1RP9A 1LO2H 3TBVA 1AP2A 3GRBA 4NRYA 3FSOA 3LRMA 4Y5YA 3TN0D 4U2ZA 1AHWB 5HYSA 3ZQ9A 5IB3A 3AABA 1MI5B 1HL4A 4BFNA 1EO5A 5LWYL 3BGFB 5BRQA 3EDDA 4YE4H 2ZCLL 3C5XA 1KTDA 1PG7W 3KPPB 2XZZA 3EDKA 1BP3B 1NCDL 3TURA 4L1HA 2GSIA 4LDLB 2O5YL 3UP1A 3R7QA 1QLEB 2PMZA 4F57L 1MCFA 4G8FB 1RK0B 1DSYA 1YN6B 5GRXG 4IS6B 2MCPH 3MO1B 4BZYA 1DFBL 1DEEB 5EOTB 1XWVA 3I3EA 3B2UC 2B1HH 1WBXB 3DIVA 4NQDA 5E08H 4TQPA 3QCVL 2Y1AA 3OKNA 3V4UH 2YBRB 5DQDH 2ZP8A 5J6GB 2XWEA 3BAEL 2Q6WA 5BS0B 5I15H 3LCYA 4GW5B 4Y4KC 3ESVF 5F21B 4BINA 5FCUL 3U48A 5ESVB 4QJ4B 1VZHA 4NI3A 2AGJL 3Q8BA 3WS3B 2ZX8A 2WUBH 2PO6C 5EC1B 3OWRA 4XCFH 1AMXA 3FTSA 4Y9BA 2BS8A 2Z8RA 4AG4H 1T2QH 5A2KH 1HE7A 1UA6L 1VCBC 5D9SA 1ZGLP 3WLWC 1Y18A 3CIQA 3KNBB 3FB8A 3J2PA 1ASPA 3NBNA 3TLRA 3WFHB 2CWRA 4RISL 3MNWA 2MTAA 1COBA 2EH8L 1U8CB 3UDWC 1MFAH 4N5EC 2QSCH 2WZPD 4HKJB 3HZYA 3DX6B 1HJCA 2VE6A 2IMMA 4XCNB 4J28A 4GAGH 4PH8A 4NJ9L 5EDXA 4HIHA 5HHPA 1PIFA 2ZG1A 1R3IL 5L2JA 4KNQA 2IWGA 2PLTA 2UZXB 4R7NB 3QJOA 1ZIAA 2W38A 4TUOB 4BXSV 2FATL 5JXAH 4QOKD 5B7EA 3SQOH 1ADQA 3JWNC 4L48A 3WKPA 2WYZA 4KI5E 1QNIA 4Z6AT 4WTQA 4ETQA 1A3LL 3V0VA 1QRNA 4B0MB 1JOIA 3SYPA 2EKSB 4JREB 1SXNA 3VRIB 1GH7A 1A4KA 4EZKA 3DECA 1OIOA 1QR4A 3CK0H 5D7IB 1JZ6A 1IBHA 1AYOA 2JH2A 4I0PD 5DR5H 1J5DA 2BFVH 1A2YA 2BNQB 3A47A 2O6PA 2AQ3A 3KYMA 4H20L 4F27A 5IFJB 5J11B 3PQYE 1BQ5A 3ZTCC 4QRRD 1S5HA 1E6JL 1OLLA 4D7BA 2XWBB 5JHAA 3TBTB 3FCUB 5D8JH 3LZOA 3S8WA 1GTNA 4OM1L 2FGZA 4GRWE 5LBVA 1WHOA 1FG2A 3HI5L 4G9DA 4NP9A 3UXFA 1IGMH 2FO4B 4JFTA 2W9EL 3M17B 2G2PA 2HH0H 1H5BC 2XG4B 4CSZA 1JWSA 3FT9A 4XVTL 4Z8FH 5D1XE 4DFHA 1NAML 2ZOTA 3ZSSA 4ZS7H 1T04B 1RV6X 5IREA 4NT6A 1X9QA 3S36X 5E8EB 3V5KB 1YEDA 1I1FA 1YQVL 2M26A 3MXWH 4K7FB 5T1DH 2NZ1A 1D5XA 1ZTXH 1V27A 1HINH 4LNVA 5GZND 3EDJA 4NQXA 2ZKYA 4C56A 4AYFA 4PLKD 2VSDA 2BZDA 1RXLA 2EDNA 5TF1H 4CVWA 3RWHA 3L81A 3KVPA 1WP6A 2B14A 2C9PA 5FKPA 4B9IA 3HZMA 1G6RA 3BCFA 4NQUA 5FYKH 5IMMB 3SE9H 4M7JL 2MHAA 3IJSA 1R47A 1P6AB 3VXUE 4EF3A 2F0CA 2H1PL 4WFEE 1KENL 2JJTC 5C0BD 1JZ3A 1Z2KA 3MA9H 2I7SA 2WQWA 3CVCA 1L5GB 5DRZA 4FQXD 3WO3B 1RD6A 5BQDA 4Y4KB 4MJ4A 1F6AA 3D2UD 4TSCH 4ZMVA 3KM1A 1A0QL 1BQLL 4UNUA 1NICA 3VI4F 1RIUL 1JWUA 4P5TD 1RZJL 2PO6B 3QJRB 2WXFA 3VW3L 1M05A 1WQVT 5EBWB 3REWA 2DM2A 4OGXL 1DYZA 2AQTA 3CHSA 2OKMA 2RHEA 3TNNB 5I24A 1MI5D 1RZKC 1E9PB 1NFDA 1BXVA 2XOTA 4EKJA 3VGDA 4BSWB 4HPOH 3OJMB 3JT0A 4IJ3C 3UL4A 3K81A 3QS2A 1X7SA 3N43F 3OKMA 2YXFA 2XIIA 3EJJX 3OX8B 4F93B 4JFPA 4LLQB 4ZO6A 5A3IC 5I18L 4GKZB 2ZXQA 3OKKB 4R4BA 3I2CH 1TPXC 3IXTA 1SJVA 2XZQL 3GZQA 2IPTL 1T03L 5D1XA 4XNYL 4F7CB 3U1SL 1NC2A 2E7BA 1NJ9A 1UHVA 4R26L 4X0KB 1G7MA 2ID5A 3GBMH 5BS0D 3U46B 2OP4L 2GKIA 3S5LA 1E9OB 1YHPA 1S3RA 5F93C 2J8UE 1HL5A 5IQLA 5I6OA