3WNJA

1.20 a resolution crystal structure of dioxygen bound copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
298
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans
publication title Crystallographic evidence for side-on dioxygen trapped on type 2 copper in copper-containing nitrite reductase
rcsb
total genus 100
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wnjA00
2P80D 2ZONA 5TK2A 1NPJA 3N2JA 4GP5B 3X1EA 2FNWA 1AANA 4DP7X 1SF3A 1AS8A 2IDSA 4G70B 3FU9A 2UX7A 5I6LA 3NJFA 1V10A 1W6LA 3G5WA 3NJNA 1DZ0A 3NSDA 3U25A 3N55A 2IDFA 4YSQA 1PLAA 4A2GA 1AOZA 1AZCA 3NJIA 1PCSA 3NSCA 9PCYA 3CVDA 4A2HA 4M4RB 1L9SA 3ZIYA 4DP2X 5E9NA 5B1AB 2VN3A 3NSYA 4A2EA 4E9QA 1AS6A 1IBZA 1OCOB 3QJUB 1J9QA 1E30A 2IWKA 4HCGA 2GI0A 5B3SB 4F2FA 3AG2B 1ZIBA 4HHWA 3QJTB 5I5IA 1JERA 3S8FB 2PP7A 1BEXA 1EHKB 4CSPA 1BQRA 1GW0A 4YSAA 4BDVB 3WKPA 2YAQA 1IBYA 1L9OA 1RZPA 3CVBA 1MZYA 3T6VA 1WS7A 2E86A 3X2QB 3AG1B 3QQXA 2JXMA 2AVFA 4GY4A 4KNUA 3CVCA 2PLTA 1IUZA 1KDJA 2IDQA 3QJVB 4YVUA 3V9CA 3WNIA 2IDUA 2PPEA 5B7EA 4YSCA 1RCYA 4YL4A 1BXVA 1HAWA 1JZEA 5PAZA 3FU7B 2TSBA 3UABA 1GR7A 1A3ZA 2W8CA 2UXTA 4DP1X 3AY2A 4WKXA 2XXFA 4W9ZA 1NICA 4G7QB 2JFCA 3T6XA 2WO2B 3EF4A 2RACA 3FSWA 3JT2A 5D4JA 1XB3A 2J5WA 2XV3A 2PP8A 4P5RA 2AFNA 2GHZA 3RYMA 1E5ZA 4AI7A 1XMEB 3FQYA 4FA7B 3FS9A 3NP4A 1MG3C 1NINA 2VSMB 3HEIB 1NZRA 4K9JA 3NJGA 5B1BB 1SF5A 1AQ8A 2BWIA 4E9YA 1SFDA 1J9TA 1NIFA 1N70A 2VM4A 2HX7A 2X88A 3NJJA 4JHUA 2FT6A 3TA4D 4E9VA 1JXFA 2UXVA 1FWXA 3PAVA 4A66A 3ABKB 4A68A 2EILB 3IN2A 2IWFA 3TU6A 3EH5B 4G72B 2HZHA 3SBPA 1OCCB 1RZQA 2FQFA 2VW4A 4GP8B 4KO5A 3MX0B 1JVOA 1X9RA 1PMYA 1YLBB 5ANHA 1I53A 2GB2A 3WNJA 1SNRA 2Y69B 2FTAA 1PAZA 2EINB 1OCZB 4E9XA 1JZIA 2IH8A 1PZBA 4ENZA 1BAWA 4N4YB 2ZWNA 2Y1AA 1JZGA 2ZXWB 3TBCA 1V54B 1NIBA 1BXUA 1SHXA 4KOCA 4KO7A 5I6NA 2PPAA 3PPSA 4KNSA 2AZAA 4JHVA 4BWUA 2BZ7A 2QDWA 1GY1A 1AZBA 5B7FA 1JVLA 5A7EA 1MDAA 1WA2X 3OMNB 2FT8A 4X4KA 4DP9X 2YAEA 4FAAB 2H47C 4DP6X 1AR1B 4QLWA 4BWTA 3FSAA 3T6WA 1WA1X 4YSDA 1AAJA 1QHQA 6PAZA 1OE1A 3QPKA 1PLBA 5B1JA 4HIPA 3WI9A 3EH3B 4E9WA 4UAHA 4BDVA 4GXFA 2JKWA 5AZUA 1SFHA 2HRGA 1N68A 2BHFA 2TSAA 3UADA 2HLEB 1A65A 1F56A 1ILSA 3X1GA 2YXWA 2DYSB 2OJ1A 3AG3B 2CALA 1NIEA 3WIAA 2CUAA 1NIDA 1W8EA 2EIKB 1GSKA 2YXVA 2HX8A 1A4CA 2B08A 4HCIA 1X9UA 5D4IA 1IKOP 1L9RA 2CBPA 3DKHA 4GP4B 2BP8A 2DWTA 5B1KA 3WG7B 3T6ZA 1CYXA 2DWSA 2XVBA 4Q8BA 2Q9OA 4E9SA 2DV6A 2VW7A 2AANA 3OMAB 3TASA 1BXAA 1PF3A 1ASPA 2B3IA 7PCYA 5AKRA 3JTBA 2GBAA 2HRHA 2N0MA 2QDVA 3D12B 4HHGA 4HALA 1AZRA 2VMJA 3GDCA 1L9PA 3PLYA 3PXLA 2WO3B 1MZZA 2XV0A 3L45A 1TKWA 1V55B 4NB7A 1GYCA 1JOIA 3OM3B 3FU7A 5I5JA 1IC0A 4CSZA 1A4BA 1AACA 3FPXA 4JKNA 5I6OA 4DP4X 1FFTB 2ZOOA 4E9TA 2GIMA 1MG2C 2PPCA 2YAMA 3DIVA 2YAHA 1BQKA 2I85A 2Q5BA 4YSRA 1GS8A 3CDZA 1KBWA 4P5SA 1NPNA 5I6KA 4DPAX 2UX6A 2DY2A 5PCYA 1T5KA 2PCFA 3V9EA 1AIZA 3X1NA 2XWZA 3FPYA 3AW5A 4YSTA 2I7OA 1ETJA 1VLXA 1ASQA 5F7BA 2MTAA 2PPDA 2QPDB 3ABLB 3FQ2A 2P80A 1KBVA 2YAPA 3T9WA 2WSDA 3UGEA 5AFAA 1JZJA 3FQ1A 2W88A 1KCWA 2IH9A 3BQVA 3IEAA 4AZUA 2PCYA 3PAZA 1KV7A 2XV2A 3H4HA 1FA4A 1BYPA 2J55A 4HCFA 4W1TA 3GYRA 1NWOA 2VM3A 1J9RA 4DPBX 4F7KA 1AG0A 1SDDB 2X87A 1PLCA 2XLLA 1B3IA 4N8UA 4AKOA 5LDUA 3ZX1A 4DP8X 2YAOA 4YSPA 2GC4C 3NJMA 3S8GB 3NJKA 4TXVB 1ASOA 3FSVA 4PCYA 1J5CA 2BP0B 3FSZA 1E67A 2VW6A 4Q89A 4A2DA 1NTDA 5I26A 4KO6A 4YSSA 3PCYA 4G71B 3NJHA 3FT0A 4DP5X 2YAFA 3NJLA 5B7MA 2XXGA 1OV8A 4HAKA 1SDDA 1JZFA 5FC9A 3FU8A 3AZUA 1GS7A 1JZHA 4YSEA 1JXGA 2AZUA 1BYOA 4NAJA 3AG4B 3CDZB 4NERA 2FT7A 5I6PA 3ZBMA 2FQDA 1E5YA 1OF0A 1TU2A 4A67A 4A2FA 1ILUA 4BXSV 3T71A 2IDTA 3QJSB 2PP9A 2XX0A 4HZ1A 3SQRA 4GYBA 3NT0A 4YVNA 2OCCB 1CURA 4WTQA 3NSFA 3NYKA 2H5UA 1L9TA 1JXDA 1CUOA 1ZPUA 1KYAA 2IAAC 7PAZA 1EZLA 1ET8A 1NWPA 4L0PB 4AX3A 2NRDA 2YQBA 1GY2A 2OV0A 2BZCA 2YARA 2A3TA 3OQRA 1CYWA 1OE3A 5IY5B 1XB6A 1WA0X 3S3BB 4AKPA 1E65A 2CCWA 3KW7A 4F2EA 2QPEB 2EIJB 3EHBB 4PAZA 3SBRA 3PAUA 1OE2A 1KDIA 3X1BA 2LLNA 3DTUB 3KW8A 1PZAA 1A8ZA 4QKTA 4EF3A 2FWLB 4UF7C 5I28A 2BP0A 1XB8A 2UXGA 3FYEB 4RH4A 4DPCX 1ID2A 1TEGA 3OMIB 2XYBA 2PPFA 1CC3A 4BWWA 4BK5C 3NP3A 1WS8A 3QJQB 1QLEB 3HB3B 1HAUA 4G7SB 1ET5A 3X1FA 3ERXA 2BW4A 1AZNA 3FYIB 2XUWA 1DYZA 1SHWA 4G7RB 3QJRB 2XX1A 1ADWA 3CG8A 5F7AA 5D4HA 3OD3A 3GXUB 4BXVA 1KGYE 3C75A 2J57A 2R7EA 3ZDWA 1ET7A 1PZCA 1ZIAA 4E9RA 3CZUB 1PY0A 3UAAA 4KO9A 1SJMA 4ZK8A 5TK4A 2I7SA 2BP8B 3IN0A 1ZV2A 2FQEA 3IE9A 2BWDA 3IBOA 2IWEA 2MRYA 1J5DA 4KNTA 4YSOA 2GC7C 2FQGA 1OOWA 2HX9A 1L9QA 1KCBA 1BQ5A 3TBBA 5EHFA 2J56A 1ZDSA 2UXFA 1R1CA 4DP0X 4MFHA 2FJSA 2XU9A 3H56A 1M9WA 2BO0A 2GSMB 1QNIA 2BW5A 3WKQA 3S3DB 1RKRA 4KOBA 1J9SA 1AS7A 3EH4B 1GS6X 1PNDA 1UATA 4M3HA 2EIMB 5B1JC 2R7EB 5I5MA 1HFUA 1AG6A 3SBQA 8PAZA 2CAKA 1W6WA 2HXAA 1M56B 1OCRB 1M57B 3ABMB 2CJ3A 2DYRB 1TEFA 1ZDQA 3ASOB 3H4FA 3MBWB 1A4AA 6PCYA 3UAEA 1NIAA 4UANA 2VSKB 3ABGA 5I6MA 2H3XC 3ASNB 4YSUA 2QT6A 1WAEA 4AKQA 1URIA 1NDTA 1PNCA 3UACA 3S3CB 3BVDB 1AZUA
chains in the Genus database with same CATH superfamily
2W60A 3ECWA 1A6AA 1LNUB 4ERSL 4PB0H 2FWOA 3G04A 5DK0B 3OXRB 4K7PX 4WW2B 5B39G 5C7ZA 5CGYD 4QWWC 1XIWC 1U8CA 1UT9A 4OCRL 2GTQA 3QRGH 3U82B 5DZNA 3VE0B 2HTLC 5EZIH 3CWGA 4B9JA 2IPUK 1VSCA 3FU9A 3HTLX 3INUH 2Y72A 4N6RA 4NQEB 3BAIA 4TNWF 4ZPVA 3REVA 3FQUA 4FNRA 3DOSB 4I0PA 1J05B 4YHOL 2Z8SA 4KITB 4PJEB 1IQWH 3ZHDA 1OIOA 1OSZA 2ERJC 3PP3K 4GKNA 4UOZA 4RFEA 3CFNA 1MWOA 2QZ5A 5AL0A 3BWAA 5LLIC 4FL4C 1PCSA 3LQMA 4M4RB 5F7KC 1WFJA 5GZNA 3PXHA 5HDRA 3E2HB 4GUOA 2FO4B 2ZSVA 4HFWA 1IILE 2Q86A 2R27A 3MBEC 4LDCA 4QRSB 2ZUXA 1F11B 3LZFH 2R51A 1EAOA 2YKKA 4FFZL 3H3PL 4PJBB 1EJOL 2Y0SA 4F7MB 3APDA 1U8OB 3UZVB 1J5OH 1TQWA 3QFJD 2QHRH 1TMCB 2CA3A 4FF9A 5D96C 1JWMB 3UTZB 1K85A 1L0PA 4NWUL 3HG0A 2FO8A 4RQQB 1RURH 3FT3A 2X0UA 4JQXA 2GYSA 3QJTB 3DUUB 3BMWA 3JV4A 1SJVA 2ODHA 3TZVA 1U8QB 1HXYB 1HXMB 2D7OA 3CCHA 4YSAA 1HSAB 3WKPA 4QXGH 4RAVB 5C3LD 4UMSA 1KTBA 3OX8B 4UBDD 4FQJL 1HOCB 1OT4A 5E8NA 2JELH 1T4WA 3JWOC 3TH2T 3O2WL 4DW2L 4KVNH 2CRIA 2ZX7A 5CMAA 5CGTA 4EI0A 3W9DA 4GY4A 5H37H 4QRRE 1BLNA 4HUXA 4GRWE 1U92B 2XTJC 1RUKH 4QRPE 5I8EB 3ZE1B 5BVPL 4YDZA 4Y1TA 2CKBB 1AI1H 3MLUH 3BPCB 3DURA 3P3TA 1CLCA 4P4KA 3MZTA 4PGZA 2WCSA 5D7JD 4PG9B 1WBXB 1HAWA 3ARQA 3RHWK 5AB9A 3L9BA 3KGTA 3DO3A 3NK4A 4EXKA 3EADA 1GRWA 1A3ZA 3QS3A 2MWCA 2VLKB 1I7RA 2BSDA 1CVSC 3UIZA 1NICA 4HWEL 4W9IC 1Z9MA 4XCNA 3PV6A 2E7LA 1WFIA 2XA8H 1VRSA 3D25A 4Z7UB 2ENPA 4HC1H 1P6FA 1NINA 2NPLX 1G9HA 1NZRA 5IFJA 1BVOA 1UT1A 4YDLC 2VUKA 2DKUA 3BUQA 3QEHA 4Z18A 5D71H 2ZP9A 2BSTA 1SFDA 4OF0A 2QLYA 4Y5YA 2YHGA 5IZ7A 4G8IA 2ZPKH 3D85D 4W9LC 3UFIA 1MCWW 1MCHA 2GKIA 1EAQA 4K7PY 5AW9B 1RIHL 1MCEA 2FWSA 2VOTA 5BRZA 3Q6GL 1VFUA 1BBJA 3NH7L 4G72B 4HIHB 3F01A 1ZLDA 5FUZL 1TLKA 3MX0B 3NDZE 4NPJA 1YLBB 4M7LH 3AROA 4FFYH 2P8MA 2R23B 35C8L 4NUJA 2IANA 3WGVB 3MRPA 4AYEC 1GC1H 4C83A 5AB1A 1GHFL 1OCZB 1TQTA 2D3JA 3IM1A 4P9HL 3SE6A 1NCCH 4NKMA 3RJOA 5J7CC 4OKDA 3TBCA 4XWOD 2HMIC 2YEQA 4GO9A 4WW2A 1WRFA 4ORGB 2C1PB 3VU1A 1KEGL 3DBSA 2NXYD 3UMTA 3W56A 3DROA 3MA7B 1DVYA 5I19L 5IGXL 4QRPB 1U8IA 4J3TA 2X4OA 3RUGE 1IBGH 3EO0B 1GY1A 4JRXE 2F54D 1L7TL 1Q94A 1NCBH 4A37A 4AEHL 2AHIA 2R69L 2AQSA 1ZLEA 4ZO9A 5IOKA 3BX7C 4UUJB 1ZCRA 4BWTA 2Z91A 2APBA 3HLAA 2XQBH 5E2WH 3T6WA 4UOJA 3AQZA 3KLDA 1JNHA 4GKZA 3O3DA 1DSYA 7CGTA 3IDGB 1ZT1A 3ALPA 5LBSA 3VYPA 1FG2A 1PY4A 3ZUNC 4BZYA 5BS0E 4TNGA 4Y7MA 2EXYC 4HKXA 4XVSH 4CN1A 5FB8A 1IBDA 5E6IA 2LVCA 4MB3A 4QXTA 2J71A 1D6VL 1KXQE 3WXVL 3QAZC 4PD4K 1FORL 4FABL 2MFNA 3FHQA 2AGJH 4N2LA 1CFVL 4TVSa 2GIYA 2V8LA 5K9JH 1U93A 3QWQB 1T1YA 4M5YL 4WHDA 5JW3H 1YZZA 3EUUA 5EZLA 5JW4Q 3HS9A 1F4AA 1KGIA 1FC2D 4TUKL 3P4MB 1X7QA 4Q8BA 4YQXH 2AANA 4RCAA 4TQEH 1EDYA 3N1QC 3SY6A 4EI5A 4QT5B 4JNXA 2WIIA 1QSZA 5LAXA 2XXCB 2MCG1 4ZX5A 5J0BA 4H1LA 3D85B 1DBBL 3BLKA 3PGCA 1SM3L 1DBML 4P23B 4FYTA 2DIAA 4IHBA 4KDTA 3DX1A 2VZTA 3HPLA 1KLFA 2BVEA 5DHDA 1J9CT 4N2AA 4OAWA 3MUJA 1OGAE 1JNJA 5I5JA 3CUPA 2QQKL 2DQHL 3RKDD 2FYYB 1DQMH 2WQUA 4QO1A 3BKYL 5DD6A 5JQIB 4AJWA 4N8CH 3DGGA 5FA4B 4HGKC 4YBLB 4BUHA 3DIVA 1NC4B 2D4FA 3CD4A 3GEWB 4YZFF 3WMQA 3R19A 2G30A 4M03A 3SGKA 2A9ML 2P5WE 4OGZA 1GGYA 1LMKA 4I2XE 2KUTA 2AXGA 3CN1A 3OB0H 5FWQA 4S0HA 3NSXA 3A67H 2NZ9D 5AVTB 4HW6A 1GL4B 3DVIA 4S1SL 3VQLA 4L4VD 5JYMA 1ORQB 2ROYA 1JTPA 3RX8A 2HA1A 2AAAA 2PPDA 1M7IA 3DSNA 3ABLB 3FQ2A 5DT1L 1HEHC 1DJIA 4XCYA 3UGEA 2O6CA 1RFDL 5JXEA 3PS6A 4PRHA 1LE9B 3BQVA 2A74A 4KWUA 5IBLC 1XF5A 1HK6A 2QTVA 5E2UH 2AK4B 1N2RA 1HC1A 4FQIH 5J3HD 4P9HH 3PWPD 2I69A 2JCCB 3RZCD 2VM3A 1NUNB 3VD4A 5CJXA 1ZT4A 5ADPL 4XMPL 2Y6TE 5SWZB 3EJYC 4AQ8C 5FKAA 5LDUA 1S9VB 1C16B 5EUOB 2JLPA 3ZE0F 1WWBX 3NJMA 4YBHA 4PFEA 3FT4B 4A63A 1YEHL 2NX5A 2H6UA 2IPTH 4PCYA 1BMWA 3QZLA 5L4MA 1INDL 2XN9D 5HHQA 3G9AB 1WAAF 2VERA 3UZEA 3MA7A 5IT2L 5KBMA 3SKMB 3PCYA 3VU2A 5CN2A 1DN0A 3FT0A 4E41B 4DAGH 3EDDA 4LSUL 4AQOA 4H8WL 5ABAA 5JIMA 1TZAA 3WS6A 1CVRA 4ACPA 2QJDA 4YXLL 3MGTA 1KFAL 1MW2A 4HFWB 2H8PB 5G55A 3FU8A 1ICTA 4M8QB 1HE8A 1F1DA 3QO0B 4MAUH 4PJBA 3MYJA 4LVHC 5I6PA 5SWSA 4R2GC 1CWVA 4MA3B 4NGHH 1ILUA 4FEMA 4GT7A 1DQJB 1XGRA 3CXHJ 3V5HB 3W9EB 3MBXL 1ZXQA 2OCCB 4ZFOB 5TE7L 5MENB 3BZFB 3NYKA 4UT9A 2B20A 2G9HB 4ZFGL 1NMBL 4UQ2B 1OP9A 7PAZA 5I75B 2VMDA 3TFKD 1GY2A 1YEDA 2BZCA 4L8SA 4YBQC 2M26A 1I3UA 4BFEA 3US1A 4PAZA 1GMIA 3T4AA 5C0CB 1F45A 2IAMB 4XNAA 1A8ZA 4HIJB 1N6QL 2X4RB 4EPSA 1GYVA 4K15A 3E6FB 4APQD 2YKLH 2NY3B 1F86A 3P11L 1QPKA 2Z31C 1M2VA 2Q3AA 4JN2B 2V2WB 1OAXL 1AZVA 4IGBB 2JK5B 2CKBA 1RIVH 5HBBA 1QATA 4GIPD 4GSDH 5D2LF 3KLQA 4B60A 2M1KA 4FFTA 4HSCX 2D7MA 2YBRB 4W6XB 4HJGA 3OJ2C 2HB0A 4WV1C 5AW1B 5JOFA 2NXZC 4L4TE 1HHJA 3E2HC 3GUFA 3MRCB 4HSAC 1QMUA 3VD1A 3MRGA 4A7VA 2CCLA 2VM9A 2DQUL 3ZDWA 2LVEA 3FQTB 3HN8A 3D25B 4LCCB 3UAAA 1Q72H 3J2PA 3IWVA 4QO1B 2L8AA 1FDLL 1SJMA 3P9MA 3D09A 2ADIA 3V5DA 3PGFH 4MSWB 5FGCE 5CN3A 1D5ZB 2IWEA 3X3GH 4KKAC 3MV9E 1DLHA 3UEQA 2WXKA 1FLRH 4Z7UF 2W65B 5DHVB 5JHDD 3ARZA 1TTBA 3G6JA 3KJ6H 2AXGB 1KLUB 5CFAA 4DF9A 4HC1L 3W5MA 4R26L 5J1AA 2YEZA 5FYLH 4ODHH 1NUDA 3LB6C 1EGJA 5IB1A 3RLSA 3RFZA 1J0ZA 2J6EA 1RJZA 2FJSA 4HU2A 1ZSDA 3TL5A 5IVZB 4XCYB 3S3DB 3CBJB 1WUZA 3QWOB 4FULA 1JFHA 4OLYL 3WHE1 1LE9A 2G3ZA 3MRQB 5A40E 4MB1A 5E8EA 4Q9QL 5FA3B 5TFSH 2WBJB 4AQZA 5JR1H 4NAMA 2XKNA 4X5XA 4ENED 4IEFB 4UT6H 4U6YB 1JGEB 4I18B 1A6UH 4J39A 3KPLB 3H4FA 3VDBA 3NJXA 2XN1A 4GS7C 1KLGA 5CZXD 4DNLA 3UAEA 3UG3A 4X5WA 2XWTB 5F72S 1ZA6A 2C3VA 3AWFA 3MN8A 3TH3T 1ETZB 5B1CA 3GZQA 2QQNL 5AYUL 3EHBD 3N85H 4JPKH 1E28A 4NIKB 3GSVA 3B2DC 3VD3A 3RX5A 3HPJA 4XVJH 2W80C 3L7EA 4YPGB 4GLRH 2Y9RT 4NQCA 5L8JB 3IDGA 3DX2A 2EXYD 5F93C 1PD6A 4K5LA 2H32H 4ZSOB 3AT8A 2WLIA 2DF3A 3FRUB 1V10A 2R8SL 1YPZB 4NQCE 4W9DC 2FJGB 1NGYA 2EJ1A 2FRGP 3QHZH 5I24A 4L8CA 3NSDA 3GBNH 1H8NA 2X10A 1DANU 5HJDA 1CQKA 2Q8BL 3U4AA 5LXGL 4PJAA 4OIAA 2E3VA 3ECBB 1Z7JA 3C60A 3NJIA 1FPTL 1RULL 3I75B 3ZQXA 3F3HA 3ARDB 5KVGL 5CLYA 5SWZD 3V6OC 4KAQH 2PF6A 3VRLE 3WHXA 2N01B 2QSCH 2GTWA 4MMZA 5CCHE 4UNTA 3QJUB 2F18A 2Q20A 4G43B 4K7FB 1P7QB 3GRWH 4M5TA 3ZKSD 4HUVB 4H2CA 1I9JL 2D31A 4XHQA 1ECYA 1K72A 2VXTH 4MAYB 2WXNA 4ADGA 3B83A 5E70A 3SEPA 1QEWA 1QFPA 3E6FA 4ZS7L 1T7ZA 2HP4A 3FUKA 4JBSA 4PRHD 1MUJB 3DMMD 3C2AH 4KKPA 4EO5A 1M6OB 3S34H 3WO3B 4YEFA 4RZCA 3BGMA 4WEBH 5BV7B 3CFCH 2BDNL 4G1MB 4W4OA 1YEIL 1L9OA 1A7QL 4YDNA 2PYFA 4U1SA 2FYYA 3A4FA 3ILQD 3T0XA 3ULVL 4WV1B 2LAAA 1MN4A 1G1YA 1GIGH 1ZTMA 3QUMA 3GMRB 4OT1H 2IGLA 3O6KL 5HD8D 3V10A 2VC2L 1KENH 3GFUA 3L3IB 4QHMB 4KNUA 1WQVT 2IDQA 2AK4E 3MV9A 2IBZX 1I85C 1TETH 3P2DA 1J12A 3ULUD 5CIPH 2IV8A 1R19A 4XB3A 1O5PA 5JHDE 3TN0A 1GR7A 4I1PA 4LPWA 1TVHB 5G5DA 2W8CA 1MOEA 1NKGA 1DBAH 5IB5A 1U8LA 3SPGA 3UJTH 3D0VA 3WLWC 5JXED 3RDJA 3OKMB 3EJPA 4DN3H 3RVUD 2CG9X 4YHYB 3S4SA 4AIOA 1OZTG 2KLRA 3QUKA 4P5RA 4AYSA 5FYLE 3SE8L 4OZIF 4HIXH 4FXGB 3A6OA 3HI1B 1YNKL 3IKCB 4XNMB 4WWPA 2B16A 3B3IB 5DMKB 2AK4A 2ROXA 43CAA 2AMUA 4KFZC 4CADB 4F7TB 2GFBA 4OF6A 4MTMA 2JQAA 1WWCA 2WZPD 4X7DC 4N0CD 1Q9KA 2FT6A 5CJQH 3ZZLA 1FNAA 4JVWA 4LSTL 1DEEA 4FX5A 4ISVB 2EILB 3LRMA 5AW6B 5ACZA 1FORH 3TVMA 2XKNB 5BUPA 4JFFB 1ZT7B 3HIZA 2E7LC 3VXRE 5I76A 1JVOA 1NM4A 1B9ZA 1OGTA 3FQXA 4I89A 4Q97A 1XGUB 2NY6C 3L2MA 5CJ8A 1UA6H 4AYGA 2VMEA 3T2OA 2K4WA 3TYFA 5IV2A 1VGKB 1ZA6B 4MNGE 3QDJD 3QIUC 3S4SG 1J5IA 5T3ZE 3BGFB 3I02A 3MO1B 3NRFA 4FQ2H 2EVGA 5MEND 1EMTH 1KY6A 1KJ2H 4QF1A 3LIUA 4Z7OB 1WIOA 4OCLC 1T0MB 3F12B 4M6OL 1CDGA 1UJ3C 3IGUA 3WL9B 5IMLA 5JXAL 4FNTA 3LTVA 2JKTM 1QFWH 4PJCE 4ZFZA 3NCWA 5CHNA 3KWUA 3FUJA 5KSAB 3T4AC 5CEYA 1CB4A 4JDTH 4P5MB 4RBPH 5EIIB 1GZQA 4JFPA 5EF3A 1G7LA 4ZMTA 4UU9A 2BNUA 5BZZA 1D6EB 4DP6X 1PFOA 2YFNA 5I66A 5TFSL 2WXGA 4D8PA 1E4XI 2XJKA 3I75A 1AAJA 5I8OH 3SCMA 2C9QA 2P5EE 1NOAA 4UAHA 4FNUA 4PCTA 1BVLA 4R8WH 5IGXH 1N68A 1FAIL 4WI7A 5ACLA 2AC0A 4X98A 3OAYK 2AAVA 3M07A 4S2SB 1I7TA 2NZ9C 4N8VA 5F2FA 3TV8A 5FGCB 1EXHA 2ZUWA 1S46A 4N2EA 5F96L 1CFSA 5FW6A 1QOKA 5TE6H 4HUVA 3ASWA 5GISL 1OANA 1NC2D 4ZZFA 2HG0A 2OZ4A 4MRBA 1NIDA 3P02A 3PWVA 5H94B 4XP6L 3WFBH 2OAAA 3ULUL 2YXVA 3AQDA 4NNXA 5E6YA 2ZAIA 3K8LA 5C09A 4PJDA 4NIYE 1B90A 1W72B 1YN6B 4JKKA 3II1A 1D9KD 3QQDA 1U4FA 3IKKA 2H26B 1L3WA 4B0MB 5MERB 2NDGA 2XVBA 5AD0A 3QO1A 2Q9OA 4E9SA 4K8RC 3D2TA 3PDOA 4E2OA 4Q56A 4MD0A 4TVPL 1JHTB 2VLME 3LNEA 1JZ5A 4HHGA 1K6QH 3OHXC 4AIZB 3F7LA 1FE8H 3GKWH 3HN3A 3OKEA 4K3EL 1JAEA 4UV7L 1L5GB 1CBVL 4HJEA 5GSVB 1MZZA 4KKBC 2OTUB 4FD0A 1UEYA 4NQDD 5E1HB 4BK4A 3EYVA 3LV3A 2OMVB 5D7JB 5TDPB 2WSKA 5CGMA 1FNGB 3L1OL 4LIQE 1MFBL 3QNFA 2BC4B 2GIMA 4M1GH 4ODXA 2JTYA 3KYKL 3ULVE 2QGEA 1S9KC 3BUIA 3WN5B 3KPNB 3L16A 4LEOA 2RR3A 3H53A 3TO4D 1A9EA 1DBBH 1SOXA 3I6GA 1JPFB 1C5BL 1KBWA 2DLFL 1KJMA 5CBEA 4TRPL 4R2GD 2UX6A 4D9LH 1NGXA 4PRBB 1ES0B 3DXAA 2VR5A 2GHWB 3BWSA 1EPFA 4AEIL 1KCKA 2XZCL 3SODB 4YSTA 5E2TL 1ETJA 2DJ4A 2HYMA 5FM4A 3HE7C 4LPTA 1EVTC 1HHKB 1PSKH 2WWNA 3DV4A 2DLGA 3SDDC 4L8BB 2F7QA 1A9VA 4ZBJA 1J1XH 3DK2A 5D7KD 1LO2L 1ZANL 4AZUA 1YEKL 3NA9L 4YWGH 3QDMA 1A64A 3UYRL 2OI9C 5JPNA 2F58L 3QUYA 2NY5C 3FT1A 3DX6B 1LO4L 5GRXG 1K5WA 1OOAA 1IIIA 1A4JB 5IBUG 4PJ5B 1A47A 4UTCA 5DK2B 2AK4D 4O51A 2XWXA 3VXPA 2D3VA 1EGJL 1VGKA 1KJVA 3TBVB 2XT1B 3IETB 3UMNA 3FNKA 3B9KA 5A2CA 1MY7A 3GBDA 4GW4B 4IRZA 4N20A 1J5CA 3IMBA 3LB6D 1BX2B 2DQGH 4GUPA 3PHQB 2C4XA 3LZFL 4CVXB 2IALA 4PLOB 4PJ7F 5J9PB 3ECUA 3A24A 3B2MA 4AMXA 4JO1L 5CLWA 2YD6A 1AKJA 1OB0A 2XZZA 4A7GA 2R2EA 5EZIL 3QUHA 1FNSH 3GQFA 4MNHA 3VX1A 4AE0A 4YK4C 4U6HB 3AS2A 2YPLB 2IDTA 1MFDL 5GRZA 4J3OC 2R0ZL 2P8PB 5EBMA 3HG1D 4HLZH 4ADJA 1Y0LA 3NSFA 2ITFA 3FOMB 4Q58C 1BVLB 2E46A 5KTEL 4N1EA 4R26H 2VDNL 3CFJA 3QZWA 1JYXA 4J6RL 1EZLA 4PJIF 4ELMF 4LRIC 4F7CB 4NHUB 2APVA 2BIQA 3QZPA 4XBEL 5CZKA 3AT9A 1N8ZA 2JTDA 4Z7OE 2NNFA 2O5ZL 2BP3A 3OSKA 4WO4A 4R84A 4YHIA 4XMWA 5AW4B 4FXKC 1E2WA 2VAAA 3EO1A 4WHYG 2V3EA 2VRAA 3DDGA 4Z0XA 5FYKH 1XF4A 2HLFC 2UXGA 4AGLA 1O6TA 4U1JB 2YA0A 5E24E 2FR4B 3O45A 3TEUA 5E2WL 4XN5A 1YMHA 4GG8B 1BDYA 4HV8A 2B4CL 1A25A 1IAIL 3GZPA 4MZ3A 5TF1H 1WS8A 3MV8A 5J56B 3LQAL 3QJQB 3ZQWA 1U95A 4I48B 4G9DB 5F3FA 4P2OA 1UH4A 4R96B 3VFPA 5DMGC 2KL6A 4NI3A 3VXUB 3UAJA 2NCMA 4NZTL 4M48L 5C6PB 4L2LA 3CC5A 4KY1H 3JYBA 3OKMA 4HT1H 2UZXA 3EYFB 4Z3HA 5ENWA 4JL1A 5C6TL 4LZKA 4P2AA 3UTSA 2AV1B 5IVXF 3IJHA 1GGUA 4KDWA 4XNBA 1HS6A 1FNGA 2VMCA 2UWEA 2CHZA 5ALCH 3TBTB 5F96H 3I6KB 3TNNB 4JO2L 1NOLA 3OZKA 5IB4B 4MB5A 1FGVH 4TRPH 3WN5A 3N91A 5CEZD 5J6GB 5KS9B 4PRPA 5DO8A 2BY2A 5EU6D 2ATPA 4M7LL 1DQLH 2WUCL 2YGNA 2PR9A 5FM5M 1LEGA 5C0NC 2F54B 5JMRA 5BRQA 2BFVL 3T3PE 3RB7A 3FB8B 5G4OA 4LSQH 5ADOL 3A47A 1I3GL 1ZDSA 1L9MA 3EJJX 3TZVD 4MFHA 4JGNA 1KYDA 4PUBL 3BEWB 2VXSL 1L0QA 1S7XA 1THCA 4HXAH 4U1NA 5DSCA 4P4RA 1XHHA 1ACYL 3HUJF 3FW6A 3ARBB 3EH4B 1A1OA 5F71A 2R7EB 4E0RA 1F58L 3SPJA 4HEPA 2B2XH 2XNAA 3LPOA 4JO8A 4PGCB 3HUJB 4LKXA 4DKEH 2DQIH 4GT0A 4ODVH 1UD5A 3C60C 5JXEC 1NIAA 2OSXA 3DRQB 2ZCZA 2E7DA 4Y2DB 4UM8A 2QT6A 1Z9SA 3ZU8A 1JN6B 4K2UH 2Z7WA 1AD9A 4JHWH 2P80D 5T3ZL 1MH5A 1JF1B 3UZQA 2B15A 1MW0A 3M1BA 4GUPB 4Q6YA 4KPHL 5JW4R 3C5SA 4GIOA 3TBSB 3C9NA 1AS8A 4HS6A 1DVUA 1DL7H 1RHHA 4PG9A 5E9DE 1HYRC 4Z0BL 2HFGL 1Z2KA 4Z8FL 2HLAB 1T1ZB 3FU5A 3PJSB 3DETD 4XNUL 2ICCA 1TOXA 5B21A 4AENB 5I6LA 3IXTA 3O11A 3CLEL 3LN5A 3GF8A 2MQ0A 4G1EB 4OCYL 1IGJB 4GW1A 4YK4B 4EDWH 5C6WH 1EZVY 1ERNA 3G08A 3PG2A 4ZYKB 2EUVA 3JWDL 3ZW3A 1AOZA 1PX8A 5AOLA 4DKEL 5LHDA 1ZLWH 4M9OA 3WJLA 1XCQB 1TCMA 2GG1A 4HX1A 3OGCA 1UURA 4NNXB 1TTAA 2FATL 3OAUL 4YNYB 3FQRA 4A2EA 3R4DA 2ZKHH 3CSBA 1KCSL 2JJWA 4QWWD 4X7FC 2I27N 1H3XA 4B5EA 5J12C 4M6ML 4N28A 4R5TA 5DVLA 4YDVA 3IMUA 1NEZB 1D7BA 5MEOB 1UJ3B 5KSVA 5BW7A 2PO6A 4Z0XB 4HSQA 2PETA 4FZEL 1M1XB 3EO9H 5LWYL 3O2DH 1UYWL 2XPGB 3H42H 3PP4L 4ONGH 1OB1B 2P9RA 2EQDA 5GGUB 1L5GA 2XC8A 5T1MA 2AK1H 2YD3A 4L37A 1LDSA 1UB6B 1E4XL 3KYNB 4IIQB 4LFHD 4WF7A 1KIUA 4OBRA 4APXB 2Y23A 4U1KB 3B6SB 4PR5A 3NJVA 4PLJC 4YQXL 3BSGA 3BH8B 4KTGA 4EUPG 5FX3A 3V8OA 5CSZB 4HLJA 2JF1A 4P46B 4FXTA 1GSMA 3QJVB 5J13C 4ZS7H 2RCSH 4WI9A 5GZOD 3RY6A 1PLGH 1EJ8A 5EEWA 1RCYA 2L04A 1JZEA 3APNA 1A14H 1T1XB 5JW5B 4M1CD 1F3DH 1QP1A 4NCC2 1BWMA 2WLLA 5EC2B 3CFMA 3RNQA 5J6GA 1J88A 4IMLA 4RISH 4BFFA 3HHMA 4WNQB 4ZUUA 1XR9A 4UIMB 3C87A 4JO1H 1AFVL 1LEGB 1BW8A 1CE6A 1YN7B 3KDMB 3X3FH 2PABA 5ABZA 2IQAB 1MG3C 1HL9A 4B0MM 4PWEA 2VSMB 3DX6A 4OBSA 3HB3D 2A38A 1WSST 3MLWH 2ZOWA 1SF5A 1YY8A 3JZ7A 2X38A 5DA4A 1HZKA 2BOBB 4U0RC 1FYTD 1RK0B 2BCKB 5CP7B 1KTLA 4NAQA 5E8OA 2HRPH 2OKMA 3D18B 4N1CA 2Y36L 5L88L 3L9EA 5JDSA 1KFGA 4NKOA 1WCBB 1UOVA 2X09A 3MNZB 3BN3B 3L54A 1S8DB 2R4RH 3HS0B 1XD0A 5I16A 2PUQT 4JG1L 5ANHA 3WNJA 2O5ZH 2R0WH 3E9UA 4WI0A 4UT9L 1EJ6A 1PIFA 3RA7L 1D9KC 4U6TA 1BPVA 4C56B 4Y88A 1MCLA 5I71B 3IPFA 3UBXA 4ONOA 4B7IA 5AUMA 1TITA 1AXTL 1BXUA 3M1BB 3DC0A 3SKOB 4KOCA 5HHOD 3WLBB 4U6HA 4DZBA 3CTTA 3V0GA 2MKWA 1ZHKA 2OP4L 1TZGL 5DRZB 4K71B 5CEXB 3IXAB 2P8PA 4ZXBD 4ZMPA 3MV01 2C4FU 4TVPE 3QWRD 3GS7A 4OZIB 4P5TA 2VSCA 4JANB 2Q10A 2J43A 4A7TA 4KXZI 1EHLH 3MRRB 5D6CA 2Z31B 5IP4A 3L1OH 2IPUG 2X12A 3AU0A 1MJUH 5AQ0A 3O6ML 4G8IB 2P46B 4C54A 1NKRA 3KXFD 4QCIB 2ZUVA 3U0WL 1QQDB 3NESA 4LCIL 5FUCE 3PWJB 4WI5A 2JB5L 2VERN 3ARFB 5EU4B 2XBZA 4X6FB 3RVWC 5IOPA 2HRGA 3IGAB 1CE1H 1UGKA 2WOBA 3UADA 2KLTA 3CFIC 3BZ5A 2B1OA 3OWRA 4XVUD 5HDQL 3NQKA 1F56A 4BH8A 4JM2C 2YXWA 2WKLA 2AVGA 4OLEA 3F7VB 2CALA 1NIEA 3CQQA 5MEOA 5D7SH 2EDKA 2A74B 2DKMA 2A9CA 1HEZA 1J1XL 3T3PB 1GSKA 3V6ZB 4FERA 1XDTT 2G2NA 4NLAA 2ODIA 2HJLA 1EHLL 4NKDA 2UZXB 4M8RA 1FZOB 2ADJB 3IDJA 4OFQA 4A6YH 4D2NA 2FLBT 2PMZA 3DX4A 3GO1L 3H9HA 5FKAB 1F3JB 1BAGA 4XX1G 2M2DA 4M7KH 1BXAA 5CJBA 5DEGA 5E9DD 3FB5B 4PREB 1X6NA 1SVCP 7PCYA 5KN5B 4DUVA 1AXIB 3FT4A 5HI4C 3VFRB 4B50A 1WIPA 2ZJSH 1B88A 4GB9A 3N50A 3U4BH 3MODL 3PLYA 1FIGH 1NBZB 2OMZB 2A6JB 1DBJL 4PRIB 4ZPVB 1E3FA 4PTTA 4F2ME 3B5TA 1IGCL 1VEMA 4XXWA 5ISZD 3BP4B 5F9DC 4ZMQA 5EIIG 1FFTB 5E2VL 3BHBB 4ICWA 5HI5C 4MJ2A 2YJQA 4QRTA 1TT6A 1RP9A 4CVZB 2YD1A 1H6FA 2YEVB 5CZRA 2I85A 1I1FB 4UTBA 4G80A 1F3RB 1XSKA 2NY2C 3SCMD 1AD0B 2GK0A 4DPAX 2Q86B 5KWYC 1G9NC 4LNRB 1HINL 1HH9A 2WTPA 4IJ3B 5E6ZA 2P47B 1J8HD 4HCRA 5F9OL 2W0FB 4FQ1L 4WDIB 4LRNL 3IAQA 5C0AA 1J18A 3RL2A 2YAPA 3KPRA 2WSDA 3GMOB 4UQBA 3FTSA 1FZMA 4HOXA 1NGZA 4EUPA 4EI5B 4DQOL 4Z7WB 3T2QA 2I9LA 2PCYA 4RX4D 4XVTL 3D85A 2WXRA 1DUYA 1I7ZB 2BVPB 1IZKA 1M2VB 2B5IC 3LEYH 4W1TA 2MCAA 2H0FA 1RJLA 4LCWD 2B9BA 4AEIH 2WLNA 4B7LA 3VFSB 5JQ6H 3L3JA 3RL1A 3ZE1F 3P4NA 1E43A 1SJEA 2AJZA 2BVQA 3U9PL 4HUXB 3W5NA 4F8TA 5A2FA 3MRJB 3HRZA 4B3EA 1IFHH 3TIDA 4JR9H 5F9OH 3JVGA 2X2UA 4XAWL 3LKQA 4L9LB 3KHQA 4HAKA 2AXWA 3OR7A 2GSIA 4P4KD 2ORBH 1Z5LA 2CKBL 5T3XD 1N64H 3O0RL 3PV6B 3CDZB 3KBHE 3UC2A 1JXKA 3GSQB 4RSVA 3V4PA 4ETQB 1G43A 3KVPA 1HDMB 2PW1B 1SDYA 1UOKA 1P4IH 3FMGL 4GYBA 4L0YA 4N5ED 5E4AA 1KG0A 3GSNH 2BSRB 2JKIS 1JXDA 5ICYA 4AVKA 4KKLD 4ZOEA 2ZKMX 3MUGB 3TOPA 2FSEB 1LL1A 3AMKA 4JZNA 1YAZA 1YMMD 3P4OB 4MA8H 4HKZB 1KEGH 1C16A 3DTUB 5EUOA 3IJSB 4U1IB 3MVSA 4FHBD 1M7UA 2FWLB 2Q7NA 1S7WA 4X6BB 2EYTB 3UBHA 4UF7C 1K8DA 1I1AB 2D3NA 4RH4A 4F33A 3ZL4L 5CSZA 1JZ4A 4LARL 4DPCX 4OZFG 3REWA 1TEGA 3D8MA 4M5YH 3ZYZA 4WI8A 4OD2A 3IB4A 1MJ8H 1AXSB 3DGCR 3ZN6A 3CPLB 2V5TA 2X70A 3CDGB 1H5BB 2EIBA 4N68A 4P2RD 4X7SL 3PY9A 5EU5A 4M8QA 1JFQL 1KBGH 2Z64C 5HHNB 4J3UA 3CLFH 4Y5XA 1YNKH 3PJLA 1ADWA 4U05A 4GMTH 4PJFF 3UJJL 3VH8B 4NZ8A 3DX8A 2A9NL 3EJTA 3VXRD 2R8SH 1ZGLM 4NC0B 3LPPA 2W07B 4E9RA 1E7VA 1ZVNA 4OZHF 4GOSA 5IROD 2IOMA 1HKFA 1I9IH 1PQZA 2EC9T 4RZKA 1JGIA 4AQAA 3K5SA 4EIBA 3VFGH 2Y6SD 4BA8A 4OQTA 3MMEA 2R9HD 4ES9A 2GW5A 5E8OB 5E51A 2FQGA 5IMOB 3CVHB 2GK0B 1AGDA 4JDEA 5E8PB 3SDAA 3ISRA 3FT3B 3ZMEA 4DH2A 4L1LA 1E8WA 4G42B 3N04A 3V0FA 3P9LB 2BFGA 5E6IB 1U8QA 2HT2C 1LQBC 3B9AA 1H3VA 1TYRA 1QNIA 3MJ6A 3KPRB 3MOBH 2B8OT 4F5CA 5I0ZA 4J5VA 2O5NA 4XNZC 5IFAH 3D05A 3W39A 4UT7L 2YRLA 4OF5A 1T04B 5EF1A 4MCMA 4NN5B 4HS3B 1AMXA 4KVPA 3VFOA 3U4BL 1UATA 4FTVA 3W9DB 3THMH 2C3HA 4YLQT 5JW4N 4NN7B 2HKHH 1S9XB 5C2BL 1EO7A 3MRCA 2ICEB 3P3SA 1MCFA 4JM4H 4TTDC 5FCUH 3ARGC 2RMNA 1JF5A 4YE4H 4BH7B 4JGUA 5DFVD 5I6MA 5L2KE 2FJFB 3D1MC 4N85A 1KB5B 3VXNA 1I1RA 1UB5B 4UM9D 35C8H 1PNCA 1W91A 3AXLB 3QEQD 2YPLD 1IAIH 4NQTA 3QDGE 5TK2A 1S9WA 4O5LH 2JLLA 1UM4L 2J2ZB 4HYTB 2E4FA 4ODUB 4U2ZA 1Q9LB 4Y4HD 3LKPB 4M61A 3RWIB 4DHLA 1WZKA 5KYWA 3QWRA 3CSTA 1Z9NA 4HS8H 1SEBA 2NW2B 3MNVB 4J4PA 5DHVA 3SDCB 4GG6B 1OP4A 3O4LB 4PWIA 3MRBB 5F88A 2KQNA 3NIGF 4L9LA 2YFOA 1U3HC 4XODA 5TJWK 3GLAA 1MJ7H 1CL7I 1GC1C 4JHBA 5DJ6B 1T03L 4Y19E 4YL9A 1EEYA 2CIIA 3OXSB 4QXVA 3P69A 4F7PB 1BCIA 2CR0A 3FFCA 4JAMA 4NOFA 4JDZB 4XBGB 4YSQA 3K8KA 4KKCD 1KEML 4KK9C 2AQ3A 3B7TA 2R69H 1CL7L 1J8RA 2NXZB 2DWXA 4KDTC 5BXFA 2FIRT 4GAJL 2VXUL 4WUKH 2GPZA 2QHLA 4WEBL 2NR6A 2R2HA 3FCGA 1PG7X 5JIHA 3FT2B 4Z3FA 4CA4A 3MQIA 2EE6A 2C26A 4OQ1A 1ECZA 3D2UD 1ACCA 2PN5A 4GBXA 2DLHA 5FGSA 4HKJA 1QNZH 1PZSA 3GSOB 4WW2F 3VX0A 3WFDH 3RI5F 1R3KB 3TVMB 3G5XB 1I1AA 4KY1L 3VFRA 2XKSA 3SD5A 2EVHA 5I0WA 5JOPD 4E42B 1I3RA 2CBQA 4MLSA 3GO1H 3QSKB 4OZGF 1P53A 3VYOA 2PP7A 4JFEE 5KSBE 1ANUA 2BHYA 5AVZB 3EOBA 1ZLSH 5HDLA 1E9QB 4ODWA 3LDBC 5DJCB 5H37G 3RE0A 4QI3A 1A1MB 2R0LL 2EE9A 4J3SA 2SODB 1HSBB 1K9TA 3FOLB 2XOTA 2NY2D 3VUAA 4I1RA 4HUWB 3VH8A 2WXMA 4FMKA 2EE2A 5JIIA 4AC4A 5G2NA 4CRPA 2NY1D 1BXVA 4P5MA 4EN3B 2ZUQC 1IRAY 3J07A 4XR8C 4HKXB 1K3IA 1QLEH 4ANWA 1HH9B 4URTB 1WTGT 3QUZA 1R33A 2G3XA 4H8QA 2F58H 2A5UA 2FL5A 4PVLA 2ARJB 3BQUD 2ZOLA 5C71A 2B39A 3VFNB 5DUBB 1IAIM 1YJDC 1TTRA 1NGZB 3FUDA 3IDIB 3ZTNL 4EUPB 5JW4M 3KWVA 1EX0A 3CHQA 2XZQH 2N59A 1U58B 4PJIA 2BIOA 3QUXD 4TQHA 2IXQB 2K8MA 5GISH 2YWYA 1I7TB 4YHZH 1JPST 5C0BB 3RX9A 4RZCB 1OKEA 3THML 1A1NA 1VDGA 4QJ4B 1VCAA 2RHEA 5E5UB 1T04A 1T6BX 1TU2B 4M02A 4U1SB 3AM8C 2CLZB 5T1KB 4G6AD 4OLYH 3ISWA 3UAJD 3KYOB 4KKCC 1WEJH 2NR6D 1RZQA 2VW4A 2EXWC 4K94H 1QFWL 1F8TH 3QXAA 1COBA 4UTAA 4BZ1L 1G7IA 3OKLA 4K55A 3HZKB 5TE7H 1JPTL 1YQVH 1IM3B 3CFUA 4KX9A 4NQVA 2EE0A 4MA8L 5HI5D 1JNNH 4WI3A 3PFUA 3JVFC 4ELKB 4EZMA 3HE6C 4Y4FD 3U0PB 4E9XA 1PZBA 4K3EH 2OSWA 3WDIA 3OR7B 3STLA 4L23A 5LN8A 2DQDL 4PJXB 3ES6A 5GSRB 1X7TA 3KEHA 4WY7H 5JA8B 4M61B 1X44A 5IESH 3UP1A 4Y2OB 4W9HC 1H3GA 2APFA 2KC0A 4AGMA 3Q5YA 5F70A 3IGKA 2G4EA 4NT6A 3FQNB 5KANG 1U3HB 3VCLB 2ICWJ 2VN6A 2X4SB 3CLFL 3CZFA 1Q0XL 2G9KA 4FJ6A 4WLCA 3WNKA 1DBKL 3WU1A 1SOSA 3EJRA 4FG4A 5ITFB 1MCWM 5BO0D 1I8IB 4DP9X 4JDVB 3QHTC 3GHBL 3K6IA 3KPPA 5C0EB 2IFFH 4JZNB 1QRNB 1CGSH 1TZIB 3ARWA 5E1IA 3DVNB 1PZUB 3DJTA 1EEZB 1XT5A 1MVUA 1HEJC 1HILB 3WI9A 3MNWB 4I0PC 3OKOB 3SD2A 1NAMA 4GAYA 4BZ2H 3ZSSA 3CJJA 2WYHA 4F33B 4DPRA 4P06A 1T2JA 4WRLA 3MACL 4NUPA 3DV4B 3O3EA 1QX1A 4X5RA 5KANI 1FYHB 4N87A 4PJIE 4Y5VB 3GSRA 1PYWB 4NO3B 5D9SA 4TUKH 1P5VB 5F21B 4X5XB 3V0JA 3MKGA 2FEEL 2P8LA 4YGAB 3WFHB 1EFXB 4LPCA 2F8XC 2WQAA 4S1RH 5D4IA 1X9QA 5BUAA 4XB7A 1L9RA 1DLFL 2XWRA 4QJ5B 3DKHA 5J6HB 3WSQH 3ZT6A 2XQ0A 4LEXL 1MCCA 2DV6A 2WQVA 1B2WL 4NQCD 1NBCA 1PF3A 4JFVA 4FQQA 3O9WD 4TULH 2WNWA 4DKTA 1H8SA 3Q2LA 1MRFL 1IGYA 4KK8D 4R5VA 4PJ7E 5B8CA 1VKXB 1WVZA 4NGHL 4KMQA 1BX2A 1U8KA 3NIDE 3QIWC 1G1KA 4HUWA 5DS8A 5L8LB 5L6YL 1AZRA 1IAKB 3QCUL 2F08A 2WN3A 2YN3A 1ROCA 4IMKC 4KZCA 4GI6A 1RZJC 2EDTA 2DKSA 4XN7A 4CSZA 4EN3A 4GQ9L 1IC0A 4L29B 4XC3H 1P6WA 2MPVA 2LTQB 3KCPA 1AACA 3EHBC 5JHAA 1M42A 4F8PA 1RLWA 4HGWA 4JGJA 5I19H 1JZ2A 1NLBL 1D5XB 1CD0A 2R0ZH 2YAMA 5EF2A 5GJTH 1QEXA 3TYGL 3C60B 1I1AC 1HQRA 2Q5BA 1G7MB 3MCYA 3BP6B 4K8RD 5A16A 5IHBA 1RV6X 5LJYH 3FOMA 3AC0A 1JYVA 1AGBA 1ZTXH 2EYSB 2YIHA 4HK0B 4RNRB 5C0FB 1O6VA 1WISA 2WOYA 3DGDA 4TQEL 3II3A 3CU1A 2W0KA 1G5GA 4D0DA 3RGVB 1P7QA 2K9FB 2ICEA 2YN5A 3QQDB 5IFAL 4NO5B 3KPSB 3BZEB 3H9SD 1OAZH 4JFED 3LKSA 3U0TB 2X1XR 5IEKB 1BVKA 1ZHLB 4YHML 3FFCE 3U4EA 1VPOH 1IC7H 3EGDB 3KYOA 5M95B 1PKQE 1JHTA 1HHJB 2QQQA 2X53A 2C9UA 2ZCKH 5BRZE 5JZ7D 3MPCA 1KIQA 1ODAA 2MNUA 3NIGE 4B96A 3IF1B 1ID5I 3K5RA 3E7JA 3MNVA 3C09B 4V2CB 2ZUTA 4JRYD 5KBNC 2GT9B 1FNEB 1JI1A 1SHMA 1C7TA 2ITCB 1RZFH 1SY6L 1XTMA 2GCYB 1EQWA 3SGJC 1JGLH 2G75A 2UWEE 2ADIB 4JJ5A 4X9IA 3TO4A 2AJ3B 4ADIA 3ZL2A 4TLSA 4TXVB 4NSKB 2X2HA 3FSZA 4Y4FA 1E67A 1QSFD 3FFCB 2K6ZA 4MAZA 3GBMH 2JE8A 1BZ9A 1MNUL 5CJ5A 2YAFA 3HZ3A 5GGVH 1CD8A 3T3ME 5DZLA 4YHZL 3S34L 1KJ2A 2WCGA 3FAWA 4XPGH 4Z78B 1VFBB 2RTTA 2X6CA 3BVXA 4PV8B 5CF3A 3RFZB 3I2CH 2SEBB 4PY7B 1OWWA 1OARH 4JDVA 1T7XA 3O9WC 3M8OH 4JPIA 5D1QA 2P7TB 3KLKA 3LRSA 1G9MC 2NZ1A 3HI1A 3VWKB 4GAJH 5FS5A 4HIQA 5IB3B 5CKGA 5DR5H 1FQ9C 1QASA 2YO3A 3MBEA 3QUYB 1KYUA 1JRHH 1CXKA 4TNFA 4A6YL 1YYMH 2BY1A 3FCBA 4Y5VC 3DHMA 1MCSA 3V4LA 4U1GB 3ZTNH 4NUGL 4XB8A 4QRUB 5K9JL 1P5VA 5I1LB 1CDJA 4GW5A 4B5ZA 4ODWB 3L5WB 1DDTA 3HE6D 4Q6IB 4QKTA 4Y4FC 4ETYA 5F9WC 3WSQL 3Q5OA 4FMFA 4LIQL 8FABB 3C08L 4B3VA 2X1OA 1HSBA 3VSVA 1ZXKA 4R3SA 1PKQB 2UUDH 3ZTJG 2IADA 4WJG3 3FBQA 1CC3A 4O2FA 1ZLSL 5DRNA 3RTQB 3OKKB 1A0QH 4JRXB 5HY9A 3RBSA 3EBGA 3PRZA 1OP5K 3C2AL 1AZNA 2YSSB 3GWJA 4ZT1A 1U30A 2V7HA 1UM5H 4GSRA 2ARWA 2XN9A 1JF1A 4TNVF 5GRJH 3TJPA 3UZQB 4EIGB 2QV2A 3QH3B 2F6AA 2WB1A 5D4HA 4DO4A 1FRGH 1WIUA 2FX7H 1RK1B 4G7VL 4PLKD 1IE4A 3RPKA 1RHHB 1R6VA 4NHCH 4PS3A 1PZCA 4LHUA 2EDEA 4TV3A 1SBSL 3UGXA 4L8DA 1WHOA 5DLMH 1I82A 2E6QA 1FYTA 3EJSA 3ISYA 4UU9B 2LABA 1WC7A 2P5ED 3QZWB 4QHUA 4MJHA 1OPOA 2DMHA 3VD0A 2WMPB 3E3QC 3IBOA 1A14L 3O8XB 4OLZL 1SXSA 3UJIH 2X3BA 4KRPB 1A1NB 3VNZA 5DO2D 1JPGB 2O72A 4X99A 5HYSB 1OOWA 1PFCA 4Z76A 2XPYA 4KRMB 4NNPH 5LGKA 3DMMC 1A3RH 3FO1A 4PMEA 1QSEB 2AF2A 1OPGH 2X4TA 1OWRM 4YNYA 1NCWL 1U6AH 4D0DB 3HC4L 1GGIL 4S2SA 4WUKL 4DP0X 1T5WB 3DI2B 1TTFA 3RIKA 2BMKB 3RUGB 4YIQB 1ZLVH 1ACZA 4OLXH 1QBLH 2C9XA 1WV7T 4JKWA 2PYFB 2Y06H 2BS9A 4EEEA 4ONGL 4JFDD 5DJYA 4MQXC 5CO1A 3STLB 5BQ7A 3VXUA 4PS4L 2HRPL 4AYFA 3DYPA 4P3DB 2CAKA 5GGTL 5GGUA 1CG9B 1IKFH 3IDXL 1M56B 4XCEA 4BV1A 2GT9A 4DVRH 3TS8A 5IF0B 1YO4A 1NA8A 2O6PA 3OGOE 4PRNA 3SY0B 1WUNT 2WY3B 4YSUA 2W60B 1URIA 3HRZC 2Q3XA 3T0ED 2NUTB 3ZE1E 1MFCL 2YA2A 1AZUA 2NNAA 1NPJA 4P46A 3ZKMD 3HW7A 2FNWA 5LXVA 2OTUA 5C0EA 1H3TA 3LKNA 4JPWH 3QI9C 1Q8MA 4WQOA 4P23C 1NGQL 1ULVA 2OX5A 4NPKA 3LV3B 5D7JA 5H2BA 3QR1A 3MV7D 1HILA 1DFBL 3C8DA 3U36A 5IHZB 2F7OA 1XQ4A 3N40P 3UCQA 1UOLA 2EEBA 4BUGA 1UWEL 1I8LA 4NZUL 5FYJE 4L5FH 4UILH 1PYWA 1WD8A 1K6QL 1A4KA 4ZODA 4KBPA 1PZDA 2IBGA 1JHLH 2DPKA 2K4AA 5I76B 3U1QA 4IRSC 1UZ6F 3DX0A 5F7EL 4G8EB 4GJTB 4XPBH 3CVHL 3GBEA 3HUJA 1OTTD 3QC5X 4ZW3A 3D39A 3GI9H 4EKJA 2WN2A 3MROB 1HWHB 2Z7YA 2LU4A 3LQAC 4Z77B 2VH5H 5B3SB 1JK8B 2FATH 1RJYB 4JFOB 4JFQA 4NQXB 4CBPA 3WFEH 3MOQA 3DUUA 4TVUA 1C5CH 1GZHA 3LJ3A 2H41A 2OSLA 1HYSC 4UQ3A 2LLGA 1UFGA 2Y2YA 5BZXA 2KYIA 2IADB 3CCHB 4KROD 4XNYL 1YA5A 3SDDD 2R29L 3SO5A 1UM6H 2VB5A 5CHNB 1R75A 3ILDA 4XPFH 4KJPD 1T3FB 3MCKB 4CJ0A 4R4ND 1IBYA 4OFIA 1U3YA 3FF8A 1YSOA 4X5PA 2VXVH 3M8OL 1G7LB 5IFHL 5KBKA 1DFXA 4BBWA 3AG1B 3CQFA 4RWYH 5EUKA 3RWGA 5I8EA 4A04A 1IGJA 3HI6L 1NC4D 2A0LD 3QORB 2BNQE 1AQKH 2NSQA 4MNQA 1KF9B 3GMQB 2PLTA 3D39E 1IUZA 1KDJA 3P9WB 3HR6A 3TM6A 2YR3A 3SOBH 5DRZA 2YD4A 2AEOA 3EJUA 1EZSA 1IGTA 2PPEA 2QZQA 4YLBA 3FCSB 3MLRL 3K6DA 3L1EA 3QEGH 5T1DL 3MRFB 3WYRA 3JV5A 3KL5A 4OF3A 3AY2A 2WMPA 5I15H 4YLCA 4HXBH 1BLIA 2EE3A 3OAYH 1L9NA 1OHZA 2LV4A 2PYED 4F3FB 2J8OA 5HYJD 5C8JA 2QPSA 1A7RL 5GGVL 5AB2A 1T03H 5HYSA 4Z7UA 2ZYIA 3U0TA 1G9MH 2P28B 5DJZA 1IC5L 1BBDL 1HH6A 1I4FA 1RUQL 2F19H 2VUOA 3E80A 1P7KB 1KXHA 1A7OL 4OLWH 4PRPD 1I9RL 3HEIB 3TBYB 3VG0L 1TSRA 3OHXA 1RSFA 3QG6A 2LQRA 4OT1L 1N8ZB 1W0WB 3MUHL 4MCZA 4RBPK 5KVDL 2EVFA 1Q0YL 2OL3A 4XPHL 1CGUA 5T3XE 5GS2H 2ILLA 4JR9L 3WOVA 4Y4HA 2JWYA 3RZWA 2G75B 1N26A 4HWEH 1XF2A 2CRZA 2IWFA 1X7SA 3Q9PA 3O45B 3MCLH 2CO7A 3CGTA 3H2QA 1P4BH 1CGYA 4Z7UE 4AMKH 1FIEA 1HHGA 4OD1H 4C83B 3FO0L 2ZUUA 3H9HB 1O75A 2HKFL 4N0FB 3S35X 4ZS6D 1FGVL 4LL9A 2B1HH 1B3JA 2L3BA 3TNMB 5IHLB 4XBMA 1FVDA 4H0HB 1VFBA 3DOSA 2QSTA 2ZWNA 1EXUB 1NIBA 4JHWL 4RFEB 3BUTA 5D1QB 5IJKC 4NKIL 1MI5E 4P3CL 4HA1A 5BS0B 3PPSA 3HC0A 3VFWA 1T5XA 5EU6E 4FZ8H 5FW8A 5IB3A 3DXAB 4WU7B 5EC1B 1URLA 4YN3A 2H2PC 2FH8A 1FN4A 3QFDA 4H13C 1HHIA 2V5SA 3PHOA 3VB9A 4LLVA 1CICB 1J8HA 1GC1L 2XWJA 4PYHA 3ZOAA 3LQAH 3IFPA 4W9EC 5DQJB 2ATPB 3IFNL 4HISA 4D9QE 3MLTA 4LLQB 3MRNA 4WY7L 5SX5K 4PIBA 2Y1VA 4UI2A 1OE1A 2JKNA 3FUIA 4P59H 3ULAB 5FR3A 3DHPA 4ODVL 1GGCH 1Z3GH 3VXSD 5ICZA 4F24A 1CDBA 2HLEB 3NIFF 4DGIH 1FCCA 2HFTA 3RL2B 5L2JA 1AJ7H 5DRNB 5EBLB 3IETA 3QIUA 3TLRA 4KKBD 4KTEL 4UMGA 2VLJA 3ZE2F 1CR9L 2I9LB 4J3WA 3WEBA 3I3BA 3S97C 3VMOA 1JE6A 1W8EA 1A7BA 1FL6B 3N1PC 5JPMC 4L2YA 3QXDA 5B22A 1E9OA 2BDNH 4JQVC 4PJFA 3WLBA 1CF1A 2WNGA 1UJTA 1HWGB 1J7VR 1I8MA 2IWGA 1Z9OA 4GP4B 2Q8AH 1GPOH 1CYXA 3E6HB 2DWSA 2WWKT 2WIIB 3HI6H 4N1HB 1R5IA 3HI5L 4NZDA 1R3IL 2CA4A 3DBXA 5DJXB 5D6CB 1YEJH 2V2TB 2IANE 3B7RL 5DO2C 3KNBA 1F6LL 3QUYC 4CJ1A 3AMLA 4BQ8A 4M9PA 3QP3A 2JKRM 4IOFC 5EOQH 2BXZA 1U8MB 4N2NA 3UTSD 6FABH 4WO4C 1BZ7A 1G6RA 1KTRL 1ACXA 3FCSA 1BQSA 3ZHNA 4B53A 1AOHA 3T77A 2YGVA 3CFJB 1MFCH 4YGVA 4JKNA 3LIZL 4NN7C 4UNVA 3FJTA 3QYNA 1WF5A 1T5WA 2VR4A 4Z7AA 4MJIE 2D3LA 4P4KC 1PS3A 2OMYA 3FSOA 3BH9B 2Z0UA 4NRZB 1HOEA 1TSHA 1V3LA 2PW1A 3QXWA 4FFZH 4HUUA 3WEOA 4ALAC 2CBMA 4X8GA 4U3HA 3EO1B 4Z95H 1EO8H 2LFEA 1HH6B 4OD3H 3C5ZD 4C47A 1BJ1H 1UVQB 4GH7B 3VXUE 5LBSL 1FLTX 1HEZB 3BKJH 3BJ91 1HT6A 3MX0A 1LO2H 2H6PB 4X6DA 3QG6B 3QQNA 2GJPA 3CH1B 3KJ4C 3B9VA 4L5FL 1VLXA 1ASQA 1EUUA 5D4QA 2CGYA 5AAMC 1LO4H 1T7WA 2QPDB 1CLYH 3U9PH 1OALA 3WS3A 1V8HA 5TDOA 1A66A 5DEGB 1X4ZA 1S9YA 5EOTA 1EJFA 4WUUA 5D2LB 3WUWA 2E7BA 1N2RB 3D4GA 2NUTA 3SE3A 4YO0A 4G8FB 1U2HA 1UCBL 1BYPA 1UADC 1AP2B 3FTYA 3W57A 2X6MA 4HQQL 1T0NB 3EDEA 2BNQD 4QRPA 2NY6B 5KZCD 4GKSB 1IC4H 4RFNC 3ZYJA 5EZPA 3V52H 2ZWSA 4Z7QB 2DM4A 3DRTA 3NIDF 2QVKA 3B6SA 3D69B 5JORA 2F53B 4TSCL 1KELH 2MHAB 3FC8A 3WFCH 1C5BH 2DLFH 1YVLA 2XVGA 4GI9A 2WB7A 4Z7QF 4XMKL 5DA0B 4A2DA 2IFFL 3QWNA 5J1TC 1WBYB 1NDMB 4OM0L 4EOWH 4YSSA 3IDNA 1A02N 5AW2B 1FRGL 1INQB 1FG2B 2ZAHA 5BV7L 1SXZA 2V8MA 4NC1E 2ATAA 2JCCE 1JGVL 1S7VB 3FHAA 3MLSL 3PE9A 5KJRL 4FKEA 5EC2A 1RSYA 3ECQA 2N3JA 3D06A 3B7YA 4JB9L 1XGTA 2XWBA 1RIUL 2AZUA 2R56H 3KWWB 3AG4B 2DBLL 4MA3A 4O02H 4U49A 4UIMA 4ZUVB 3TT1H 4XWOC 2V9RA 5D2NA 3SQOH 3CVIH 3N1FC 4GQQA 4AT6A 1TG8A 2QVIA 2NY5H 1T89A 4G9FE 4ZFOA 5EZOH 1MJUL 2FGWH 5I6XC 3NT0A 3GNML 3PQYB 1UXSA 3D3VD 3VFVB 1IL1A 2J21A 2K45A 4NFBA 4YHYC 1DVFB 1LGVA 5DFAA 3BUYA 2Y5EA 2OSLB 1RVFH 1NWPA 1H6TA 1J0YA 3T1FA 3RNKB 1TIUA 1S7UB 2C34A 3D18A 1IIKA 3K81A 3IU4L 1WA0X 4AKPA 3VA6A 2H9GA 3ZLQC 5DMYA 1BIIA 5F7UA 4EOWL 3AXIA 3X1BA 2MOGA 2YMXL 3QRFM 1P7BA 3QI9B 1HKLH 1SVZA 5F0PB 2OMTB 1PSKL 3VI4E 1UD8A 1YHPA 2QADD 4OCNC 1QVOB 4UB0H 4NPYA 2W5PA 1CU4H 1HXYA 1HXMA 3PQYE 4I3SL 4JQIA 4BWWA 1JD7A 3RTQD 4F15B 3V4VL 1MI5D 1T1ZA 4WUUE 1H8LA 2DI8A 1ET5A 3ERXA 3B7UX 3K2MC 5ESVB 3B2VH 4FADA 4U4BA 2EIZB 3U9UA 3KH3A 3F84A 2FHCA 3L1FA 3MRGB 3ARRA 4IMKA 2YGOA 1T83C 1WZ1H 3ZXAC 2JI3A 5C8JB 1KIRA 1LEKA 5EN2A 3SYQA 2ED8A 1GGCL 2J57A 3BVUA 2NX5E 4BK5A 4TQPA 4ZAKB 3HMWL 4NC2B 1QTSA 2FEJA 3G6JF 2AQPA 4K8RH 3SDXE 4Y4KB 5C0DA 5H4ZA 2IGTA 5C92A 5ICYB 2XJLA 4AQEB 5KSAC 3GHEL 5LGJB 3V0IA 3BH9A 4NRYA 3HFMH 4JDZA 1D9KA 4U3CA 4FXLA 5E08H 4F2MB 1OEZW 1ZMYA 3IU3B 4FHKA 4N9GB 1AZZC 1GA2A 2P42B 3LD8C 4FXKA 5IM7B 5I1CL 5CILH 1QLFB 4FCHA 1KCUH 2D9CA 4G9FB 5E0QA 4JCLA 1PIGA 4Y4KD 3HZYA 5DD5H 1BQ5A 1JVKA 5GRVK 3ZDXB 2ENQA 3SPVB 4X4ME 3BJLA 1JDAA 2IH1A 2ZUYA 4XMPH 4PJ6A 3WKQA 2BW5A 1R3IH 1QRKA 3NCYP 4I5BA 3SPIA 1MCQA 1RUML 4PLJD 3BWUC 3QORC 1I31A 2Z92B 3ZSTA 4U1KA 1UWXH 4CNIB 1DEDA 2OR9H 4R9HA 4X6EA 3WJMA 4HVBA 5HHNA 5I30L 4O2CA 1QW9A 4HAGA 4K2UL 4N8VG 4YFEA 2YXFA 2Q76A 1RZ8A 5IVNA 2CJ3A 3H0TB 5BCAA 5C86A 3WLWD 2FECL 3EOBB 5MEQA 5LVEA 3LIZA 4LOFA 5D8JL 4IKIA 3S3SA 2WNKA 3UGUA 5CILL 1CGVA 2ZYSA 1NDTA 2LOEA 5GGSB 5LCVH 3DROB 3QCTH 4IMLB 4KUCF 1FBIL 3TXAA 3NGBC 5C0GB 3INOA 2BY0A 1R3HA 4GBXD 1BF8A 1PJWA 3CDFA 3HZMA 2IDSA 3E8UL 5IMKA 3L4UA 5HHXH 2UX7A 2AQQA 1NGWB 1W16A 4N0CC 4TVPH 3TBWB 5D1ZA 3FB7B 2GJZB 1RZJL 4P48A 3E0GA 2VUYA 1KBGL 4FJYA 1KJ2L 5EOQL 3H6JA 3UO8B 5I15L 5ID1B 3RGHA 5DUBA 1AD0A 4OJCA 1LWJA 4B97A 3P40A 4R0LA 5T33L 4WW1B 3VFVA 2EUWA 3CVDA 3ZIYA 1MLBB 2F7IA 1NQBA 4Z7VE 5C0RH 3NA4A 5B3JE 4GSQA 5FUOH 2ZKYA 4G43A 5HPOA 2LHAA 5F7DA 3MGAA 2IWKA 4HCGA 4WTWA 3LAFA 4OJFL 4NX0A 5LBGA 2ZOTA 3LS4H 2BVOA 2H3KA 4QHKJ 4Z7WF 3ZHFA 4FFYL 1QVOA 3GK8L 3BO8A 3CFQA 4NENA 1S3KH 4DK6A 1YNLL 2WYIA 3MRDA 1FPTH 4LCUA 5EOCJ 2A83A 1JWSA 4AYID 3S8FB 2ICES 2OI9B 3QA3B 4OCXH 2XY2A 3O4LA 4P5TD 3TFKC 3EJCA 4GRLD 5IK3A 2K9UA 3DVGA 2YAQA 2ZF8A 3P4NB 5JW3L 2XIDA 1RZPA 1MZYA 1KGCE 1I7RB 4QAMB 3OBAA 3MRRA 1MEXL 5F8RC 4D7BA 3U9UB 3GI9L 3O3BA 5D71L 3TURA 3TT3L 4ABWA 5F1IB 2CM5A 2OMYB 1R5VA 5JZ7C 2MPAL 4ZQKB 3NEXA 3VQMA 4NJ9L 3ML9A 4GO8A 2EABA 4L3EA 1LO3L 4LLMA 2YEZB 2O30A 1EAPB 4KH2A 5F7HA 4U0QB 3BPOB 1O7SA 3NEOA 2TSBA 3EF7A 4LSSL 3IGAA 1BFOA 3N9GL 3ATBA 4JM2D 4Z7VF 5HYEA 1NANH 5JIDA 4KQ4L 4AJVA 4V11A 4OZHA 1UXLA 2XXFA 1FL3B 4PJDE 3QE5A 1F4YH 1M1SA 4UQAA 3D0AA 1RUAL 5FO9B 4XOBA 2J5WA 4X4XB 3LRHA 1QSFE 4JVUA 1BVZA 2GJJA 3RYMA 4H26B 2A6DA 3ZZQA 2YQ3A 3SOBL 3G04B 5DK0A 5D1ZD 3SPVA 3FQWA 1FC1A 5G4NA 2BNRA 5B1BB 4RFOH 3V4VA 5ESQA 1VFAB 4AGQA 2OULB 1IEBB 3DX7A 5FIEA 3S6CA 3IVKB 1J9TA 1LD9A 4MX7B 2VDQH 1HHHB 4LHUD 4HEPG 4ISVA 4DEUA 3JTSB 4QTIH 2EYTA 4DJMA 1HJBC 4FQ1H 4YAQB 4DWHA 4O2CB 1LDPH 1CDIA 4YR6B 2GUOA 1QTPA 4GQPH 3SBPA 1PEZA 4M5ZH 1NL0H 4YJZL 4EXPX 2UVEA 1CF8H 4MA1B 3HPJB 4PJCF 3S8WA 4YFDB 2E56A 4ZRGA 3O2DA 1UTDA 2B14A 4HH9B 1IKNC 3U4KA 2X70B 5ALBL 1XWVA 3TTYA 4JMXA 4ZQTA 2KQMA 3KEDA 3DX3A 3VG0H 1UXWB 4OGQC 4YHLL 2QHRL 2N0KA 3BDYH 2ZX6A 4KK6C 5C07E 3QCUH 4ATWA 4AK2A 1Q72L 4UUJA 2QBWA 2GITB 1DJHA 4OLXL 3KDPB 2F68X 2ARJA 4V1DD 1G87A 1YEEL 3BDXA 3IYLW 4WI2A 5AVQB 4JHVA 4MDIA 1UXSB 2DQDH 1YCSA 3HAEA 1BYNA 1PX4A 2FUTA 5C0AD 1BD2D 5I1KH 1WA2X 3H9ZA 4WDIA 1WT5C 2YAEA 4IGBC 4N2MA 1D5RA 1R46A 3D3VA 1AR1B 2WUBH 1J1PL 4TNEA 5HGAB 1P5UA 4X7TB 4IRJA 1LP9B 1MRDL 3O81A 4M3KB 4WTXA 4WW1A 5M7QA 3Q5TA 3GPSA 4JZOB 4BQBA 1HN1A 2Y7SA 2PWFA 3DXAD 1HTYA 2MJWA 1EEQA 3C6SB 3EH2A 3F6IA 5I1JH 1B0GB 3C5ZA 3GJFK 3UDWA 1MIMH 1NGQH 1O5DT 2VXQH 3PWUA 2O6FA 2OJ1A 2NY0B 2DEYX 3HNTL 3BD4A 2D0GA 5C09B 1XFPA 2AEQH 3ES6B 5FM5O 4OZFA 3LS5H 3S98A 5F1SA 4BM7A 3O3AA 1KIQB 4BKSC 2F8IA 3IF1A 4N2CA 1RZFL 1R5WB 4B41A 3WTWA 2CGRH 1G7HA 2MQCA 2Z6FA 4PP2A 4YPJA 3WKNA 5KVFL 1Z3GL 4WHTB 3WG7B 3ZTDC 2PWEA 4Y19D 1GKEA 4W70A 5KYXB 3TN0B 3LYRA 3EJYD 2NNRA 2B3IA 4FQXB 1DVTA 2F5BL 3AFLA 4ODUA 2DWDA 3BYTA 3RHWF 3GSQA 4LVNC 2FIKA 4W9JC 4BHUI 1U6AL 1UD6A 5IVOA 3V6FA 2ZIDA 5F88B 3L9RA 3RWCA 2VXQL 3V5DB 1NSNL 2CDEB 4L9DA 1FFPB 4JM4L 1ORQA 5K9QG 1KCVL 3F5WA 1XH0A 3M6DA 3VA2C 2YJLA 3W81A 2VLJD 5IWLC 5INDA 2CMRL 1FJ1B 1FNSL 3SKJH 3NZUA 1DZBA 4Z8FH 3GSRB 1ZA3B 4S11A 2HMID 5F3BA 4WWKB 1TQSA 3EG9A 4BD4A 1DQIA 2A6DB 1XH2A 5I6KA 1MFMA 2O61A 1B0RB 1EZUA 2WP3T 4X6CA 2HWZH 5FOJA 2WQ8A 2UZYA 2JB6B 2PCFA 4QOKE 5HTSA 3MXVL 3MRLA 1R24A 3H7BA 3S88H 2A9BA 1VFAA 2JCCF 3AW5A 3NCJH 3KLSA 4MMZC 1RMFL 3A6CH 3ARTA 1AXSA 4NJAL 3A4EA 4FI8A 4J6IA 3TV3H 3M46A 1R3KA 2Q2EB 4GQZA 3RVVC 3WNMA 4LF3B 5ERWA 4N2BA 5DJ0A 2E9BA 2QGCA 3KYMA 5J12B 1KV7A 4MD4A 1Q9WA 5EEZA 1VKXA 2PWGA 3RDTD 3SKMA 2DWYA 4GBXC 2J55A 4D9RE 1EVUA 1NWOA 4ZO8A 32C2A 4LSSH 2VC2H 4CC1A 2COVD 4IRJC 4KK5C 5HY9B 4LCYA 3B34A 4N8UA 3D7PA 3B9KB 3W82A 1YYLL 3QQ4B 4DOHB 3O4OC 3OF6D 3TBWA 3X12A 1D7FA 4NQEE 1IAOA 1D5IL 3K3QA 3FOLA 5JHMA 1ITBB 2D03L 2ZWYA 3ETTA 3Q0HA 3KPRE 1U3JA 3BVWA 3KS0J 3N43F 4HZLA 4PH8A 1G9NH 2YSTA 2VL5B 5CZVL 3A6CL 3UPRB 2WLIB 4DP5X 3K46A 4PGDA 1AC6A 2HFEB 3ARPA 3BESR 1P4LA 3O6LL 5J13B 2DN7A 1F6AA 3VXSB 2WLHA 1EXGA 2J5LB 1NFIB 5DQ9A 3RY5A 2E9GA 1XZWA 5C9JA 3AREA 1G4MA 3A6BL 3MKKA 5F7DB 3RZCC 3ZDZF 3T2NL 1RIVL 1NCJA 1WFTA 2WAQA 3JTTA 4BXSV 1X4YA 3GLZA 1CT8B 4QT5A 1LE5A 3QISA 4M5SA 4BSJA 4WEEA 1EA9C 4GAGH 1GOFA 5I8CB 1MCOH 1Z6JT 3PGCB 3AVEA 3V0EA 1HNGA 1U42A 5CAYB 3T65B 5EUOF 2OV0A 3MDJA 5HHPB 2CUHA 1XB6A 1A6PA 4JQXC 3S3BB 4JY5H 4WWNA 5T3ZD 4ONHA 3B7SA 2EKJA 5DQDH 4Y8DC 4HCRL 3W38A 2ZD0A 5DD6B 1TQBB 5DJYB 5FK9B 1WG3A 4MBRA 2A9MH 5GRVL 4OCSH 3CFDA 4LOEA 5ABDE 5E99L 3L3OA 3TN0D 4U1HA 1XGPB 1GYWA 3O3AB 4TQ8A 1VERA 4LAJH 3PIQA 4NZRL 4S1SH 5D7IB 3MV8B 4BK5C 2VLMD 1W8NA 3LMJH 3JV6A 4IK7A 2F7RA 3G5YB 3SY0A 4KX8A 5BMFH 4L4TA 1GW6A 4OY9A 2BW4A 3V0WL 5D8JH 5GS3A 1TJMA 1OTSC 3TT3H 4F7PA 2XQBL 5CCKH 3T0AA 1IEHA 2F8VA 1M7IB 3DSNB 3B5GA 5TPWH 2E75C 4TPRL 3WIHH 4WO0A 5ENWB 3T0EC 4M7JH 2BRRH 2YC1B 5DD1H 4OUUA 3EYUH 3GXUB 2X0VA 3SDDA 1LEIA 2LFGA 2EDMA 3NIFE 4H26A 3PFQA 5F1KC 2DAVA 2AQTA 1XF3A 1DHKA 3SKJL 2ZUQB 3U9WA 1I8IA 2I7SA 4LGSB 1ZV2A 5IVZA 4KHTL 4OFPA 4P8QA 3VWJA 2B0SH 4XPTH 1MXDA 1TJHH 4P57B 3VTTA 3MLRH 5T5FA 1TZIA 1RZKH 4BGLA 4H25B 1V5JA 3KBEA 3FUEA 2CHXA 2X4QB 4L5FE 4MXVE 5E8EB 3HCVA 4NM4L 3BOVA 4M48H 4Z7NF 5DRXB 4X4MA 2BERA 3OKOA 3WXWH 2DZEA 4Q6IA 3VB8A 3R1GL 4K0OA 3VRIA 3VG9B 3ZDYF 3QZMA 4L1TA 4DQAA 3FFDA 2ICWB 4EQ3A 1FLRL 1F0LA 4PIRF 4RSYA 2MOVA 4BSVA 2XWTA 2EAEA 3GMPB 3KXFE 1FO0A 2ZCLL 3D39B 4QXGL 5D9SB 1EGJH 4OGAD 1RKRA 2Z3FA 1QABA 4PWKA 3T2PA 2CQVA 2P8LB 5HYSG 4PJ9B 4G82A 1JZ3A 3CIAA 2E7HA 1XGQB 1MJJB 4X4YB 1AG6A 4HIEA 1QBLL 3CMOH 3GM0A 4PJBE 3Q3GB 5KSUB 5IQ7L 3MJ7A 3WS6C 1M57B 3MBWB 3S37X 5ECGA 3WTTA 5I17B 4QJ3B 1KT2A 1Y18B 2EVIA 4L1DA 4K94L 1C7SA 2DTML 1YPZA 4K7PL 1XF1A 5JYLA 3JWNC 2H3XC 2N7BA 3HN5A 4Y16D 5CR8A 1IAOB 3U7AA 4AKQA 5FM8A 4C58B 2OZNA 3NIGB 4Q14A 2EADA 1BXXA 2FVNA 3KPMB 5ID0B 1Q1PA 2PCPA 3QK0A 2VL5A 4HS6B 4M1DH 4X7SH 3CU7A 5D5MF 4YE0A 2O1AA 3S2AA 3ATFA 3WNOA 5F9WB 1J8SA 3KCPB 3SDYL 5CJXC 3Q01A 2XTJE 2VZOA 3FO1B 3HBGA 4G3YL 5JPMB 4LP8A 4KZEH 3WTSA 4JN2A 1UFUA 5I66B 1DTUA 1HZLA 3IU4H 1NAKL 2G4GA 1F4WH 2VDNB 5GZND 3V95A 2IDFA 4U1MA 3K2IA 4CU6A 4F57L 1LYQA 2YMXH 1NAML 1AZCA 2X6AA 1OP3H 3OKNA 1P7KA 3HFML 2CK0H 3U2SB 4WWKC 4DFHA 1RQ5A 2VN3A 43C9B 2H1PL 3DYOA 1RL1A 2W9LA 2VIRA 2Q8BH 3BZEA 1HCVA 3N06B 3BAWA 1E30A 5DHYA 3MV9D 2HPTA 1NGPH 5GGTA 1FF5A 5CD3B 2WBKA 3ZO0A 2CO1A 4PRNB 3GMRA 5D7JC 4GKLA 1MWAB 2IH3A 3LN4B 5MEPA 5CJOL 1XGPA 1FNFA 3DA0A 2DBLH 1ORSA 3KWXA 5AZ2H 1OPGL 1ZIBA 4H20L 4J2QA 2QGDA 5D7IA 4L37B 4PW4A 1WGOA 1EANA 1OGAA 2FBJH 5IB1B 2A2QT 2VZVA 1R0AL 1ND0B 4WJ5A 1FFPA 3T2NH 2R2BA 5D7LA 2CKNA 1ZVSA 3D07A 3QUZD 1C8QA 2DW5A 3QB7C 3UC0H 1TQVA 5IHZA 4LCWE 3FTGB 3S4SB 5TDNB 3CVCA 3CZKA 4Y9FA 3K6SA 2IDUA 4PTUA 3ROLB 4YSCA 4KXCA 1KCVH 4LB8A 3WY3A 1KTJA 3AS3A 4U6YA 5BQDA 4KC3B 3HR5B 2ZAGA 2GFBB 2NY0C 3D33A 4OCRH 5A2JH 5HGHA 1QSED 4P57A 3B37A 1JGDA 4J12A 4RDBA 4WKZA 3EDFA 3C60D 3MLYL 2Y22A 4H5SA 1PPIA 4NI6A 1DJWA 1X5XA 2WZ0A 4M43H 4UV4H 2H4EA 4XXDA 1F1AA 5MP6H 4P05A 2DQFA 4LF3A 1A1OB 1RZJH 3CFEB 5ERWB 2OW6A 2J1ZA 2EO9A 4Y16B 3VM7A 3VI3A 1XMEB 4PCSA 3FS9A 4NJ9H 2AJSH 1PG7W 2JB5H 3LPGA 2O6DA 5HHMB 4HWBH 2J6WA 2VLRD 3TN0C 5SWSD 2P5WD 2CUMA 1IE5A 4QRUA 4G8AC 1WFOA 3VTAA 4KXBA 3W11D 4LVNB 4OLVH 3BP5B 1YQVL 4OIFA 4J2XA 3K2UH 3EGXA 4NP9A 2B1AH 1UCTA 4R7LA 3P77B 4W9GC 2GK2A 5LCVL 2NDFA 3X12B 3ULUF 4L8SC 4MD5A 4G8GE 2VDKB 4YXKL 1OAZL 1TF4A 4R3SB 1OCCB 2DQUH 3RP1A 5DK2A 4KO5A 3NN8B 3BIKA 3HMXA 4HZLB 3DWTA 3VM5A 5I2IB 1X5GA 2CZNA 2ESVB 3MBWA 5I1AA 4JRXA 5F7LB 1NFDA 3OB8A 1KTDA 4CSSA 4L29A 5K9OA 1RJCA 2OBGA 2P5WB 2BSSB 2MKLC 4XPTL 1YYML 3RVTC 3WHXB 2KPWA 4E41E 1P69B 3QNZB 4QGTA 1PCXA 3VXSA 1F18A 4I0PD 1WPCA 1JZGA 3E8VA 4ZZKA 2WAHA 4IYKA 4PWJA 4R97B 2Y1YA 4F3FA 3QIBD 1KELL 3SDCC 3BKMH 3VXTA 3RFRA 1QR1B 1KJ3H 3EZ8A 2OLDA 3K0WA 5EWIH 2VN4A 1UZ8B 4LPUA 3T8MA 2VLLB 2A6IA 1UD2A 4QOKD 3KYAA 1C5DA 1XH3A 1JD9A 1JSYA 2AABL 1QI4A 1HNFA 2DDQL 1E6JL 2RGSA 3I9GL 4X4KA 4L4VA 4XMVA 5HI3D 5SWQA 1KWGA 1RFDH 2HTKD 3BD5A 3QZNA 3KVDD 1FH2A 4AQ8A 4RMQA 4CN6A 2H32A 1NMBH 1I9IL 5LDSA 3QT2A 3L3GA 1M1XA 3U1PA 1MREH 3V5KA 4B9PA 5EZOL 3RIFF 3S5LA 4W9KC 5HDWA 4L18A 1C9SA 5GGRB 2FLMA 2FYVA 1N6VA 1FVEB 2Y5TA 3FO9A 4XN4A 3VI3E 5I75C 4ONFL 4N0YH 4O9HL 4OTXH 5CD3A 2DYSB 1WZ1L 4FS0A 4QTFA 2GCYA 3IDYC 2MSPA 2R1WB 4WUUB 4XN9A