3WNJA

1.20 a resolution crystal structure of dioxygen bound copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
298
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic evidence for side-on dioxygen trapped on type 2 copper in copper-containing nitrite reductase
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 100
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wnjA00
2CCWA 3HB3B 2OJ1A 2DV6A 1WS8A 1TKWA 1MG2C 4KO6A 1L9SA 3TA4D 4MFHA 2BHFA 2DY2A 1GSKA 2GI0A 3DTUB 2XU9A 3T71A 4E9XA 2QPDB 2QDVA 4KOBA 2XX1A 2VW4A 2AANA 2VM3A 1E5ZA 3QPKA 4DP1X 1ASQA 3IN2A 4UANA 3H4HA 2EIJB 2DYSB 1ASOA 2HLEB 1AZBA 3PAZA 5I6MA 4HCGA 2AZAA 1MZZA 1ILSA 2PCYA 2BP0A 3IE9A 4F2EA 1AQ8A 4BDVB 4YSSA 1E65A 2CUAA 3RYMA 1BAWA 1A4BA 5I6LA 2FWLB 1JXGA 5I5JA 1ZV2A 4Q8BA 3TASA 5I5MA 2GIMA 3AG3B 2OCCB 1IKOP 3FQ2A 3X1FA 4N8UA 1ETJA 1BQKA 1T5KA 1PCSA 2BP8B 3AG2B 4DPCX 2YAHA 3C75A 1IBZA 2H5UA 3TU6A 2AVFA 1PNCA 3ABKB 1SDDB 1YLBB 5B1JA 5TK2A 1PLAA 3PAUA 4KNTA 1EZLA 3NJLA 4A2EA 1W6LA 3MX0B 1L9RA 4GXFA 1E5YA 3FSAA 4G71B 4WTQA 1GS7A 1R1CA 2PPEA 3D12B 1WA2X 3UAEA 1V54B 2XVBA 3ASOB 3QJSB 3PLYA 5F7AA 4YSRA 2CJ3A 3NYKA 1PZAA 2ZONA 4YSPA 1FA4A 2XV3A 3S3CB 1OCOB 4YSAA 3QJVB 1DZ0A 3OMAB 3NT0A 1PF3A 4FA7B 2BZ7A 3WNJA 1GS8A 4HZ1A 2HX7A 3NJKA 2TSBA 2YXWA 4F2FA 1JZIA 4A67A 1JVOA 4L0PB 1NIBA 1BXVA 3SBPA 3N55A 3V9CA 4W9ZA 2GC7C 2R7EB 4JHVA 4TXVB 2WSDA 2WO2B 2YAEA 1SNRA 3UAAA 1BQ5A 3NJGA 5B1JC 2J57A 2XUWA 3FQ1A 1AR1B 4X4KA 5B7EA 4AKOA 1XB8A 2MTAA 3WKQA 3QQXA 1OCCB 2IWFA 4HCIA 2FQDA 3ZIYA 2GC4C 1JZHA 1M57B 1AIZA 2I7SA 2IH9A 4K9JA 2I7OA 5AKRA 1ILUA 2XWZA 4EF3A 1JVLA 4N4YB 4BXVA 2BP8A 2JXMA 2J5WA 1ZIBA 3FPYA 1ET7A 2FQFA 1QHQA 2Y1AA 3UADA 1IUZA 4YSEA 5D4JA 3TBBA 2IH8A 3JTBA 1HAWA 3PAVA 4PAZA 2UX6A 4A68A 2J55A 2FNWA 4YL4A 3AZUA 2DWSA 2Q9OA 1CYWA 4A2GA 2BWIA 1SFHA 3DIVA 1WS7A 2XLLA 1BXUA 2XXGA 2W8CA 3AY2A 5AZUA 1GR7A 5I6PA 4NERA 2DWTA 4YVUA 4AZUA 2EILB 2YAMA 3T6XA 7PCYA 1OV8A 2FT8A 4KOCA 2J56A 3FU7A 1JXDA 2BZCA 1DYZA 1PMYA 1PNDA 2PLTA 3ABLB 3L45A 1A3ZA 3FU9A 2TSAA 2B3IA 1ZDSA 1AS6A 2W88A 2R7EA 1WA1X 6PCYA 1JXFA 3NSCA 3GDCA 3NJMA 1ADWA 1SF5A 3TBCA 5ANHA 3CDZB 5TK4A 3ZX1A 1AS8A 2XYBA 1NTDA 3CVBA 2H3XC 2NRDA 3MBWB 1L9OA 1MDAA 4ZK8A 2QPEB 6PAZA 4BK5C 1EHKB 2YAPA 1GW0A 3FYIB 3X1NA 3U25A 2VW7A 3FQYA 5I5IA 2EIKB 4AI7A 1A65A 2PPAA 1J9TA 2PP8A 3NJIA 3DKHA 3IN0A 3NJNA 5LDUA 4GP5B 1WA0X 3NSDA 1QNIA 2HXAA 4QKTA 4DP2X 2WO3B 1PAZA 3CZUB 4HHGA 2B08A 4NB7A 4BWUA 1OOWA 3FS9A 4KO5A 1NIAA 2ZOOA 1PLCA 2DYRB 3X2QB 4YSQA 3S8GB 3H4FA 4G7RB 7PAZA 5I26A 1OE3A 2PCFA 4W1TA 1NWOA 3KW7A 5D4IA 4E9WA 4KNUA 4DP4X 4DP9X 1X9UA 1MG3C 3QJRB 1BYPA 1NDTA 2Q5BA 2VN3A 3WG7B 2GBAA 4G7SB 1JERA 2H47C 1WAEA 1GY1A 1AZUA 2EINB 1A8ZA 1M9WA 2VSKB 4E9QA 3IEAA 4HCFA 2HX9A 4E9YA 2BP0B 4KO7A 5B1AB 4BDVA 3UABA 1AG6A 1V10A 2IDFA 4KNSA 4A2DA 2AZUA 1QLEB 1SFDA 2IDQA 2HZHA 1OCRB 4AKPA 2FT6A 5B7FA 4GY4A 1KCBA 2IDUA 3ABGA 4YSDA 4DPBX 5F7BA 3JT2A 2IWKA 5EHFA 1AACA 3SQRA 1NIDA 1OE1A 2GB2A 2CALA 4DP8X 2GHZA 3AW5A 4E9SA 4E9RA 4AX3A 1AANA 3NSFA 3NJJA 1M56B 1PY0A 3ASNB 1IBYA 5B7MA 2FT7A 1AG0A 3X1EA 1CURA 1ZPUA 1PZCA 4HHWA 3PCYA 4YSTA 1KCWA 2BWDA 4WKXA 1SF3A 2FTAA 3X1GA 2IWEA 1KBWA 3SBQA 1AAJA 4KO9A 1PLBA 2BW4A 5I28A 2EIMB 3AG4B 4FAAB 1J5CA 1E67A 2PPDA 2YQBA 1XB6A 1KDJA 2BO0A 2QDWA 1KV7A 3HEIB 4ENZA 2YARA 1ASPA 4G70B 4CSZA 2I85A 2XV2A 1V55B 5D4HA 5B1KA 3S3DB 4E9TA 3FSVA 9PCYA 1E30A 3BQVA 1J9RA 3NP3A 1MZYA 1UATA 3NJHA 1AS7A 2CBPA 3KW8A 2LLNA 3WKPA 5A7EA 4GYBA 4BXSV 2CAKA 4DP5X 4HAKA 5PAZA 1NIEA 1ET5A 1ZIAA 3EH3B 3GYRA 4HALA 3FU8A 1A4CA 2RACA 2PP9A 4E9VA 3T6ZA 3QJTB 1BXAA 1ET8A 2YXVA 4YSUA 2ZWNA 1AZRA 1I53A 3S8FB 5E9NA 3WIAA 4JHUA 3T6WA 5AFAA 1TEGA 2IAAC 1N68A 1URIA 5FC9A 3EH5B 1BYOA 2E86A 1HAUA 3OD3A 4BWWA 2XX0A 2YAFA 1NINA 1OF0A 4M3HA 3OM3B 4AKQA 1PZBA 1KGYE 1XMEB 2UXVA 3BVDB 1GYCA 1XB3A 2VMJA 4P5SA 1SDDA 3PXLA 2N0MA 3UGEA 1CUOA 3X1BA 4UAHA 3FYEB 1KDIA 4CSPA 4NAJA 4A66A 3EH4B 1L9TA 1N70A 2HX8A 3CG8A 4HIPA 2FJSA 5I6KA 2UX7A 3G5WA 2VSMB 1AZNA 2VW6A 3CDZA 3EHBB 3ERXA 2UXTA 3ZDWA 8PAZA 2PPFA 3SBRA 2PP7A 1RZQA 4G7QB 4M4RB 3V9EA 3CVDA 2IDSA 2HRGA 1J5DA 3FPXA 1SJMA 2XV0A 4Q89A 4PCYA 2AFNA 1J9SA 1KBVA 2PPCA 2FQEA 3FSWA 1X9RA 3IBOA 4DP7X 1B3IA 3N2JA 1OE2A 3OMIB 4RH4A 1HFUA 4DP6X 1IC0A 1TEFA 5I6NA 2OV0A 2UXGA 3QJUB 2ZXWB 1AZCA 4YVNA 5I6OA 1FWXA 2QT6A 1CYXA 1RCYA 4A2FA 1OCZB 3PPSA 2XXFA 2VM4A 5B1BB 1F56A 3ZBMA 1JZEA 1VLXA 1W6WA 1NPJA 3WNIA 1GY2A 1ZDQA 1L9PA 1JZFA 2X87A 2A3TA 2P80D 3FU7B 3CVCA 1FFTB 4QLWA 1RZPA 4YSCA 3T9WA 3UACA 1GS6X 5PCYA 1JOIA 3AG1B 4DP0X 4A2HA 2YAOA 3EF4A 1BQRA 1SHXA 4JKNA 1A4AA 3NSYA 4UF7C 2MRYA 2UXFA 2FQGA 1L9QA 4P5RA 5B3SB 3FSZA 2BW5A 1TU2A 3NP4A 1NPNA 2JKWA 4BWTA 2X88A 1NZRA 1RKRA 3NJFA 1CC3A 1NICA 1W8EA 1JZJA 1ID2A 4GP4B 2JFCA 1JZGA 1NWPA 1NIFA 3WI9A 1J9QA 3H56A 4GP8B 2P80A 2GSMB 3QJQB 4G72B 3GXUB 3OQRA 3OMNB 3T6VA 1SHWA 2IDTA 1AOZA 4DPAX 1BEXA 3S3BB 3ABMB 1KYAA 5IY5B 2HRHA 4YSOA 4F7KA 3FT0A 2YAQA 2Y69B
chains in the Genus database with same CATH superfamily
2VDLL 5A2IH 5IESL 2C26A 1PQZA 3IDYC 2Y06H 4LFHG 4WW1A 3QUZD 1Q9KA 5I1LB 1GAFL 5MEPB 4GRWB 5GSRB 1N6QL 1KELL 3CN1A 1OK0A 5FDWB 4YHYC 1I75A 2QBWA 3IGAA 5DC0A 2Z7ZA 3IPBA 4WWKC 3H3PH 2XXMB 1B4RA 3KGTA 2YXFA 3WTVA 3L5HA 1ZTMA 4V1DA 4UMSA 5AVSB 2NY5C 2IH1A 3BPNB 5DJ6A 5C08D 1OGAB 1UQSA 3IWVA 1QYGH 1XWVA 4LKXA 3UIYA 5HDOA 3EGXA 1A9VA 3ILPA 3T3PE 1F4AA 1CGVA 4ODWB 2OMZB 3ZL4H 3IE9A 4GH7B 1EHXA 4QXGH 2CUAA 3F62A 1EZVX 1S2EA 3IMTA 5D5ME 1IBFA 1UZ8A 3N85L 4WKZA 4G83A 3O45A 1KJMA 3WELA 3L8QA 2IANB 3G6AB 2APWA 4ADIA 2NTFB 4U1KB 3QPQD 2BP8B 2IPKA 5FA4B 4XOAA 4Z7WF 3KCWA 5HYQB 2O72A 1UJ3B 3WNOA 1RAMA 2OX5A 3EG9A 4RMSA 3WS6C 1DVZA 2DQUL 4Z8FH 3MNVA 2WXHA 4KMQA 3V4VL 5HGDB 5BVPL 2ALWA 5I6XB 2X12A 3D25A 4TQHA 3U46A 3TGXA 4Z6AT 1ODUA 3FN3A 1T83A 2CNYA 3VI3B 3E2HB 1GS7A 3T0EC 1AZVA 4WNSA 1OTUD 5MEQA 2F1BA 5JXAL 4P57A 1OF2B 3I3EA 2A74A 2XVBA 3FQUB 4C4UA 2KL6A 5SX5H 3ZLQC 1A0QL 2EVIA 4GW4B 5AYTA 1KJVB 1BIIB 1IEHA 2R0WH 5SWQB 2XFGB 3BQUD 3UBXA 3UEZA 1UXWB 1RUKH 3V52L 4CKVX 3IFLH 2VR6A 2VM9A 4PS8A 3VQ1C 5FO7A 5T33H 4MHHG 4Q0XL 1DO6A 1GYWA 1FNAA 4FFYL 4TULL 1M1XA 5FV2A 3VGAB 5IW6A 1GS8A 4YDMA 4CNIA 3LQAC 1JCVA 4APQB 4GUQA 4XHQA 4OGAC 1JVOA 5TE6L 3U36B 4L0PB 1FFPA 4DQAA 1J1PH 2F5BH 2YQGA 4N0UA 2N59A 3V9CA 4IOSA 4BSJA 5IVNA 3D30A 4Q4EA 4YHOH 2DQTH 2DICA 2VAAA 3IE4A 3VAEA 2FR4A 3AS1A 2HWZH 4QRRD 3U4BH 4WRLA 1QLFB 4WTXA 1Z9SA 5CM1A 3ZDZF 4UILL 1CDHA 1LLAA 4B41A 1WWBX 2FQDA 5GS1A 4A6YB 3D2UD 3PE9A 2MQ0A 5K33A 4RMWA 3VG0H 2Y22A 4XN1A 1L6ZA 5ID0B 5IQ9A 2P28B 4ONHB 4XWOD 2K7PA 1R33A 4BZ2L 4NKIL 3D08A 3D4GA 3TFKD 4CBZA 2JCCB 4QD2E 5DHVA 4OV5A 4JFFA 3H2PA 3QUZB 1LMIA 4KTDL 4Y9FA 5HVWA 4OJFH 1XCXA 4AK1A 5IW1A 2CKNA 4Y4KA 4LF3B 1KTRL 2KT6A 1U3ZA 2AITA 1SXZA 5CEZL 3VU1A 2HG5B 5I6PA 4Q52A 3VXUA 4KDTC 3FQTA 4F8LA 2FD6H 2K6YA 5GGVL 4ZNEE 3QG7L 1Q9LA 2F58L 4QHLA 3OKNA 1UWFA 4V11A 3UAFA 3GMMB 3LD8C 3MXWH 1EXHA 4LP5A 4XN5A 4R7LA 2GIYA 1PGRB 5DJ8B 5GS0C 3ZU8A 4Y9GA 3V0DA 2VN5A 4FDWA 4LQFH 3S48A 3C08H 4ZTPL 4OB5L 3UPCA 3HZYB 3LRKA 1A3ZA 3X14A 5CZVL 5I75C 5T33L 4S1QH 2QKSA 5FFOA 1R9FA 4G6JL 3OMZA 4XT1C 2C4FT 5EZOH 1G9NH 1W72H 3QDAA 3TO2A 1VKXA 4Q6IB 4N0FB 3VXNA 1NEZG 5B8CA 1JFQH 3ARVA 1N7MH 4UZUA 1S7TB 3CVBA 5C0AE 3KYMB 3W38A 5DJ6B 5D7KD 5CIPA 3QYCA 2DQIH 4HC1L 4A7TA 4DEPB 3L3GA 3MFFA 1U3YA 1AGCB 3PFQA 3SDCC 3NEEA 1G43A 4KVNH 4R96A 4NENB 3EGSB 1AGDA 4KKNA 3NSDA 4QKTA 1RK1B 2FEDD 3A24A 4PJBE 2YD9A 1QLRB 3KYNB 2W92A 2J8UF 3T04D 4JKMA 5EU4A 4E36A 3U0PA 3L9RB 2IIJA 5IHBA 2CHXA 4LEXH 3HPJA 3MLSL 1IT9L 3S8GB 1ZA6B 2HFEA 2VDQB 1A6TA 1FGNL 2IPKB 1ZTXL 5I26A 1UKTA 1SXAA 2BS8A 1KT2A 1YJDH 2WB1A 4MMXB 3RWEB 2OTUB 5HD8C 3V6FA 2DYPD 4AQZA 1FZKA 3MJ9A 2QELA 5F3FA 1KGXA 2RJMA 3WIFA 1TQTA 4X9FA 3RGVC 3L5XH 1JERA 5HGHA 2DLTA 3B3BA 3G6DH 4H1LH 4A6YH 5INDB 2BP0B 2EVFA 3UABA 4PU2A 3MLZL 1JNLH 1ZA3A 5E5MA 4ZMYA 3EOBB 4OD1H 3D18B 4QRRB 5DQJB 1B0IA 3L4YA 2FEEI 4CVUA 1UB6B 4K07A 4HIJA 4G1EA 4NUGH 4XAWL 1IKFL 3NIFE 3RY6C 4P9HL 3US0A 4F7EA 2WOBA 1JF1A 3NFNB 4C8XA 3QUYD 1FJ1B 4GIOA 4QRBA 4DN3L 4EN2A 5K9JH 4YSDA 4R3SB 1CB4A 3L2LA 1WEJH 2VN4A 4LRNL 3PL6D 4WV1B 1QBBA 5ICZA 1L9NA 4G8EB 3X3FH 3BGFB 4BUHA 3DI3B 5GRVK 5AVVB 2PXYA 4PGBA 4JREB 4IU2B 5E2VH 1E7UA 2P5WB 3NPSC 4UAOB 2IALB 1XGZA 3OWRA 2H0FA 4WO4D 3PS6A 1G1OA 5EIVA 1TJHL 2BNRB 5L2JB 4GQPH 1PEWA 4NKOA 4TSCH 4LP4A 5ACLA 4HPOL 4MJIA 2VXSH 4X6BA 3IMRA 4J4PC 1XSIA 4JM2B 4TUJA 1UB5B 5L4IA 2Z35B 3H8NA 3X13A 1BEYH 4P2RA 3CQFA 1ZLEA 2GIXA 3HR6A 4PJIB 2XA8H 3CFEB 4RISL 3RKDC 4NNPH 5JMRA 1A14H 4Y5VC 5EUOB 3GNMH 2E75C 2K4AA 3AFLA 1DANT 3O4LD 5GPRA 1HX0A 4A39A 3TZVA 4WW2A 1E6JH 3DSFL 4XP5H 5G55A 1I1AA 4KKAD 4XVTL 5AZEL 3L3JB 3FQWA 1WIPA 4K71C 2A73A 3DXAA 5C08B 3S3JA 1ET5A 1QD0A 4HALA 1MLBA 4U6HB 1A4CA 2A74B 1B6UA 1HZHH 2FEDC 3GS7A 3L3HB 4C56D 4QRSB 5C2BL 1N0LB 4HUXA 4DKFH 1ONQA 2RIKA 4Y4HC 1KNOB 1KC5H 2WYIA 4ZAKB 5KYUA 1QW8A 5DCCA 5E9NA 5IW1B 3V79C 2NY5L 2YA1A 4LARL 3EO1B 3MJ6A 2BVQB 3ILQD 3I3BA 2IAAC 1CCZA 4ZXBB 1REIA 3MMEB 5D6DC 1ACZA 3I02B 4TS6A 3GIVA 2FYYA 2YD0A 5JIQA 4Z7QB 2QKIA 3CDYA 3QISA 4PW3A 1WWCA 3IFPB 4XCEB 4KUCD 4WNQB 3IJSB 2DJ4A 5T3ZH 3RPIA 5GS2H 5LN4A 3QRLA 3KBHE 3BWAB 4YFEA 1UENA 4XN4A 4X9HA 4CBPA 5CJXC 2VDQH 4HJUA 4L8SB 4WHTA 3G04A 5D2LE 4F3FB 3EYUH 3JUYA 3EH4B 4JFQA 3VXOB 4IJ3C 4JCMA 2ADFH 4TTDC 5FWQA 3RP1A 2DM4A 2CIKA 4K9EC 4MS8D 1CS6A 2FBRA 1DE4A 3DV6A 4NWUH 2CBOA 2X4PB 1JZ5A 3CDZA 3VSTA 5DVPA 3CBRA 5LXGH 3L3OB 3SPCA 1Y07A 1EA9C 3IB4A 4WJG3 1J8HE 1HEZB 4G2AA 1N9PA 3ZDYE 4NO2B 1AY1H 1IJ9A 3C6LC 4NRXB 1T1ZB 3FSWA 1X9RA 3ABZA 1Y6NR 5I0YA 3EOTL 1QUPA 2VWEE 43C9A 5J3HC 3B2PA 4D8PA 1NGQH 2G0LA 3MCKB 4JMNA 5EBGA 4UT6L 3VXQA 1TEFA 1RK1A 2W65B 2XTJE 5CJBA 1XEDA 1LNUB 2K4WA 5IMKA 3VXSA 1AZCA 4EOWL 2GUYA 4NN6C 1A6TB 1C16B 4GG8B 2CHZA 5GHWH 3TYFA 5FKPB 3S35X 5IQMA 2WUCL 1DEEB 2ESVA 2H2SD 5GJSH 2JJTA 1J48A 1OAXL 5KVEL 1XTMA 3BIKB 4XMPH 3CVCA 5E8EB 3KGSA 5HGAB 1TO5A 4ONGL 5JPMB 2Q7YA 1D5IL 4HKZB 1T66C 2DW5A 2YAOA 3WFDL 2Y5TA 3SJVB 3OQ3B 2OYLA 5JA8B 4O4YL 3PDGA 2JB5H 4IRZL 4KHTH 2NY1D 1MRFH 1DQQA 1QEXA 3TC9A 4Y0GA 3TJPA 2IBBA 2X88A 4UV4H 1CI5A 3DOSB 4LHUG 3FT4A 3ROLA 3US1A 3QB7C 1KPRB 3QXAA 5GRJL 5IQ7L 3OL2A 3KM1A 2M2DA 3ZRFC 1UOVA 1CD1A 5DJXB 3SDAA 1WPCA 3MOBL 4BM7A 1KIQA 1CBVL 2P80A 3MGTA 4WSKA 2VIRA 1EVTC 4JJ5B 4YJZL 4TSBL 2HKFL 3GSXA 4LSRH 3C09B 4RMUA 2G9KA 2D2CC 3BT2H 4G6AD 3TIEA 4PWJA 3V5DB 3WGVB 2NY3D 3W9EA 4WY7L 1DR9A 2D8KA 2Y6TE 3QZWA 5E5RB 1EXUA 1C08A 1MW3A 1WUNT 2VJXA 2H1LM 4PCKA 2AXGA 5JIDA 3CH8A 3QS2A 2Y25A 2EH7L 5DMIL 2JELH 3HS0B 5GS2D 4BELD 3FTUA 4D0DA 1EO7A 4MDIB 3REVB 1UB5A 4OVUA 2EE0A 2X3CA 3EFFB 3OKMA 2OXGA 4PREB 3ZTJG 3L5JA 3QUXB 5FO8A 4LMQE 2YBGA 5EN3A 3VH8B 1VACA 5T5FA 2QSCL 1BAGA 3WTTA 1IL1A 4NQDB 1J05A 5H4YA 3TESA 3IDMA 3QPKA 3WMQA 1M9SA 1ZHKB 4UANA 3LEYH 4ZO8A 2MKWA 2EIJB 2DYSB 4R0LB 3V8OA 5C3TA 3K6DA 3FO1A 3ETTA 1XGPB 1IZKA 4LAJH 1K4DA 5F70A 5I6MA 3EYQC 2GITB 2AGJH 4P5TA 4I0PC 1AQ8A 5HGBB 4L0YA 2XYCA 3OKOA 3ZMEA 2ZOLB 4XTRD 4PSPA 5C1MB 1NC2B 1JXJA 1SXSA 2GUOA 4PJGF 5I5JA 3T0AA 3HC0B 5F3BB 2F5AH 1JF1B 1H8NA 1PY9A 2AK4A 2AV1A 3FO0H 1FCCA 3E9UA 1U8HA 4LASH 3V6ZA 5JUEH 2NY7H 4OZGF 1IKFH 1BQKA 1U21A 3V10A 4X4YB 2HKHH 4H8PA 5MEOB 1A3LH 1H3VA 2P45B 2R29L 4O2FA 5EO9B 3OPZH 1MRCL 2IC2A 3SD5A 3IFPA 1E5UI 3O9WB 4YIQB 5EN2B 4R4FL 2SODB 2AVFA 2PXYB 3IFOB 1KCUL 1C8QA 3CSFA 4PJXE 4BQBA 5I15H 4WU5A 2XI9A 1T2JA 2GJ6E 3HC4H 4J3OD 5C8JB 1I1CA 1IFHH 2WYTA 2HTKD 4WHCA 43CAA 3UTPE 4GXFA 1NKGA 5KBPA 1FL6A 5LBSH 1ZT4A 5IJKC 3QJSB 1BFSA 2FX9H 3HJEA 1JPGA 1CU4L 4PB9H 4YSRA 3NYKA 3ZPDA 4EIUA 3LKPB 3K5RA 2CPCA 2OMXA 3MBEA 3ARGD 5B39A 5I0WA 1I8IA 4ZMXA 4NZUH 4OFYA 1TZIA 1QFOA 4FLOA 2XA8L 2WGXA 2O6DA 3GKWL 5IV2B 4HPYH 1YMHB 1XT5A 3V7AE 3IKCB 1HHIB 4JN2B 2CG9X 4Q6IC 3RVWC 5KSUA 1QFWI 2IPUK 3OXRB 5AAWC 3WBDA 3JWOL 2JSFA 2J88H 5C0CD 2UZYA 4X8GA 4C4KO 3ILPB 3DHJA 3ZGHA 1QRKA 2VGLM 3SOTA 3L1OL 2WLLB 1TVHB 2HH0L 2VLRA 4DQOH 4ZS7H 5BZXA 2JIXD 1CLYL 3OGCA 4Z3TA 1DFBH 1N67A 1FC1A 4L9DA 4WUUB 5BMFH 3MUHL 3VXRB 4UT7H 3AB0B 3K81A 5TE7L 3PWUB 3ZIYA 4PGEA 4KXZH 2IANA 4MB1A 4XCEA 3T4AC 5DR5L 3UYPB 4G11A 4TUOA 2Y7OA 1KPUB 4M4RA 4WZ9A 2AK1H 5B21A 2GBTA 2KDGA 3AREA 2VYRE 3C5SB 3T1FA 3TO4B 3U4AA 5ITFA 4YSEA 4F7CB 2Z31D 2OULB 2DKUA 1KEML 3SJVE 2UX6A 5TDPA 1XIWA 2CIKB 2NQDA 1Z9PA 2NY0B 4JRXA 5D1QD 4A68A 3FOLB 2LGNA 5J13C 5BJTA 4LEBA 3BGFC 2O5ZL 4KI1A 4K5NA 2B8OT 5F71A 2ZSWA 3SO5A 2WUBH 4Y1AB 3D0AA 1AP2A 2XN9E 4F7PB 2CSPA 1GR7A 4ZTPH 4IBQA 2J1WA 1XH3A 1HZHL 3TJHD 1A5FH 1SYSA 3MUJA 1Q0XL 1OY3B 2CLZA 1MJ8H 1UM4L 1DCEA 4ABVA 1EXUB 3WTYA 4WI7A 5F89B 3BUQA 2VMCA 3FU7A 5DSCB 2C3VA 3HKZA 2AXGB 1UVQA 5D70H 2I5YL 3N41B 3S36L 5IMKB 5LGJA 2HJLA 3IJ7A 3NZUA 4IKNA 5A2FA 1X5LA 5G4OA 1FFPB 1T7YA 5JHMA 4PR5B 2R0LL 1MCIA 3OAWA 4P4KA 4Y19D 5KSBB 5DEJA 1JXFA 3KWVA 1QFUL 4HJ0D 4LLWB 5AW8B 3UYOD 4NUQA 4YXKH 2WGNB 4BIKA 4WWKD 5GGTL 2J12B 3VH8A 4ZUSB 4TTGA 4U3SB 3Q8FA 4QXTA 2CHWA 4JKPL 4LPCA 3NZHH 3LNIA 2EDNA 3VXRE 4BQ9A 4RMBA 2KDYA 3HIZA 3QHZH 2XETA 4Y16C 3MLSH 1PW3A 1FE8H 3FQYA 4BZ1H 1FGNH 4HS8L 2N7AA 5EO0B 5CFHA 3GFUA 4UUJB 5L4JA 3VFGH 1OLLA 1UXSB 4G42B 5H35A 1XGTA 4V33A 5DI8A 4UTAL 2XZCL 4GUPB 4NM4H 1R4XA 5BO1H 3BWUF 4DKEL 3A4EA 3NFPA 2GJ6B 2XZQH 3GBML 1EHNA 3HI1A 4NB7A 4ZI8A 2MPAL 4MRCA 5LO7A 3NCYP 3BAXA 4L8DB 2Z8VC 3LZOA 4Q7DA 3VD5A 1JI1A 3QWRA 2OQJB 2X2YA 2F54D 3UBXI 1YY9C 3B2VH 4O9HL 5DJ0A 5KJRL 3W39B 2G4GA 2Q7AA 4E9WA 4K94H 5EA0H 3QIUA 3I6SA 4UZSA 1ACCA 2D7OA 4L4TA 1GTFA 2Z1PA 5I2IB 2CDFB 1RK7A 4LU5H 4QHNB 3U0TB 2FJHA 1GIGL 3UO1L 4Y8AA 3X3FL 3GS4A 4XP9H 5BOJA 3M1OA 3DO7B 4U1MB 1CDYA 4I5BA 5D1QC 1AG6A 2L4OA 1T66D 5I30H 4EIBA 2HFFB 5DJYA 5D1QE 1CE6A 1BMWA 5ITBL 4B53A 4H5SA 3WLBA 4AKPA 4FRWA 2NY1B 3VD1A 4G9DA 3CUPA 4KDVA 3VFWB 4L4TD 2VUKA 4ZTEA 4B50A 1EEYA 4Z9KB 4HD9A 4N6RB 5I76A 5CJXA 1YDPB 2EYRA 2BIOA 1QACA 1YNLL 5HHMD 1J12A 5C9JA 1PZ5A 3W82A 5C0FA 5B22A 3GLZA 5DRZA 3HE6A 2YFOA 3F7YA 2OL3A 1AANA 1JN6A 3MOQA 1MIMH 3IMSA 5C7XH 5F3BA 5HHQB 3R1GL 4HWBA 4NZRL 3MRMB 5I1EH 2WSPA 2DWXA 2AQ2A 5I6XC 5I28A 3ARBD 3BKCL 4YPGB 4Y1AD 5E9DA 4ACPA 2ZP8A 2QDWA 5IUCA 4RX4D 5ID1A 2OSLB 2H2PD 1ASPA 1KCKA 1RMFL 2WPGA 4JZNB 1IBHA 4PI2A 4R26H 4U7MA 1BGXH 5GGVH 1U42A 2BOLA 3QUGA 3QZLA 3I6KB 4UQIM 1AR1C 1M05B 5KUKA 2C1OB 1J9RA 1SY6A 4PTTA 3BKJH 2I69A 1QASA 1AS7A 1NBVL 4FQQB 5C92A 4F2MA 3ZE0F 4UM8A 2E9WA 2XNAA 3EYVB 5I23A 1QKZH 4DP5X 2WXGA 3NIFF 1UD8A 3O3BA 1NGXB 2ZYSA 3KGRA 3WEOA 5PAZA 4P23D 3KLLA 3HC3H 4XNQA 1LEIB 3K72B 4E9VA 4CVZB 4L1LA 1DVTA 2NNCA 4EJ1C 2YXVA 2WYHA 4R0LC 4U1HA 3MRJB 4AY0A 1Z32X 2ZAGA 5F9JB 2J1YA 3FO2A 1E9QA 3ARDC 4NRZB 5JZ7C 2R27A 2YLHA 3SQOH 2E86A 3CQQA 4A2LA 1SMAA 1H5BC 4TVSa 2OMTB 2YEZA 3KEDA 1F5WA 3PHQB 2BNRD 2RQ8A 3QAZC 3FBKA 2XRAL 3EYSH 3OM3B 3P02A 5F89A 3BIAX 3Q3GA 4WFHE 5F7LB 1BIHA 1SDDA 3FO9B 5DTFA 2YC1A 1LD9B 4GMSH 2WLLA 5LWYH 1EH9A 2JLPA 3RDTA 5EOCJ 1N6VA 1S4IA 2Z0UA 4Y5VA 4UU9B 3NACL 2IBGA 4PR5A 3P77B 1D9KA 1VGKB 3RJQB 1FSKC 3Q1SH 1EEZA 3O6FD 2QQKL 5CJQL 5L8JB 5AWNL 1NCWL 4PJBF 3KLHD 4ZUVB 4UT7L 3DX8B 4OZFB 3LPOA 3ZDYB 4MJIB 1P4IH 4Q9QH 1ADQL 4E42A 4E2OA 3VRLF 4RRPM 4F8TA 4ANUA 4QHUB 1YZZA 4X6EA 4FMFA 3R0MA 1TTUA 3QNXA 2C1PA 4XBMA 2E59A 4U49A 4Y9CA 2LU4A 1J8KA 1UCTA 5ITFB 1J9SA 2P5PA 3S5LA 3HCVB 2J6WA 3AT0A 3OG4B 4JM4H 3KWTA 5DK0B 2EDJA 4PRDA 1ROCA 1E4JA 2C8NA 1T6VN 1NEPA 2NXZB 2WLIA 5E6IB 2G2PA 3RA7L 4KVCH 1F90L 3DHUA 4N0YH 2VDKH 3GBEA 2HPTA 4Y7MA 2X1QA 1DN0A 5F7EH 1UM6L 1TZHB 2BVYA 4HFUL 4WFHD 3K0YA 3TJHC 2JI3A 4UTAA 1QRNA 3B5HA 4FG0A 3NCJL 4JRYE 4P2OB 3LPWA 4YBLC 4I3SH 1H0DB 1NPJA 1OD9A 4F20A 4U6XB 2RCSH 3P9MB 2VABB 1INDL 2A83A 3DVNB 1FFTB 4JDTH 4YSCA 2FDBP 3W0WE 2K3TA 3ECVA 4HV8A 4U2ZA 3QEQB 1KXTA 2AEOA 1DQJA 5I66A 4JKNA 1T0MA 1S5HB 4OVVA 3VE0A 5I1LA 3PWNB 4IMKA 4XXCC 1K2DA 1NICA 4WI3A 1NCBL 3WLBB 2GY7B 5E94B 2JFCA 4PJEA 1QSZA 3T0EE 4IBSA 3GSWB 1MFUA 3G6JF 3RL2B 1MW1A 2BMKA 2F7PA 3OB0K 4NO3A 5JW4N 1K5WA 2K7QA 2AAVA 3M8OH 4LCYB 2BHYA 3DX2A 4MAYB 1RP9A 2HLFC 5IFHH 4G42A 5EF0A 4HS8H 3K91A 5E8OB 2PO6C 2BFVH 1MCKA 3MTXA 4PS7A 2P8PB 4YLBA 1M7IA 4CMMB 4HUUB 2OJ1A 4YPJA 1DDHA 3U48A 4QXUH 5TDNB 2VDRL 43C9B 3I6GA 3ZDZE 3V52H 4LCIL 1N3NB 1TKWA 1W16A 2DRUA 3VMPA 1GGUA 2HN7B 2KPNA 3NGBC 3R19A 4KO6A 4AEHL 2YHGA 2F53E 3O45B 3B8YA 3FL7A 3O6FC 3H2WA 4F1SA 2YMOA 3VFNA 1EVUA 1YQVL 1KGUA 1AC0A 5IBUG 1UYWL 5D7IB 3L4UA 5KJRH 2WTRB 2JCCF 4LT7A 4XPGL 2VM3A 4CN6A 1EHLL 2VLRD 3LAFA 5EA0L 4WWKB 5EC2A 3IDXL 4QHNA 1IVTA 5F7EL 4JFZL 2B15A 4GSQA 1W72A 4ANXA 2GI7A 3P1VA 5EZIH 3IAGC 1T1XB 3TYGL 1NFDB 5D5MA 3CZFA 2AJXL 4XZUA 2NZIA 2Y5TB 1D7DA 2CJUL 4YBLB 1HH9A 2G9HB 3VDAA 2OSXA 5HYEA 5J0BA 1DQDL 5MEQB 2CDGB 5CGBA 4Q8BA 2CQVA 4JAMB 4UQ2A 4OLZL 1IKOP 3BZFB 2V2XA 3KPNA 1PCSA 2JXMB 4OQTH 3LN5B 4JFHD 3OR6B 2PW2B 2WAHA 1AGBA 1I8AA 5INCB 1RLBA 3B4NA 4FYRA 5LUMA 1KIPB 1XSOA 4WEBH 2V7NB 2ADGB 2UUDH 4ODWA 5IJDC 2WO4A 2HRLA 4LKCA 4ZW7A 1UCBH 3QI9B 2YRLA 4LVHB 1L9RA 4PJ9C 5IJBC 1IGTB 4ELKB 4IOFD 2LQRA 2PPEA 3D12B 1VPOL 3LDBC 2EEAA 4MD4A 4EUPH 5K39A 2GTWA 1V54B 5F88B 4HH9A 3FTGA 1OTTD 5TQ0L 3G6AA 2Q3ZA 4EOWH 1URLA 3DV4A 3ZUNC 1S5IH 2BERA 4HCRL 2ZONA 1N4XH 4YSPA 1JPFB 3BSHA 2GJJA 4ZPTB 4XN8A 2R2HA 4XMWA 1BGXL 4AH2A 3ALWA 3GXFA 1K8DA 3ILQC 5JW3H 1Q90A 2DQFA 1BD2E 2A0LC 4N8VG 3ESVF 2R29A 1HKLL 1MREL 2XACC 1DJHA 4JFEA 4A67A 3KS0J 5C0IB 1GJIA 4X5XB 2AJVL 2JCCA 5DHVB 1EJ8A 2N01B 1H5BB 1B4TA 1YYML 2FGWL 3I50L 3QUKA 4LRIA 3HC3L 4XNAA 4HQQH 8CGTA 4A7SA 2YD2A 1E5BA 2XUWA 2FWSA 2A9NL 2CKBA 3UZQA 2CO4A 4APQC 4AKOA 2UVEA 1RP8A 2VQTA 2MTAA 1J9CT 2DLFL 4KZDH 2GUOB 4R9HA 5I1DA 1OCCB 4O02B 1H8SA 3KLAA 4MKTA 4KKLC 4G7YH 5AKRA 4IBUA 2F8OA 5KS9A 4EKJA 3DVNA 4RQQB 4XPFH 4B9YA 3LNFA 4MAYD 2JK5B 1ZLSL 4UTBH 5FF6A 5CGYC 5EBMB 4PBDA 3GZQA 5D1ZI 5IBLC 5ALBL 3B6SB 3Q9PA 3O3UN 4DOHE 4HJEA 1MPAH 3BGAA 3Q8AA 1AHWB 2IBZX 2I9LA 3QDGB 3Q8EA 4IBTA 3TA3D 3CDFA 4H20L 2EDDA 4WI0B 5TF1L 1SJEB 4XBEL 1X5XA 4WI9A 1N19A 4GLRI 2XXGA 4YX2H 2Z3FA 5HJBA 1IGYA 1PLGL 5AZUA 1X5HA 4X42A 2X05A 2AK4E 5CP7B 4DEUA 3BZ4A 4M5ZL 1NSNL 3HCVA 2R56L 1P4LB 3GI8H 1F4XL 3MLWL 2J8OA 1K6QH 1B0RA 2C9AA 4V2CB 4JM4L 1U92A 1OALA 2YGQA 3KPQA 1O9VA 3V0VB 1EERB 4OZ4A 4RRPG 3IKCA 3K1KC 4ZAKD 2H3NB 4NENA 4HFWA 4CGUB 4GO6B 1UHVA 1U8OB 4ZXBD 1WEJL 3FFCA 3S88H 9CGTA 5ICXA 4ELMA 1MCNA 1QLRA 3KYNA 3QPXL 2AS5M 5DD1L 3K6NA 4F33A 3E8VA 1TQWA 3DXAD 5A43C 4FXGC 4YDJB 3VFGL 1I7UA 1Y0LA 2WQ8A 1T21A 2VE6B 1HCVA 4GRLB 3SGJC 2H1PH 2PCFB 2BSRB 3C6SB 3NDZE 4R4FH 4X6CE 2X9WA 2UZIH 1D5ZB 1W72B 2W81C 2DBJA 4G8FA 4XNYL 4NNYB 1OKEA 1IC7H 4Y4HD 3BIBX 1ECZA 4AI7A 2J5LB 5IGXL 1XDTT 4NHUA 4J6RL 3DKHA 5IR1A 4P2RD 5KVGE 2RFXA 2EIDA 1XVSA 1HCFX 1CZ8H 1I9RL 1K2DB 1TZGH 2D9QB 4LSTL 4Z7QF 2GCYA 4O00A 3PQYE 4OLWL 3U2JA 4J3UA 2MKLC 3U7YH 4KO5A 2ZOOA 5D7SH 5F21B 3ZOAA 5D7LB 1RZJC 3DECA 4IU3B 4RA3A 3QWOB 1M6OA 3OXSB 5HHNA 3L08A 5EO1B 2OXHA 1TO4A 1O7DC 5BNXD 2X4OA 3PWVB 4NQTA 4YWGL 2ITDA 1CGUA 1PKQE 1A6WH 3K5SA 5FGBC 4ZFZB 2YS4A 2NUPA 4M48L 4BFEA 3B5GA 4Z0XB 1E3XA 1LL1A 1M7DB 2R69L 2NNAB 3IU4L 3MV11 4L29A 2NY5H 5E56A 4LOUD 2R39A 3LKNB 4KK5D 3QI9A 3FDWA 3JWOH 2M1KA 3H7BB 4OT1H 3C5XA 5C9KA 2PWEA 1U3HB 1NAKL 3DRQA 5FHAL 4KRPC 3N1QC 1O9ZA 1YEKL 4AW4A 2EXSA 4C4KT 4HA1A 5JR1H 3TTSA 3H6AA 3A6CL 3BD5A 1NCDL 5B4MD 3QXDA 4NJ9H 3RWIB 3DTXA 5JHDE 5TE7H 4Y5YA 6FABL 5B7FA 1G4RA 2WLJA 5K5YA 3KZ8A 1KT2B 1FVEB 2LFGA 2EKJA 3QIBB 4K8RL 5DJCA 2A1WL 3PQYD 1QO3B 5EU3A 5DLLA 4I87A 1B0GB 3FW6A 4FCHA 2F8IA 4P3WA 2PR4H 5D5MB 3UYRL 4AG4L 2IOOA 4L1BA 1HHJB 4TOYL 2V8LA 4ZBJA 2JJWA 4HF5L 5E6YA 4YXHH 1PZSA 2R2CA 2AJXH 4I4WA 4I2XA 3ASNB 4RX4A 3IXAB 4X7SH 4JAMA 5DVLA 4YFDB 4L4VE 3UDWA 2XG4B 2WBJA 3MV8A 4DWHA 1N5YL 3H6JA 1Z7JA 4YDIL 5DFAA 1SF3A 4J3XA 4NI3A 1ZLUK 5JHBA 3BPCA 4G1EB 4PBXA 3PUUA 3EO9L 4NFBA 4OM1H 5KYWB 1J5CA 3V4PH 3EFDH 5MP6L 2BO0A 5MENB 3K2KA 3L3DA 1IGMH 3BQUA 5KS9B 3V9FA 3F84A 5L0QB 4WV1A 5CWSB 5B1KA 3QGVA 4E9TA 4R4BB 3HE6D 3BUYB 4AEIH 4EEEA 2UVFA 1FPTL 1SBSL 1JK8B 4UT9A 3KPOA 3KS0H 5GHWL 5TE6H 3RL1B 5BCAA 4GYBA 2WVUA 1UGKA 2B77A 3CLFL 1CD9B 1QPKA 4EN3D 3FU8A 3RVVC 3OKDB 1A1OB 1XR9B 2NXZD 3G5VB 3QJTB 5E6ID 4BKLB 5E08L 5DWPA 4WK4B 4JHUA 2NCMA 4YS4A 1C12B 4ZFGH 2R2HB 3FH8A 2BCMA 3TV3H 4H8VA 3FTVA 2E7HA 3BZ4B 3C60A 4OIIH 2DQEH 4ODXB 4R6UA 4M1GH 1T03L 4L37A 3T08A 4HKJB 1AXTL 1EEYB 1KGYE 2WZAA 1T4KB 2OKMA 2GFBB 2VLKA 5DWUL 4JZJA 4L8BA 4PRPD 5F44A 1NA8A 4J3BA 2A7BA 1D5BB 2O61A 3ATFA 4RISH 3CXHJ 1URZA 3HUJA 1AI1L 1NMCC 1KDIA 4RIRA 4U3HA 3BUDA 4JFFD 5ICXB 4DKEH 4HIPA 5CIPH 2F54A 5AZEH 3EJJX 4G43A 1OARH 4UV7L 1GZHA 1ND0A 2Z8RA 3JQOB 4QF1A 3IDGA 2VDLH 2B16A 2JKRM 4XE0A 4JZJC 1YNKH 2DMKA 5EOTA 2IAMC 3O2DH 3ES6A 2JELL 3IRZA 4YC2B 1LXMA 2V9UA 2EXYD 5E1AA 1KBVA 1PZDA 1BFOA 1LQSR 3E6HA 1UM6H 4P59H 3WTSA 4NHUB 2G0KA 3WAJA 2ITEA 1PFCA 4E9LA 1AD9A 2VQUA 1KCVL 4JCWA 4ODUB 5AALA 5SWSB 1PX3A 4OZGB 1JPST 1MCEA 3F7VA 3IGAB 5EEWA 2ZOWA 2PYEA 2BSSA 3QRBA 2QPFA 3QJUB 2BK8A 3WHXA 2H4EA 4N8VA 1PSKH 1RCYA 5CEXB 4CVZA 1OSEA 3HMXH 2ZZUT 5G5DA 1MDTA 1S9YB 2X4OB 4N9OB 1X6NA 1MFBH 1NKOA 1XH1A 3FCTB 3ML9A 5HDBB 4NO2A 1PTZA 5AB1A 3WUWB 2CU9A 1S46A 2NY2D 3MBED 4HGWA 1G6RH 4HJGB 2W9DH 3T9WA 4FEIA 4LASL 3LZQA 2VR8A 4FG6C 3RHWF 1XD1A 3ZHKA 5JPNC 5D71L 3IFNH 2JCWA 2ESVD 3U82B 1JGVH 1JK9B 1LNUA 3HA0A 3CVHL 3NEOA 5C09B 3D0LA 2WXIA 2VLMD 5IBLD 3U0WH 1ANUA 3IJYA 4WJ5A 1I7UB 4LLAA 4Q58C 1KPVB 3VRJB 1A4JB 4L1TA 4NKQB 2E7MA 3D9AH 4XNMB 3BKCH 3TT1L 3LXBA 5KS9E 3HFFA 3L9EA 3V6BR 2WD0A 1P53A 1AXSB 4MLIA 1W9XA 1RZKL 2Z31B 1K72A 2LOEA 3B7TA 5FB8B 1V05A 4AYMC 4E42B 2WY3B 4IGBB 5EU3B 5BOZG 5I1GL 3MROB 3I6LE 1NGPL 2YRZA 3SZKC 4F7KA 2V17H 3IDJA 4KAQH 2ZG1A 3CSBA 4IJTA 4Z7WB 2F8VA 3B2UC 1I8KA 3F58L 3MLZH 4RSVA 2GCYB 1I7RB 2D3JA 3HLKA 3SGJA 3VDBA 5G4NA 1WS8A 3EJTA 1D2PA 1FL3B 1NSNH 2VKWA 5I1AB 2I24N 3WY1A 1G9ML 1OO2A 1S6NA 3MV8B 3OV6A 4HOZA 3FUMA 1YMMB 4MS8C 1RZ8A 2ZCZA 2ZX9A 4OGZA 3PXJA 2D3LA 2VIRB 2DS4A 3N5AA 2FIKB 5CUSL 4YBQD 2V6HA 4Z7VB 2OBGA 5B1CA 3V4LA 1A6WL 2ERJC 2NNAA 1C5DB 3CN2A 3QJFB 4F7MA 1OAKL 3H4HA 4APQA 5MHSE 3IU3A 5J11C 3MRLB 4K3EH 3RWFB 3TFBA 4KRPD 1HL4A 3L5WB 3DUSA 3LH9A 3DX9B 4YHLH 4K7FA 5TTRA 3RYMA 4LVNB 2NY4D 3RTQA 4MCZA 1QMUA 1T0MB 2Y6SC 3GRWL 1S7RA 2XWTA 4P3DA 3OJDA 5IB1B 3IJ9A 3UTTE 4JQIA 2HLAB 5GS1B 4JDEB 1IM9D 2OMUB 3T77A 2GIMA 3ZQ9A 2XJLA 1BZOA 1E28B 3SSGA 5FWRA 1PKQB 4FMVA 3QDMB 4JG5A 4RNRB 3GSOA 4GT7A 1MEXH 3WFEH 4YAQA 4FYQA 5A1AA 1DEDA 2R23B 4NO3B 2GFBA 2AK4D 5C0DB 2NUTB 1ACXA 2FJGB 3TBYA 1CLCA 5KSBF 3BVTA 3QIWC 2X4QB 4M6AA 2DQGH 3OKYA 1LO4L 3T4AB 3MX0B 1KC5L 5IM7B 4PYGA 4HIQA 4ERSH 4QXWA 2YMTA 2VLRB 3ESUF 4BGDA 1KJ3H 2WWMC 3OGCB 2J5LC 2DWYA 1BLNA 1NDMB 4OM1L 5J1SC 8FABB 5I19H 4PJ7F 5KSVB 1NAKH 3N40P 4EAEA 3P4MB 4ZMTA 5DD5H 3SKOB 2XXCB 1SJHA 2PTTB 3Q5TA 3MNWA 1LK3H 2BRQA 1JGDB 4HZ1A 1WZLA 4FXGB 4P5KB 3GT6A 4OZGA 3GBDA 3WEXB 3JTTB 4I13B 5EBLB 1KXQA 4ZW8A 2NNRA 3QG6A 4NS0A 4AJWA 3RLSA 2ICWB 2PN5A 2VZTA 5DUBA 2XIDA 3VXMD 1MPAL 1L3NA 3HG3A 4OJEH 3WKQA 4KKLD 2PO6A 2KS0A 4D9LH 3UZVB 3RZWA 2JTDA 2YMXH 3HNSL 4N2NA 1A47A 1IM9B 4NLAA 3OPZL 2DJMA 3MUGA 3BH9B 2QVFB 5HYSB 2I7OA 4CKQA 2F74B 3C2AL 1ILUA 2UY7B 4J4PD 4MNHB 2A5UA 3SPVB 5EEZA 1HWGB 2X9ZA 1L3WA 2JXMA 2PR9A 5E5UB 5BVJB 4H0IA 5GGRB 2IFGA 1IC1A 4NHCH 4L4VD 1RD6A 3CMOH 1BVKA 4KX7A 2BS71 4RGNB 7FABH 3GKWH 3SGKC 1OT1A 2NZ9D 3UFIA 3JTBA 5IIEB 2ADGA 3VXMA 1D3CA 3BKYL 2ENYA 4Y4FA 4CADB 3D0LB 1IE4A 1CFNA 1ZK9A 3STLB 3U0PB 5JORB 3MLWH 3W0WB 4DGIL 4TQIA 1BMGA 3P0VH 4QJ4B 4N2MA 1A6ZA 2ISDA 4HJIA 3VXRA 4J7RA 3T4YA 2IH3B 4P48A 1M2VA 4MDRA 1TT6A 3L5XL 1NFAA 4M7ZB 1CF8L 1P0SE 2NXZC 5E6IC 2FE0A 4ZMAT 1FP5A 4LLUA 1KY7A 4OZFH 3U9WA 3WIFB 2WTOA 2EILB 3HNTH 4MS6A 5DJAB 3EBIA 1MFNA 1U0QA 4LCCB 1IGCL 5KVGH 1PX8A 1BDYA 1YY8A 4MQTB 1G7PB 5T5FH 1UFGA 2ENSA 4GUPA 3GK8H 1A9EB 4PJ7E 4P46C 1N64H 4XO5A 1CD0A 2V9QA 2XQBH 1ZDSA 4MDJB 5TDOB 4YL9A 1JZ8A 4M7KL 6PCYA 1DSYA 2NX5B 3NSCA 3D5OF 5FXCH 3MLVL 5IHUL 2BIHA 4Y2DC 4L8DA 1X4XA 3LQZB 3SE4A 4J6RH 2I60L 4K8RC 1BOGB 3VXSD 4W9GC 5I16B 3UTSA 1YEGH 5AAPA 1PX4A 4WHDA 3ZE0B 1W8OA 3B43A 3DBXB 2ZNWA 1R3KA 1YN7B 3ARFC 3Q8BA 4KVPA 5DFWH 2J2ZA 1BOYA 2CM6A 4N22A 3MRGA 5JW4Q 1SLWA 3H3KA 1RULH 3CH1B 5EEXA 4FKHA 2VDKB 2F61A 3DUUB 4JRWA 3UXFA 5DJ2B 3SE8H 4DZ8B 3JV6B 1IX2A 2B2XH 3DSNA 2FJHB 3NQKA 4N5ED 5BS0D 4FHBD 4UM9B 4JM2A 3D52A 4TUJB 2PO6D 4FN0A 2GEEA 4RGMB 1K3ZA 1WGOA 4OLVL 5AVRB 4CGTA 4XPHL 1A02N 2YPLB 3L6FB 4GG6F 4HS6B 4EDXB 5C0NC 1JGLL 7PAZA 5FB8A 5GGSA 3MUUA 5SX5K 2PTVA 4YAQB 5SX4I 4GSDL 3PGDB 4X7EC 3N6YA 2E46A 3T3MF 4S1RH 3VTMA 4EE2A 2X4TB 3EXLA 2X4QA 1CL7I 4CMHC 3DXAB 5FYLE 1MREH 4OJAA 1GOGA 4R7DB 5F96L 5HHOD 4LFHD 1A8ZA 3UZEA 3NJXA 5JYMA 2WXQA 4RDQF 4K8RH 2AQ3A 4NQQA 1B3JA 5J11B 4E41B 4L1DA 1T5WB 2IG2L 4WW2F 4ELMB 2R69A 4HULB 3BH8A 3V7MA 1YC7A 4K71B 3ZHNA 4X7SL 4FXLA 4GKSB 4UIMB 5B38B 1AVAA 1TOXA 1N64L 2OSLA 3FMGL 4PQXA 5MI0C 3SDXE 1GZHC 3DNKA 3W5NA 2IXQB 5BV7L 5IT2H 3QH3B 1QATA 4L4VA 4LPUA 5FS5A 3WEXA 4R8WH 1NL0L 3MOAL 3KNBA 2XNAB 5TGBB 5E5LA 3RWCA 3D25B 4XMZA 4POUB 1PY0A 3RTQD 1EBAA 1AG0A 1QAWA 1YEFL 3GSUB 1IQDB 3DOHA 1NCIA 3BLBA 2HYMA 3PRZA 5JHLH 3OWEA 1V5JA 3J27A 3V4VA 2PO6B 3FU0A 3OKKB 1YN6B 3CLWA 1HS6A 3FRPB 3DJRA 4ZX6A 1HEJC 1JYWA 4LSPH 4QAMB 3UG3A 2P43B 3D33A 3HKFA 3CFCH 4D8OA 1KV7A 3GHBL 1ECYA 4R5TA 4HD5A 4M8QA 1OW0A 1QWHA 3A6BH 2VL5A 4M5ZH 2I85A 4ZX5A 3RDTC 4M1DL 3SYOA 2EYRB 1E4XI 1HWWA 5AB2A 4KKAC 4RDBA 5J6HA 3NABL 1A22B 2R1XB 4NQED 1MZYA 4FTVB 3MX0A 5DHEA 2J88L 2X1OA 4LLYB 5IIEA 5FKAB 4BD4A 4NXSA 3FN9A 5T3XD 1ZIAA 4LNRA 4R2GB 2F7OA 4M1CD 1Q72L 2Z6FA 3H7BA 4UDTB 5DD0L 2PP9A 3PIQA 4ZMQA 3T6ZA 5SWSD 1CICB 3U4KA 1SYVB 4AXWB 1C16A 1PEZA 4LB8A 1H8OA 2WMPA 3C5ZB 1R3LB 5AFAA 4YZWA 3OGOE 1ERNA 5C0GB 4NZRH 4I9WD 3T0XA 4OF8A 3GPSA 3MO1B 3JV4B 4WUKH 3P30L 3SO3C 1VESA 1LO3H 3D2UA 2OZNA 1CLVA 2QTVA 2OZ4L 5JO5B 1NOLA 4RFNC 5EIIA 1HOEA 4RAVA 4UOW0 2GG1A 1NCTA 5CLWA 2OX5B 5D72L 4G3YL 5GRJH 4KVNL 1HKFA 2XWJB 1FBIL 4WCYL 3IWUA 5L6YL 3EYVA 4BK5A 1G7PA 1NBYB 3FYEB 2O5ZH 1PZ2A 3O3DB 4XNQB 1LEIA 3GXMA 2W0FA 2VT0A 1CZ8L 2NY6D 1V3JA 1PU0A 1SLUA 1ZWIA 1J0KA 3U83A 1CD1B 2B39A 3KPPB 3QIWD 1E6OL 2JQMA 5JQ6L 1IM9A 8PAZA 1J1XL 2PPFA 3CK0L 3VFPA 4JGNA 1KLFA 3HB3D 4GW4A 4HVBA 5BV7B 2VXQL 1UJTA 4ERSL 3BN3B 5CR8A 1ETA1 5I73B 4MKMA 3QZWB 1JWUA 3N44B 1ZV5A 2NX5E 3L95B 2VABA 2R83A 3N2JA 2FSEA 4KHXH 1A0QH 4KX9A 3JV6A 4OIFA 3BUYA 1HFUA 4DP6X 1AD0B 1EUTA 4Y19A 1U8MB 5MEND 3KYKH 2H41A 1KSRA 3PAYA 2BNUA 4IGBC 4C4BA 1NM9A 1PKOA 4AGQA 1NANH 5ANMA 2ZPKH 1OCWL 4YXKL 3VYPA 4KI5F 5FA3A 4JRYA 4E5XA 2H2SC 4NQDA 4OU3A 5IMOB 3R06A 3X3GL 4RMTA 4UYPA 5DZJA 3SQOL 4Q6IA 4HSQA 4ATWA 4TVPD 5I0DA 1RPQA 5ILTL 5CJQH 1SPDA 5F9WC 4HJSA 4OIAA 3KPRB 4RGMC 5HJ3A 3VD9A 1HL9A 3D09A 3GMLA 1KXQE 3ARQA 1I8LA 3VWKD 1XX9C 2X9YA 2P8PA 4HUWB 3AGWA 3NSYA 2YGVA 4ZO9A 1Q0YH 4JKWA 4WK2B 4IRSB 1CMOA 1BFTA 2G30A 2QKIC 4PJXB 2A9CA 2CGRH 4B7IA 1S7WB 1T5WA 4QRAA 1J8HA 1E8WA 2NZ9C 3WSQL 2DLFH 1R46A 3DJ9A 1BEYL 1H19A 1O9WA 4GP8B 4PRHE 4LF3A 1SXBA 4G6AC 3IFOA 1HWHB 1UASA 2HG5A 5DF0A 1INEL 5E23A 1B2WL 1EUUA 5TE4H 2DPKA 3LZPA 2QMJA 1MHPH 1XQ4A 1DJWA 1HXYB 1X5AA 4MMZA 3CPLA 1WYJA 4PRIA 5DJ8A 2J73A 1KTBA 3VE0B 4PG2A 3FN0H 1TTAA 5DEFA 3VDCA 1A7NH 4LSUH 1G7LB 1ZT7A 4W6WB 2L04A 5IQOA 1D5MA 2YA2A 3PWPA 3HRZA 4LBEA 4NFDA 5DZNA 5SWSA 3ZMRA 3HTLX 2GI0A 3M7OA 3IMUA 3CVHB 3OB0H 3MBEB 2BIQA 4EI0A 4MA1C 1CF1A 5DQJA 4KZCA 3AUWB 4XZ4A 5DYFA 4JBSA 4C55A 5FCUL 1E5ZA 4GW5A 3TN0A 1KBBA 4PG2C 5LLIC 2X4TA 1F4WH 1HIMH 1QFWH 1G4MA 2JNZA 3L1GA 1QBMH 2J6EL 2UZYB 4XNDA 3MLVH 5IHUH 5DK2A 5ERWB 4BH7A 1ZANH 3H9ZA 2AZAA 3HJ0A 4KK9D 4Z7NF 3IRPX 1L4IA 4JO3H 4MD5A 4NLHA 4Z1PA 1QNZH 5HI4C 3CFMA 5KSAD 1IGFL 4EN3C 1MHHB 5I6LA 1PD0A 1U3JA 3UJJL 1ZEAL 1CT8A 4G5ZL 1J88A 1YEDB 4UTBL 2GTWB 5DC4B 5EU4B 4KNQA 4N3TA 3IJYB 4HK3J 4WJ5B 3X1FA 5C6PB 1DJSA 1HYSD 4RETB 5K9QI 5IB3A 4ZW5A 3LN9A 3T2QA 1JGEB 3NIGB 2CR0A 2H5UA 3Q6FA 2CLRA 2B1OA 3BZ5A 3CSYA 3ULUH 5I71C 4F7CA 3NZ8B 4OZIA 1E4HA 5EC1A 4I1RA 3QFJD 4FNLH 5EBWB 1PLAA 2P5EE 1IQWL 1CR9L 4M62H 3TH2T 4FQHB 5C2UB 4QHKJ 1WQVT 4U6TA 5IZ7A 5AOJA 1ZLVH 4XBPA 1KYDA 2QZQA 2AEPL 4Z7WA 2IOMA 2ZXQA 3L3JA 4HMCA 4HIEA 4BHUA 3P11H 3MV9D 1UZGA 3IDUA 5EULV 1MH5B 2DKMA 4X6DB 3FC8A 3BE1L 4DCQA 1JYXA 1NGZB 5C6TL 4R4ND 3I74A 2WLMA 1WFUA 2EXWC 4JQXC 1UB6A 3HFMH 4ZAKA 1BXXA 5FYJL 3UBHA 3ALXA 3DURA 5IF0A 1LE5B 2WQXA 4NUJB 2QVMA 4JHZA 3BESR 4FQXC 1A7NL 4LSUL 3S3CB 3T0WA 4ZXBA 1UOWA 4JPIB 4CVWA 2DBLL 2X6BA 1CXKA 4M1DH 4N2LA 2YPKA 4NQEA 4G8EA 2XTJB 1HI6A 5FF6B 3VCLB 3G5XB 3OR7B 3NIDB 3OHMB 3TX4A 2EDKA 4YNYB 2ZJSL 3EJYD 5H4ZA 4W9ZA 4NGHH 2IQAA 2R7EB 5F0JB 4Z3FA 3ARFB 3WY3A 2XN0A 3NACH 3RAJH 1WH0A 1BQ5A 2NXYB 2WMPB 3C5ZA 1GYAA 2YD5A 1CFVL 1AR1B 2BXYA 1IC7L 1WD8A 4MA8L 1XB8A 4NHCL 3TXAA 4F7TA 4JFED 2X09A 2ROXA 3HHMA 1TQSA 4KH2A 4RFEB 2XT1B 4OCSL 4RAVB 5HDLA 5BO1L 1TJIL 2IH9A 3T2LA 4RA0C 5CP7A 2OZ4H 1E28A 3ULUF 4LPVA 2MQ3A 4JO4H 4UB0L 4KJYA 2DQFB 3NN8A 4KAQL 2OTWB 3UPAA 3FB7B 4WCYH 3ARGC 3ARYA 5D7KE 3TBBA 4NWTH 1FGVH 1COBA 1MELA 1I85A 3BHBB 4HX1A 3Q6GH 1WBYB 4G6FD 2W5PA 2K8QA 4A2GA 2HTLC 2DZEA 3MRIB 3MXWL 4S0SD 3STZA 3DIVA 1THCA 4YXLL 1HOCB 2XLLA 3A67L 2BVPB 4LU5L 1VGEH 4P4KD 1JE6A 1KB5A 2LU7A 2YPLD 4P46A 3FUFA 3CX5K 1U58A 4QRUB 2QGBA 3O6MH 1U91B 2BXZA 4PIRF 4PJCB 2WSKA 1J0IA 4JB9L 2A6JA 4KQ3L 4WUUE 1IGIH 4JG1H 3ZIMA 5F3HA 1YYCA 1IGJB 1BAFH 1ZS8B 3PV6B 1MCCA 3BAYA 5IR1B 1PNDA 4EBQH 3LNDA 2EDTA 2UZPA 3VXRD 1D5MB 1TYJA 4P5KA 3UAJA 3O0RH 3I6LD 1G1CA 4WAFA 1ACYH 4M43H 5DFTA 1ZOXA 5KS9F 1MIEL 1D5RA 1UUSA 1DLFH 4NZJA 3WTWA 1J1OH 1SY6L 3CUPB 1ADWA 2V2TA 1E42A 2X40A 3CDZB 2OMVA 4MVBC 3D85A 5BZWB 1U2CA 3EGDB 1D6EB 3GEWB 3LVTA 2YEQA 1XTLA 5SWZD 4OIIL 3HMWH 4MNQE 4OM0H 5D1XA 4F91B 1HEZA 3SKMB 3UGUA 2YAPA 3X1NA 2AEQH 1GYVA 4EXKA 3LQAH 1GMEA 1S7VA 4U1LA 3EO9H 5BVJA 4EUPG 3CGTA 2EO9A 3GI9L 3IN0A 4IMLB 4XVOA 3FFCE 1YAIA 3MCKA 5CILL 5F7YC 3T1WA 4BBWA 4R26L 1CT8B 4X9YA 4I3RL 3GRGA 4TRPH 1YQVH 2KQMA 3CZGA 1FPTH 2IEPA 3VFUA 3ZYOA 4NZDA 4LBAA 4Z76B 4FTDA 2EEXA 4H8WL 3TYFB 4OD1L 3CLEH 3U9UA 2K0RA 3KGUA 3MRCB 5D8JL 5DD1H 1KJ2H 1NCHA 2PCFA 4W1TA 5D4IA 5FLVA 1S9WA 2CLRB 4PY8J 1KGCD 4L1HA 3LPPA 1T20B 35C8L 4ZS6D 5HGDA 5K9JL 2ZPKL 1I1FA 5K9QG 4IK7A 3ORJA 3AC0A 3U46B 1HHJA 1O6TA 5F9OH 3PWPB 2XVKA 1RJZA 1M9WA 2V3FA 4HCFA 3RI5F 3GTVA 3BO8B 4X80L 1LYQA 2X4UB 2E3VA 3CFJA 4LOEA 4PJ8B 2X2IA 3IT8D 4PRAB 3BPOC 1IBGH 1DQML 4HK0B 1A6AB 1AE6L 2CXGA 4KRNA 5HI5C 4IRSD 3EDEA 3SDAB 3RUGB 3CCHA 4M00A 1QSFE 3S5LG 4S0HA 3BSGA 5AB9A 3ECUA 2EEFA 3AAZA 2OS7A 2FZ3A 3O0RL 5F1OB 2FO4B 4GAYB 2NYZA 5HHOE 1C7TA 1HDMB 1I7TB 2AJSH 3OAUL 5EHFA 4WGKA 4QHMB 1E4XH 2X41A 3RVWD 3GMQB 3KXFA 3KBPA 4YNYA 3O41A 3UP1A 3V0EA 4H88H 3ML8A 4IBYA 4HKBB 1SM3H 3ARRA 5HYJE 2Q8BH 1JGVL 1I8UA 2FR4B 2NY0D 4ZMLA 3DSNB 3RKPA 1XR9A 3FB5B 3MLXH 4RGND 4O51B 3QT2A 3UMNA 1I85C 4XRCA 4ZFOL 3V7AG 3D05A 5JTWA 2WNKA 4O5LH 1C12A 3QUXA 1KDJA 5FO8B 2ZUVA 1MFMA 1A5FL 1DUYA 4CSZA 2OJEB 2CLVA 1U8IB 3MLTB 1E30A 3BQVA 4G1MA 1CLZH 4PY8I 4WGWB 1TLKA 4M5SA 3QXVA 3RY6A 2ZG2A 3HMXL 4TVPE 3INOA 2CBPA 3C6LD 1IGCH 2LLNA 1N12A 5GQBA 4M1CC 4J27A 1IJNA 5B8CC 25C8H 2CAKA 1A3RL 5E03A 3OXRA 1MCHA 4D0CB 1CN4A 2DJUA 3EH3B 3TVMA 3LHPL 3KPSE 5FGCE 4UZGA 2Q20A 3GRBA 1DZBA 1NC2A 1Z5YD 4XPBH 5CD5C 2W9DL 1KJVA 4GKNB 2WNWA 2KQNA 4B0MM 1BQHA 1T0OA 2ZUQB 3S96B 4JPIA 4A7VA 4QRUA 5KBKA 3GSVA 2EDRA 3L3DB 5HYJD 4TL4A 3INUH 3WN5C 2JKSA 4WO4B 1JTPA 2YAFA 1YEEL 2WWNA 1NAML 3ES6B 4OZHE 4PSRA 5E2WL 3TVMC 5LXGL 2VISB 3PGCA 1KUMA 2NLJA 4POZD 1FSKB 5BOPA 4NN6B 4B60A 1RULL 3GQFA 4QO1B 4YHLL 2H9GA 4HF5H 3ARFA 2P26A 4BCYA 3VGFA 4YUEH 3OAZK 2Y72A 3QEUB 4AT6A 1GMIA 3QDMD 4BKLA 4UBDC 1X5YA 3QUMA 4ZQKA 4PV8B 4OUOA 4PM1A 3DMMC 4WI4A 4TVPL 1EAPA 2VH5L 4PRHA 1D5XB 1MFAL 2F19L 5J8OA 1Y1DA 3PL6A 1F4XH 1QFWM 2F1EA 2R4RH 1KFAL 2XBZA 1YEJL 4YGAB 5ID0A 1XF3B 3Q7JA 3D7PA 1G9MH 4OFVA 4NCDA 3UL4A 3IM1A 4NUMA 2R0KH 2Y6SD 4X9IA 3S5YA 3CNKA 3IVKB 2VL5B 1SEBB 1P5VA 4GNKB 4NPYA 3OKEB 3D3VD 1JPTL 3DWTA 3OMIB 1V3KA 3IAPA 4AVKA 4RH4A 1OAXH 2GJZA 3ARTA 5J6GB 3X17A 3KVPA 5KVEH 4RIRB 3HMXA 2FAUA 4Y5XB 1R3JB 5D2LB 2WUCH 5AVTB 1KXVA 2MQGA 3HRPA 3MJGX 5DC2A 5G2NA 3BP4B 5LGJB 4X99A 3WE6A 5E8PB 4FTVD 4Z76A 3QA3A 2VM4A 1AKJA 1HE8A 5A16A 5DVOA 3VJ6A 4NZFA 5T5NG 4M5TA 4Y7OC 4ETQA 5F1NB 2GK0B 1DQLL 1AXSA 1IM3D 2JKLA 1GGCL 2AQSA 1GY2A 3O6ML 4MMXA 1KTDB 5C0GA 3EDKA 5CD3A 1FG2B 1KEGL 3C9NB 4PJEE 2Y1ZA 1THAA 5C0BA 3D2UB 3GKZA 3FAXA 2Z1KA 3LRHA 3IBEA 4X98A 3QEHB 1LO2L 4XOCA 1BQRA 1SHXA 2WBJD 4JANA 4F92B 3BVVA 5HDBF 1BG9A 2XZAH 3CFQA 5JXEC 4U4IA 2CDGA 4RESB 3EAKA 1FL3A 3OZ9L 4QRRA 3NH7L 3FOLA 2V2TB 5J12B 3E0GA 1JZJA 2RH0A 3WIHA 4KROC 3CBJB 4MA3A 1KENL 1U8NA 4Z23A 4QCIB 1PYWB 3FCTA 4NSKA 3OMNB 1O6SA 1B0WA 2CKBL 2IDTA 2IANE 3SY0B 5CKAA 1D9KD 1X5ZA 1KYAA 1A6VL 3PV7A 3RVTD 1U30A 4FQCL 4R96B 3S7GA 3OHXC 1NGWA 5TQ0H 5I1KL 2BNRE 3L5WA 4J28A 5TK2A 3SDXF 4EUPA 1RJYA 3HB3B 4FABH 3RILA 4EVNB 3QUML 1YEKH 1EJ6A 3WYRA 2MSPA 3D3VB 1QFWL 4G8GA 5LB1A 1Y7VA 1N8OE 3O8XB 4XVUD 3PDOB 5DD5L 5CCHE 4B97A 3C2SA 1I7ZB 5I1HH 3KJ4B 4KQ3H 4X6BB 4C57C 3MCYA 4H40A 1GC1H 1NCGA 3VU2A 1AJ7H 2XC8A 2HLAA 5IVOA 1LP9E 4LZKA 3CAFA 3GGWA 1DUYB 2XX1A 2DTML 3FRUB 2DQTL 5FUCE 5IMOA 1HTYA 1ASQA 4WU7B 5EUOA 5J56B 3SDCD 5I1JH 2CZNA 1HESA 5GRZA 4DT2A 2VMDA 1KGIA 5EO0A 3V8CA 1QPXA 4KMTL 1OT4A 2AXFB 3QCTL 2PKDA 4IBLT 3MJ7A 4XWGL 3W11C 1ZVSA 4BZ2H 3BT0A 1OB1B 5AZ2H 4P23C 3KPRD 1WISA 4FG2A 4DTGH 4GG6E 3POHA 1GRWA 3O4OC 3TASA 3B2VL 1KWGA 2DWEA 1RK0A 1ZSDA 5DHVH 3CK0H 4KTDH 6CGTA 1LILA 2FO4A 1MW0A 3SDCA 4Y8DC 1X5IA 4U6YA 4XXCA 1GZQB 5F9DC 1UH4A 1TPXC 4K3GA 2ADIB 1T4WA 3TU6A 3CC5B 3ABKB 4IU2A 4KTEL 1MCOH 5LVEA 4XBEH 1YLBB 2CJTA 2R9HD 3PWPE 1NPUA 2BIPA 2CDFA 3CHQA 1E9PB 3GLEA 4FG6D 4KNTA 4WHYH 5AW3B 1ESOA 3NJLA 1E3ZA 5CZXC 1TQUA 4I89A 4U1IB 2OFQA 3ULVE 4NQDD 4FNTA 4LOUC 5I17B 4JG0H 1VADA 3D87B 1FUNA 4KI5C 1WV7T 3FXIC 3K72A 1P2CB 3QFJE 1T5XB 3HRZB 2JKXA 2YD3A 3KH4A 3L3OA 5CGYD 2DQEL 3JWDL 2WXPA 1X3DA 3MRJA 3ZE2F 3JBG7 2SEBB 1S7UB 3IDYB 4NGHL 1P5UA 1VDGA 3MZGB 1LP9B 3MUGB 4Q9RL 5M7QA 2XQBL 4J2XA 1BQSA 3H3BC 4U05A 1DO5A 2CK0H 5FYJE 1YDPA 1HINH 3UC0L 3GHEL 2V3DA 4W4OC 2VLKD 4I77L 5GXBB 3FFCB 3T4AA 4FKEA 2AK1L 4JPVH 4YDVA 2CMRL 3TIDB 1EFQA 3KAAA 4PLJD 3LS4L 3Q5YA 2E9BA 1A7RL 3QE5A 4L3EA 4UCFA 1TQCC 2OYKA 2XWCA 2J57A 2VDRB 4Y5VB 5K1JA 3D1MC 5E1IA 1DJYA 1XIWD 4DW2L 1AO7B 1SVZA 1SUHA 2VXTL 4M61B 1KTCA 2GC4C 4K3HA 1QOKA 2R59A 4MCMA 3SKOA 2VISA 2XWZA 1A1NB 2BP8A 3SKJH 1JD7A 5I0XA 5ISZB 2BVUA 3V4VH 4LO9A 4I1NB 2BFVL 2EACA 2AP2A 5DK3A 15C8H 5D4JA 1ZE3H 4OZIB 4UM8B 3GUFA 1SXCA 4PAZA 4PGZA 4GAFB 4PRDB 1KULA 3K3QA 4X8XA 4FQHA 4YL4A 4BCZA 1FH5L 1HEHC 1BQHG 1M6OB 2DWSA 3OXSA 3WLWD 3IF1B 4WV1C 5EOCL 2Z7WA 3DPBA 1LO5A 1BXUA 4QCIA 4XNZC 4DCQB 3BRFA 3QIWA 2NZ1A 32C2A 4JJ5A 5DHYB 4TUKH 4DERA 1DLFL 4NERA 4M3JA 1NGYA 1RJLB 3IVKA 2LVEA 2Z34A 1BBJA 3BAEH 4GXVH 3MJ8B 4DH2A 1UWGL 4WTZA 5LGKA 4KOCA 2YJQA 5GGTH 3VYOA 1EJOL 3LCYA 3MKGA 2E9GA 4ELDA 3U0WL 3ZMNA 4URTB 3LQAL 1JHTB 1G6VK 4PP1D 3QO0B 5T1LA 1SJXA 4KTYA 1YRKA 4OFPA 5DD0H 3G5ZB 3IJHA 5JOPD 4IKJA 4MAYC 4UIKH 1ORQA 5I8KH 4A2MA 2CRZA 3D0VA 1IIIA 5ANHA 1FVEA 2Y7QA 1I4FB 3VGAC 2FBJH 3FRUA 2C3GA 2VXSL 4OJFL 3F01A 3WD5L 1AO7E 1RZKH 3BIKA 4CC4A 1LO3L 2P24A 4K3DL 1DLHA 4HKZA 5IESH 3GSNB 5DMKA 3HBPA 3LKQB 5DHDA 2PPAA 5I1IH 5EWIL 2AXFA 3L2NA 5D6DA 4CW1A 3BGMB 5EU6B 1MAMH 1TTRA 5L2KE 1E4KC 2XZAL 5BZDA 4HUUA 3RWHA 4IBZA 4Y1SA 5TDOA 3V4PA 3BHBA 1OAZL 1N3NA 1OOWA 2LLGA 2EDBA 2BVEA 5IWLC 5CN1A 2AHIA 3C6LA 3VFOB 4IIQC 1WT5C 3V5KA 4FQ2L 4W9LC 2QEJA 1RHFA 1OAUH 3O9WA 1LK2B 2CIIA 1NWOA 2AW2A 3F6IA 1QR4A 1O6VA 5J13B 2X3AA 3RL1A 1AGEA 2XY1A 4LE8A 3VNZA 4CL7A 3D3VA 3OAYK 1JMZA 5FGCB 4G7SB 5F3HB 4PPTA 2E4FA 3MLRH 1JGIA 4L05A 4OCWL 1XBRA 3BEWB 3A5VA 3M07A 4EDWL 4TMPA 3B7UX 5HHPB 1T04B 1BZ8A 2W0KA 3BAEL 3QFDB 4M8VA 2C9RA 4MQXC 1X5MA 3WXVH 1QI5A 2PXYC 4LVEA 4ZMVA 1UM5H 4PFEA 3LKPA 4H0GA 1QSEE 4OCMC 5K59F 4E5XG 1VA9A 3B2MA 4PB0L 1MCWW 4YHPB 1FFOB 4JJOA 2WKLA 5D55A 5ILTH 2FH6A 2O26U 4PJFA 5GRUL 4PJHA 1EO8H 2EYTA 3CDGB 4GRLD 3KEHA 4HISA 5J12C 5KBDA 5IG7A 4MAYA 3FFDB 1OP3H 1LEGA 1ZVSB 3O11A 3P2DA 3C8KA 3LNEA 2F54B 1M56B 1RMFH 5IOPB 1IEAA 4ES8A 4R5XA 3O3EA 1S3RA 2CGRL 4W6YB 4Z3EA 5EZLB 4HHWA 4B9GA 25C8L 1MY5A 3DK2A 3F12B 3PCYA 4OGXH 4NQEE 1TCRB 1UYWH 1S78D 3HHSA 4H25A 4K4KA 2BW4A 3AG4B 5IVXA 5F88A 1JNLL 4YGVA 5AVWB 1SEQL 3CFNA 3BLPX 3WO3B 3TS8A 1QVOA 1A1NA 2ZOUA 2YWYA 3S3DB 4AEHH 2HKAA 1RUPL 4P9HH 4WI2A 3LS5H 3TNNB 4PJDB 1AJ7L 3NP3A 4U0QB 1OCWH 5AW9B 1HJCA 3NJHA 43CAB 4DETA 1RV6X 2QSVA 2PNDA 1ZT4B 5HI3D 5HYSG 1BF5A 3QSKB 1OM3H 5F72S 4Y16A 1ET8A 1OW0C 3UTSD 5F7NC 5INDA 4XVSL 3L2MA 4BGLA 3QO1A 5HHME 6TAAA 5FIEA 1A6PA 1P5UB 5I8OL 2K9UA 1HNFA 4PD4K 5JHLL 3TP4A 3GXPA 4P4KC 4WEBL 3GUTB 5IB2B 4P5TC 3WV0A 2XX0A 2HJKA 1FNEB 2EYSB 2VR4A 1FN4A 1QZ1A 4OD2A 4KC3B 2Q86B 5IGXH 4GG6A 4X4MA 1ROWA 5ICZB 3CMOL 1KCRH 1NUGA 2V7NA 3V0GA 3SE6A 1ODAA 3A4FA 1QTSA 1MWAB 3B3IB 1JZ4A 2XG5A 2Y07H 4L3EB 1G1KA 1JTOA 2B14A 4A66A 1IFGA 1TZGL 1X44A 3CG8A 1B2WH 1KB9K 2YUWA 3GIZH 1IGTA 1ORQB 2VSMB 4AGPA 3CIQA 5GIRA 1JDAA 3FUDA 1R3LA 5FYKU 4HEPG 5L2JA 2UXTA 3GSRA 4G6MH 5GGTA 1G7IB 1QWUA 2ODHA 4DAGH 1L0PA 4MD0A 1LDPH 5CCKL 2EDWA 1DLHB 1WICA 4HFUH 4Z7NB 3X13B 3J07A 3L4TA 4LSVH 4PCYA 3FT9A 3KXFD 1KG0B 3L7FA 4QPEA 4QTIH 2AJVH 3IBOA 4ZMWA 4PJGB 4PJIA 1ZSHA 2CLVB 4L1SA 5CBAB 5TDPB 4HS3A 3FT1A 3O6FA 1CTMA 3MHZA 4PJ5D 3OJMB 3N44F 4IRSA 1CFBA 2VRQA 3FZUD 3D85D 1JMXA 3ZKQD 1TF4A 1F6LL 1LO5B 3TVMB 1QBML 2J6EH 3PFUA 2VXVH 3C6LB 3VFOA 3PPSA 1ZANL 3SYAA 4BFNA 4Z7VA 5I18H 2H32A 3I75A 1F1GA 2OQJA 3BMWA 1ONQB 4JFPA 2Z93A 3FONB 4F7MB 2RALA 3MRFB 4GKNA 4HWEH 4Z3GA 3DVGB 2NW2A 4NBZB 3K6SB 1UOKA 3HLAA 4JM2C 4EPSA 2CO3A 3GIVB 3DUSB 2O5YL 1J18A 3NCYS 4YMPA 3J7HA 4LSQL 3H2QA 4DW2H 5IFAH 4DGVL 1R3IL 1SQMA 1U9KA 3WFCH 4A2HA 5EU5A 4NO0B 2EXWD 1G5AA 2ICEA 4W81A 2FQGA 2X70B 4G7YL 2XWTB 4GSRA 2HUEA 3FOMA 1MEXL 3NCXA 5EV7A 3TPKA 1C9SA 4L3ED 2APVA 2Y06L 1S9VA 3AXLA 3FUKA 4UT6H 1A6UL 3MFGB 4ZMNA 5JQHC 5FYLH 1UA6H 4GP4B 1NWPA 1Q9OB 2HVJA 3G3LA 4N2CA 1CG9B 1Z9MA 3MV9E 1DE4B 3DV6B 2GSMB 1D7FA 1N26A 2ZKXA 5DVMA 3ALPA 4NCC2 3P11L 1QEWA 4Z3JA 5KZCB 4NC2B 5IBTH 2NUTA 2BHUA 2UUDK 3LKOA 4PJBA 4BUQA 1CU4H 5L4MA 3HUJE 2Y69B 4BFRA 3LZLA 1RIUH 3ZN6A 3LIZL 5JW4R 2E7LA 4OSUH 3WTXA 3GSNL 3V4PB 1E2ZA 4AEEA 4O2CA 2GJZB 5EZLA 1Z3GL 1BZEA 1H6UA 5DLMH 5FM5M 5FUOL 5KANI 2YJLA 2YIHA 4RGNC 3BUPA 4GAGH 4JDZA 4AGNA 1DQTA 4MZIA 4FLSA 4QDGA 1J5HA 4Z7OF 2CO6B 4YDJA 4ZS7L 1AZZC 1DQDH 5C0JA 1JZ6A 2XSKA 1JI2A 1AGEB 4M1GL 1T03H 5G4MA 2YPVH 5FKPA 1F00I 3VWKC 4Y4HB 2WVVB 3BPOB 3DX1A 2ESVB 3CPLB 2JI1A 1NJ9A 2DQMA 3UTQB 3PAZA 1FG2A 5HYJB 3O6LL 4HCGA 5B3JF 3BP5A 4U1MA 1ZLDA 4YK4C 4JHWL 4F2EA 1T04A 4NN5B 3BT2L 2VMFA 1OHZA 3GINA 3FHQA 4PTUA 1G7LA 4Y88A 2H1PL 1FVCA 3RG1C 1JIBA 4NRYB 3C2AH 4LGSB 2GAZA 1RZFL 3LIZA 3QJXA 1K8IB 2OMNA 4K5LA 5H8DA 2KLSA 1NCOA 3A4DA 3HAEH 4R84A 2CRIA 4JMXA 3ZTCC 1OF2A 1J1OL 1SY6H 4NXKA 2WVSA 5JIPA 1Y18B 4PB0H 1T5KA 1Y1UA 5SWQA 3S36X 4DPCX 4HXAL 4LSRL 3V55A 3DETD 3NSXA 3VSVA 3RZCD 5AKSA 1PYWA 4NUGL 3QDJA 2R0WL 1N4XL 4QGTA 1LHZA 3EDFA 3NZSA 3IXTB 3QXTA 1UURA 4PJEF 1SDDB 1T6BX 2DTSA 2VR5A 5E0QA 1JPTH 1XGUB 5GS0D 3EHBC 1MWAA 3B3IA 2QV2A 3GI9H 3E3QC 2UY6B 3PAUA 4X6CF 4H26B 4Y4FB 1Z3RA 1J0ZA 4CADA 1YMMD 2GT9B 2NNXA 3N50A 4M7JL 4ODVL 1S78C 2YGNA 5ADPL 3NIGF 5L9DH 2LTQB 2I9TB 4FHJA 3P77A 4ZODA 5I1CL 1U2HA 4G71B 3QUYB 4L5FL 2NW3B 4DHLA 2QR0A 2B59A 3DRQB 3M7FB 4B9IA 5D70L 1MFCL 2CR3A 4JY5H 1MCSA 1JRHH 2E74C 2WWOA 1II4E 5KVGL 3BFOA 2W95A 1PJ9A 5FA4A 5ENWB 5HYQA 1O7VA 3L3IA 4A6YA 4EDWH 3TNNA 1KG0A 3PWPD 5TQ2L 4M43L 3ULUC 2WC7A 4KXCA 4X6DF 1XZ0B 1DL7H 1E9OA 2M83A 2G5BA 2FL5A 2NY2B 4M7KH 4UYQA 4M6NH 4AJVA 2HRPH 3PXHA 4N90D 4WGVB 3VWJA 5KSAB 1J8HD 4JO1L 4JZJB 4L8BB 4RMRA 5T1DH 1F18A 3LN4B 1JNHB 5C7ZA 2RBLA 1J8RA 2FWOA 2ATAA 2JJSC 2WBJB 1FLRH 3L5IA 1V7NL 2OSYA 2QADB 5DUML 3TBWA 3DYOA 1FDLH 2XZQL 1TFPA 5LBSL 1GH7A 3DVGA 4OZFG 5KYWA 1WZMA 2WB7A 2AK4B 2AV1B 2VLLB 4XO9A 3GEFA 3P54A 3VXUB 4AYID 2AKRB 3PQYA 2X2HA 1M1XB 3KD4A 1DUZB 1FNGB 2A6JB 2X1PA 1LD9A 1QHQA 1K85A 3OJVC 1F1AA 3QDGE 4QRPD 1JK8A 4UM9A 1N10A 1W0VB 2IH8A 1D9KB 1VGKA 3N9GL 1AD9B 2J55A 2VAAB 5E6SB 5K9KB 2TRHA 1WBXA 3ATEA 4LMQI 2Q9OA 4Z7AA 1EDQA 2X1XR 1AQKH 3RFZC 1F3JA 2XJKA 5HPMA 4L2LA 5EEUA 1UOLA 3B9AA 1M3IA 3JWNC 1JFHA 2PWHA 1SDAB 3VXTA 4KUZL 2MCPL 2WANA 3IYLW 4JRFA 5I8KL 4FGMA 3VFVA 3L7FB 4NZUL 1SVCP 4AZUA 5T1LD 4MNGE 4AQOA 1GJUA 2SEBA 4I3GA 1MF2L 1OTSC 2R4SL 3HI5H 4A7QA 1E5CA 4AW7A 4IRJD 2NXYC 1WTGT 4GUCA 3ZE1B 4JY6B 3KPSB 1BZ7A 5ESQA 3RPKA 1F3RB 2WCSA 4GKZA 3K8MA 4ZFGL 4LCWD 3H9HA 2VUOA 1MVYA 5FGRA 3VGEA 3EGSA 1JDCA 4XCFL 1IC5L 2PLTA 2FCBA 1F86A 4E68A 4BH8A 3CSTA 1OM9A 3RNQA 1P7KB 1QHPA 1XCWA 4XO3A 4Y4KB 3E80A 1H0DA 3N41F 3LNGA 1WFMA 4MXQC 1KPVA 3ZHDA 2DQJH 4NQCB 1IAIH 1TJIH 2H3XC 5D7SL 1X5GA 2WQSA 3INUL 1Q9LB 1RHHB 1YEFH 2F53D 1EHKB 2EDQA 5EC2B 3RZCB 4ELMF 3U25A 1NUNB 2BSBA 4FZEH</