3WNJA

1.20 a resolution crystal structure of dioxygen bound copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
298
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Crystallographic evidence for side-on dioxygen trapped on type 2 copper in copper-containing nitrite reductase
rcsb
source organism Geobacillus thermodenitrificans
molecule tags Oxidoreductase
total genus 100
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3wnjA00
4L0PB 1BXVA 4DP2X 4QLWA 5B7FA 4A2HA 1NIEA 1JOIA 7PCYA 4DP8X 4UF7C 3QJTB 3G5WA 2W88A 1BYOA 4YSEA 3ASOB 4BWTA 3NJGA 2GIMA 3QQXA 5I5IA 3CVBA 1GS8A 4HCGA 5IY5B 4AI7A 5I28A 1TEGA 4KO5A 3FS9A 2N0MA 1CYXA 3UADA 3MX0B 1AANA 3FU8A 1ID2A 2IH8A 3NYKA 2R7EB 5I5JA 1SF5A 4N8UA 5E9NA 2FT8A 5D4JA 2HX7A 2TSAA 2UXGA 4YVUA 2CCWA 1W6WA 4KNUA 3UGEA 1WS7A 1BQ5A 1RZPA 1ZIBA 2HZHA 1OCCB 3PXLA 1TU2A 1ZIAA 4HCFA 1L9RA 2IDQA 3EH4B 1EHKB 1SJMA 2BWDA 1L9TA 2IDTA 1AS6A 4ENZA 2AZUA 4DP6X 4E9RA 5F7BA 2IAAC 1GY1A 2WO2B 1AS7A 2IWFA 2UXFA 5I26A 2YQBA 2GC4C 2YAOA 2GSMB 4E9SA 1NIAA 4NERA 3NP4A 1JZEA 2YAQA 3FSZA 3HEIB 2QT6A 3NJHA 3TASA 4BXVA 1ZV2A 2H3XC 3BQVA 3T6WA 1KYAA 2FJSA 2PPEA 2VSKB 2YARA 3ABMB 2FWLB 3AG3B 4A2GA 1JZHA 2R7EA 4A2DA 1AQ8A 4G7QB 3X1GA 2OV0A 4GXFA 4DPBX 4G7SB 1AR1B 2JFCA 2JXMA 3FQYA 1FA4A 2GHZA 2WSDA 1JXGA 2AANA 1W6LA 4YSTA 1HAUA 3CZUB 1PZAA 4GP4B 5B1JC 3AG1B 3ZX1A 2GBAA 1ASPA 3FSWA 3OD3A 5PCYA 2BP8B 3NSFA 4PCYA 1TEFA 1KV7A 3IN0A 1IBYA 3N55A 2XU9A 5TK4A 3AG4B 3WNJA 2CJ3A 4G70B 1AS8A 1X9RA 1HFUA 4HAKA 3ASNB 2BW4A 1SNRA 1ET5A 2I7SA 1RCYA 3BVDB 2IDFA 4HHGA 2BZ7A 1ETJA 4F2EA 2EIJB 1J9RA 1JXFA 1SFDA 3GYRA 4G7RB 4M4RB 1YLBB 3FSAA 3ZDWA 3S3CB 2ZOOA 1JZIA 3GXUB 2DV6A 5EHFA 1URIA 6PAZA 4GY4A 3D12B 1BQKA 5B3SB 4YSSA 3NSYA 4KO6A 2PCYA 1WA0X 3ABLB 3EHBB 1PLCA 1W8EA 2BWIA 3H56A 4YVNA 1WA2X 3X2QB 3ZIYA 1JERA 2BP8A 1VLXA 1WS8A 1J5CA 2CUAA 2DWSA 2LLNA 4GYBA 4DPCX 5AFAA 3S3DB 5B1JA 2PPFA 1T5KA 1ZPUA 2EIKB 3C75A 3WKQA 1WAEA 1E65A 2P80D 4M3HA 1ET8A 4BWUA 5B7MA 3H4FA 2X88A 4E9QA 4DPAX 3CVCA 5PAZA 1AOZA 3TBBA 2FTAA 1ILUA 2J56A 4A68A 2HX8A 1ZDSA 2XUWA 2CALA 5I6MA 4A66A 1OCZB 1NPJA 4ZK8A 2WO3B 1OCRB 1SF3A 3N2JA 5TK2A 1NIBA 2VSMB 2IWEA 2XV2A 1E5YA 3T6XA 4RH4A 4X4KA 2UX6A 2J5WA 2JKWA 2Y1AA 4JHVA 4W9ZA 3PLYA 4PAZA 1OE3A 1SHWA 3X1NA 3NJLA 2YAPA 2EINB 1MG2C 2GC7C 3NJFA 2UXVA 1V55B 1B3IA 4HZ1A 3RYMA 2NRDA 4BWWA 1AG0A 2Y69B 8PAZA 3X1BA 5A7EA 2VW7A 4Q8BA 2AFNA 4G71B 4YSPA 1BQRA 1X9UA 1XB3A 4BXSV 4DP9X 3ABGA 1F56A 2ZXWB 2Q9OA 2HX9A 1QNIA 1AZBA 4KO7A 1ASOA 1GS7A 3UAEA 1OE1A 2B08A 3PPSA 1NDTA 4P5SA 4KNTA 2FT6A 4HALA 1MDAA 3UABA 5FC9A 1IUZA 2TSBA 3AW5A 1AAJA 3UACA 2YAFA 3SBRA 4KOCA 4QKTA 1L9PA 1M56B 2J55A 2H47C 1HAWA 2GI0A 1MZYA 1MG3C 5ANHA 3IEAA 4NB7A 3FT0A 5B1BB 1CURA 3EH5B 3JT2A 2VMJA 2MRYA 1RZQA 3WKPA 4F7KA 3PAUA 1L9OA 1XMEB 1J9TA 3CDZB 1NWOA 1SHXA 2FQGA 2HXAA 1GSKA 3DTUB 4P5RA 2HLEB 5F7AA 3ZBMA 5AKRA 3IE9A 4KO9A 2ZONA 1PZBA 4N4YB 2B3IA 4YSAA 3SBQA 1J5DA 4A67A 1NIDA 1NTDA 1IC0A 3FSVA 1AZNA 2AZAA 1A65A 2DWTA 4HCIA 3SBPA 2Q5BA 2I7OA 1KCWA 3FPYA 1PY0A 4GP5B 4HHWA 4JHUA 3QJRB 2PLTA 2H5UA 3HB3B 1SDDB 2XLLA 4JKNA 4E9VA 4YSDA 2FNWA 1FWXA 1NPNA 2XX1A 1JVLA 2DY2A 4KOBA 4E9YA 2IDUA 1BYPA 1ET7A 4E9TA 3NSDA 1KBWA 3CDZA 3S3BB 2OJ1A 1L9SA 2YAHA 3AZUA 1FFTB 1JZJA 3NJIA 2YAEA 3FPXA 1AZCA 1GR7A 1NINA 3CVDA 4A2EA 1A4AA 1CYWA 2PPDA 3EH3B 2VN3A 1PLBA 2PP8A 1JZFA 3KW7A 3OMIB 3OMAB 1QHQA 1GYCA 1IBZA 1R1CA 3NJMA 5AZUA 4A2FA 1A4BA 5I6LA 1J9QA 1JZGA 2PPCA 2BP0B 3WG7B 1SDDA 1SFHA 2EIMB 1NWPA 2E86A 2PP7A 4AKQA 4AX3A 2GB2A 1TKWA 1OE2A 4MFHA 2MTAA 1IKOP 4NAJA 1XB6A 2BHFA 1CUOA 1PF3A 3IN2A 4GP8B 3UAAA 3WIAA 1GW0A 2XVBA 3QJQB 4YSOA 4KNSA 3AY2A 3FU9A 4YSRA 5I5MA 1DYZA 4UAHA 3AG2B 1E5ZA 1J9SA 2UXTA 5B1AB 2HRGA 2CAKA 1NIFA 2VW4A 4WKXA 3NSCA 2VW6A 5I6PA 1KGYE 3NJKA 4DP5X 5I6NA 2J57A 4FAAB 2W8CA 1EZLA 2BW5A 4E9XA 4DP4X 2QPDB 3EF4A 3X1EA 2EILB 2FQFA 6PCYA 4TXVB 2FQDA 1BEXA 2OCCB 1M9WA 1PCSA 3QJSB 2X87A 2BP0A 1XB8A 3QJUB 7PAZA 1AACA 1E67A 1KCBA 1UATA 2DYSB 2FT7A 4E9WA 2YAMA 4DP1X 3V9CA 4BDVB 2PPAA 3L45A 2P80A 1E30A 2XWZA 2XXGA 3GDCA 1OV8A 1JVOA 3ABKB 1KDJA 3OQRA 5LDUA 3S8FB 1WA1X 1A3ZA 4Q89A 4CSPA 3S8GB 2HRHA 1ILSA 3FU7B 1V10A 3CG8A 3FQ1A 3X1FA 5B7EA 3NJNA 3WI9A 1GY2A 4AZUA 3NP3A 5I6KA 1CC3A 1N70A 4W1TA 3QPKA 3OMNB 4UANA 3PCYA 1BXAA 1ADWA 1BXUA 4G72B 3NT0A 1KDIA 4WTQA 3QJVB 3T6ZA 3U25A 2RACA 2XV0A 1A8ZA 2QPEB 3SQRA 3IBOA 1M57B 1V54B 4FA7B 3T6VA 3TU6A 5I6OA 1PNCA 1MZZA 1QLEB 4YL4A 2A3TA 4YSUA 2I85A 1OF0A 4BDVA 2UX7A 1I53A 2QDWA 2XYBA 2YXWA 1A4CA 1L9QA 1OCOB 3FYIB 4DP7X 1NZRA 3H4HA 1PZCA 3JTBA 1JXDA 4CSZA 3KW8A 3WNIA 2IWKA 2PCFA 3FU7A 3NJJA 5D4HA 3TA4D 4EF3A 2VM4A 3MBWB 9PCYA 1DZ0A 1RKRA 2DYRB 1ASQA 2AVFA 4YSCA 1AZUA 1AG6A 3ERXA 3V9EA 4AKPA 3DKHA 1KBVA 5D4IA 2QDVA 1BAWA 2ZWNA 3FYEB 3OM3B 1AZRA 4AKOA 2XXFA 3T9WA 1ZDQA 2XX0A 1AIZA 2YXVA 1GS6X 2IH9A 1PMYA 2PP9A 3TBCA 3T71A 3PAVA 4K9JA 4F2FA 1PLAA 1N68A 3DIVA 5B1KA 4DP0X 1PAZA 2VM3A 3FQ2A 3PAZA 1PNDA 2BZCA 2IDSA 4BK5C 4HIPA 2XV3A 1NICA 2BO0A 4YSQA 2CBPA 2FQEA 1OOWA
chains in the Genus database with same CATH superfamily
1N6UA 4ZFOL 3CN4A 4R8WH 3MBWA 1G7PA 4LBAA 5E5MA 4N1HB 4OZFB 2W59A 3MRCB 3BAWA 1F1AA 4KVNH 5A6LA 1IAMA 2JJSC 3ZKNC 3AWFA 1BIIA 3QG6A 3U82B 1BYNA 3HUJF 2V3DA 1NCAH 4NQDA 4F7EA 12E8H 1CMOA 2OKMA 5CZXD 1IB5A 5I28A 5EU4B 5K39A 4CMMA 3UTSB 4HEMA 5IFJB 3IJ9A 2CMRL 1GGIH 1BQHG 3OG4B 2YK1L 4F9PC 2PYEB 4AC4A 2RHEA 3D9AH 4DTGL 5IQ7H 1WS7A 1W80A 3JYCA 1DDHA 2YA1A 3OKNA 3I9AA 3P11L 5HHMD 4OZFH 3GSUB 5LJYH 3VCLB 2WLIA 4HFUH 5JNYB 3UG4A 2AJ3B 1T2XA 3B7UX 2DTMH 2NYYC 1CVRA 3JWNG 1KN4L 3S96B 4JPQA 4E9RA 2FSEA 3MRCA 4OZFA 2YIHA 4LSQL 2EKSB 1GIGH 1PG7L 2X40A 3CTTA 3HRZB 2FEDC 2Q2EB 3UPRB 1WJ3A 5I26A 3IJEB 1KTDB 3RZCD 3GNMH 4FFWD 2RBLA 5EH1A 1R6VA 3HEIB 4ZQKB 4JY5H 2QT6A 2Q8AH 3F04A 5EU4A 5HD8C 2AEIT 4NQVB 3UTSA 5IFJA 2QELA 4PGDB 4YWGL 1A2YA 2ZSWB 2Y36H 2NPLX 2EXWD 2F7OA 4FFVD 5MI0B 5F70A 2NY1D 3HFFA 4WJG3 2GHZA 1DJHA 2WSDA 1JXGA 2COVD 4CC0A 2A4ZA 4YSTA 3WYRA 3MPCA 4HUCA 3AG1B 1I1FB 3GSUA 1V7MH 3VCLA 2BY3A 3FSWA 3MV9D 4H4NA 5JNYA 4O2FB 1T20B 2AJ3A 2F54D 3GUTA 4KUZH 3UXFA 1TEFA 3ASWA 4IKNA 4P46C 2EKSA 4HAKA 2K3TA 3HRZA 3TT1H 4EKJA 1SNRA 4G42B 2CGRH 3EOYG 3UPRA 3M7FB 4LSDA 3IJEA 3OKDB 1IKFH 3B83A 3MV7A 4KJYB 4NYLB 4ZQKA 5FS5A 3VNYA 3VD4A 4Q6IA 1NFIB 3NESA 4X5WB 4F2EA 2VQ1B 4HJGB 2E59A 4PGDA 4AJYV 4BKSC 4EIGB 5IVNA 5GISH 2BY1A 2EE9A 1A6AB 3ARDB 1N64H 3U4KA 1CGUA 4OGYL 1DBKH 4ZW3A 3ULVF 1YEGH 4DK6A 1ZLUK 4PS4L 4HS3B 1FO0L 1ZJAA 5HI4D 5FO8B 1FCGA 1PLCA 1W8EA 1I1FA 4GQPH 1K5NB 4EI5B 4ZZKA 3EADA 5INCB 3DXAD 3X2QB 1I82A 4O2FA 4KTDH 3IDJB 5CEYB 3NMEA 4BCXA 1C8QA 3BD4A 4M5YH 1CFSB 2DM3A 4Q9BA 3ZKMC 4M6ML 4NQCE 2NX5D 3HHRB 4WDIB 5IJKA 1NC4D 1K8IB 1WBZB 4AYEC 3MKGA 2YWYA 3C75A 4G42A 4NQTA 4DFIA 1WAEA 3FFDB 5ESQB 1G43A 4KJYA 2F74A 4NYLA 1CL7I 4WSKA 1NFIA 35C8L 4X5WA 4FHBD 2VQ1A 4HJGA 4AL8H 1SY6L 5J0BA 4PS7A 4FQXC 1RERA 2HAZA 4XI5C 4X6CE 5JHDE 4FQ1L 4MMXB 4KKNA 3SKJH 1A6AA 3ARDA 2OAAA 4YDLC 4ORGB 1EO7A 5IR1B 1AQKH 1HDMA 1JSYA 4HS3A 4AQ1C 5FO8A 3KPLB 5GS0L 3D3VD 2A83B 3GI9H 1K5NA 4EI5A 5INCA 2WB1A 4Z7QB 4JFDD 2X1QA 2Y07L 1SXAA 5HHOB 3R19A 3IDJA 4JHVA 3L4UA 5CEYA 3U30C 4HC1L 4K3DL 1CFSA 2YAPA 4WDIA 1TG8A 1ECYA 1K8IA 2YRLA 3RDJA 1WBZA 3VGGA 3OJDA 4BFGA 2FCBA 1E40A 2VLKD 3R1GL 1CTNA 3MLYH 3FFDA 5ESQA 3VD9A 2AQ1A 3IFLL 4KKBC 4RVBA 3V4UL 4S1DC 1OP5K 4JCMA 2XG5B 4NZDA 2EVGA 3UAEA 3FFCD 1GAFH 3FUMA 4U1LB 4YPGB 4MMXA 2B08A 3PPSA 4FG4A 4QT5B 3WE6B 4Y4FC 4ZD3H 2AITA 3AMLA 5E56A 4ORGA 3Q6GH 5IR1A 5CJBA 1HL9A 1GGTA 3CSGA 3BAIA 1A14L 5HDOA 4PJFA 3EYOB 3FT2A 4X0KB 3KPLA 5JA9A 2YAFA 3SBRA 2A83A 3U6XA 5AL0A 1QUPA 4JEGB 5JXED 4YE4L 3UJJH 4ELME 1T66C 5HHOA 5CJXA 5CMAB 4APXB 3QDME 1MG3C 3H9HB 1WEJH 3KBHE 3QNZB 1I75A 2AS5M 1CURA 4CSSA 1TT6A 3MR9B 1WUNT 4A2MA 4OD1H 1B9ZA 1HKLL 2KPNA 4MLSA 4TSBL 5D7LA 2DS4A 2WZAA 5KVFH 1VHPA 3EBIA 4OCRL 3GPSA 4YHKH 3O45B 2XG5A 3BQUC 3PWUB 4M8UA 4ETQA 5E6UB 4UQDA 5FYLL 2O1AA 5D7KD 4GLRH 3NIDF 4HSQA 4P2OC 4KO9A 4W70A 5I5RA 3LHPH 3GRGA 4N4YB 1YDPA 4PUBL 4U1LA 5FPIA 4QT5A 5F88B 3WE6A 4L8CB 1QSFD 5E4EB 3CDFA 1YG9A 2PNDA 3BAYA 2CHZA 2DMCA 3RL1B 2NY2D 4P2QD 3EYOA 4X0KA 5EO0A 5GRJH 2CLZB 3HI5L 4P0DA 4NQSA 4U6TA 3TBVB 1NMBH 4B96A 1SJHB 3KWUA 5CMAA 2YC1B 4X4MA 3MLVH 4APXA 2XLLA 3H9HA 3QNZA 4UNUA 4L3ED 3ARGD 2LLLA 2NUTB 3MRIB 3HLAB 4M29A 4QNPF 3MR9A 2JCCB 1X3DA 1FJ1B 1QWUA 2CIKB 3UAJC 3MV8D 4XO4A 5DD1H 4FJYA 2VC2B 1C9SA 1J0HA 4TUOB 1KBWA 1HKFA 3HRPA 4XAKE 3A5VA 2LW3A 1X5LA 3O45A 3PWUA 3AT0A 1HEZB 5EOCJ 5BNXD 4WFEE 1Z5YD 3FPXA 4G8AC 3V6ZA 1S7WB 1FBIH 2WXKA 2PWDA 4ZDHB 5F88A 2X3CA 4FQCL 1RURL 4GUPB 3VU1A 5I16B 4MD0B 3SE4A 2A77H 3RL1A 4LEXH 3HG0A 1CD0A 3OMAB 4JFPB 2IALB 3Q2NA 2CLZA 1JJUA 1J1PH 5FUOL 5CNHA 3RJDA 1PD1A 4PW4A 1R3JA 1W2KT 2AI0H 2OSLB 5E1QA 1OO2A 2Y2WA 4C57C 2IO5A 4ZQTA 2HMID 4EO5A 1SJHA 5E7FA 2YC1A 4AGQA 1E4KA 3KPQB 3WD5L 2VC2H 4GKSA 4AKQA 1L7IH 2HKAA 1FRGH 2C3WA 2YGNA 3HLAA 3JWOH 3MRIA 4FKEA 2NUTA 1LDSA 2JCCA 4FQ2H 3TP4A 4AE0A 3UBGA 1FJ1A 4FXGC 1WWBX 3SQOH 5A2JH 3HNVH 1PF3A 5ID1B 2WYIA 1GW0A 4TUOA 4NFBA 3IGUA 4K8RC 1HEZA 2UXTA 1SN0A 3LS4L 1WP6A 4TSAL 1S7WA 3UO1L 3EYUH 3MCKB 2J57A 1RIHL 3B2DC 1Y07A 1RMFL 1EAOA 2VXUH 4S1SL 2CUHA 4ZDHA 4GUPA 5CN3A 1PS3A 4L5FL 5I16A 1WHPA 3UMNA 1QVOB 3DVIA 4L4TE 4PGCB 2OMBA 3ZL1A 1QYGH 3SYPA 3Q7JA 3EF4A 4JFPA 2DJ4A 4P57A 2IALA 5EDSA 2BSTB 2OFQA 4GAYB 3V0AC 1KWKA 2G2NA 4XXCC 3QJUB 3AACA 4P23C 1Z5HA 2OJEB 3GMOB 3KPQA 5MP6H 3QZNA 1IGIL 3S35X 5I73B 2Z65C 4V1DB 3ZTNL 5EIVA 2VLRD 3N41F 4DP1X 3T0ED 4LVOB 4OQTL 2XWZA 5ID1A 5E9DE 2Y7OA 5LUMA 2R0ZL 2Y1YA 1J1XH 1U8QA 5C07E 3VXRB 1AHMA 1Y18A 3GBNH 3QRGH 4LCWD 1GZHC 1LL1A 1XEDA 4MJ6B 4ORZC 3MCKA 3SYAA 4DN3H 4HBCL 3K6IA 5AENA 1KPUB 1FGVL 3V55A 1VSCA 5DU7A 1R0AH 4LSSH 4D2NA 3ALWA 2NT1A 3N0AA 1XQ4A 1QVOA 4IDJH 4NIKB 4PGCA 4L8SB 3APNA 3MTRA 2VCOA 1TZ8A 5EEUA 3TN0D 4ENED 4FQIL 3ALPA 2NY1B 4JS7A 3I50H 2BSTA 4GAYA 1MCPL 3GSNH 4LPWA 4BJLA 2I60L 4AMXA 4MJID 4KKRA 1M57B 1Q9OA 3B5HA 1NCNA 2OJEA 3GMOA 5C6WH 3HAEG 3CQFA 4V1DA 2OULB 5KANG 3NIGF 4B9CA 3MV9B 4HPYH 5DHMC 4NCC1 2W60A 1P4IL 2F54B 4Z7UB 3P30L 1G1CA 1CDCA 4DP7X 3NFSL 1LILA 3TBTB 3VXRA 4R97B 5A43C 2LTQC 3FH7A 2D3LA 4OI9A 4MS8C 4Y2NA 2UZXA 4MJ6A 5E95B 4KQ3H 4OFYA 2D03H 3KJ6L 4NKQB 3QDGB 1KPUA 3SCMB 1G7JB 4HF5L 4JRXB 5DMGC 4Z95L 4PJ8B 1RZ8B 3AM8C 5CHNB 4L8SA 3H7LA 4FZ8H 1JGVH 2JIXB 4AKOA 2R1WB 4Q74A 5TQ0H 1KGCE 4JG0H 1J5HA 3IFNL 3Q1SL 3FTWA 4HJ1A 3MJ9H 4M8VA 3JBG7 2AABH 1J48A 4YLBA 4PWKA 5D1XB 4WSGA 2VM3A 3TLRA 3ZZQA 3DOSB 3F64A 4JFTA 1FNHA 3HG1B 3MJ9A 2BZCA 2F54A 4TNVK 4RDQF 5DJZB 1XEUA 2DL2A 1INEL 3TBTA 2VGLM 3GI8H 4EPSA 3HJ0A 1I85A 2W9LA 2BDNL 4XZUB 4EDWL 1WISA 1RZIB 2WXMA 2K4AA 4XVOA 3QDGA 4PBDA 3SCMA 5BRPA 3EZ8A 1G7JA 3IXAA 4WTZA 5KJ7E 1HC1A 2VXQH 4JRXA 4PJ8A 4A63A 1RZ8A 2D4DA 1KOAA 5CHNA 5D72L 3QUXB 4ZNEE 1CYGA 2JIXA 4AGPA 2R1WA 3T3PB 2YFOA 4MQXD 5JTWA 1BF5A 2VXQA 3EDEA 1D6EB 3FS9A 1CYXA 3RWDB 3B7SA 5DR5L 1Q1JH 3AGWA 4U0RB 4XMKL 5I5JA 2AJXL 5E4OA 5FA3B 5A2BA 4XOBA 3DECA 5D4JA 4N3UA 4WFGD 2ZWSA 5D1XA 1HH6B 1SLXA 1YYCA 4C4KT 3DOSA 3EIFA 3LEYL 3ML9A 5KG9B 3HG1A 3JWDC 2ZUQC 2KQMA 3VXUE 2YMXH 2WIIB 4PJ9C 5DJZA 2P46B 2CNZA 4XZ4A 3U7YL 4WTWA 3NJVA 4LSTH 4NP4H 3QDJE 3LN9A 4XZUA 1CF8L 5C71A 2N7SA 4UINL 1RZIA 5KS9A 5DFWH 4AQZA 5T33L 3Q9QA 3HJEA 4LQ1A 2F53E 5MEPB 4AV0A 1JFHA 2IAAC 3P4LA 4AEEA 1IL1B 3QUXA 5T5NG 1OT4A 2YQBA 4I3GA 2XA8L 2BSRB 3LNDA 4KMTH 4M1CC 3OJ2C 4LRIA 1ZV2A 1D6EA 2XTJD 4I0PC 3RWDA 2X0UA 1MEXH 2PPEA 3U48A 4XXWC 5FA3A 2JKNA 1WZ1H 4QXWA 1SM3H 5J8OA 1HH6A 1MW2A 2ZXGA 3TV3L 1CL7H 1F4HA 1F4XH 3F62A 5KG9A 2F5AH 3MYZA 1L0PA 2VMCA 4BYHA 4XWOC 2XBTA 4NJ9L 3FU0A 1M7XA 4JX0A 1BM7A 4NKIL 4QRRB 1ONQB 4LDCA 3GBMH 1YEEL 1DQMH 1EH9A 3PP4H 4G70B 2QQNL 5MEPA 1U58A 4W68A 5F9WB 3RA7H 3LXUX 1IL1A 3L5WA 1WIPA 3WFZA 1IMHC 1NUFA 1LHZA 2AJSL 2UY6B 2N4IA 4DQOL 4RZCB 5EA0H 3F7LA 3GHEH 4N2GA 2YXMA 4C54A 5TJWK 1OAUL 4CRPA 3VFOB 4P2QB 1IVTA 3TJEH 1H3UA 2X0WA 3TGXA 4CDHA 3BP4B 3QAZC 1OGSA 2C34A 1BVZA 2YJQA 3QCUH 3LPFA 4PW9A 2IV9A 4TUUA 5EHFA 1MCOH 2E7HA 5T3ZD 1SEBB 3OZ9L 4HD9A 5DLMH 3LH9A 3L3JB 3PGCB 2Y6TE 3GRWL 1AO7D 3U1PA 1FH5H 4QRRA 3O8XB 1ONQA 5C0AD 2Z91B 1DVYA 5IB3B 1XBRA 1IBDA 1OAQL 1Y1DA 3K5RA 3HZYB 1V3KA 5D93C 4GYBA 3C6LC 3WIIL 5F97E 3B9KD 4DPCX 1OHZA 1YQVL 4GNKB 4AE1A 5DMKB 1DANT 5GQBA 3VFUB 2X1XR 2YPKA 1RZKH 3LX9A 2YGVA 5EF0A 4FQQB 5HVFB 1YA5A 2UY6A 1P4BL 1W0WB 3C6SB 3NACL 2ZUXA 1H8OA 1JNNL 4FI6A 4N2NA 4Y5VC 5EU7C 2NUPB 4KY1H 1AE6H 3S3SA 2FYVA 2FTAA 4P5TC 4JANB 3VFOA 1UH4A 4A68A 2QPFA 1NMCC 2RTTA 4DEPC 1UT1A 1TYRA 3OLDA 1BM3L 4XP5H 4C58B 1J5OL 3D33A 2IQ9L 4NQED 1C7SA 4X5QA 4H20H 2VSMB 3LY6A 3L3JA 4MB4A 2VLMD 3PGCA 5D1ZC 1LEKB 4X4KA 4X5XB 2E7LA 2VMEA 1FH2A 2UX6A 4TSCH 3TFKD 3O8XA 5IB3A 2Z91A 4IJ3C 4HIEB 3B3IB 1RJLA 3HZYA 1RL1A 1OE3A 3DGGB 5DMKA 3VFUA 4YMPA 4C56E 4MA1C 5F8QC 2AQ3A 4QD2E 4XX5A 1PZ5B 3RZWA 1VPOH 2AP2A 2I27N 5HI5D 4BSWB 4BWWA 4FQQA 4RAVB 2G30A 1RPQA 1W0WA 3C6SA 3KPRB 1WDAA 1FE8L 4NPJA 1XB3A 5ALBH 2NUPA 4JANA 2MPVA 4KO7A 2NSQA 1ASOA 2WLHA 2ALAA 3VMNA 4P5SA 5HGAB 4EEEA 4KKPA 4KNTA 4UQEA 5F9OH 4PJ7B 5H8DA 5BW7A 2K6YA 1KTJA 2DB8A 1EXHA 3L4XA 5D6CB 4FE9A 2E6JA 4ZX6A 4DW2L 2FH8A 1CZ8H 1LEKA 3S48A 4X5XA 5IHLB 3BZ4B 3IFOB 1QLFB 2Q7YB 2HH0H 3IMSA 4HIEA 3B3IA 3CXDH 2D7TL 2ZNWA 2JKRM 3RVVC 3WL9B 1HEJC 3QDAA 2NR6D 4IOIA 3DGGA 4KZEL 1NFKA 1WWWX 5D2LE 1ZVYA 4GXUM 2P24B 3BH8B 4EXPX 3WN5A 2RA1A 1ZT7B 2DW5A 4AK1A 3U6RA 3WKNA 4BSWA 3LMJL 4BQ6A 3RVWC 4S0SD 4RAVA 4HXBL 3KPRA 3VD1A 4XB8A 2X4PB 1JRHH 4A2LA 3D34A 1BQHB 4PJXB 2IGTA 4ZMWA 2A38A 3MGTB 1WTLA 3QJXA 3N44F 4R2GD 1VB9A 3ARZA 3VTMA 1U92B 5LBGA 1EGJH 2JKXA 4EUPG 5C0CA 3FT3B 5HGAA 3SBQA 3AS3A 4MJIB 4PJ7A 4A7SA 3LD8C 4XNUL 1EGJA 2BXZA 4X6CF 1OAXH 3R8QA 4Y7MA 1U4EA 3BZ4A 2TRHA 3IFOA 1V7NL 1QLFA 2IIJA 2Q7YA 4AYDC 1TENA 1G9MC 3L3OC 4UT6H 1BREA 1ORQB 3WL9A 2WYTA 4JKNA 4ONFL 3O6MH 3P3UA 1CDJA 4XO8A 4ZX3A 2BNQE 2P24A 3FOMB 4NCC2 3SGJC 5IHBA 2OXHB 1X9LA 1MVUA 1B0WA 1T1YB 2VO5A 1NPNA 1ZT7A 4FQLL 4UT9L 4FTVE 4UT6A 2VSDA 5BVJB 3D4CA 4G8FB 2BP3A 2HTLC 4DERA 3FNKA 1U8OB 1T03L 1NCBH 2IGLA 3I2CL 5A16B 2X4PA 1BQHA 2Y3NA 3IDUA 2JKLA 3MGTA 4JPWH 5ANME 3FONA 5BRQA 1U92A 2BNUB 1DVZA 4Y2DC 4KHTH 3FT3A 3I9GH 3GBDA 2EC9T 1JNHB 1RJYB 2PP8A 3VGAC 1KBBA 3VDCA 5FWRA 4HCRL 4QHKJ 4XNMB 4JM2F 5ESVB 2Y23A 1WWCA 2IC2A 4ZX5A 1H6EA 4NWTH 3NJMA 3HC4L 1VACA 2F19H 4LK4A 1HOEA 1ORQA 5EU6D 1QA9B 5FUCC 1IM9D 1AD9B 2PF6A 3FCGA 2YRBA 4H1LG 3L2MA 2XBZA 5I24A 2OXHA 4X4YB 1PTZA 1A7OH 4FFZL 5BVJA 4ELMF 5EU5A 1CUOA 4G8FA 4MAZA 3WIHH 1U8OA 2G0KA 3CMOH 4B7IA 2QSCL 5KJ4A 3RHWK 1JDDA 3MLWH 4EZMA 5F71A 1ZPLA 3BDYL 1GJUA 3WEMA 5I6PA 1BZ9A 2BNUA 3IGFA 4U49A 5I6NA 2VOTA 4Z8FL 2ITCB 5TD4A 3S7GA 5JPMB 1QHOA 2V4LA 4LLYB 1JNHA 1RJYA 2DAVA 2P5EB 1LXMA 1R17A 1GMIA 3M46A 3LRSA 3WXWL 1A7PL 1XO8A 3KWXA 4XNMA 3UOAB 4W9DC 2DF3A 5C8JB 5ESVA 4IRZL 2H41A 4CVXB 3QZPA 4EN2A 5SWSB 1E9PB 4ZMXA 1NBYA 3VGHA 3N40P 4PG2A 1QA9A 4RIRB 4UIKL 3RGVD 1AD9A 3DTDA 3E38A 5E5UB 2C4XA 4YHOL 3HR6A 1ND0B 1T89A 1IT9L 4X4YA 4WFHD 3VWJC 2HT3D 1HYSC 1LYQA 2CHWA 3O6FC 3NUKA 3RFZC 4FADA 5HVHC 2J73A 5I1EH 4JZNB 3SBWC 3PDOB 4JM4H 5FECB 2ARJQ 4KDVA 4KRNA 3S2AA 3B2VL 2CA3A 3QJZA 4NM4H 5EC2A 2NCMA 4K71B 3ZMEA 3W39B 3X1FA 3NJNA 2ITCA 5IROC 3PG2A 4Z7AA 3L3DB 3ZDZE 5LGKA 1MJUH 1ZV9A 4XVSL 4LLYA 4P2RD 3QIWD 4QOKB 4YXKL 2P5EA 4HQQL 1TNMA 2X4QB 4QJ5B 3QJVB 4CVXA 5SWSA 1E9PA 3S5YA 3W0WD 1KIQB 1AFVH 1FZJB 3IU4L 4RIRA 1THAA 3P2TA 4ZUWB 4LASL 5AW5B 4H5SB 4N22A 1ND0A 2A3TA 3IKCB 2I85A 4YLQT 1JPGB 3QEGL 4MDJB 2FHCA 5GS2H 4XP1L 4JZNA 3PDOA 4ZSOA 1Q0XH 2DIEA 1TTBA 5FECA 4WO4D 5LXGH 3ROLB 3BN9D 3PE9A 4NZFA 4DVRH 1IKNC 2Y6SC 4IGBB 2IAMD 3W39A 5F6IB 4Y8AA 1HINL 9PCYA 1CFQB 3FTXA 5T3XL 1RKRA 5GRYA 5C70A 3L3DA 1AZUA 2JTYA 3LH2L 2R0LL 1S2EA 3IDXL 4QOKA 1A5FH 2R1YB 5D4IA 1S3RA 2PCXA 2UWEE 1J10A 2X4QA 1AZRA 1MLBB 1DQKA 3X3GH 4YBLB 3CFJB 4MA3B 5DGRA 4G7VH 3K1KC 1KIQA 1KZYA 1FZJA 2DJUA 1YPZA 5AVXB 3EJYC 4ZUWA 4K9JA 1COBA 4H5SA 4DP0X 1PAZA 1LE5B 4OKVA 3TVMA 3DNKA 1JPGA 1NSNH 3MXWH 4MDJA 3HKZA 1W72L 1YEKL 5L9DL 2Q1EA 3EGDB 5EBLB 4ZODA 4BQ8A 3PV6B 4BK5C 4X9HA 2NY6D 3FO9B 5IGXH 1U0QA 3RE0A 2CRYA 3IYLW 4IGBA 2DZEA 2ZG2A 1NIEA 1CFQA 5DVNA 1KENH 4LMQE 1TR7A 2OMUB 4XTRD 2EUWA 2DPKA 2WLKA 1CWVA 2EE2A 5IW3A 2OMZB 4IRJC 1BYOA 4U6VH 2R1YA 3ASOB 4PJAE 4BWTA 1MFBH 2UZIH 3PJSB 5I5IA 4HHAB 1NGXB 1MLBA 1GS8A 2C8NA 4NI3A 3ZE1B 4D9LH 4EBQL 1MF2H 3CFJA 2F2HA 4MA3A 5GGUB 3L4CA 2IH8A 4JMNA 4G5ZH 4YNYB 3HG4A 1GZQB 2C7UB 5HY9B 3KYNB 2FT8A 2GJ6D 2UXGA 5EEZA 5I15H 4J3UA 1LE5A 4K5PA 1RZ7L 5IHWA 3G08B 1WCQA 6FABL 3NCYS 3EGDA 2WLNA 5EBLA 3BEWB 3U7AA 4WUKH 4N2EA 2NZIA 3FO9A 1FZKA 1L9RA 2WTOA 3ARFD 2Z35B 3OAYK 3Q8BA 2L7QA 5GXBB 2WXLA 5IJBC 2PN5A 4Y9CA 3TWYA 2DH2A 2NT0A 3ZO0A 3F83A 3I3DA 3PJLA 1S9KC 2OMUA 4CDGC 5F7BA 3UPAA 4RGMC 4ZTEA 2OMZA 4D9QD 1XF3B 4XC3H 1QATA 1ACZA 4G9FB 3WDHA 3PJSA 3QHTC 2H2PD 1NGXA 4BXVA 5F7UA 3T6WA 5GGUA 2H3KA 3FB6B 3UX9B 4YNYA 4PVNA 1GZQA 2C7UA 5E2UH 1C5CH 2OYMA 1QEXA 3AT8A 1SYVB 3DV6B 4OBSA 5HY9A 3HFMH 2LLGA 2J8HA 2WWKO 2KZWA 3G08A 2F58L 3BEWA 2BINA 4OTXH 4UILH 5D9SB 1UCBL 3ZX1A 1YNTF 4POZC 2Z35A 4KI1A 1YEJH 2VRAA 4OT1L 2K6WA 2Y7SA 3ZYIA 1CXLA 1IBYA 3OTTA 4NO0D 4Z7WE 3SHSA 3DX9B 1AS8A 3KMDA 2A73B 2GJZB 3BKMH 2YWZA 1ET5A 1XF3A 4JRYE 4KK6C 1A7NH 1CK0H 4WEBH 4G9FA 4FA8A 2IDFA 5HDLA 4AIEA 2GEQA 1YEFL 3KHOA 4YO0A 1XAUA 5FHBH 2EIDA 2DQFA 1HWWA 2VMDA 3FB6A 2RJMA 5TPWH 1U41A 3TFBA 1SHMA 3KPPB 3O11B 4KTYA 3AWGA 1UOWA 5AOLA 6PAZA 1JS4A 3N1QC 5D9SA 2E27H 1YCSA 1X7QB 2I5YH 1EEYA 1XF4B 3O2DL 1IQWL 1PZ3A 2YD4A 3D2UB 2CO7B 4DO4A 3FULA 3CLFL 3ELAT 1JERA 2Z8VC 4MMZB 1AZZC 2MSPA 2R0WH 3A6CH 2OA9A 1QBML 1WS8A 4YUEL 3ZKXB 4P99A 2ZOUA 3BO8B 3LXBA 5CKAA 5AFAA 2MIZA 5JHLL 4XMPL 4ZXBC 1YJDC 3TNNB 2A73A 1ZHKA 2GJZA 4HXAH 2OK0L 3EO0B 3MHZA 1Q94B 3ME0B 4I4WB 5KEZA 3DSFL 4OB5H 5JQHC 5CEZH 3G6DH 4RMVA 4TNVF 5JW3H 3BAEH 3D25B 3WY4A 4BQ9A 3HAEB 4ECNA 3V4PL 2VDPL 3RAJH 1DQJB 8FABB 1E5UI 2KBGA 3Q44A 3O11A 3KPPA 4FMFA 5L2KD 4OIFA 1IC7H 1SF3A 5GZOA 4LAQL 2DMGA 5D7SH 5M94B 1ZLDA 1IM9B 4R4ND 3C87A 4WU5B 1X7QA 2FRGP 4M43L 1XF4A 2C9SA 4XHQA 3I9IA 3D2UA 5BUGA 2CO7A 5FW6A 3MQIA 5AW9B 2VUYA 3DIDA 1A3QA 4S11A 4MMZA 4G3YH 2IADB 4NQDE 2HPOA 3PLYA 5BO1H 1JGUL 3B5GA 2HVBA 2B2XH 3BO8A 2EDMA 2W07B 1ZHLB 3VRIB 3VFVB 4LLQB 3W9DB 3TNNA 3BRFA 1DVFD 4HEME 3RUGB 2CKBB 1RV6X 2GBUA 4ZAKB 4QRPE 1Q94A 4JK0D 4J1UB 8PAZA 3P69A 4G6FD 4I4WA 4OLYL 4YDJB 2EDTA 3X1BA 2MQGA 2K7QA 2VDRL 4WW2C 3H55A 4FNSA 5I23A 1KULA 3D25A 4I18C 4XPHL 3HAEA 4NPYB 2ZXWB 1YC8A 3ISWA 5CILH 3OZKA 3FBQA 3VI4B 2HX9A 3MA9L 4DGIL 1DQJA 3BKCL 8FABA 2D0FA 3LPOA 15C8H 1NGPL 3BPNC 5K1JA 1WZAA 4HLJA 5C08B 3R0NA 3RGVB 1WIUA 1IM9A 1IUZA 3DJZA 1J8KA 4WU5A 1KCUL 2MCG1 5BV7C 2P8MB 1D5MB 1SBBA 3LQZB 4I48B 4OCSH 1RUKH 2DRUA 4LGSB 3SDCD 1G1OA 4KK9C 3H3PL 1IU1A 2WLYA 1F1GA 4PBVC 3ZOAA 4NRZB 1UM5L 3LQAL 4JY6B 2YRPA 2W07A 3COOA 4KPHL 1ZHLA 2IFGA 3Q5OA 4LLQA 3VFVA 3VRIA 4N2FA 3UTSE 3W9DA 2DJSA 3RUGA 2NXZC 3UG5A 1DTUA 1HVXA 4ZAKA 3QYNA 5JW4N 3MV11 4J1UA 2BOBA 1EZVX 3Q5TA 4YDJA 4JLRA 1EV2E 2CXKA 2D3VA 2PYEE 3B8SA 1MCNA 2B1AL 5C0DA 4XCNB 4NPYA 3TV8A 4A7VA 1I8IB 3ZT7A 3VI4A 2CGYA 5ALCH 4OCXH 3TC9A 4ANXA 5DO2C 3VW3L 3MLTB 5C08A 4A67A 3ML8A 1IGFH 3QE5A 1D5XB 1WQVT 4KZCA 1MPAL 2P8MA 4WZ9A 1D5MA 3D7PA 3LQZA 4I48A 1CICC 2ZP9A 3MAWA 1MCLA 1MJ7L 5BMFH 1MAJA 5H94A 2J72A 3RNKB 4U0QB 4WV1C 4NRZA 3O3UN 3VXNB 4JY6A 2Z93B 2TAAA 3PGDB 4J8RB 4JFOB 3MRQB 3BH4A 3KHQA 4QRQB 1K85A 3SB3A 3L95B 2PCPB 4P3CH 5J6HB 3C2AL 3NPSC 4M7LH 3GD1C 2Z7UA 3A3YB 4Z0BL 2V37A 4YFDB 2F0CA 3WS3B 1JZ4A 3TCXA 2WZ5A 2GPZA 5ICYA 4XCNA 1TZAA 4R6UA 4AYGA 1CFBA 1I8IA 3AABA 4N8VB 4NAMA 5E70A 4GT7A 3T2QA 5B1CA 3TPUA 1ZGLM 2VXTH 1OP3K 2VR9A 4FP8L 3MOAH 4UQIM 3N85H 4ZW5A 4K3EL 3DYMA 3W5MA 4AM0B 4MCZA 4MQ7A 2X05A 1QSED 3HLKA 2G2RB 3WFDH 1NGWA 3P77B 4JG1L 4N9GB 4XCCL 1LVEA 2JB5H 4H88H 2PKDA 2WXPA 3RNKA 3DVFA 4LSVH 4ZFGL 1NWPA 3VXNA 1HQ4A 1V27A 2Z93A 3FT1A 4DQAA 4J8RA 1I3RB 1XGRB 3MRQA 4JFOA 1EQWA 4KK8D 4QRQA 4NAJA 3L95A 2PCPA 4J6IA 4NJAH 5J6HA 4AIZB 3UDWA 2NCEA 2WQWA 2FH6A 3SDDB 3IMRA 4QRUA 5D2LF 1NFAA 3WS3A 5DURB 4UAHA 1MI5D 3WU1A 3SDAD 4KZDL 1WF5A 1J05A 1XH0A 3D1MC 3KWTA 1WYJA 4N8VA 1RXLA 2D7MA 1KGYE 2R27A 3D85D 4B0MB 5CD5C 2QADC 3O4OB 2W8CA 4RDBA 1KC5L 4Y16D 3IPEA 2EH8L 1NCHA 3NA9L 4DP4X 4Z3JA 2E6QA 4IMKA 2X89D 3MXVH 1UWFA 3HBQA 3V2AR 2IXQB 2FQFA 2G2RA 3P77A 4N9GA 2FATH 3I3EA 4LHUG 3A4DA 3QUYB 4AMKH 2FX9H 3L1FA 4K7FB 1UKQA 5DVPA 5I8OH 3ATFA 1XGRA 2Z64C 1DHKA 3PWPD 4HX1B 2P80A 4AIZA 4ZJ9A 4N6QA 5DZLA 3SDDA 4A39A 1HYRC 3BMWA 5I1DB 1NCIA 5F7WC 3ZGHA 1XGPB 2MOVA 4FN0A 4TUKH 1GCFA 2BIIA 4W81A 1KB5B 1ILSA 2PCFB 3GUFA 4LPCA 3O9WC 5DJ8B 4I3RL 1L3WA 5E2TL 1OALA 2B39A 4Z7QE 4JQXA 4NUGL 4D0DB 5HHOE 3QPKA 1DSFL 2HJKB 4JFFB 1BFTA 1N0XH 3AVEA 1IC5H 2VR3A 3AS0A 2VZ3A 2VDQB 1O0VA 4K9EH 3QUYA 1UADC 2NYZA 4HJ0D 4OM1L 2BWQA 4WGVB 4K7FA 4YL4A 3U2JA 5GGSB 5DVKA 2IPTL 4X2UA 3AQXA 2WJ7A 5D7EA 3NJXA 2RMNA 1KV3A 2XQYG 3SYOA 5I1DA 5KVFE 1N3NB 3WKML 1PZCA 3T2NL 2WKLA 3RWFA 2YGQA 1KB5A 3VD5A 2ATAA 4O58L 3MLSH 5E08H 4PY8J 2PCFA 5D4HA 3TA4D 5BVPH 5DJ8A 4DFHA 1DZ0A 3ES6B 3WLWD 3KVPA 2DYRB 3HIZA 4ERSL 5D8JL 3JZYA 1ASQA 4G8GB 3ZVVA 4D0DA 1KN2H 5FB8B 3H3BC 4AGLA 3LNGA 4X4ME 1E50A 2VDQH 4HSCX 1KTRL 4JFFA 3WTSA 3LN5A 5CSGA 3VXMD 4YZFE 2X0VA 3UJIL 3OM3B 1PY9A 2BMKA 3HC0B 2EADA 3QARA 3BE1L 4WHYH 2NZ1A 4FXTA 3KPTA 1D7CA 1GYWA 3LZPA 2ZWLT 3C60C 2W95A 1N68A 1AXTH 2G5UA 5GGSA 1NM4A 1ZLVH 5DUPH 1AYRA 1QAWA 5DS2A 1MN4A 1A6UH 3HHSA 2HG5B 1U42A 1N3NA 1S8DB 4QRSB 3V0WL 1DLHB 1MRFH 2CPCA 4EIBA 4XBEL 4DKFH 2FECL 1VADB 4OI7A 3ES6A 4HS8H 5FEBA 3NCXA 2AJUL 3QJOA 4PJCB 2P5WD 4G8GA 5SX5H 4XVUD 4OJYA 5FB8A 3MSPA 3SPIA 1BP3B 3CC1A 4KVNL 5DHEA 3NJGA 4JCWA 1YNLH 2FGZA 4XT1C 4FZEL 2JCCE 5AW4B 5JLZB 3L5HA 1SMDA 3ZDZF 12E8L 2X4UB 4LLAA 3S2CA 3UADA 4OD3H 1FQ9C 4FYTA 3QA3A 3RHWF 4Z7NB 3TEZA 2ZIDA 4CUCA 4N8UA 5AVWB 5AOIA 1SXBA 1ZWIB 1LGVA 4F93B 2ENQA 4EZKA 4EI0A 4NS0A 3UGEA 4LVHC 2HG5A 3D9AL 3RDTC 1U6AH 1EHAA 5IQ7L 3A47A 1UD3A 3PL6A 4QRSA 1BAFL 4E36A 1MW1A 1DLHA 3MNDA 1N6VA 4BELD 1JGLH 1EDQA 1MHCB 2DWDB 3S37X 1R3KB 2X9XA 4HFUL 1VADA 4ANVA 3EKCA 3O0RH 1KPRB 4G7YH 1DE4B 4O02B 4PJCA 3CNKA 4BFFA 5CU5A 3EJJX 4CJ0A 3W38A 5I8CB 2FX7H 1LO4H 2VLJD 2GC4C 2IPUG 4D9RE 5JR1H 1JZEA 2F61A 5JLZA 3Q8EA 1P5UC 4WIQA 2F8VA 4DH2A 3RBSA 2Q8AL 2JJSA 3FO0H 4JY5L 1B6DA 3ABMB 4H1LB 4A2DA 1NDMB 1AQ8A 4NENB 5IHUH 4IOFC 3MRRB 2UWEF 4N2CA 3CFKA 3BZEB 1ZWIA 3U0TB 4M03A 5CJOH 4PLOB 5G4MA 2JFCA 3UTTD 3QEHB 1HNFA 4M62H 1ZK5A 5F72S 1I8KB 3ILPA 4CU6A 5FR3A 5JQ6H 2VDKB 1OARH 3E1F1 4O02H 4XOCA 4F9PA 3M6DA 1QZNA 4QXTA 4ZBJA 3R7RA 4BK4A 1MHCA 2DWDA 3QIBD 1R3KA 5EZPA 1KPRA 1OAJA 2Y5TB 3AG4B 4KUZL 1DE4A 4O02A 1EDHA 4XCEB 3HA0A 2P8LB 4YDIH 1OTUD 1NH6A 4MWFB 5I8CA 2I7SA 3TT1L 3RU8H 3V0IA 4WWKD 4KRPD 4V1DE 4Y5XC 3BPCB 1IKFL 4OY9A 2ADGA 3UBFA 4P46B 2O26U 4L37A 1NDMA 1J9RA 4PJAF 1HOCB 2X9WA 4NENA 4PGJA 1E6JL 3M1OA 3MRRA 3ARTA 3QR0A 2CJUH 3EHBC 3EJZC 4L1BA 1IQDB 4J27A 3VXRE 2VDKH 4OIIL 3DGCR 3ROOB 3WS6C 1G1KA 3REVB 2RALA 5GISL 5JXAH 4WY7H 1NKGA 1E43A 1I8KA 4Y4HC 1DBKL 4J3OC 4TV3A 5TE6L 1YEGL 5IT2H 3ZSSA 3LZRA 4FD0A 2OL3L 3FQTB 4O00A 4NSKB 3ZIYA 1UZ6E 5F9DC 4M9PA 3RWCB 4KH2A 3DO7B 3IKKA 1MFCH 4LP4A 5CFHA 3KLQA 5IHZA 1S7SB 3WNLA 1GZPB 2Y5TA 3E0GA 4M5YL 4XCEA 3JQOB 2P8LA 2ALWA 5I75C 2ZKHL 4MWFA 1QNZH 1UGNA 1E65A 1ET8A 5ITBL 3BPCA 3H4FA 5K59E 3MV9E 5AOZA 4P46A 5ISZD 3ULUD 2F54E 4Z7UE 1T6VN 4MA8L 1HOCA 1WZLA 3NAAL 3STZB 4AL8L 5HYQB 2CALA 1IQDA 1OY3B 4W6WB 3QPXH 3T4AC 2ZXCA 3ROOA 3UAFA 4UU9B 4RGND 3REVA 4ODUB 2WO3B 3ULVH 1UD2A 1OCRB 3SPHA 1TQWA 3TJPA 1AQKL 3QDGE 4FQXB 1GTNA 4K5OA 5DFVD 1UA6H 2CDGB 4JRXE 3FQTA 4NSKA 3DETC 4YDLB 3RWCA 3GI9L 4I0KA 3DO7A 4URKA 1S46A 1AIFB 4R0LA 1S7SA 4AQ1B 4RISL 3E8VA 5HYEA 1B3IA 4F24A 1TO5A 1G0DA 1ITCA 2IANB 3U30B 4CVUA 5AW8B 5D1XE 3MLYL 4Z7WF 3QS2A 2FGWH 2NW2B 1SZNA 3HVNA 2AXHA 2DQCH 1PAMA 2MPAH 3HG1E 5L4IA 2H32B 3X17A 1J0ZA 2XI9A 3STZA 5HYQA 3WXVL 3W11D 3GGWA 1KFGA 4UU9A 3P1VA 1GAFL 2ZP0T 3FH8A 4ODUA 4ZD3L 4PLJC 1C5BH 2KI6A 3Q6GL 4FQXA 3DO3A 1EMTH 1BMGA 3O2VH 5AZ2H 2CDGA 4HZAA 4AJVA 3TO4C 3QFJB 4F27A 3T1FB 4Y4FB 3L3HB 2H1LM 1AKPA 4M5ZH 4XMWA 2GI0A 1CE1H 4JM0A 4UZGA 5CZKA 3SGKC 1HZLA 3UJJL 4W9IC 1AIFA 3T3PE 3QS3A 1YZZA 4MXWH 3MBXH 5FW7A 4AQ1A 1E42A 3EH5B 4JJ5B 1WEJL 5DXWA 3ZYOA 2CHXA 1CE6B 3V6OC 2H32H 3L81A 4OD1L 2IANA 1NOAA 3FRPG 3F6IA 5ABDE 1WHOA 1A3RH 4G1EB 3CDZB 2NW2A 5J5EA 1OTTC 4GI8A 1E27B 1MDTA 4X6BB 5KVFL 1H3XA 1H3TA 3H9YA 2H32A 4YHKL 2OLDA 5AW2B 3QQDA 3AAZA 4XPFL 3NGBC 3FO1B 4OJCA 2ICES 4YSAA 2XPZA 5E1GA 3F3HA 3TNMB 3LHPL 2PXYC 3BQUB 3OKOB 4XHJC 4HMCA 1JTTA 4M8RA 2CXGA 2J25A 3SBPA 2MTPA 4PW3A 2YD6A 3BGMB 5E1HB 3QFJA 1B2YA 1KLGB 4Y4FA 5GRJL 3T1FA 2CH8A 4MXQD 3PREA 5JPNC 2X2YA 1ROCA 2O5YL 1DLFH 1EXGA 1NMBL 5AYQA 4YJZL 1OTSD 4CC4C 5GS0C 4LKXB 3RRQA 3MLVL 2FNWA 1TKWB 4JJ5A 1SGKA 2BJML 2ORBH 2QTVA 1O6SA 3LZQA 5EDXA 1LP9B 1U91B 3CHOA 2ED6A 1JTOA 1CE6A 2WBJD 1FPTH 1TJGH 4UQCA 4Z7IA 4Y19D 1BEYH 4HEPG 1IM3D 4UQ3B 2IFFH 1BGXH 4R26H 5DD1L 4G1EA 3CDZA 2SODB 3QO1A 1E27A 4LDOB 4X6BA 3VFRB 2R4RH 3W81A 1NGQH 5DZVA 1THCA 3VTAA 1F3DH 1Z0MA 3H6JA 5GJTH 1QKZH 2JJVA 3AFLA 3FO1A 1A6VH 3Q43A 1FBIL 3OJMB 3MYJB 3TNMA 4QRRE 1ACXA 1NMAH 3BQUA 3L1EA 2Y7LA 1J0KA 2UY7B 3OKOA 5EO1B 4NRXB 1R75A 5AOJA 1J8RA 4XN4A 4P2OA 4UUJA 3BGMA 2FJFB 3IJ8A 2X6BA 1KLGA 5K9QG 1JZ7A 1J1PL 1ZRUA 5HGHB 5D7KE 1J9QA 2AI0L 1FC2D 4O2CB 1ZVSB 3N1MC 4LKXA 4FYSA 2VERN 1TKWA 2DQDH 1L7IL 3CFCH 3JWOL 4G43B 5I8KH 1U2YA 1LP9A 1SQMA 4P2QE 4FQ2L 2F7IA 5L6YH 1FGNL 2EDQA 3HNVL 4HK3N 2BCKB 4UQ3A 5CWSB 4WU7B 3QZBA 3FU9A 4JR9L 2OYPA 1TVBB 4RAHA 5F7FA 1YEDB 2CWRA 4FXGB 4FNUA 3UAJA 2CAKA 1T22B 1YMMD 4BQBA 1JHKH 1RJZB 4U05A 3FZUD 3CCHB 3EYUL 4XP4H 3SE6A 3ARUA 3MYJA 2Z4TA 2PABA 1JPFA 1QFWI 4UBDD 2NQCA 2VXUL 2UY7A 2WCSA 1CFMA 3FUHA 3FU6A 5EO1A 3BMVA 1GGCH 4NRXA 1EAJA 5CJ5A 1DN0A 4ZMYA 1F45A 2WYZA 3T2PA 3NRQA 2XN1A 3SJVD 3I9PA 1QYGL 1QWHA 2FJFA 3P4MB 5D6DC 1IJ9A 3V4LA 5ADOL 1NCWH 3RWIA 3CZJA 4O2CA 4ACPA 3GSRB 1MY7A 3T8VA 1KCBA 1UATA 2QHRH 5AB1A 1NQBA 5MP6L 3RY4A 1Z7JA 4G43A 1WGVA 4JG9A 3V9CA 4KV5F 4Q0XH 3GDCA 3ABKB 4P23B 1BPVA 5CWSA 4WU7A 3DARA 3KWWB 1TVBA 4RZKA 2GW5A 3K6FA 1YEDA 4K8RH 4Q89A 1UH3A 4FXGA 1J1XL 1T22A 3GBNL 3ELQA 3QRGL 5F6HJ 1V10A 2VTFA 5IBLC 3S0PA 4PRIB 5A2KH 3C5ZD 1UWGH 2ZKMX 4JFZH 4TLKA 5I6KA 1HJCA 1IBGH 1R0AL 1IAII 2GQHA 4FERA 3UG3A 4LSSL 4OJDH 3QXWA 5CF3A 4IDJL 4GW5B 5FYKH 5I71C 1K4DB 3CVHB 3P4MA 1A8ZA 5DUMH 3IBOA 3UPCA 1K6QH 3GSNL 3GSRA 3KPRE 2RH0A 3HE6D 1QLEB 5EOQL 2WVSA 2DMKA 2DYPB 1GOHA 2UX7A 2XYBA 4DWHA 4XXCA 5JHDA 3WMPA 1A4CA 3FCUB 4HPYL 4NC1C 3K2MC 4NWUH 4P23A 3K72B 4FG6D 2ADFL 1NZRA 2Y5EA 3KWWA 3U46B 3QUKB 4BFBD 2XPYA 2OMVB 4PJ7E 3T2OA 2JKSA 5KBMA 2IWKA 5B4MC 4FOMA 5C9JB 4PRIA 4KQ3L 6TAAA 2D03L 1HI6B 3L1OL 1AG6A 3DDGA 2A6IB 2LTQB 2VKWA 4MASA 1S7RB 2QDVA 3OV6A 3W5NA 4IRSC 4GW5A 1B0IA 1K4DA 1QLEH 1VGEH 2C4FT 4FZ8L 4U6HB 4Y4KD 1JGVL 2XPGB 5EIQA 5I0ZA 2EE3A 3MLUH 4I9WD 4PRAB 1AI1L 4JG0L 3SOBH 2ZXQA 1EJOH 3MRDB 4J6RH 4P49A 3MJ9L 4V2BA 4XMUA 2WAHA 4PJXE 2YEQA 5T1LB 3UIZA 4EN3C 4W9GC 3KGUA 2DYPA 4JFED 4NN6C 5IW1B 2YMOA 2VYRE 3VI3B 3K72A 5MERB 3ZRCC 1H19A 1T83C 4JFWA 1TSHA 1NICA 2M83A 4QHKI 3U46A 1UOLA 2OMVA 1N12A 4K15A 4MJIE 1A9BA 2QMJA 5D96C 5IEHB 3GI8L 1QEWB 2DQEH 1XGYH 2B15A 1JK9B 4PB0H 3PNWB 2QVMA 3HI6H 3EW3B 4GSDH 3JWNE 4QHLB 1CLYH 5CINH 5C9JA 1HI6A 2A6IA 4ZMVA 3MJ6A 5F21B 1TJMA 3F7KA 2HJLB 1QI5A 4MB5A 3WENA 2HB0A 3DBSA 3MGAA 1XZ0B 5TF1H 4DKAA 4U6HA 4AI7A 4KO5A 2XPGA 4Z7QF 1U3HC 4PRAA 5T1DH 1I8AA 4WLCA 4OF5A 2R7EB 3AM8A 4LEOB 1Q1JL 3MRDA 1SVZA 2YQ3A 5ACLA 3TEYA 3VXOB 3IPBA 5T1LA 2GKIA 5F89B 5FYKU 4B6ZA 3M1CA 1USZA 3EGXB 3KD4A 3A67H 4G11A 5IW1A 5ERWB 2F5BH 5SWZB 1P6FA 4NO3B 4JPIB 5HYJB 3QGVA 5MERA 2YMXL 1BZQK 3IM1A 4HAGA 1ZIAA 5HYSA 4HCFA 2D7QA 4PRPB 3B7TA 1OGAD 1QEWA 1L9TA 3GO1H 4LSTL 2ZUQB 4NP4L 5LB1A 4PJ9B 2IDTA 3US9A 2I9TB 1JK9A 4QHLA 3PNWA 4S2SB 3RFRA 1ODUA 2GK0B 3FTUA 5FGBC 4DP6X 4LF3B 5AWNH 1NAKH 5C3IA 5I18L 5FOJA 1H5BC 4W9KC 4X7TB 2WVVB 1CU4L 5HJDA 2HJLA 2IWFA 4PCSA 5TDNB 3SO5A 2RCSH 3DYPA 4URTB 1BAGA 1XZ0A 3KLLA 5DC0A 4P9HL 1NDGA 2DWEA 3D52A 2OCFD 4KMTL 3KGSA 3UL4A 4F3FA 2R7EA 1KSRA 1WD9A 4AY0A 1UT9A 1MEXL 4LEOA 5EU3B 4GXFA 4BINA 1DQIA 1WZ1L 5C0BD 1P5VB 4P4RB 1SM3L 5F89A 3EGXA 4I0PB 4DOHB 1WICA 5ERWA 5SWZA 1CL7L 3JWDH 1F4XL 3E80A 4NO3A 5HYJA 5IBTH 1KMGA 4Z5RB 1BQUA 3GQFA 1X5HA 1WT5C 1QR1A 1KEGH 1R5VB 2HLAB 2P5EE 3JVFC 4PRPA 5AW0B 1GGBH 4KH9A 1SXNA 4PG9B 4FQHB 4PJ9A 4HUMB 3GBML 4S2SA 5TK4A 2GIYA 2WQRA 5SWSE 4LF3A 1DQML 1PBYA 2H7WA 3ZZSA 4ESKA 4X7TA 2GSIB 2WVVA 3MROB 4F7MB 4KVCH 5TDNA 4HPHA 1NCDH 1R3IL 3RA7L 1OSZB 3HMWH 3WELA 1RSYA 4LHUB 1WAAE 2BIHA 3WFCH 4HYTB 3MZTA 2ZYIA 1D5ZB 1VJSA 5EA0L 2PO6D 3GHEL 2LVCA 5D70H 5EU3A 1SDYA 4KKLD 1PGRB 3H85A 4P8QA 2JCCF 1LWHA 3MJ7B 1Q9KA 3QUZC 2ZOOA 1JZIA 2ZKWA 3TJEL 3UYOD 4P4RA 3SN6N 5D4QA 4D8PB 5A2FA 2MNUA 4I0PA 4H8PA 4OLWH 2DLFH 2CJSA 5AUMB 3BISA 4XXWA 2FHBA 4Z5RA 4OCNC 4B7LA 5GGSY 3PXJA 5DLML 4QOKE 2HLAA 3EXJA 3DJTA 1INQB 3EAKA 1FH5L 1QR4A 4PG9A 4FQHA 3WIFA 2DWSA 1IM3B 3WFBH 4N9OB 3S3DB 2XC8A 4Z0XB 3G6AB 2GSIA 2QLYA 4F7MA 5MEND 1RZKL 3DVNB 1SLUA 2ZZUT 3FB8B 5D93B 4ZMLA 3C6LB 1OSZA 3WO4C 5I74C 4AENB 1TZHB 4LHUA 2Q10A 3K46A 3GLZA 1D5ZA 3NTCH 3APFA 5IJCC 3CC5B 4CGUB 4FEIA 4KY1L 2XUWA 1AE6L 4ODBD 3ATAA 4TVPH 3MJ7A 1KEMH 5ETUB 4Y5VB 3D48R 4Z6AT 3CBJB 5IIEB 1TSRA 4XP5L 2MOGA 4P5TB 5AUMA 4D94A 1A6WH 1NMCB 4H20L 3ESNA 4DEPB 5IHHA 4RH4A 1L5GB 4PPTA 1CO1A 4XN1A 4GG6B 2ZXBA 4KROC 5KVEH 1INQA 1Z3GH 4YE0A 5H37G 5CZXC 3BIKB 3S36L 4P59H 5IVXB 3MBED 3H6AA 3X3FH 5D1ZB 4Z0XA 2WWOA 2JKIS 3O3AB 4AEIH 4IJ3B 1FFOB 2D3JA 4YXLH 1F0LA 1AG0A 3FB8A 3DVNA 4LRNH 4F7CB 1VPOL 3C6LA 4AENA 2HPTA 1S4IA 1TZHA 1EEQA 2W1NA 3L4TA 1U3JA 4ANUA 4YOKA 1X5XA 2FX8H 2ZT9C 3BN3B 4MA1B 3CC5A 3V0EA 4E2OA 2QJDA 4G82A 2NOYA 2DWXA 1AYOA 2XFGB 1KG0B 3NSJA 3PABB 5ETUA 1NDTA 5E2JA 2XQYA 4FL4C 4Y5VA 4FKKA 4YDVB 5IIEA 3PDGA 2VDNB 2ZX5A 4AJWA 3CXFA 4P5TA 4Q2ZB 5F9OL 4TQEH 1TJIH 2X7LA 3KWVA 1S9WB 4GG6A 4JE4B 1CZ8L 5E6ID 3RZCC 4FFWC 3BIKA 3MREB 2HH0L 3ZE1E 3CXDL 1JYXA 4YDKH 3PQYD 5IV2B 3WAJA 2G75B 5D1ZA 5KZCD 3FF8A 4Q6YA 4PJ5B 4U4IA 3O3AA 1UZ6F 2EXWC 3BWUF 4FFVC 1FFOA 2NY1C 4F7CA 3OLEA 4B50A 1GYVA 2VB5A 1JPTL 1NWOA 3H53A 4IU2B 5GZND 3DTUB 5D7HA 5AKRA 1KG0A 4I8DA 5DZNA 5KVDH 2DI9A 1JUFB 3PABA 3IFPB 5K59F 5KUKA 4YDVA 3ARQA 3L9YA 4Z7UF 1LDPH 4KJPD 4Q2ZA 2DQGH 4AW4A 3FSVA 4NZ8A 1MOEA 3TX4A 2A4EA 4GEJA 4NFDA 1JZ3A 1TQVA 1S9WA 2VL5B 1OAXL 2VUOA 4PVBA 4PJBB 4G9FE 1D7BA 3GXMA 1T1XB 3LD8B 3MREA 4C59B 3JTSB 2ED9A 4UDUB 5D7JD 1B4JH 5IMMB 5IV2A 1VFMA 3O6ML 2G75A 4JE0A 4OJFH 1BHGA 4PJ5A 5DZ9A 1FWXA 3ZUNC 3ZRSA 1ZT4B 4UTBH 1JVLA 4MZ2A 3L3OB 5I30H 5EZIH 3U9UB 5CN1A 1S5IH 1NCBL 3HI1B 3V5KB 32C2B 2XVKA 4UTBA 4YHMH 5HI4C 3RWJB 2X2UA 3QG7H 2GBTA 1NINA 2V8LA 2Q0ZX 2M8XA 4PRBB 2HA1A 1JUFA 3OX8B 5I1GH 3IFPA 2HVJB 3KYOB 2AHIA 4JHBA 2Y4SA 3CFEB 4KHTL 1GC1L 4XO3A 1DCLA 2N01B 1UM6H 3SDYH 1T5WB 2MH4A 3QNFA 3T0VA 2XQ0A 1XTLA 4NZRH 3EFOB 4UAOB 2LR4A 2MQ3A 4Y2DB 2VZVA 3L9RB 2VL5A 4WUUB 4JFEB 4XCYB 5L2JB 3EH1A 4NWTL 1G9MH 4PJBA 3VGAB 2OM5A 1T1XA 4PGZA 3JTSA 1IAIH 2F19L 4UDUA 5K93A 1G0YR 1BWMA 2ADJB 5IMMA 3QR2A 1ZS2A 3AXIA 4Y2LA 1IKOP 1LO3H 4HU8A 1BA9A 1ZT4A 1PX8A 4L4JA 3L3OA 2ZX8A 4KXZH 4YSOA 3U9UA 3VH8G 3AADB 3T3PF 3U4BL 5CEZE 5JMRA 1Y6NR 2IBZY 4RWHA 1GL4B 3AT9A 3WIHL 3SGJA 3LB6D 4FJZA 3CMOL 3A23A 3A4EA 3CDGB 3HI1A 3V5KA 32C2A 4M5TA 7FABL 3RWJA 5EPMB 3GK8H 3QYMA 3NSCA 2P1YA 1BV8A 1FL5B 4KDTC 4N3TA 4PRBA 3OX8A 2B16A 3ECBB 4UTAA 2HVJA 3KYOA 2XZAH 5JO5B 3CFEA 1FVCB 1ZK9A 2A7BA 3UIYA 1E2VA 1CGYA 4JFVA 3DROB 1F1DA 1ZLSH 4Y2DA 3DRQB 4W4OC 3VFNB 3L9RA 1E6OH 1EJFA 4WUUA 3OGOE 5L2JA 43C9B 1NLDH 1XB8A 2ZPKH 4J3SA 7PAZA 1B0GB 4C4BA 3UGUA 1IGJB 5EFIB 1KJ2H 3MA7B 3T3MB 2R0KH 3BLPX 3D6GA 4TQPA 4PRHB 5A1AA 3LRLA 4BM7A 1EFXD 4FA6A 4YGVB 3O2WH 1KJ2A 3BFOA 4K94C 3VVVA 5I1EL 4FMVA 1QBLH 2W0FA 3H9SB 4JM4L 4TOYH 1WA1X 5IZ7A 1QFWM 2WZPA 3CDGA 3VWJB 3BJLA 3O6FB 4N0UB 1KTKE 4XNZC 5EPMA 3RFZB 5HVHB 4FLOA 4NM4L 1RI8A 5B7EA 3LJ3A 2GFBB 5JXEC 1A4JB 3UTQB 4M5SA 3ECBA 3SGEH 4J3OG 3SY6A 1MJUL 4ZRGA 1FVCA 1G7QB 3DROA 2WWMD 1BLNB 1YC7A 3KXFD 4WK4B 3DRQA 3RUGE 3UO8B 3VFNA 3BVNB 1L7TH 1ZV5A 1AP2B 3PWJB 3G5VB 1SJEB 3WJJC 43C9A 3FT4B 2AK4B 1OP5H 4FLQA 1B0GA 3D50A 4M48H 3T6VA 1AFVL 3FCTB 1IGJA 4IIQC 5EFIA 3MA7A 4K7PX 4TNWK 4AGMA 1PYWB 1S3KH 3BUYA 4PRHA 3VI4E 2YD8A 1LD9B 4HWEH 1MIEH 4YGVA 3P2BA 3RWEB 3CHPA 3JTBA 3VB8A 4DIXA 3H9SA 2NY2C 4KXAA 5C08E 3VWJA 1AQMA 3O6FA 4N0UA 3RFZA 3SBWA 2DLHA 4DVRL 3T77B 2GFBA 1A4JA 3UTQA 2JELH 1M1SA 3LSOB 4WFHE 3SKOB 1A7RH 2PO6B 3ARGC 2L7JA 3Q5YA 2GAZB 1A5FL 1G7QA 1BLNA 2BPBA 3KL5A 1M2VB 2XXFA 5AB2A 5IROA 5LBSL 3BSZH 3BVNA 3PWJA 4LCVA 1AP2A 1UG9A 2Z7YA 3G5VA 5T1KB 3DPDA 4WO0A 1GS6X 1SJEA 3FT4A 2AK4A 4G7VL 2VAAB 1SUJA 3GXDA 5IEKB 2C3GA 2EYRB 3FCTA 3TIEB 3FUNA 3BSZA 3FRPB 3WKYA 1PYWA 4Q52A 4E41D 1DVQA 1T2JA 3I6LD 1QOKA 4FQPA 1LD9A 4X4ZA 3DYOA 4HIPA 4N2MA 4YSQA 4HJJL 4TL5A 3ECQA 5AKTA 2FQEA 4PYHA 5IGXL 3CH1B 3P0GB 2NY0D 3E8UL 3T77A 3ZW3A 1HK6A 4LE8A 2HMIC 4XBPB 3REWB 3N06B 1KENL 5AW1B 3G5ZA 4DP8X 4U3CA 1D2OA 2F68X 5H4ZA 1IKNA 3MCYA 3KYMB 1T0MA 4U6VL 1VCAA 5KYXB 1M2VA 1MFBL 2UZIL 4Q58C 5IY5B 5T1KA 2ICCA 2OQJB 4H25B 3FU8A 4G6KL 1VGKB 1MF2L 3NYKA 1CFNB 2VAAA 2EYRA 2B1HL 2ZXDA 4G5ZL 3TIEA 1F00I 1X5MA 3FRPA 3ZMNA 2GG1A 2D3NA 2WY3B 4BEIA 1U2CA 2OR7A 1PLGH 1DEDA 2BY2A 3PXLA 2DKMA 4NHUA 4WUKL 1TO4A 3TT3H 3VDAA 3CH1A 1SN5A 3CN1A 3QO0B 1FYTD 1KY6A 2WM0A 1Q0YH 3EYSH 4BK5A 2VSCA 4XBPA 3REWA 2KT6A 1M6OB 2JE8A 4PJ7F 4XC1H 1SXCA 3ZHLA 3O3DB 3KYMA 5KYXA 2GSMB 4Z3EA 1A0QH 4IK6A 2YAQA 3O3BB 3T0EC 5LHDA 2BSDA 2OQJA 4H25A 1KYAA 4G6JH 4RGMB 1VGKA 4IRJA 5EBGA 3RY5A 1CFNA 3O0LA 3FL7A 1RPUA 1BZOA 1UFGA 3L4ZA 4DPBX 5E2UL 1E5AA 3TBWB 1ZT1B 3JTTB 4HEPA 3HFML 4FTDA 4J2QA 4IJTA 4TMPA 4RDQG 3KNBB 5C0GB 1PEZA 1X5JA 3DX0A 2OZ4H 2FD6H 3ILQD 2N3JA 3MC0A 4OTXL 4PJXF 4UILL 5EORL 4S0TD 4KRMB 3MGOB 3TN0C 4ENEC 4B5ZA 3QO0A 4G8EB 2OZ4A 4ODTH 4UB0H 3QEQD 1M6OA 4YEEA 1DQLH 3O3DA 3BKML 1ZLVK 1AZVA 3P0YH 1YYMH 1A7NL 1CK0L 3O3BA 4R7DB 1ETJA 1M7IB 4ZUTB 1X5YA 5C09D 3GS4A 1JPSH 3V52H 4DPRA 1RLBA 3QHZH 5FHBL 4FABL 3HG3A 3WHXB 3TL5A 3GYRA 5TPWL 1ZVNA 4I88A 3ZL2A 1ZT1A 3JTTA 5E00B 3L4YA 3TZVD 3Q2LA 4E0RB 5SX5K 3MRBB 1P7BA 1URIA 2WXQA 5C0GA 3KNBA 4GQ9H 4Q6KA 3TA3D 1HCVA 3Q2CA 1EA9C 2QQKH 5GGRB 2LE9A 1OVZA 1NAMB 2I5YL 3BHBA 3MGOA 3QRFM 3FT9A 4JFFE 5EB9A 4BHUI 1A6ZB 1MFEL 1MRDL 2R0WL 3MNWA 2WP3T 3OLIA 1GMEA 4EZJA 2VZOA 4KMQA 2XWJB 3MKKA 4DHLA 3OSVA 3KYKH 4XP6L 1QBAA 4YQXL 5DMYA 5DJXB 3HC3H 3W9EB 3U1SH 3CFMA 4R7DA 1EX0A 4OB5L 1M7IA 4ZXBB 4ZUTA 1FV1B 5CEZL 3G6DL 2KKQA 3ENEA 3TONA 1XGQB 1AOZA 3FUFA 2VJXA 5JW3L 3BAEL 1LLAA 1X5IA 3FMGL 3WHXA 3RAJL 1NAMH 5E00A 4E0RA 3MRBA 2L04A 5GRVL 3SDXB 5FCUH 5D7SL 4X8JB 2NNFA 4FNPA 3BWZA 5GGRA 4G8GE 3T6XA 4LARH 1NAMA 5J56B 3BUDA 4KKZA 5JZ7D 1A6ZA 4W9ZA 2XQBH 5K9JH 4MQXC 2WCGA 1KCLA 5JPMC 4X99B 5J1AB 2EINB 1IGTB 3S35H 5BO1L 3EFFB 4NDMB 4AXWB 2B2XL 1JK8B 2XWJA 2P26A 3MACH 2OSWA 2ZUUA 2AXGB 1ZE3C 2WC7A 3B34A 5ICZB 5DJXA 1G7HB 3W9EA 4GOSA 5SV4A 3FOLA 4XO5A 5I8EB 2WXHA 1YAZA 4JQIA 4JVWA 4YSPA 1T7XA 4ZXBA 3QDJA 1FV1A 1CFVH 1T0PB 1XGQA 3DURB 4I0CC 5E8DH 1VRSA 4KI5D 4AITA 1DQDH 2ESVD 5CILL 1L9NA 3IDIB 3VX1A 1OE1A 5J1TC 1WAAF 2IGFL 4GXUN 2OW6A 4WW2B 3V5HB 4OLVH 15C8L 4I18B 2FZ3A 4HALA 4UOW0 3Q01A 3T0XA 1RUML 3SDXA 3IT8D 3CFBB 4X8JA 3UACA 4N20A 4PJCE 3BP7B 4OAWB 4QKTA 4AYID 2D8KA 3BPNB 3UC0H 4WK2B 1BLIA 2J44A 2V9RA 3BUPA 4IBTA 4LMQI 4OCSL 5C0ND 4Q56A 1N18A 2CR3A 1EFXB 4MNQB 1XGUB 4X99A 5J1AA 2XTJC 3FT0A 2JV6A 3EFFA 5BV7B 4GG8A 4C83B 4AXWA 1JK8A 5ICUA 3KLHD 4Z7NE 4HULB 3CHXA 3MNZB 5MEQB 2AXGA 2JLPA 1FHNA 5ICZA 4BK8A 1G7HA 5C8JA 5I8EA 2KC0A 1O7SA 1JBJA 2ZX9A 4PJHB 2HXAA 5C1MB 4B9FA 2NXZB 3NCYP 1WBXB 4M6OH 3OPZH 3X13A 3DURA 5F7AA 1WD8A 4DUVA 3ZTCC 25C8L 3US1A 1Z9SB 1QPPA 3IDIA 1XXDC 4M6NL 4WW2A 4LSRH 5ALCL 3V5HA 4OCXL 4I18A 2AQTA 2P45B 2AJZB 3CFBA 2DWTA 1ZY9A 3BP7A 2J6EH 4OAWA 3VYPA 3FPYA 4CILA 2AMGA 2DQHH 4XODA 3WLBB 1KTBA 3BSHA 5JOFB 5AW7B 4HUWB 3VMOA 3NVQA 2PLTA 5BMFL 1UT2A 4MZRA 4MNQA 4NXSA 4JPVH 2J6EA 1EEUA 2WCPA 4C83A 5D1QD 1CICB 3D30A 4KXCA 2DI8A 3MNZA 2BIOA 3IJYB 1ZOXA 4IK7A 4WCYH 4P3CL 5MEQA 4WV1B 4J3OD 4M7LL 1JYWA 1U2HA 1FLRH 3QZWG 4RMRA 2OJ1A 4PJHA 3IGKA 3RP1A 1WBXA 4P07A 3NPSB 3VMPA 1Z9SA 3V0VB 4OM0H 2K6ZA 4CADB 3QB7C 3F12B 2VXTL 2EE6A 3B9KC 2DD8H 2AJZA 4ODSH 3MOAL 4XOAA 3N85L 2AQRA 3NCJL 4LLUB 1I31A 3WLBA 1FZMB 5DS8B 4HUWA 4HGKC 2PPCA 1CDYA 2BP0B 3LZOA 4XR8C 4JFQB 4MJ4A 2JB5L 2EIMB 5HHVL 3JYBA 5JIPA 2E86A 4H88L 4QY8B 4KNQA 4ZFZA 2RR3A 4LSVL 1CICA 1D9KD 3ZYZA 4RFOH 2W91A 3H2WA 3KPSD 3AU0A 4MHHI 3UYRH 4NJAL 4IYKA 1BOYA 1QZ1A 4WV1A 3ZE1F 5KW9H 2H6PB 4HOMA 1K9TA 1E5ZA 1AQDB 4FYQA 2G3MA 4UV7H 1I3GH 5FYKD 3MRHB 1A1NB 3N9GL 4DP5X 3RTQC 4OI8A 1CD1B 3TFKC 3V0VA 3RURA 1OGPA 3ZT6A 4CADA 5DVOA 2BW5A 3F12A 3F65A 5LN8A 1LMIA 3IWVA 4PRNB 3POCA 3AUVA 1XTMA 2CG9X 3MXVL 2QADB 4TXVB 5LNGA 4KY2A 4LLUA 1RUPL 4UDTB 5HI5C 1A25A 5FO7B 1FZMA 2YN3A 5DS8A 3ZSTA 4PLNC 2BP0A 2A6JB 4JFQA 1EHXA 3TTSA 4HJIA 4QY8A 4AMKL 4ODXB 4CL7A 4TLUA 1KGUA 4X5LA 4UTCA 4KGJA 4XNXL 2I25N 3K3QA 4F2MB 4V11A 3LKOA 4PLJD 1WH0A 1CG9A 1FYTB 2D0HA 2QZ5A 4YHPB 4DZBB 2H6PA 4XCFH 1AQDA 1VERA 3ZHKA 1BCIA 3MRHA 1A1NA 4N5ED 4TUKL 2LAGB 3ISYA 5FHAH 5I1KL 1I7RB 3FAWA 1E8ZA 1CD1A 3KBEA 4LSUH 1JF1B 4J5VA 4HK0B 5KTEH 1WAPA 5DQDH 5C6PB 3UTPD 1DBJH 3WGUB 2NR6C 1PQZB 4PRNA 4Y1SA 1SVBA 4XN7A 4K3JL 3GBLA 4G6AD 2D7PA 4NQXB 4HBQA 4M56A 1TCRB 4GAJH 4UDTA 3DC0A 2NY4C 5FO7A 1IC5L 2X1OA 2IANE 1MAMH 4L4VB 2A6JA 2WLMA 1HXMB 4K9EL 5GPRA 5I0XA 4ODXA 2G0LA 4R2GC 5B39G 4YSUA 5KSUB 3QWNA 1BFOB 4F2MA 3BUQA 3U4AA 1YSOA 2X4TB 3ZTDC 2CRMA 3AITA 4YHPA 1QRNB 4DZBA 4JGMA 5JYMA 1B0RB 5LAXB 4JGUA 1ZCRA 5MHSD 1NBCA 3A6BL 4X9IA 1OEZW 2APXA 1I7RA 1IV8A 3MLSL 1CFTB 1R5IB 5E08L 1EUUA 5BVPL 1JF1A 3QFJE 4HK0A 4HKZB 3NH7H 5H37H 4ALAH 4JY4B 1PQZA 4N28A 5DC2A 1P69B 1XAKA 3K6DA 3WMSA 3O9WA 2ZWNA 2VDQL 1RHHB 1DQQB 3QNXB 4LFHD 4NOBA 4NQXA 1C12B 3SE3C 3J27A 5H37A 3WJLC 1TCRA 5CLWA 5JDSB 3V79C 3N3EA 2PP9A 4L4VA 3SE8H 3TBCA 4NKDA 2V6HA 1HXMA 2D9QB 1TQSA 5B1KA 2UV3A 2VJ8A 4JKPH 3VM7A 1BFOA 4ZS6D 1AXTL 4ADGA 2V3FA 1SYSB 1QPKA 4J8QA 3OKLB 4X8XA 2APSA 3C60B 1QRNA 5KYWA 1MY5A 2RD0A 3U2IA 4ACTA 3FUEA 3O6LL 5EEVA 3GEFA 1B0RA 3HMXH 5BS0D 1RVFH 5LAXA 1MRFL 2B77A 5E6SB 1N2RB 2V9UA 3SGDI 4ZMPA 2L7EA 3K5SA 1Y1UA 4GMSH 4DKFL 1CFTA 1R5IA 1KIRB 1JOIA 2EXYD 1TOXA 3HMXA 2IVFC 4HS8L 1ESOA 4JY4A 3G5WA 4R7VA 2DIJA 4HIHB 3QNXA 2GIMA 1RHHA 1LM8V 2EQDA 5JDSA 4QXGH 1LP9E 1YNLL 4BE6A 3BZ5A 3KDMB 3ZGIA 1XVSA 3S88H 4OD3L 3KDPB 5TE4H 1LEIB 2CQVA 1NKOA 3WN6A 2CCWA 5F7EL 1L0XA 3RUGF 3CGTA 3UMTA 5F93C 5FYLD 3LPGA 1SYSA 4OCYH 1BQ5A 3MLPA 1GA2A 5A7BA 3C60A 5I1JH 1OCCB 2B9AA 3ZJAA 2WBWB 1BD2B 2GY5A 2BVOB 3WY2A 2BWDA 1TFHA 3VI4F 1N2RA 1JGLL 2AK1H 2ZUYA 4LVHB 3RDTB 3FQNB 1KIRA 2YQGA 3O0RL 1MQ8A 2CD0A 3F5WB 4G7YL 2WUBL 1GY1A 1OWWA 4HIHA 1UXWB 1WFJA 2YAOA 3BKYL 4WFFE 2ESVB 2ZYRA 1PU0A 1LO4L 3FQWB 2HT3C 3D08A 3MLRH 2H0PA 1INDH 2BVTA 1B6UA 5JR1L 1BZ7B 1LWJA 2FJSA 3KDMA 2YARA 1ZMYA 3AG3B 3F2LA 4JO4H 1YAIA 4G7QB 3FO0L 3X1GA 1LEIA 2EO1A 1UWYA 2X70A 4NLHA 5HJ3B 3ULAB 5IHUL 1P5UB 5CJOL 2FEJA 4APQD 3KL3A 4QWWD 2B3RA 4DGVL 1QTSA 1ZANH 3QIWC 1BD2A 3GSQB 5JQ6L 4IOSD 1OARL 5PCYA 3TXAA 4O02L 2BP8B 4IBZA 4GW1B 1FIGH 3BIBX 3RDTA 1JI2A 4M7JH 4R4FH 4P2AA 3L2LA 4ZTOH 3OR6B 3F5WA 4RMSA 4Z3GA 4MAYD 1LK3H 3HE7D 4YDIL 3AC0A 1UXWA 4TNWF 3MRJB 5AB9A 3FQWA 2BZ7A 4OLUH 4GO6B 2VDMB 1PL3A 4YDNA 3UTOA 1BZ7A 4J4PD 4HV8B 5F0PB 4WO4C 3U0WH 1JXFA 2FSDA 3M7OA 3BN9C 4Y5XB 5T5NF 5HJ3A 2CJUL 2IAMC 4L29B 1P5UA 5LWYH 2VDKL 2JJTC 3GWJA 3W3BA 5BO0D 1ZHBB 3GLEA 4U1SB 1Q9LB 1JTPA 4PRIE 3EHBB 4WY7L 2Z1KA 2YUZA 3N50A 1UUNA 3GSQA 4OBRA 4AMWA 3BAKA 2BP8A 3L2NA 4GW1A 1VLXA 1UM4L 1H3WM 1CR9H 4Y4HB 2YOCA 2GT9B 3DIFA 1WWAX 3II1A 2V9TA 3OR6A 2R8SH 2PMZA 3U83A 2Y22A 3GXPA 1ZPUA 5AAPA 1I3UA 4DVBA 2HRPH 1URLA 3WKQA 3VE0B 2K1MA 3MRJA 1QNZL 1AGFB 4JN2B 3ULSB 1U8MB 5CGMA 4HV8A 1SOSA 5I75B 1SQ2N 2GTZB 3QUML 4OVVA 3DBXB 3JV0A 2NY6C 4EI6B 3STBA 2EDOA 4RRPM 4Y5XA 3M07A 4S1RH 4L29A 1NPJA 1RZJC 1SEQH 4JFXB 2OYKA 3ULVL 4U1SA 1Q9LA 2AKRB 2IWEA 4XTRC 3RVXD 1IFHH 4WWNA 4CBPA 3KH4A 2FR4A 3T4AB 4KXBA 1TVHB 2AEPH 3WS6A 4ZZFA 3QQ3B 4DTGH 1UA6L 4BUHA 4B5EA 3ESUF 3BP5B 3UBXG 3P11H 2EEAA 4Y4HA 1VIWA 1XGTB 4QDGA 2KPWA 4LGRB 5DJ2B 3JVGC 3AMKA 2ENJA 4Y9EA 1OP9A 3WEXB 2Y69B 4OJEH 3VE0A 3GKWH 4IW4C 4JN2A 1AGFA 4ILDA 3BX7C 1MQKL 4G9DA 4CBZA 3ULSA 4JHWH 5JOEA 5BUAA 2UZYB 1EBPA 1U8MA 1R5WB 2FGWL 2IBBA 3C09C 3VI3E 2GTZA 4XBMA 1WGOA 1EWHA 2DQCL 3CSYA 4CN1A 2MPAL 2FBOJ 4EI6A 1BIHA 5EUOB 1XX9C 3ARFC 4XBGB 5FYJH 3P73B 5BRZB 4ZOBA 3POHA 4YWGH 4JFXA 4F9LC 2WVUA 1RIUH 3CFDB 5DMJB 1I1RA 4JVUA 1ZGLP 1C5BL 4KOCA 3KCWA 3FTZA 1L9PA 1EMTL 4MB3A 1TVHA 3T4AA 4NQCD 4XRCA 3QFDB 3QQ3A 4U1NB 5AZ2L 4Z3FA 3MUY1