3WNIA

1.50 a resolution crystal structure of dioxygen bound copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic evidence for side-on dioxygen trapped on type 2 copper in copper-containing nitrite reductase
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 98
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wniA00
1SHWA 1AS7A 4KO5A 1ZDSA 1JZGA 1FFTB 1WA2X 4DP5X 1A8ZA 2VN3A 3CDZB 3X1FA 2H3XC 4YSUA 1FA4A 1R1CA 1IBYA 2GB2A 1OCRB 2GI0A 2FT6A 2AVFA 2AANA 1W6WA 3FU7B 2VSKB 1PCSA 2PCYA 1KGYE 1E5ZA 1A65A 3PAVA 1OF0A 1OCCB 1L9SA 2ZOOA 2YAMA 4F2EA 5B1KA 1AZRA 4DP1X 4YSCA 2EIKB 1L9OA 1GY2A 1AANA 4HHWA 4BWWA 4A2GA 1JVOA 3V9EA 3H4HA 1ZIBA 4HHGA 1OCOB 3OMNB 3WKQA 3CZUB 2YXWA 5A7EA 2PLTA 4E9YA 6PAZA 1BQRA 1KCWA 1BAWA 3CVDA 4P5RA 3NSFA 5E9NA 1A4BA 3NJMA 3ZIYA 4A68A 3U25A 4A66A 4DP2X 4CSPA 2BO0A 3JTBA 2OJ1A 1SFHA 4F7KA 2BW5A 1GY1A 3FSVA 1GR7A 1QNIA 2IAAC 3N55A 4YSRA 3AG1B 1AZCA 3C75A 1PLCA 1JZJA 2BP8A 7PCYA 2DYSB 4G70B 3NJLA 2VMJA 3EH3B 3PPSA 1E30A 5I5MA 3NSCA 2XVBA 2VSMB 1AG6A 1KV7A 3IEAA 3ZBMA 2XUWA 5I6NA 1HAWA 1KDIA 3H4FA 1AAJA 1AOZA 2CUAA 4YSOA 1ASOA 4K9JA 5F7BA 1V54B 3NJIA 4W9ZA 1ET8A 3QPKA 1F56A 4E9TA 1CYWA 3KW8A 2GBAA 1KYAA 4YSEA 2OV0A 1AACA 1JXGA 2FJSA 2XXGA 8PAZA 3FYEB 2IH9A 2DWTA 2IDFA 4DP8X 1IC0A 2BWDA 3AG3B 4GY4A 3NP3A 3ABLB 3AZUA 2Y1AA 2EIJB 3AG4B 4KNSA 2HZHA 3T6XA 1A3ZA 2GHZA 1KCBA 2IDUA 1WA1X 4ENZA 1WS8A 2ZWNA 3FU7A 1BQKA 3FU8A 3UACA 1OOWA 2IWFA 4JKNA 3FQ2A 1VLXA 2JFCA 2VW7A 4KO9A 2I7OA 1ASQA 3GYRA 1GW0A 3X2QB 3ZDWA 2XU9A 3FSWA 7PAZA 2LLNA 2B08A 2W88A 3ASOB 1JZHA 1GS7A 3SBPA 3NYKA 1AS6A 1BXVA 2JKWA 2WO3B 4N8UA 3TU6A 5I6MA 2IDQA 2TSBA 4A2HA 4BDVB 3FU9A 1GS8A 2GC7C 1XB3A 2I7SA 2QPEB 2TSAA 2QDWA 1ET5A 2W8CA 2ZXWB 1JXFA 3NP4A 2J57A 4A2FA 1UATA 1QLEB 3FQ1A 1W8EA 5I26A 3L45A 2CJ3A 1NINA 1DZ0A 1NDTA 1ZDQA 2EINB 1J5DA 3FQYA 1PZCA 1OCZB 4A2EA 1NICA 2X88A 4DP4X 1AZBA 4GP8B 4CSZA 3ASNB 1MZYA 4PCYA 2X87A 4TXVB 2IDSA 1NIEA 1SF5A 1J9QA 2HXAA 2XX1A 5B7MA 4UANA 1NIBA 2DV6A 3S8FB 2VM4A 3X1GA 4YVNA 4QKTA 2J55A 4X4KA 3G5WA 3QJUB 3QJVB 1SJMA 2R7EA 3T6WA 4E9XA 2Q5BA 2P80A 3AY2A 5EHFA 3PAUA 1A4CA 2A3TA 3TBBA 1M9WA 4BWUA 1IKOP 2BZ7A 2PP7A 4MFHA 3S3CB 4G7SB 1GS6X 1V10A 3EF4A 3ABMB 1AQ8A 3S3BB 4YSPA 3NJKA 3CVBA 1AS8A 1RZPA 3OD3A 2GSMB 1BYPA 5B1JA 1HAUA 3UGEA 5B7EA 2QPDB 4DPAX 1MZZA 1NPNA 4YSQA 2BP0B 2Q9OA 4BDVA 1FWXA 1ET7A 1E5YA 1L9TA 1NIAA 2QDVA 4HIPA 2HRHA 4YSTA 4G72B 5AKRA 5FC9A 1XB6A 1PMYA 4E9QA 5I6LA 1GYCA 4M3HA 3UAAA 2HRGA 3TASA 3QQXA 2B3IA 5IY5B 1JZIA 3FSZA 2FQEA 2PP9A 4G7QB 4AKQA 4GXFA 3X1BA 1AZNA 1JERA 4AKPA 4HALA 4BXSV 1EZLA 4G7RB 3QJSB 2YQBA 4NB7A 1ZV2A 4HAKA 4DP9X 1WS7A 3GDCA 4EF3A 2QT6A 1IUZA 2FNWA 3UADA 2BHFA 1NWOA 3QJTB 1YLBB 1ILSA 1L9QA 4DP6X 3BQVA 4AZUA 1GSKA 4NAJA 1AG0A 2R7EB 3FT0A 4HZ1A 5F7AA 3V9CA 3NJNA 2DY2A 2GIMA 1NTDA 2YAEA 2HX8A 2CCWA 4UAHA 3HEIB 1PF3A 2BZCA 2UX7A 5D4IA 2UXGA 4HCIA 3EH4B 3GXUB 1W6LA 2XV2A 1SFDA 2UXTA 3EH5B 1JOIA 3FPYA 2OCCB 1TEFA 2E86A 1ILUA 2HLEB 2BP8B 3DTUB 2VW4A 1HFUA 3OMIB 2I85A 1ASPA 1NIFA 2H47C 2FQFA 4KOBA 5PAZA 3OM3B 5ANHA 2XWZA 1MG2C 3WI9A 1NIDA 5I28A 4P5SA 2PP8A 1DYZA 4Q89A 2EIMB 1ETJA 1BXUA 2WSDA 3FYIB 3NT0A 4KO7A 1M57B 2XV0A 1QHQA 1V55B 3CDZA 2HX7A 1J5CA 1L9RA 1SDDA 4KNUA 4DP7X 2P80D 5D4JA 1SNRA 4DP0X 4YSSA 3WG7B 3SBRA 1ZIAA 3S8GB 2AFNA 2YAHA 3IE9A 5AZUA 3IN2A 2WO2B 1J9SA 2FT8A 2MTAA 1N70A 4HCFA 4BWTA 2GC4C 4AKOA 2Y69B 2XLLA 1XMEB 5I5IA 1OE2A 4A67A 1I53A 2UXFA 1NWPA 2CAKA 3RYMA 3NSDA 4JHVA 5B7FA 2YARA 1CUOA 3D12B 3PXLA 2IDTA 4RH4A 1AR1B 4QLWA 4ZK8A 2CBPA 1AZUA 1MDAA 2YAQA 3X1NA 5PCYA 2FQGA 3T6ZA 2BP0A 1EHKB 1JZFA 1OE3A 2XV3A 1SF3A 4YL4A 1BQ5A 3NJJA 1KDJA 4AI7A 4KNTA 4YVUA 1WAEA 1XB8A 3FS9A 3MX0B 3WNJA 2PPDA 1PZAA 1N68A 1BXAA 1CURA 2BW4A 1E65A 1AIZA 4JHUA 3SQRA 5I6KA 4E9RA 1OE1A 2AZUA 2CALA 2MRYA 3UAEA 5B1AB 3DIVA 2VM3A 4FAAB 4G71B 1BYOA 2RACA 2XXFA 4PAZA 4NERA 4L0PB 1RKRA 3IN0A 1CC3A 1M56B 3PLYA 1RCYA 3WIAA 1B3IA 1PZBA 5TK4A 3WNIA 2J56A 4HCGA 3OMAB 2XYBA 2PCFA 4YSAA 3T71A 4DPCX 4WKXA 1PNCA 2H5UA 5B1BB 3ABGA 2PPAA 3AW5A 3ERXA 2BWIA 1URIA 2DYRB 2PPFA 2IH8A 3WKPA 3NJHA 4DPBX 3BVDB 1L9PA 2ZONA 3IBOA 1PY0A 1BEXA 2NRDA 3OQRA 1NZRA 3CVCA 3ZX1A 2DWSA 3S3DB 5I6PA 2FWLB 1TEGA 4GP5B 2PPCA 1NPJA 2IWEA 2XX0A 2YXVA 1T5KA 2AZAA 4E9SA 1X9UA 3DKHA 1ID2A 2FQDA 3T9WA 1PLAA 3UABA 3X1EA 3NSYA 1ZPUA 1OV8A 1KBWA 3H56A 4UF7C 5I6OA 2JXMA 2UXVA 4KO6A 4F2FA 4KOCA 3TA4D 2IWKA 2PPEA 5D4HA 3TBCA 3JT2A 3NJFA 2J5WA 1SDDB 1ADWA 2VW6A 1TU2A 3QJQB 1RZQA 4N4YB 2UX6A 3ABKB 1TKWA 4AX3A 1A4AA 1PLBA 3N2JA 3EHBB 4Q8BA 1J9RA 3T6VA 5B3SB 5B1JC 2YAPA 3PAZA 3KW7A 1MG3C 1JVLA 2YAOA 4FA7B 1JXDA 1PAZA 3PCYA 4GP4B 1X9RA 4GYBA 4E9WA 5LDUA 1SHXA 4M4RB 6PCYA 2EILB 3MBWB 3FSAA 4BXVA 1IBZA 3QJRB 1WA0X 5TK2A 4A2DA 9PCYA 3NJGA 4YSDA 2FTAA 2YAFA 2N0MA 3AG2B 2HX9A 2FT7A 5I5JA 3CG8A 4E9VA 3HB3B 1E67A 5AFAA 1JZEA 1CYXA 3SBQA 1J9TA 4WTQA 1KBVA 4W1TA 4BK5C 3FPXA 1PNDA
chains in the Genus database with same CATH superfamily
1ZA6B 4NKOB 4M1DH 4OM0H 1PYWB 3MSPA 4NN5C 3A3YB 4NCC2 4R83A 5DD3H 5CFHA 2VRQA 1DFXA 2AEQH 2Y2TA 1Z0NA 4MAYD 1WZMA 4FULA 2WZPA 1JUFA 1ZVHA 5CKAA 1MFEH 1HHJA 5DURB 6CGTA 3VI3A 4GBXD 1ZTMA 1QSFD 4H8UA 5GRWA 2FVNA 4P5TA 1KGYE 5ITBH 2VO8A 1T7ZA 4OCWH 5CN2A 1U3YA 2FHFA 1MCFA 1O75A 5AVUB 5AD0A 5ERWB 4TPRL 2ZOOA 2C3VA 2KPWA 2KHAA 4ZO9A 1D5MB 4FJ6A 4XP9L 2WZPD 4ODXB 4OLEA 1T6VN 4KTDL 2MIZA 1L9OA 3RWJA 2G0KA 1GY2A 1ZS8A 2Y7MA 4EIGB 4LNVA 3O9WC 2Y4SA 1F4WH 2CIKA 3VXTB 1F4XL 3MOAL 2WTRA 4BH8B 3S98A 5ESAB 2LVCA 3FO2B 1H8OA 2VLJA 4ZTOL 1CFSB 4AIXA 1QI5A 5LXGL 2VO5A 3K6SA 1KCWA 3B5TA 2VDOH 2F53B 3FQNB 3QQ9D 1A4BA 3VYPA 4F1SA 1RZFL 4NQSB 3QNXB 1VDGA 3M17A 2P42B 2G60H 4L3CA 4NM4H 5DUBA 5DUML 1EZUA 4F7KA 4Z3JA 2FAUA 4PGZA 3PL6C 5KS9B 2V7NB 4HJ1A 2VR8A 5DZNA 3SPVA 3FQ4A 3MRKB 1MAMH 1AMXA 2OM5A 4LCYB 3VXTA 2FCBA 1QSVA 3K2IA 1PDKB 5D7JA 3NSCA 3HR6A 2GPZA 3BIKB 2JJWA 3OAYH 1TLMA 1JVKA 1B0RB 3IYLW 3WJJC 4Y5YC 1DE4A 4POZD 1Q9KA 4IJ3C 5H2BA 1GYVA 2GHWB 1IGJB 1SXAA 3MV8D 3UBXB 2AI0H 5F7BA 2G30A 2XTJC 3QQ3B 3HS0B 3II2A 5AKTA 4PJ9B 2A1WH 1MF2L 1DVUA 2QPSA 1BD2D 4UNUA 1RIUH 3A0OA 2VR9A 2QSCH 3MCLH 1Z5HA 3CZGA 1E2ZA 1E8WA 1MRFL 1JXGA 4XXWA 4ESKA 1NL0H 4GMSL 1NKRA 1G7PB 4PWGA 2F8VA 1OSYA 4R4NC 5E1GA 3QWOA 1EZSA 1HINH 1VGEL 5BPPA 1JCVA 5ISZD 1NC4D 2ZSVA 4PVLA 5AAMC 3MN8A 4I5BA 4RA0C 2EDYA 3FCGA 2E46A 1DO5A 2ZWNA 5CEYA 2NY0D 5IJDC 5A3ID 3SDYL 3W11C 5CZVL 4HCRL 1VLXA 1JP5A 3BUTA 2VW7A 4KI5F 2GEQA 5DVMA 1KMGA 4X6CA 2VXTL 2DZEA 4XMVA 5IROC 4DW2H 5LVEA 5F89B 1UACL 4XT1C 4FQLL 4AY0A 4NI6A 4IOSD 4MRBA 5BXFA 4PRHA 4X8JB 1M4KA 4HWBH 4XCEB 2VISB 1UCBL 1Y0LA 3GXFA 1KGIA 3H3PL 4Q56A 5I8OL 5FYKD 1IU1A 2OJEB 4ODBD 4WI7A 4Y4KC 2RFXA 3T0EB 4RBPK 3MV9B 2PWHA 3TN0B 4NC1C 3VXRB 4PRAB 1EAOA 3IFPB 3R8QA 2GC7C 1V3MA 1YY9D 5DD5L 5F7WC 1JXFA 1H3GA 1UD6A 1YECH 2TSAA 3DJTA 3FB8B 3G7TA 2EDWA 3NACL 1HU8A 3EHBC 4Q52A 2H9GB 4X9GA 3UX9B 2FDBP 4Z7WB 4GQRA 3IJEB 2JKXA 5KVDL 1OSPH 1TQBB 1DVSA 2Y7QB 2D8KA 1I8MA 4YNYA 5IGXH 4JO5A 2HCZX 4ODXA 3U30C 3UZEA 3N42B 1R3JA 3QDJA 5AQ0A 3PRZA 2DF3A 4QPEA 5TJWK 2B1OA 2R4SH 3T3PE 4R26H 2KYIA 3ZKQD 4G8FB 1NIBA 3IBEA 3BAJA 2X4UB 4JFYA 2XBTA 3WIHA 2QFRA 1T03L 3T0VA 1MJUH 1TNMA 2LQRA 2XWBB 3GLDA 1UT2A 4OI7A 3QDGA 4XOEA 4LBEA 1WWWX 4RAVB 1S5IH 5DR5L 2WZAA 2AJYH 1I8LA 1IEHA 1UXMA 2BVOB 2BJMH 3E9UA 4MQXD 2XACC 2I25N 1LD9A 5DLLA 2V4LA 1U8CA 3DXAA 2AQTA 1FHNA 3ABMB 2CO7A 1C5CH 3BLBA 1N8ZA 5DJ2B 3NJKA 1TCRB 1BD2A 2EH7L 2Y9RT 4NWTH 2WYIA 5JHAA 4EDXB 1FZJB 1WAAF 3TBSB 1I3RA 3NUKA 3Q8EA 4LRIC 4AGNA 2MKLC 5K9OA 4OB5L 1P7BA 5DZ9A 3SYQA 3HG4A 3I74A 4KK8C 1UH4A 3TCXA 2NX5A 3GSWB 5TPWH 3QORC 3RWFA 4J3UA 3DXAD 4PLJD 4XP1H 2H6UA 1WFUA 1YY9C 1LEGA 2FD6H 4UB0L 1CD1B 5I18L 1P5UC 3KDMB 1LGVA 3JWNH 1HQRA 3SE3A 3ZLQC 2C7UB 1ZGLP 4WHYH 3ZQWA 1IAKA 2CDGA 3V4PB 3QYNA 3DNKA 4A39A 1LNUA 4HALA 4MJID 4M6NH 2VJ0A 4XI5D 3OZKA 4XPBH 4Q6YA 1F1AA 2IH1B 5JHBA 1BSIA 3JBG7 4JGUA 4G5ZH 4P9HH 3T04D 4PRHD 4GKZB 1I7RA 1JDAA 4HZ1A 5EF2A 3ES6A 4OGYH 1EFXB 2Z92A 4XMUA 2CCWA 4OF3A 4XN2A 1GYWA 4GQPH 4AEEA 4U6XA 2OMVA 4EKXA 5EU4A 2DLTA 3HN5A 1MIEH 2NW3A 3PGDA 4U1SB 1FYTB 3H3BC 3GMRB 5EU6B 1ILUA 1IFRA 1Q0EA 2XWTA 4MZ2A 2FWOA 5HGDA 3C08L 3OMIB 2OQJB 4FYQA 1W0WB 1TQCC 4PGEB 4HKJA 4C4KT 1RULH 3M1OA 2YKLL 5FA3B 3QJHA 5T3XL 2EYTB 4NZDA 2MPAH 2VL5B 2ILLA 2IQ9L 5IB5A 2ENYA 1J1OL 3FYIB 4FNRA 5K33A 4Q7DA 1BFSA 1KELH 5DJAA 1TPXB 1LVEA 3G6JA 1HOEA 1L9RA 2BVQB 3JWNG 3T2NH 1J5CA 4DP7X 1S7TB 1YPZB 5FA4B 1WUZA 4F9LA 3W5NA 1KF9B 4D9RE 1MVUA 3BW9A 4DGVH 4Q9RL 3GMRA 2NY5C 4O00A 5KVEL 1AD0B 4FQXD 3N0AA 1FI8C 1TQBC 1U3HC 3QDME 4I18A 5IW3A 5HBBA 3TURA 4ONFH 1F3DH 3SKJL 2DMCA 1IRAY 4MNGE 2FRGP 2P8PB 5FA3A 3RVUC 2CH8A 1G9ML 4LPUA 5B7FA 5D7LB 4L4VD 5E6RB 3VXUB 3MBWA 2IBBA 1KC5L 12E8H 5JUEL 3P0YL 1P4BL 4PWJA 5C0JA 3WFEH 1NCAH 2GIXA 4MQ7A 4WI4A 3ZE1F 4P2QD 5MP6H 2VXQA 4X4XB 5GZND 5IMOA 4EE2A 4HEPG 4L4TE 1CL7I 4NRXA 1BF8A 1YJDH 4G7YH 3L1OL 5EUOA 3NJJA 4F93B 2EDEA 3I9GL 4M7ZB 3KAAA 1DO6A 5DS1A 1GGBH 4NDMB 2N7BA 1TQUA 3P30L 4G5AA 1AQMA 1IGJA 4G11A 3UJTL 4H4NA 3RWDB 5IIEB 4PGJA 3NFNA 4JFOB 2AZUA 3VRLE 2AEOA 1CMOA 4OZ4B 2F7PA 4KQ3L 2BNUA 3MCKA 4LDEB 4L8SA 3AABA 2EKSB 1A3LL 2X9YA 3GSXB 3H2QA 3WEOA 3VCLA 1RCYA 3WLWD 1CXFA 1KEML 1L6ZA 2GBUA 4I1PA 4RSVA 1KB5H 3BMWA 4L4JA 3V4PL 5T1MB 1PZ5B 4QRSA 4Y88A 1MJ7H 5I23A 2PPAA 4WWNA 5FFOA 2BWIA 3PS6A 3REVA 4UYQA 3FQTA 5TQ0L 1IBHA 2CQVA 4ZFZB 1W2KT 2DQJH 2R51A 3TNNB 1L9PA 2V2WA 4AVKA 3WY4A 3KJ6L 5AAMA 5A6LA 1HL4A 2H7WA 2WKOA 3N1QC 3RRQA 4Z7VA 4JFUA 3NCBB 3L16A 3US1A 2PPCA 4M8QA 3PWLB 5DJYB 2F8OA 1FL6A 4WFFE 5D93B 4JRXA 5F6HI 4MBOA 3FU6A 1F97A 3VI4B 1MY5A 3CFUA 2CDFA 5AZEL 2R2BA 1THCA 1U91A 1S78C 4Y2DC 5D1QD 1MW1A 1UVQA 3GNMH 4B96A 4DGIL 2A6IB 5AWNL 5E8OB 5FCUL 2F1EA 2DW5A 4ALAH 5IB3B 2R69H 4PJ8D 4FI8A 3HE7D 1H3XA 4JFDA 3L4XA 2YAOA 1E4KA 3U4AA 3SGJA 4XMWA 1RURH 5CF3A 1YC7A 4GYBA 3MJ8A 3VFVB 3C6SA 4UTBL 4DSYA 3RJDA 4MCYB 1FNFA 2ZD0A 2R0WL 3UO1H 4I4WB 3JVGC 2NY2D 2NXYD 1B0WA 4NKMA 4N90D 3CFDB 2YD6A 3FCBA 4PRPA 4NJAH 4WK4B 4M48L 4XVUC 4YHPB 5DHXB 4C56B 2CNZA 4Y2OA 4C56E 3D34A 1QAWA 2K3TA 5DMYA 3NCFB 4APQB 1A6TA 5FF6B 1J9TA 4AUUA 5EEYA 3TPKA 5GS1A 3BUDA 5CU5A 2ENQA 1EBAA 1JMXA 4AL8L 2V5YA 1JZGA 4GUQA 2NMSA 2BVPB 4LASL 4DP5X 5KYUB 2VN3A 1NCTA 4WFEE 4V2CB 4NWUH 1HH9A 1R3HB 1FA4A 5C0IA 1YEHH 3ETTA 4LGRB 2AVFA 5EF1A 4DAGL 5K9QI 1QTYT 2VSKB 4G8EB 1S78D 4FG2A 1JPSH 2GUOB 4HZAA 1MFBH 3F58H 4HOZA 25C8L 4UQ9A 3P54A 2FYYB 4M62H 4EI5C 1BAFL 4MA8H 3SBWA 4F2EA 2BLFA 3IS0X 2IEPA 1AE6H 1N8OE 2RJMA 4CU6A 4Y4HD 3PWVA 3HB3D 1LO5B 4LE8A 3JTTB 2W80C 3C5ZA 3LNIA 3E7JA 4P5MA 4F2MA 3QIBB 3MLSH 3CSTA 4JHAH 4HHWA 3ULVD 2DQDH 3CV5A 1VERA 3JV6B 1LWHA 4LVNB 3LIZA 4F33A 1EEZA 1GZQB 3MV8B 1DVZA 3ZYZA 2W60B 1QPKA 4KTDH 3BYYA 4YHIA 3H9HA 1KGJA 5F9WB 1FYHB 4KUZH 5E1AA 2DQTL 2NR6D 1YUHB 3CX5J 1I1YA 4JPWH 3FB5B 2Y7OA 3U25A 1WCBB 2VT0A 3DX7B 1KNOA 1U58A 4B9IA 5D96B 5FUCE 4CU8A 2HJKA 4ETYA 7FABL 2BW5A 1HK6A 3WFZA 2Z93B 5CLZA 4KDTC 1H6FA 3MRJB 3CH8A 3F8UB 2DYSB 4I2XE 4I77L 4RGND 3FOMB 1P0SE 1UC6A 3AXLB 2VLME 4OJYA 4BFRA 4TNWF 5ICYB 5F7DB 4JFPA 4LCIH 5CSGA 3DMMC 3QPQD 1BAFH 4MA8L 4FQCH 1NBCA 2M83A 3ABZA 1XR9A 5F9DC 3UTSD 5LKNA 1M6OA 3ZY7A 4KRLB 1ZSDB 2O5YL 3FW6A 3IGAA 5AL8A 3VW3H 1WAAE 4NP4H 1H5BC 2NZ9C 3SQOL 1G1OA 5MEPA 1BQLL 1C8PA 3DXAB 4JFQA 3E6FB 4FQXA 3MXVL 4N2DA 3TBVB 2EC8A 3LDBB 3WE6B 4PJGF 5DTFA 4ETQA 1LM8V 3IETB 1QBAA 2JTDA 4JFZH 1TTAA 3CU1A 4GW5A 1HT6A 1ZOXA 3UTSA 4PUBH 3I2CH 2COQA 3PHSA 5FUOL 4FXKB 1T89A 1TVBB 1Z9MA 3IDMA 3MROA 2IWGA 3DROA 3GJEA 5T3XH 5ECGA 3DRQB 5JPNA 2I27N 2Y2WA 2X28A 2XBDA 4NKOA 3D4GA 1YC8A 1MCJA 3HG1D 3KDMA 1T0PB 4JMNA 4MA3A 2FHCA 3LB6C 1E3ZA 2PR9A 5F88A 4J1UB 4R90H 1J8HD 4QWWC 1YUKB 5C3TA 5MI0B 2HT4C 1MRCH 2SODB 4Q0XL 4PH8A 1DBKH 1NCWH 4W70A 5E6SB 2I9TA 1ZWIA 3QB7C 2GIYA 1TVHB 5IREA 3RUGA 1E4XL 5AD0B 3UAJC 2WLMA 3MNMA 2C5DC 4QXGL 4UTAL 1CIDA 4B0MB 3REWA 1N2RB 3FSWA 4XN1A 3VXSB 5IOKA 1KV3A 2KLRA 5DYOA 2XYCA 2LLNA 7PAZA 2WAHA 1XGZA 3F64A 1FUNA 3UPAA 4X6EA 1Y1DA 5DK2B 4JM2D 3K0WA 1HNFA 1AS6A 1S3KL 3F7QA 2V5SA 2AJXL 3TU6A 2QVFB 2ADJB 5C7XH 1B4JL 1KCUH 1RZJL 2UY6B 5AALA 1E5CA 1EMTL 3TN0D 2AEWA 3ML8A 4NPKA 4EOWH 4IRJA 4ABUA 4RFEB 1BOGB 3MRRA 1AO7B 4IKJA 2WTPA 2VOTA 3UZVB 3H0TB 5FO2A 3RLSA 3L2LA 3D4YA 1W0WA 4JKMA 1NCAL 4WU7B 3K6DA 4ZPTB 2OK0H 3P4MA 1QVOA 4A2EA 2CLRB 5E8PB 3J27A 1RUQH 1KENH 1LHZA 4GP8B 5GHWH 2XPYA 2ISDA 5FDWA 4TXVB 1VKXB 2X09A 1NBZA 4YXKH 1WBZA 3I6KA 4NIYE 3UG4A 3TJHC 5TQ0H 3V4VA 4FGMA 4BEIA 1NGPL 1BF2A 2X05A 3C08H 4ZSOB 4QKTA 3EO1A 4JFFA 3B9KD 3U36A 5D9SB 1IJNA 3U7YL 2W07A 2FLMA 1I1AB 4DN4H 1OPOA 2P80A 1QLRB 1QUPA 4IIZA 1KB5L 2XOTA 4HPHA 3F00A 4QEGA 1O7DC 1B0IA 3V6OA 3F7PC 2UZXB 1JPTH 3QUMA 5TF1L 5FO8B 1E7UA 1MJUL 2IAMD 3KWWA 3T08A 4WNQA 2OMNA 4H8WH 1GC1L 1SN0A 4ZT1A 2ED9A 4XNZB 2F08A 1I9IL 3O2DA 3AWGA 1UA3A 4AC2A 4DUXA 4JO8A 4KI1A 4JCLA 1R0AH 2ICWJ 2Q9OA 4LPXA 1H15A 3VTTA 4WEMB 1JV5A 4NQEB 3ATFA 4X5RA 4Y2DA 5ILTL 1E7VA 3EDFA 5ACMA 2XZZA 3C60A 3FB6B 5HD8D 2HRGA 4DFIA 3AY4A 1JZIA 1YECL 4P9MH 5HHOA 3IPFA 2BP5M 1WHPA 1KELL 4W68A 4QF1B 3L3IB 5D5MA 3T1WA 2YQBA 1BOYA 1T21B 3T8XA 1IUZA 5I5RA 2FNWA 3MGTB 4PGCB 5IBTH 1U8OB 2N1KA 1FQ9C 4WKZB 1L9QA 3NCXA 4NS0A 1BZQK 3WIIH 3LH2H 3NA9L 1O9ZA 3FTXA 4DW2L 4ZS7L 3FZUC 3MROB 4OFPA 1XR8A 1E6JL 3FB7B 4MA1C 1G4MA 4XPBL 3CZNA 4HOMA 4JPIA 2XFGB 4N5EC 5DGRA 1G5GA 4KMTL 2JV6A 3EFDL 1PF3A 5TE4H 2UX7A 3A6BL 5DHDA 4A7UA 5JW3H 1XQ4A 3B2PA 1JK8B 4TQIA 5D1QC 4GQ9H 1BMZA 3N6YA 5FK9B 3T2NL 1SXNA 3AS1A 3BP6A 2GSIB 2K45A 1EVUA 4HGKC 4XNAA 3HZ3A 1KTRL 1NBYB 1CLVA 3DO3A 4HP5A 3HAEH 4POZC 1ASPA 5IMLB 3IMTA 2FQFA 3LRSB 3BVWA 4DKEL 5CCJA 3HPLB 1K9TA 3OM3B 1AGDB 5GSRA 4AXWB 1SUHA 3QPXH 2YLHA 1U93A 3T0EE 2Y2YA 3PL6A 5GSVB 2XWZA 5F7YC 1SHSA 1BZEA 5EU3A 1NCCL 1UA7A 1L7TH 2WOBA 3ZDXE 1DYZA 1NGZA 3ZYOA 1RIUL 4ZFFB 3UL4A 2UYLB 1ETJA 2A9DA 4KO7A 4KROB 3B9VA 1W16A 2X53A 1NDGB 2HX7A 2PO6C 4Z76A 3LXCA 4DKFH 3MYJA 5G5DA 3QRFM 4A6YA 2VXVH 3ARGD 4FFYL 1GZQA 3MV8A 1HILB 3LXUX 1ZLSH 2QADC 4JQVA 4CN1A 1LYQA 5HPMA 5DZOA 4QWWD 1BIIA 4P5KB 2CHWA 2DQTH 3A67L 3K2MC 3F6IA 5E5UB 5IB1A 5KJ7E 2V2TA 1UKSA 3KYOA 2V3FA 1U8JA 1GAFH 1QYGL 4LSVL 2FR4A 2BVOA 1RY7B 3VSUA 4RMUA 2QADB 1CFVH 4PJGE 4HVBA 1KFAH 2CAKA 3PWPA 4HQQL 4OIIH 4IMKA 1YEEH 4NQDA 1SPDA 1QR1B 2IGFL 2Z93A 5BW7C 1JF1A 1KFGA 5KOMC 1FHGA 4R3SB 4S2SA 1KWGA 5T1LA 1HSBA 1D5XA 4WHDA 5KSAD 4P4KC 3FCSA 3MLXL 3EO1B 3NACH 4HF5L 5J13C 1KLFB 2NDFA 4LCCA 5FLUA 3BKJH 5I18H 5IW1A 3U83A 2Y3NA 1U8NB 4Y2LA 5DT1L 1XB8A 3MV7A 4OCNC 3V6FB 4X4YA 4W6XB 1MI5B 4DN3L 2WQAA 3HG1E 5GS1B 3STLB 2QMKA 1TOXA 4IHOA 5CGTA 5E1HB 1SJEA 4N8CL 5C6TH 3EGXB 3PV6A 4JG1H 4NO3A 3LVTA 4XX1E 1AFVH 1BYOA 4PAZA 3IDNA 5CFAA 1AZVA 3Q5YA 3GMOA 1EVTC 2VXQH 3S6CA 2CRZA 2ZOUA 1FORL 2J43A 2YD4A 4E41A 1ONQB 1H15B 3CDGA 1ZY9A 3H7LA 3KDPB 3DX6B 3FT1A 5KS9E 4AV5A 3CN3A 2AJSH 3MA7B 2WVVA 4MCZB 2JLLA 5BV7H 1B2YA 3GSUA 4DPCX 4LSUH 5B8CC 1YCSA 1QBMH 3ABGA 3HB3C 5EO0B 2HTKD 3O6KL 3U9PH 4NBZB 5CJBA 5ANMA 2W65A 3LNDA 1KGXA 2IAMC 3QIUA 1IKNC 3EO9L 3ZE1B 4APQD 1ES0A 1U8KB 2ICWI 3HTLX 1NAKL 3HI6H 5KW9L 4HCRH 4KROC 1IC1A 1TEGA 2QQKL 5LNGA 5IJKC 3O0RH 4U33A 4Y4HC 2A6DA 4E9SA 5FKAA 5CLWA 3EF7A 1RZ8A 2X38A 4MA7H 4LLUB 4DVRL 2QGEA 1FE8L 2F7QA 2EDHA 5EEZA 4MLSA 2PPEA 4HJIA 2K8MA 1GJWA 2DI9A 3Q8FA 2DJMA 2DM3A 4RDQG 1GRWA 4A38A 2O26U 2IC2A 2ZUUA 3GK8L 4GINA 1KJ2L 5CCGE 2AV1A 3DDFA 3BO8A 3MCLL 5IOPB 2VLKA 2D73A 2VE6A 3PAZA 3WXWH 2BNRD 3APFA 1KN2H 1IAIL 3S3PA 3V5HA 1NC2B 5E4AA 1KXTB 4J3OC 4F57H 6TAAA 1TENA 3FU0A 1LO2L 35C8H 1NUFA 4YLBA 2ZOLA 3MUGB 3FSAA 4PI0A 1CDYA 3KYNB 1DVFD 3ATEA 4B9PA 5GS0H 1IEBA 2WNWA 3M86A 4AEIH 5IQ7L 2NY3C 2EXYC 2FTAA 2K9FB 4YE4L 3G6JE 1FG2B 5HPMB 1I1AA 3LYRA 5I2IB 2OCFD 1KBVA 3M88A 2XG5B 1HCYA 3MLZH 4NKIL 3RQ3A 3HRZA 2AK4B 5EU6D 1AS7A 2NR6C 1IM9D 3EDJA 3MXWH 2ZWSA 3CC1A 3MX0A 2VABB 4G59C 1WA2X 3AM8A 3QXAB 1LK2B 1KLGA 2XKSA 4JQVC 3RAJH 1ACYH 1UEYA 2CG9X 3ZRFC 4S0HA 2WXFA 2H32A 4HLJA 4LLMB 4ZXBB 1GCFA 3P0VL 3MI6A 3P11L 1ZLWH 3OAZK 3RPKA 3NJXA 1CWVA 4NNYA 4C59B 3QHFL 1IZJA 1E28B 4MJ6A 4XNMB 1D6VH 4K9EC 4DN4L 3TIDA 3CQQA 1MQ8A 4Q6KA 5L2KB 2Q3AA 1YEFH 5FYKE 4DCQB 2P4AB 3I3EA 4N8PA 4BQCA 5T5NG 4QRPB 4XWGL 5T1DH 3D3VD 4Z3EA 3UGXA 3CIQA 2P5EA 1TZGH 4KKNA 3VRJA 1X3DA 3U82B 1SXCA 3A4DA 2OX5B 3PJLA 1QLFA 3D0AA 3UROR 2DQJL 3UTOA 1JVOA 3RB5A 3L3HA 3QXTA 3OPUA 5L7XH 1IO4C 1COBA 3K1KC 3GEWB 4QOKE 4XWGH 5CEZH 3O2DL 2J1KA 4PJBB 4WFHE 4FA6A 4R8WH 3GPEA 2V33A 2EDRA 1PY9A 4BFOA 4M43L 5HYJD 4QRQB 1BAWA 1FVCB 2DH2A 3CVDA 4HXBH 1HDMB 1N5YL 2VR7A 2A0LC 2YJQA 1AR1D 4DP2X 5KUKA 1T66C 2ODHA 4P2OD 5CGMA 3LZFL 5CS7A 4IRSA 4QI3A 1UZ6F 3BH4A 5GS2D 4P2YA 4ZTPH 3ILQD 4IBQA 7PCYA 2HT4D 3PPSA 1RIHL 3CBJB 4PCSA 4UNIA 1WF5A 5C2BL 4Q14A 1AG6A 3S96B 2F53E 2ENSA 3I9AA 3MUHL 1M7XA 1G9NC 4QHUB 4RA3A 4M6OH 1KNOB 2RBLA 3RIKA 3LN5B 3QDGE 1X5MA 5GGRA 5IBUG 2DBJA 4KRPD 3GM8A 2YPLD 4M61A 1IGIL 3UJIL 3EOTH 2Z31B 5FO8A 4CJ0A 5KYXB 4W9GC 1N0LB 4ZS6C 3PP3K 4HUMB 4PREA 5DQJA 1WH0A 1NGPH 4E9TA 1Z2KA 2XC8A 3PABB 4HWBA 5FHBL 5I1HL 1MHPL 1KXHA 3ALPA 1EERB 5AVVB 2GBAA 2ZOTA 4AGOA 5JHDD 5K9JH 3V6OC 1OB1B 2BSSA 5L4JA 5KSBA 3S96A 3L1FA 2UWEE 4QHUA 1RJZA 1WYJA 1OF2B 2VE6B 2F53A 3FQNA 4K7PY 3GK8H 3WTXA 4H1LA 3LTVA 1HQ4A 2V37A 3ZHDA 5KYUA 1JF5A 3ET9F 2A0LD 4H2CA 3BH8B 5EB9A 4MD0B 4C47A 4HWEH 2ZX8A 5CD3A 2ZXAA 1RK0B 4P5TB 2V7NA 2MNWA 5I0XA 3QQ4A 1I4FB 5E2UL 1BQKA 3ZE0B 3DO7B 4LCYA 3GIZH 3P02A 4JKNA 2KC0A 3NK3A 2HG5A 2F19L 3DTXB 1D3CA 1WP6A 4HIHB 3ZDWA 2R8SL 2MNJB 2NY4B 2YWZA 2OL3L 2VLRB 2K3HA 1SEQH 1X5ZA 5GS3A 3VFTB 3O3DA 4JQXA 3VXSD 1GS7A 4OZHA 2WKOF 4Z7VF 4P2CG 4X5XB 4Y4HA 5IHUL 4GNKB 3KPSE 1YEFL 3HMXA 1S7RA 3AADB 4G9FD 2IO5A 5BOZG 3MR9B 5EBWA 1QSFE 3EFOB 5L9DL 5T3ZL 3UTTB 4BZ1L 3OKDB 1IC7H 1F11A 3BFQG 4NKDA 1WTLA 4P46D 4X4MA 4A2FA 5D96C 1MY7A 4AQ8C 3LMJH 4Y5XA 5I26A 1R34A 5J12B 1FF5A 1VESA 1NDTA 2CLZB 5EBLA 3P0VH 4XNMA 3MA7A 3Q8BA 3FQYA 4YBHA 3BZDA 1JV2A 2WLYA 4B53A 5GSVA 1UH3A 2EYRA 4DP4X 3HS9A 2OJZH 1G1YA 3OKYA 3PWPE 4M93C 4MXVF 4BKLB 2IG2H 3IJYA 5F9WC 3I2CL 5FUOH 3L1GA 3W81A 2KMWA 4X9YA 3VRJB 5BMFL 3MLTA 2D3JA 1WC7B 2EZ0C 4Z76B 3GRWH 5KEZA 3MDJA 1ZEAL 4XBPB 2XIIA 2HPOA 3UP6A 4K5PA 1E6OL 2C4FU 2WUBH 1E4XI 3CFCL 1NAMA 4HUVA 4K3EL 3VGAC 3I75A 5ADPH 4NQVB 1BLIA 1M9WA 1XR9B 3QRGL 1F13A 4X80L 2V2TB 1F6AA 3V0HA 3MRCA 3Q9QA 2B2XL 1QFWL 1JXJA 4GAFB 3VXMD 1AXSB 2AXHA 2EE9A 2EACA 1INQA 3HBPA 4L1TA 5ENWB 4QHNA 5IK3A 1HCZA 1G7JB 2G9HB 1ACXA 1EK3A 3WFBH 4TUJA 2GSMB 3X12A 2C3WA 2RFXB 5F6IC 3T0EA 3O3UN 1XZWA 4UM8A 2OL3A 3KYMA 4H7VA 4NQTA 3ZO0A 1G94A 2YGVA 4GO6B 2CO3A 3QO1B 3WN5A 2XA8L 2YWYA 3JWOL 5D7SL 3DPBA 4KXZH 3FT2A 3L7FB 4JPWL 3PXJA 5AVYB 4P3CL 4M3HA 4ZUWB 2EXWC 3M1CA 3ROLB 1HJBC 1FGVL 5AVTB 5ABAA 4GRWH 3BP5B 4OZGF 4JFOA 2A6KA 1GH7A 35C8L 3OF6D 3IJ8A 3JUZA 4GRWB 4N20A 3FF8A 1DBJH 4WFED 4BM7A 1K6QL 3T6QC 1Q8MA 1LEIB 3HS8A 1DQLL 4X7TA 1OGPA 1ZV2A 3ZJAA 4N25A 1B0GB 1BP3B 3U0WH 2ICCA 3BC9A 4AM0B 5I0WA 4QXWA 4NGHH 2EH8H 1WT5C 4G80A 2J8OA 5SWZB 2J6EH 5CM1A 1MREH 3WLBA 3QPXL 5DK0B 2R7EB 1SEBB 3TWCL 4ONGL 3K5SA 2G2PA 1NTDA 3VI4E 1P4IL 3V0VB 3VM5A 3B83A 4HOXA 3HEIB 4FNLL 4TYUA 5E6IA 2BSCA 1OT1A 5D5MB 3TONA 2CO7B 2Z8RA 4JO3H 4N9OB 3HS0A 4GSXA 3EH5B 3LNGA 3L3DA 3HZKB 4ZAKB 3C6EA 5D71H 5EZOL 2I85A 3RZCA 4KOBA 4K9EH 3WNPA 2H6PA 3BRGC 3DO7A 4OSUH 4GAJL 3TF7C 5FKPA 4PM1A 5FB8B 2BOBA 5CGYD 2FUQA 4MJJA 2O6DA 3PHOB 2QVIA 4GUCA 3W2DH 1RZKH 2DL9A 4E41E 5BUGA 2EIMB 4TRPH 1ERNA 2VLRA 5D1QE 1V55B 2J72A 2JJSA 2OSWA 1TSHA 4KXCA 2BXZA 1TJXA 3PGCB 4CC0A 3MV9D 5CBEB 4HG4J 3OAUL 1FC2D 3IN2A 1E6OH 3MRNB 4U6TA 4MNQA 2CK0L 1XHHA 1D9KC 3LS5H 5I1KL 4QD2E 4R5VA 3U7AA 3O0RL 3C6LD 3TWCH 3BAEL 5DD0H 4E68A 1KJMA 1CIUA 3GBNL 3UYRH 3GB7B 4JNXA 5I5IA 5EORH 2CDEB 2VR6A 4GRMA 1FVDA 1JWSB 4F2ME 4KQ0A 1DQTA 2RTTA 2E9IA 4EDXA 1BZOA 3CAFA 3WSQL 3UBXI 1OP3H 3T8MA 3OV6A 4L0YA 1OANA 4OJFL 4L4TB 4PTUA 1I9JH 5PCYA 2FQGA 3CXHJ 1HH6B 1DP0A 2XRAH 4KJYB 3QDHA 1CBJA 1CD1A 3KYOB 2QTVA 1VENA 1BQ5A 5D8JH 2AAVA 3QVAA 3ZDYF 4F37K 3DOSB 5IM7A 2BC4B 1YEGH 3OB0K 1RZGB 4YFEA 2EZ0D 4I48A 1Q94B 4BJLA 1IAKB 1ICTA 1YY8A 3V4PA 3ZOAA 3PIQB 2J7LA 5HHPA 1BZ9A 5JW4N 1OE1A 1UD2A 2VZOA 3CBKB 2CO1A 5IWLA 2PMZA 4P49A 2FJFA 4JG1L 3TYFB 2VXUL 5ID0B 3PABA 2QGBA 4JPSA 1RK7A 4MYPA 3P69A 4NAMA 4FG0A 5KBMA 5BVPL 1ZT1B 1EAJA 4X6DF 3OG4B 1EEUA 1E8XA 2OMUA 4NJ9H 4M03A 3QBTB 4D0CA 1T66D 5L88L 4LOUC 3TEXA 4YSAA 2ZXGA 1RZGA 1FH5H 1DVFB 1N8ZB 5DJ2A 3VD9A 1A7PL 2GCYB 2DH3A 1CDJA 1LK3H 3GHBL 1ED3A 4J8RA 5LWYL 1L0YA 1K3IA 1WVZA 2IQAA 3VFWB 4PJHE 1X5YA 4TSCL 1JNJA 5E6UB 4MVBC 2WUCH 4XVJH 2O5ZL 3DO4A 1MCPH 3O9WA 2NRDA 5CINH 1FBIL 1FO0A 4XBGB 4Z3TA 2DQGL 3VFGH 2BOLA 4JPQA 2C3XA 1CJYA 3CN4A 4RQQB 4NUJB 2WLZA 3QORB 1AGDA 1J87A 1NPJA 4O2FB 2AZAA 3PUUA 1UXLA 4EZKA 1TQTA 4NDMA 1KJ2A 1NGXB 2HWZL 4GLRH 1LJMA 1DSFL 4OLUH 2X7LB 4AH2B 2OI9B 3BXNA 2CDGB 1V3KA 2IWKA 3ARVA 3TC9A 4DKFL 1CE6A 4BRJA 2HH0L 3US9A 5AB9A 1TZAA 1DQMH 2Y24A 1L6XA 1N4XH 1E9OA 2BOCA 4JRYA 1ZVYA 5TE6H 3VUAA 4UDTB 2IGLA 4LDOB 2QGCA 1L5GA 3A4AA 4WIQA 4WW1B 5BO0D 5BJTB 1OAZH 4MXQD 4MS8D 1A6WH 5H4YA 4LPWA 2PNDA 5D4QA 4ZX6A 3DURA 3O4LB 3J8F7 4AQ1A 4CMMA 3CZFB 3LRLA 5LDUA 1SHXA 4CC4C 3LZFH 3UBHA 3LPGA 4GSDH 3GGWB 4XB8A 2Y07L 3QJFA 5CWSB 5ALCL 4YZFE 3RFRA 4ABVA 1JD9A 4UDUB 1T1ZA 4XNQA 3II1A 2PYEB 3QI9D 5BRZE 2WMPB 4NP4L 2DM2A 3QUKB 4GG6E 1T1XB 3UTSE 4Z78B 3MOBH 3RL1A 1CICB 3ME0A 1QA9B 2CJUH 1S5HA 5DGQA 4BWWA 4ILDA 1PNDA 1RQ5A 1P5UB 3FUJA 3PWNA 3ZZSA 1IKFL 4RGNE 3SZ6A 4E0RB 4PD4J 4ZYKB 5IB5B 4EI5D 2R0KL 5F9AC 5DSCB 4H8WL 5KS9F 3QI9A 5AEAA 1HIML 4JPKH 4KZDL 1OCRB 3I9IA 4BQBA 2ZKWA 1W72H 3G9VA 5E5MB 4PP2A 5GRXG 4NUGL 3ARDD 3ZZ1A 2FX8L 4H88H 1R3IH 3IK2A 4ONHA 4AL8C 3ZKXB 4ZPVA 2GJRA 4PWIA 2KUTA 2WV3A 1IQWH 4HT1H 3S35H 5KBPA 1J05A 2RCSL 1AJ7L 5C7XL 2K9UA 1NMAL 4X8CA 1ODUA 3S3SA 2DQ6A 2JE8A 2NY2B 4OF7A 2XKNA 5FECB 1HNYA 3B6SB 4K3GA 3MU3A 4Q9CA 1KENL 1MCOL 4I3RH 2DQEL 5JMRA 2CUMA 1ZLDA 2G4EA 1QFUL 3E80A 3KPRB 4ZMZA 3DX9B 2F1AA 3FN0L 3FL7A 3BWZA 1EDYA 3DUHA 4JN1L 4ZG1A 2Y5TB 5CP7A 2G9KA 1M05A 3FT3B 4UMGA 2FK9A 4NN6B 3TA3B 2ESVE 2Y7NA 3MXVH 4P05A 5DK0A 1BVKA 2XT1B 2DD8H 2EIDA 3P4OB 1P53A 1A6ZB 4BZ2L 3T0DA 4ELMA 5A1AA 1R46A 4PBWD 4WV1C 2C7UA 3ZSSA 1U8MA 4A6YL 1NBQA 4Z5RA 3GO1H 3LOWA 2GJZB 3NRPA 3LKQA 3Q43A 2HLAA 5IFAH 4FG6D 1PFOA 5JHDE 3K46A 3QCVL 5D6DA 4IJ3B 4AJWA 1GW6A 5EF3A 1QRND 3RDTC 2Y1VA 5D7IB 4NFDA 4PJIA 1UB5A 1KV7A 3ARBD 3NTCL 3RPIA 1A6VH 2X6BA 2XWCA 1A7QH 5SWQB 3Q6GL 4LSQL 1D5RA 2Z92B 4M4RA 3L5XL 2YD2A 4OLXL 1YSOA 3R18A 5D7KD 4XO3A 5A2IH 1V54B 4AGQA 1F2QA 5HHXH 2E47A 3G5ZB 3NCYS 4M9PA 4P46B 4JZJA 4NT6A 3OAWA 4MNQE 4S1QH 1EEZB 2JKSA 2ZKYA 4PJ7A 3KR3H 4NNXA 2XVKA 1JPGB 1Z6JT 2OV0A 3QXUA 1L5GB 3ZTJH 2FJSA 3MRPB 1VADB 3VH8A 1WAPA 2VZVA 3OXRA 3GSNB 3GIVB 3WCYA 4DKDC 1M1XB 1CFQB 1GMIA 3EDEA 5DC4B 3AG3B 5H94A 3NFPB 3GLAA 4JY6A 5GGVL 4TQEH 4H0HB 5I1AB 3GI8L 4LLMA 1ZE3C 3A24A 4OZFA 4ELMF 4YC2B 1J5OL 1FGNH 3CHSA 1A3RL 4X7DC 4LSQH 5SX5K 4JUSA 1K5NA 3FU7A 1TO4A 3HN8A 1OAXH 4G8IB 4RAUA 3FU8A 2V9QA 4HFWA 5FGBA 3GM0A 5IHBA 5MEOB 4LP8A 1IGML 1FZKB 5IQ9A 2M8XA 3WXWL 4CNIB 3EBHA 3VH8B 1X44A 4FQLH 4H1LB 1BD2E 1IAOB 4YN3A 4N8CH 4MD0A 4M00A 2AHIA 2QLVB 4LARL 4AC4A 1I3RB 1DLFH 2N01B 3D3VA 5D7KE 4LCWE 4XAWH 3BDYH 5DD1H 3PE9A 1NGWA 3FNKA 3ZDZE 3VW3L 2FECL 3HJ0A 4PG9B 2I7SA 1VB9A 2QPEB 5BQ7B 1ET5A 1JPSL 3X11B 1WTGT 3QZLA 2H26B 5J6SA 2YN3A 2VYRE 5LNEA 3CVIH 3VGAB 5SV3A 3CVHA 4AIZA 4HPYL 4HV8A 4P2RB 4I77H 3BN3B 5D1ZB 5I71B 1FNGB 3BZ5A 3V79C 1HOCB 1S7XB 5D7JC 3GSVB 4JL1A 1SF5A 1R3HA 1SDYA 1UOWA 3S5LA 3ZE2B 1OIOA 5DRZB 4G6AC 1DQLH 4ANUA 3OR6B 5HI4D 1N59A 4UANA 3SPCA 4XHJD 3O9WB 2VM4A 5D72H 1SBSL 4PRAA 4AYBA 3CZSA 1MRDL 4QT5B 4M93B 1MEXL 3GUTA 4MCMA 3X11A 3HE6A 4NZRL 2GK0A 3MVSA 1Q72L 2IFFH 4WENB 2VMFA 2A3TA 3TBBA 3VFUA 3Q2CA 4Z7WA 3KLHC 1BVKB 4BWUA 5B3JF 1IKOP 4MFHA 4NLHA 5FOBB 1V10A 5HDWA 1SN5A 2V2XB 4UQCA 1Z3RA 4PRIB 5CP3H 3IXAA 1M7UA 4WTZG 5EU6A 4K7PX 1N0LA 2YZ8A 2KZBA 5DQJB 2QPDB 5F93C 3OR6A 1J1XH 1CL7H 1OGSA 5EH1A 3CXDL 3NEEA 2X1WL 1YYML 2V2WB 4URKA 1CYGA 4EUPG 1ET7A 4R4BA 4LF3A 3OPZH 2QDVA 4PVMA 4D0DA 5AG9A 2HRHA 4UTAA 2GT9B 2F5AL 2C3HA 2Y1YA 4KRPB 2HRPL 4L8CA 2V0AA 3FRPB 4HWNA 3GRWA 4Z7UB 1BFOB 5IROD 5CR8A 4JDTL 2YMXL 5IY5B 3FUNA 5E5LA 4YHOL 3A6BH 4GIAA 2CLRA 4ZUUB 4I9WE 3ARFC 5I8KH 5C07D 5JZ7D 2XQBH 4BXSV 1JFQL 1U91B 2FATL 1KEGL 2NNCA 3NCJH 5DVLA 5EPMB 2QT6A 3SYCA 1O6TA 4KKBD 1QWHA 3ZHKA 5C9JA 3ZIMA 4K71B 3L7FA 4JRXE 2QSVA 1E9PB 3VA6A 3K4AA 1MW0A 2FB4H 4HDIA 4YDZA 3EOAA 2ZYIA 5GJSL 4Z7UA 1CGUA 3QIWB 4Z7NB 2ZZUT 1OL0A 1A02N 1X5JA 3ARXA 3EOTL 1T6BX 2A74C 1P4LA 4KKLC 4F8PA 1PLGH 4HS6B 2E7DA 5D7EA 3EYOB 4YIQB 1KCLA 3EYVB 2Y06L 3OR7A 3JWOC 4F3FB 1O7VA 5IKCB 4PRNB 3CNKA 2DOCA 4QNPE 5D6DC 5C07B 3LN4A 1S7SA 3ORJA 2CBQA 4F7MA 1I75A 5E1QA 3J7HA 2OCJA 5LQBH 4HZLB 4AYEC 1H3WM 1DCLA 1OTUD 2O5ZH 1NSNL 2NX5E 3SKMA 3NT0A 5DJ8B 1NAMH 2Z8WC 1MJ7L 3GS7A 1QR4A 4GW4B 2WBJB 4CUCA 1LK3L 5J6HA 4LT7A 3K8LA 1SDDA 2AQ1A 1II4E 2GTWA 4WGWB 1CE6B 4PBXA 3EYVA 4UV7L 1NBVL 2QFPA 1PZSA 3IKCA 5DXWA 2Q87A 5C0CD 5HHVH 1ZWIB 2VERN 4ZNEA 2KBGA 3G08A 1ZKAA 2AFNA 2DM4A 3QEHA 4FZ8H 2WQSA 2WCPA 4OCYL 3SEPA 2WC7A 1VIWA 4UILL 5BQ7A 5FB8A 1N19A 3TNMB 3V6ZB 1ZHLB 3T77B 4O02L 2Y69B 1CF1A 4L37A 5L6YH 1DN0A 2BFVL 1J5IA 1GHFH 4TSAH 4A67A 3FUIA 3QUMH 3OHXC 3RI5F 3CVHB 3PGFH 5FYLH 5DO2D 3C5ZB 4P5MB 1Q9OB 1VZIA 3NIGE 4QHNB 3VMOA 5KSUB 1BREA 2WK2A 1IL1B 3G04A 2EO1A 4O02H 3FUKA 1AR1B 1MH5A 4HIXL 2RHEA 3MRNA 3FFDB 4LU5H 4LDCA 3QORD 2VDRH 3Q2VA 3QFJE 5BZWB 2VDOB 1PX4A 3PWUA 5BRQA 5IB4B 4F8TA 4FQJH 4YL4A 1BVNP 2Y1ZA 2VDRB 4MMXA 2ATKB 3BE1H 3BAXA 3KBFA 4FLQA 2P8LB 4YVUA 1KUMA 2P8PA 3VXOB 1KTLA 2WINB 4LSRH 1SOXA 3O45A 1E65A 1NFIA 4MD4A 4MB4A 5T1LD 3G6JF 4OQTL 5I6KA 4PRHE 2ZICA 4UAOB 4ZYKA 5KSAC 2V17H 3ZDYB 5F3BA 3DIVA 1BMWA 2FX7H 2YK1H 5EC2B 1L3WA 4UCFA 3ULUH 2ZSWB 1QP1A 1JI2A 5FW6A 5ID1B 4JPVH 5BVJB 5JOPD 3CXHK 2FZ3A 1GGIL 2WLJA 3MRMA 3AXLA 4JVPA 4LLYA 4MJIA 2DKSA 1PZBA 2BCKA 2FSEB 4L9LA 3LS4H 4IK7A 3EYQC 2H8PA 3I9GH 4HJJH 4F91B 3OMAB 5M94B 1XDTT 1T7VA 2GJ6E 3KWXA 1G6RA 4U3CA 3IDGA 3N1PC 5H94B 3TO4A 3FO1A 5C7ZA 4MCYA 5JIMA 1GJUA 1MNUL 3B9DA 1GYUA 2QR0A 3O2DH 5E6IB 5E9DD 3VG9C 1KJVA 3ZTDC 1S7UB 1VFMA 4Y9FA 5J9PB 2J6WA 2ITCA 2OX5A 3DJ9A 2ITFA 1G0YR 4PJEB 3WKPA 4X98B 1OW0C 1DJSA 2YGNA 3C09B 3IBOA 2D7NA 3FQRB 2BY1A 2O1AA 3HFML 1HSBB 1J8KA 3OSVA 2G3ZA 3HHRB 1OQOA 4KVNH 1T4KA 4PHZA 4B5ZA 2VDKL 4TVUA 2WVUA 2IVFC 1CXHA 1HXKA 4HK0A 2PYED 3RHWK 1LP9E 2BRRH 1JE6A 3D0LB 3OLEA 4B9JA 1XTLA 1OV8A 5HYJA 5MERA 3QZOA 5I6OA 2R2EB 3PF2A 2O61A 5AOIA 2B59B 2JXMA 4EIZC 4Y4FD 1YMME 2MCG1 5E0QA 3EJJX 1JK9A 4JO3L 4ZOAA 2ITCB 1UFGA 1CVRA 1NOAA 4H0LC 5EOTB 1JDCA 4BFIB 4V1DE 2J8UE 4ERSH 1PVHA 4RQQA 1LEKA 4HPOH 1ZCRA 5IB1B 3P3RA 4JDZA 3B2VL 4X7SL 3FBKA 3SE8H 4CW1B 1YJDC 3QA3A 5CJOL 5HTSA 1T04A 1MCNA 3BWUC 3N9GL 1JVLA 4ZNCD 1WUNT 3UYRL 1OK8A 2C8NA 4NQUA 1N2RA 4MNQD 4HS8L 4N26A 3SGEI 3DSNA 2NNFA 1IAMA 3L4ZA 1C5CL 4HKBB 1UUNA 2CSPA 4XAKD 4H40A 1A7BA 4KKRA 3PXHA 3QJRB 3NGBC 2V8LA 4LPVA 1UM6H 1YZZA 5FS5A 1AOHA 1XSKA 3HC0B 3WTTA 4DO5A 1PIGA 2DYPA 3CCHA 4Z0BH 2R0LH 2YPLA 2N0MA 1TQWA 1XSIA 4JGNA 2H0PA 3NESA 1IAII 2JH2A 3HB3B 5B8CB 3ROOA 1JCKA 5IB2A 1QFWM 3UPRA 1BQHB 3WOVA 4AZ8B 5C0EA 1HKLL 4Q4IA 1SYSB 2OR8A 3FXIC 2H45A 3L1EA 4V11A 4PJCE 4Z3GA 4ZAKD 1IFHH 1MIML 2WUCL 4KO5A 1K3ZA 3HUJE 4XVJL 2VDPB 3MRHA 1UGNA 2Q76B 2JB5L 5E4OA 3PPEA 4X6DE 3NIFB 3NZHH 3X1FA 1FL5B 3L4UA 2P8MA 2WSPA 1JFQH 5G5DB 2YPKA 4ZDHA 1Q9OA 3MNWB 3CVIL 5TH2B 1OGAB 1U8LB 4XVTH 1G1KA 4NKMB 1UD4A 3Q8CA 2BSTB 2BS9A 3QULB 3RWFB 3F58L 3AROA 2ZCHH 2FIKB 1U8IA 2JJTA 2F5AH 2YAMA 4HFWB 2AV7B 2BNQA 3IGAB 4JM4H 2HPTA 2XTJE 5KVMC 4KZEL 1MLCB 3HAEB 1HCFX 3K72A 1S7VB 3QEGL 5BNXD 3TBVA 5E6ZA 3C8KB 3UMTA 3FQWB 5EUOF 1CLOH 4HFUL 2A4EA 2YEZA 4W9HC 3CUPB 3MV01 2I24N 1FNHA 3ARTA 3TEUA 1PY4A 4PRBA 1MF2H 2B4CC 1F11B 1TVDA 4GG6A 4X6CF 2OMXB 3HPJA 3VE0A 1MWAH 2NYKA 4PLKC 5GGQH 2BNQB 3MRIB 3C60B 5CIPH 3ZIYA 3DI2B 4RWYL 3IU4L 2WZ5A 4U6YB 1R5VB 1DE4B 1HEJC 1LO5A 4TQEL 1BW8A 1VGEH 5TQ2L 4XMXA 1E8YA 5T3ZD 3BXNB 3BPOB 3DX9A 3NBNA 1KLGB 2R4SL 4PIBA 1RHFA 1WC7A 3SSGA 5CR1A 3PNRB 3ARZA 3S5LB 2WM0A 3AWFA 1HS6A 4YBQD 2A9AA 4Z95L 5C09B 4LDLB 1UJTA 3C8DA 1P1ZA 1T2QH 2I60L 3QEQB 1XD1A 1JGEB 4GBXC 4R7XA 4NM8L 3VI4F 1MFMA 4NQXA 4M62L 1ZLWK 3WD5H 1BM3H 2QEJA 2ARJB 5DEGB 5DU7A 2XV6B 4OV5A 4L3CB 2CHXA 4IRSD 1W72B 5HGBB 3BEVA 3HMXL 1AOZA 3RTLA 1KJ3H 1UXSB 3JSSA 3KYNA 2Z3FA 3SN6N 4ZMWA 4PB0H 4XPGL 3M6DA 4XCNB 1OGTB 3TBWB 1RUML 2XA8H 5ANMB 3L5WB 1IGYB 1UENA 4IRJB 1IIIA 4J3TA 4XCYB 3RVVD 3TESA 1M71B 3KW8A 4P48A 3CGTA 4NQDE 1CGXA 4OIIL 2O6EA 1NANH 2IG2L 3BUYB 3UJJH 3LH8A 3OSKA 2FEDC 3RL1B 5J1SC 1F45A 2GJJA 3QAQA 4DP8X 4GO8A 1T89C 4G6FD 2YGOA 5DEGA 3OKNA 1XCWA 3ZO9A 1MFAH 3O6FA 4M8VA 3ULVL 15C8L 4GQQA 4R2GD 5D7LA 5DUMH 2AEPH 2C1OB 2O93L 1S8DA 4BV1A 4NUMA 5IJVA 5IJBC 3ELAT 2HZHA 3F7RA 4WQOA 5BV7B 2VXVL 4FFYH 4JKWA 5ISZB 2R1YA 1OLZA 2NUPB 1RZ7H 2ICEB 5F9JB 4JZNB 2E8YA 5BZWA 5LCVL 5I19H 5LG6A 1FL3B 3BKYL 4PRPE 2ENPA 3P1VA 1L0QA 2EDNA 3GIVA 3RIAF 1CFNB 1CZ8L 2R1XA 5GRJL 2LTQC 2X4NB 1ZLVK 1KCRL 1AH1A 3ZE0F 1A6TB 2XU9A 4OFDA 4AQ8A 5FF6A 1TO5A 2ZUWA 4GG8A 4QHLA 5EU5A 2P5EB 3A21A 3UMNA 2BIHA 1N10A 1OPGH 4TLSA 2JK5B 4OQTH 4KGJA 3ZPDA 1QO3B 4WF7A 1Z3GL 3O41A 3CZKA 1AGEA 5I6MA 2WZ6A 4UV4L 4WW2B 3M1BA 1EJOL 4PJDB 4MS6A 3FU9A 4KY1H 3MNWA 1JHLL 8FABB 2O30A 5HVFB 3MHZA 3FCSB 2W8CA 1IC4L 1VFBB 2LU4A 3ETSA 3SKNA 1R3IL 1FZKA 1TCMA 1FRGH 2WLNA 4LOFA 1BFVH 3SDCA 4KVCL 1ZDQA 1QSEB 3NK4A 4OZGE 1RP8A 2KQMA 5J6GB 1SZNA 1I7UB 1LK2A 3KS0J 4G2AA 3KPNB 5EOCJ 3P40A 4IIQC 2R23A 3VWKB 2ADFH 3CPLB 3LKQB 4P04A 1AP2A 4PG9A 4RGNC 4KBPA 4YVNA 3ESOA 1T0NB 3PGCA 5CBEA 2J55A 4UMSA 1PSKL 1ZLEA 2ED7A 3AGVA 3TS8A 4L1LA 3F7LA 3L3OB 4PJIB 2K8QA 4Y4FA 5C6WH 3C5XA 5ALCH 4KDWA 4OCRH 3TBTA 3EH1A 3WNOA 1EJOH 3ZYJA 1DTUA 3S3CB 1FLRL 2EYSB 5GPRA 3FB5A 4UQIM 3GMPA 3E8UH 4PP1C 4ODHH 3IAPA 1IBGH 3CVBA 3UXFA 2ZCKH 1F02I 1MUJB 1JNHB 1V7ML 2Y7LA 2WSKA 5A6IA 3OZ9H 3D5OF 2XWBA 3HRPA 5A2LH 4IOIA 1CG9B 2BDNL 3MR9A 2B3RA 3N43B 3UJTH 3PFUA 5I0DA 3WHE0 1GGYA 3RWGB 4LVHB 3DOHA 3U4BL 1T04B 4C58B 1GGBL 5I1LB 4JFPB 4N2LA 1EHNA 3FMGH 1PMYA 4KK6D 4PCTA 2CBTA 4PJAA 5EBLB 2GFBB 4FTVA 1J10A 2CMRL 4TF4A 4LU5L 2FBOJ 4J3OG 5AYUL 4ODUA 5DEFB 4UINL 3A22A 3NAAL 4G6MH 4JRYE 3E6FA 1HHGA 3QJSB 4FQXB 1D9KA 1DR9A 3S2CA 2YPLB 4JZOB 2CWRA 1IVTA 1WV7T 5MEQA 2X6UA 5SWSA 2ZSWA 3DBSA 3AAZB 1FBIH 1NWOA 4POYA 5IB2B 3HI1A 1YLBB 5CBAA 1N7MH 3CBRA 4PJGA 5E94B 3VXMB 2EXYD 4ANWA 4AJVA 2H1LM 2VWEE 2R0ZH 2ITDA 3R4DA 3B8SA 4TTDC 4NZUH 2G0LA 3V5HB 2X9XA 5GZOD 5AW6B 5D4IA 4M61B 4XNYL 4HU8A 1QRNB 1RIVH 5KN5B 2EE3A 1S8DB 4AUYA 3N1FC 3K2KA 3LDBC 3RZWA 2R27A 5A7BA 1AHMA 1KCKA 5EEWA 3D2UB 3N91A 2V5TA 2VGLM 3LKNB 3NIDB 4QRUB 4W6WB 3RUGE 1VZHA 5SWSB 1H5BB 1UKTA 5F9JA 1ACYL 4HXAL 2FYYA 4WK0B 1K85A 1U3ZA 4UNVA 4OAWA 5ACZA 2J8HA 2O72A 2BSBA 5KBDA 3ZRCC 2K7PA 4IEFB 4NXSA 5H2BB 1YEJL 1OW0A 2B59A 2JXMB 1T3FB 3U9PL 1E27B 5A3IC 5F1SA 4Z3IA 4GI8A 2ZKHL 3GLZA 4Q0XH 5TE7L 1GMEA 3SJVD 4DP0X 1O9WA 1X4XA 1U9KA 3DDGA 2IANB 1JZ3A 4AYDC 5E1AB 1U8PB 4DEWA 2VDMH 3NN8B 4GS7C 3GHPA 3ARGB 2VDMB 2VLRD 5F44A 1U93B 4Y19D 3WD5L 4H20L 3A47A 4YEFA 3K71B 3QHTC 1CR9L 1OAQH 4N8VG 2OYKA 2AABH 1QEWA 2RH0A 3ESUF 4KMLB 1I9EA 4OZHB 2J88L 2N56A 1S9WB 2R2HB 3FH7A 3GGWA 4HFUH 4WJ5A 4PJFE 2VITA 2E7LC 1JS4A 1VKXA 4WEEA 2YGQA 3RWIA 2WXIA 3V9FA 4B97A 2IAMA 1CVSC 1NUGA 2AJ3A 1ES0B 4XGZA 3EFOA 4X9BA 5CMAA 1K5WA 2UZYA 3RHWF 4QXUL 3ILQC 2WXRA 5JOFA 5J11C 4U6HB 3T2LA 3O8XB 3ZR6A 4CSSA 4P57B 2K1MA 2ZG1A 2HRPH 2XN9D 1D6EB 4TVSa 1BM3L 1EXUA 4JE4B 4XAWL 4Z8FL 1CF8L 1Y18A 3ULVH 3BQUC 5LBGA 2XTLA 1PZ5A 4QRSB 5C0BE 4KK6C 4XMPH 3NH7L 4OGAD 3G5VB 4FP8H 43C9B 2D0GA 4BK5A 4Z7OB 2BHYA 2P8MB 1BV8A 2WXHA 2F8XC 5JPNC 4XCYA 4XP6H 1D5XB 1I8UA 3MJ6A 1U8HA 4ZQKB 3SDYH 3WLBB 2ZCLL 3MLVL 1JTOA 5JOFB 1ZANH 1CG9A 1RUPL 3OKMA 5J1AA 1NAMB 1D6VL 3BH9A 1EGJA 3A67H 2H0JA 4LSDA 1NLDL 1K4DA 3GJEB 4TNFA 4OLWH 5FV1L 5KAQG 2WWNA 3FRUB 2XPZA 4BUQA 3RWDA 4PJDF 1NLBH 3O2VL 4MA3B 1UURA 3GMMB 4G8GA 1MI5A 3MUGA 1PNCA 3BEWA 2Y7QA 1I8MB 1CO1A 5FHAL 1FFQA 5FIEA 3AW5A 3BSGA 4L3EB 3ZHLA 2DYRB 1QFHA 1JPST 4LCUA 1JWMA 2X89D 2KT6A 2F54A 5D2LA 2LFEA 3NFSH 1MAKA 2W38A 4V33A 4DO4A 2IADA 3ARPA 4HJ0D 4KQ4L 1R6VA 3QR2A 2H1PH 3WKML 3MGTA 2APXA 2K0RA 2ZXCA 3DHUA 3H9SA 3B2VH 3O2WH 4PGCA 4X7SH 3F04A 4XC1L 3CN1A 3N85H 3ZL2A 1I3VA 5BS0A 4JM4L 5JXED 4G8AC 3X1EA 3FTVA 3GNML 2JCCF 5DT1H 2MCMA 4B9GA 3TX4A 1T1YB 3HNSH 3L4YA 4F5CA 5AB2A 4G8GB 3GKWL 3ZUNC 1WIUA 4ZFZA 4GSQA 3WEMA 3PIQA 5HHPB 4W9LC 4JQIH 4EJ1C 1NLDH 2YC1A 3NRQA 2Q8AH 5JIDA 4G6AD 1SMAA 2MQ0A 4N4YB 5K59E 2HRLA 4QTHA 3ATBA 3HNTL 3VU1A 5HSFA 3ISRA 2DKUA 2P24B 4WSGA 4U4BA 4X5WA 2GW5A 4JO1H 2W81C 4Y7OC 4YHLH 4D0CB 4HPOL 2B1HH 4LMQI 3BEVB 4TL5A 4PS4L 5L4IA 4TTGA 2WHVA 2ID5A 1I8LC 2E27L 1ZHKB 1XH3A 3ETBF 4FDWA 5IZ7A 5DS8B 3VI3B 1S7WA 4LKCA 4X7CC 3U46B 4QXUH 4YFDB 2CGRL 3V52H 1QABA 4ADJA 1TSRA 4Y5XB 3STBA 3L3JA 3SBQA 2CO6A 3FO9A 4U05A 4W1TA 3B5GA 2WKLA 3BCDA 3DVGB 4HK3N 3FPXA 3N43F 4MQSB 4UWQB 4X99A 1Q94A 4FCHA 4YSRA 1DBMH 2R59A 1M7IA 1ZDSA 1TQSA 2HUHA 5F21B 3U0WL 1MQKH 3KWWB 4HULB 2Z8SA 4XB3A 2OULB 5D2NA 1RHHA 5FCUH 1MCOH 4I3RL 3VFSA 3N40F 2GY5A 2HTLC 3O6KH 1LO3H 3KYKL 1IBYA 4JFEE 5I73B 4URTB 2EABA 2XZQL 3FU3A 1KGUA 1JPTL 1K5NB 3FU7B 2ZX9A 4R3SA 4S2SB 4A7GF 1PCSA 2PCYA 1G9MC 5DRXB 1MCLA 3S0PA 1A4KB 1L9SA 3H9HB 1BVZA 2DMKA 1KYFA 2HT2D 5F6IB 3QJOA 4WFHD 1XVSA 1BX2A 2EO9A 2EIKB 4JW3A 4Y7MA 4ZW6A 3S4SG 3IRPX 2JMRA 3KXFB 1Z1WA 2YXMA 4R5XA 2XKUA 2W9LA 5IFAL 3KD4A 3DUUB 4MXQC 4GEJA 4C8XA 2H4EA 3S3JA 4XODA 4NO3B 3IJSA 5C6PB 4XPAH 4G82A 4N0RA 4H8QA 1V8HA 2K78A 5KSBB 1DN2A 1T1WB 4EBQH 2WNKA 4U1KB 2ODIA 2WIIA 3RVVC 3V0IA 2J71A 2VM9A 3IE4A 3R1GH 4AIZB 4FFWD 4BK4A 3NZUA 4LL4A 4NPYA 3D0LA 4YPGB 1KEMH 4LSSL 5ICZA 3LNFA 4KRMB 3FSVA 2JIXA 4WWKB 1E9OB 1QNIA 3N55A 5F1NB 3NJVA 4XN9A 4IDLA 3RVTC 3V5DB 3CVHL 1GYAA 2HSIA 1S3RA 4F58H 3BYTA 5DHVB 1X9LA 5I9QB 3IMRA 4PJBA 2XVBA 3RIFK 4R4FH 5MENB 2A83A 4Y8DC 2X9WA 3N42F 4CMMB 5H8DA 3SCMD 1NCWL 1A7OL 1D5MA 1C16B 2ATPA 2QLYA 5L9DH 4H88L 1E9QB 2VDRL 3HC3L 2C1PA 2GJ6D 1K4CB 1S7RB 2D9CA 2E7BA 2IANE 1ET8A 4W9ZA 3UZQB 1B90A 5LN8A 2QQLH 3QZWA 4PJHA 3KPMA 4PGDA 3W0WD 1P2CB 3HHMA 4U1LB 1CYWA 1NCCH 4YDJA 1VHPA 3HZYA 3QUZB 4NIKB 3SDDA 2FGZA 3TT1L 5DHVA 1U6AL 4N1HB 2CLZA 2OMBA 3B4NA 3O3BA 1XCTA 2OW6A 4PR5B 3IT8D 3W3BA 3D3VE 2ZCKL 3VGHA 3BWAB 3FRPA 4JVWA 4Y8AA 2XG4B 3VU2A 3D25B 3FOLB 3IJYB 4JFZL 5JORA 1JF6A 4HUUB 1OM3L 4FF9A 4A2LA 4UZGA 5LHDA 4DJMA 1A7PH 1EJ8A 3U9UA 2NW2B 3MA9L 4UU9A 2PWDA 4HWEL 4O2EA 1K4CA 1KBBA 3QFGA 3NIDE 2BOCB 3VXRA 5CAYB 5L88H 4XGZB 1KCBA 3OKKB 2PW1B 4PGBA 4YS4A 3X3GH 4ENZA 1P2CA 4RRPG 5CIPB 1I85A 3BUYA 4CJ1A 3FUDA 2JCCB 1Z5LB 3TO4C 4HIEB 32C2A 3I75B 1NDMA 4Z7VB 4KO9A 5AOKA 3WIIL 3DVFA 2YKKA 3BCFA 1B2WH 4OBSA 1GW0A 3X2QB 2VXUH 2VRAA 3DV6B 3ECWA 1J1XL 3B9KB 1AGCA 2ZUYA 1IIKA 2XPGA 3MLPA 1AI1H 1TTCA 3D25A 3FOLA 3R19A 4GO9A 43C9A 4UINH 1IMHC 2YSSB 3OAZH 4WWID 4N8UA 3UIZA 2ICEA 4MD5B 1NMBH 1ZV5A 1U95B 3WFDL 4A2HA 5AW7B 3VWJB 4BDVB 5E1IA 2WMPA 1V05A 3STZA 1DSFH 5FYKH 4XN5A 2X6AA 1FVEA 2NT0A 2G4GA 1W8EA 2C7FA 1FFRA 3U2JA 4KU1A 3KM2A 5JHLL 5C0CB 4JE0A 2AJXH 1SLUA 3LPWA 2YXFA 1J5DA 2WKGA 3BP4B 3EJYC 1Q1JH 1C9SA 4MS8C 2JK5A 4N2GA 2GG1A 4TUKH 1LO4H 4KH2A 3H53A 3V5KA 5IEKB 4XO8A 2UZXA 4RISH 3VFTA 3VI3F 2WBJA 1V3JA 1MZYA 4PS8A 4K73A 3FUMA 5HDRA 5E70A 1T3FA 3B34A 1F6FB 4F9PC 5C0BD 4JMXA 1TJHL 1XF2B 4OM1H 5KVFH 1LP9F 5AW8B 3G5WA 4Y2OB 4PI2A 4ECNA 1J1PL 4HX1B 4KJQC 5K1NA 5IF0B 3BT2H 3LSOA 3VWKC 1CE1H 4QRQA 4FL4B 1YRKA 3CFEB 1T22B 3K4ZA 5AYQA 2ZKMX 1ZGLB 3D07A 4YSPA 1MHHA 3MBEC 4E9XA 2VISA 3RTQC 3BD3A 4ZAKA 3W37A 1HC1A 3ZKND 3RWIB 4NP9A 5J7CC 2AAAA 3DX8B 3IU3B 3O11A 3IRCA 3T3ME 4Y1AB 3RTQA 3EJCA 3MACH 2JKIS 2VLKB 4Y19E 5GGUB 4M7JL 3CFBA 2N7SA 2VIRA 3V55A 3FCUB 3JZ7A 3O6FC 4ZXBC 4ENED 3Q06A 2CIIB 4CADB 1ZTXH 4FQIL 2VZSA 2P47B 5C92A 3PWVB 1NFKA 2DBLL 5GGRB 4KUZL 5IMKA 1EUUA 1J8HE 4JREC 2A7BA 1FNGA 1JZ2A 2OR7A 5KYXA 2LTQB 3QT2A 2NQCA 1A1OB 1DFBL 5FAAA 3VQMA 5F7EH 3GDCA 5I1EH 4Z95H 5IQ9B 1A9EB 2NPLX 4HKJB 4DP6X 1E4XH 2PO6A 2NY3B 2TAAA 5I30H 5HVWA 2DEXX 3ZT7A 4U49A 3DURB 1CFTB 3O4LA 4KJQD 4LIQL 2CIIA 4CADA 4N90E 2P3YA 2AJZB 2BZCA 3AB0B 1BVLB 2UXGA 3RWEA 3L3GA 4KI5C 5DJZB 2MFNA 4QNPF 1MWAL 1OD7A 1HSAB 3LPFA 3OLDA 5CWSA 4BE5A 4FCAA 3N1MC 1HH6A 2FEEI 1D7CA 5DHYB 4Y9GA 3V0FA 1WIOA 1E28A 1REIA 3D52A 5AVWB 2WNGA 1QRKA 3IM1A 2KH2B 4IU2B 4WWPA 4LBAA 3UJJL 3HFFA 2BIIA 3THML 4CBPA 5ANHA 4JFDE 4X7FC 1J7VR 3SGJC 4AL8H 5HYEA 4P5SA 5F7KC 1E50A 1ZSDA 1OCWH 4XMPL 4H8PA 4NENA 3F7VB 1M57B 3TZVD 5FK9A 3H42H 4I5BB 4F7PB 1ACCA 4NQDB 1BXXA 2D2OA 3KL5A 4ZX4A 3GMQB 5L2JA 4K4KA 4BZ2H 4LOVA 5DDHB 1OZTG 3EDDA 3FN9A 3MRBB 1CI5A 5C70A 2IALB 5C08E 1HZHH 5LXGH 3UTTA 4LCIL 3GF8A 5SX5H 1LMIA 1N70A 3D9AL 3N85L 4MQTB 5ERWA 3POHA 4BWTA 3GXNA 1D5ZB 4R4ND 1PG7X 4XXCC 4ZUSA 5DZAA 4WI5A 4C55A 4JN1H 4WRLA 2KL6A 2M26A 2ICEC 2QELA 2P46B 4IRSC 2UXFA 4QMEA 4YAQB 3C2AL 1B9KA 1JV2B 3ZTCC 1BGXH 5J3HD 1H0DB 2EIEA 3HE6C 5KVDE 5A2AA 1N3NB 1VCBC 4ANKA 3LIUA 5IQNA 2DI7A 4H20H 1FJ1B 1FAIL 2WN3A 1AZUA 1CS6A 1I3UA 2YAQA 2E74C 3FTYA 4LF3B 4DOHB 2P7TB 4N2KA 4S1SL 1G4RA 3HZMA 1XZ0B 1TVHA 1IZKA 2H9GA 4G83A 3VFNB 1KN4L 4JEGB 4TULH 3VRLF 1E3FA 2KS0A 2GJ6A 4I0CC 3RKPA 3TV8A 3ZK0A 5HHME 2AJVH 4LQFL 3GXIA 2BW4A 1T22A 3CFMA 1A2YB 4ACTA 1AO7D 1AXTL 4JB9H 3BD5A 5EO0A 2ADGB 5B1AB 5TH2A 4H1LH 2H41A 3HKZA 2XZCH 3DARA 4WJG3 3T4YB 1T83A 3HZYB 1RKRA 4M1DL 4OM0L 4A7QA 2XQ0A 1SJVA 2PO6D 4HUXB 4WHCA 1LO4L 4XXWC 3IDYB 3V0AC 4P57A 4DN3H 3WIAA 4E5XB 4UT9L 1AD0A 3EJRA 3KPQB 2D0HA 1U8NA 2NY0B 1U8KA 4H5SA 3ZKMC 1SXBA 1Y7VA 2DD8L 5TDPA 4XNBA 4ZS6D 2X3AA 2VIRB 5EEXA 2M1KA 1DJXA 4DAGH 4K94C 3H9YA 4HIJA 4B27A 3EFDH 2VDQL 3QE5A 5TE4L 4YFLI 4TQ8A 2CKNA 3CUPA 1G9HA 3VFRB 4ZS7H 1PQZA 1RK0A 3NDZE 3RFZC 4HW6A 4XBEH 4XPTL 1P84J 3VQ1C 1CR9H 4YHYB 2R0KH 5MENE 4XHJC 4BA8A 1S5HB 1J8HB 1ML0A 5F0LB 5LJYH 3GPSA 3KPQA 1RULL 4GP5B 5GZOC 2A77H 43CAB 4B41A 2CBMA 4UIMA 4Q9BA 1CFSA 1E4WL 5T3XD 1PEWA 5TDPB 5ADOL 2P8LA 2R0LL 3SDAB 2BY3A 5HI3D 4XCFH 2J44A 3KYAA 1L4IA 3HBQA 1RU9L 2XN0A 3TBYB 5HYQB 4WI8A 3T3MB 3OZLA 2J5WA 2J1ZA 3RNKB 4IBZA 3I85A 5KS9A 5DMGD 4K2UL 3V0JA 1N9PA 3K6OA 3T65A 4JR9L 4JFED 3IFLL 3V5DA 4BHUA 4OUUB 4HISA 4YK4B 4NQEA 3F85A 4YZWA 4Y16B 4EDWL 2YK1L 2FX7L 4JVUA 5B1JC 2JLPA 3KW7A 1GOHA 2LAAA 4HC1L 1RD6A 2P5WB 1Q1JL 5CGYC 2BNRB 4G7VH 2FH6A 2ADYA 1AVAA 5I1GL 4GB9A 5KVFE 3PGDB 4U1SA 1WA0X 4QRPD 5TK2A 3JTSA 4Q9RH 1EJFA 1PBYA 4LEXH 1O9VA 1JGLL 2XICA 5ABDE 3VG0L 3DVNA 4UDTA 2J2ZB 3MACL 3QUZA 5HI5C 4GT7A 4ELME 2VLLA 4LSPH 4HUVB 1WHOA 4MX7B 4WTQA 2YUWA 1CTMA 4JO2H 4R84A 2PR4L 1E5AA 1TXKA 1SHWA 4P5TD 2WGXA 1T5WB 4TKWA 4FC3E 5DJYA 3NIDF 1U8MB 1DQJB 5E6IC 1MWOA 2B39A 3BFOA 5E9AA 3ZQXA 3BWUF 4OLYL 4PU2A 4LLVA 1QATA 4YSUA 5FO7B 1JSYA 4KDVA 1INEL 1DQML 5IESH 4O2EB 3VXUD 2LU7A 1A66A 3E1ZA 3VB8A 1TFPA 2CBOA 4OJEH 4Q97A 4XP4H 1UD5A 1YUHA 2Z34A 3FT2B 5IHLB 4UV4H 1OSZA 3CHRA 1QWUA 4I85A 1E90A 3FO0L 5GGTL 2P9RA 1M3JA 3CSYB 1XIWB 3VXUA 4XN4A 4FMVA 2BS8A 4X8JA 4O02A 4P9HL 2V17L 2XY1A 4KKLD 3O41B 3TT3H 1XBRA 2JCCE 4FFVC 5JPMC 5B4MD 5B38B 5I8CA 2WQ8A 3QUYC 4UT6H 4Z7UF 1BEYH 1ZA3B 2OTPA 3L81A 5I75C 1VZGA 4X9HA 3INUH 2JELH 4P23A 4FTVE 4TQHA 1H3UA 3WTUA 4PJAE 4P2QB 4HJUA 4LL1A 2ZCZA 2ADIB 5MP6L 4AENB 4FXGC 1H8SA 2RQ8A 4FABH 1KWKA 2XKNB 4JLRB 1GY1A 4Z18A 1DJGA 4YMPA 2A77L 1USQA 4N3UA 4N6RA 2CR6A 3NCCB 4FZEL 1IEAB 4NQED 4WI3A 1JZJA 3CVHH 4PREB 5ELIA 1JV5B 1MQKL 1ROCA 2VZUA 3KCWA 1W0YT 2ZWKA 5T1DL 4U1NB 4H0GA 4E2OA 4FXKA 4F5CE 3QISA 2E6JA 4XB7A 4CC4A 2F5BH 2VDQB 3QSKB 4ZOCA 1BWMA 4F80A 4BZ1A 3SJVB 1KACB 1YEGL 4MAYB 4JDEB 1DUYB 3I6SA 2FBJH 1ZMYA 4JFXA 4P99A 5FGCE 4ELMB 4EMZA 3V7AE 3L08A 3G9AB 2XN9A 1A8JH 1ZHBA 1PKQE 5I1GH 2D7MA 2APSA 4UAOC 5DMIH 2EVHA 2YEZB 4PJXE 4EEEA 4EI0A 4DQAA 4Z7QE 1DDHA 1R3KB 2FWOB 5HGDB 4KKZA 5DWUL 4QYAA 3L7EA 1VA9A 1U6AH 4NCC1 3WKMH 4B9ZA 5ESQA 4JFHE 5HYFA 4HBCH 2IH9A 2ZJSL 2H2PD 3IDXL 2X4PB 2FECI 2AJVL 3FH8A 4LQFH 4V1DD 1X7TA 1AYOA 3EGSB 3O6ML 3MJ7B 3CZFA 3BOVA 3UZEC 5C07E 1OGAA 1G6VK 3CE1A 3EFFB 3DX1A 4FTVD 4DKAA 5EOTA 1MI5D 5I0ZA 4AQ1C 5K9KA 1Z5YD 1ND0B 2D3LA 3QW9A 1T0OA 3HNSL 4RFEA 2IH1A 4YXHH 4B5EA 1XZ0A 3SOBH 4TRPL 4PJ7B 3UACA 1QASA 3O6FD 1TZIA 3CH1B 3GJFK 3UC0L 3BSZA 1NCHA 1RJZB 1J8RA 3PDGA 3DI3B 4ONGH 3FULA 1ZPLA 5FDYA 4AGPA 4BCZA 2PKDA 2PTTA 3MPCA 2IXQA 3QR0A 1TCRA 3PWNB 5I1CL 1RSFA 3VXPB 3CHOA 5T8IA 2C9QA 4KRPC 3OMZA 4MB5A 1UZ8A 5KANI 4YHZL 2WXNA 5CJ8A 5EUOE 3IDYC 3QEUB 2VRKA 5CILL 2PF6A 3CZJA 3SZKC 1XIWC 3CTTA 2EDFA 2J1XA 2ERJC 1OP5K 4N3TA 3L9RB 4YDVA 4MAUL 1XV8A 2NOYA 3MUY1 5DJ0A 4HH9B 4XC3L 4NQSA 4HWBL 5JNYA 1LEIA 1EAPA 4PQXA 3U6XS 2J88H 2EH7H 3D6GA 1ED3B 3KLAA 1UT9A 2YPKB 3LHPL 4GXUN 1J9QA 3BDBA 3OXSB 4QAMB 1CD8A 1KPRB 5EV7A 4PTTB 4J3SA