3WO0A

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-ala
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
465
structure length
465
Chain Sequence
KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords Alanine-anticapsin ligase BacD
total genus 140
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wo0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wo0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wo0A01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wo0A04
5KKNB 1GSHA 2R86A 5JQWA 1UC8A 2YRXA 2Z04A 2OLSA 4O82A 3K5HA 2YZLA 2QF7A 4IHJF 2GPSA 1B6RA 1Z2PX 1AUXA 3RFCA 1M0WA 2PVPA 2V5AA 2V58A 2DIKA 4MA0A 5D8DA 2FP4B 2W70A 3G8DA 3TQTA 5LP6F 5LXTF 1BNCA 2GPWA 5I47A 4O83A 5BPHA 5GONF 2GLTA 3ETJA 3R9RA 4EG0A 4MV3A 4GGMX 2DWCA 4MAMA 4FFRA 4XYLB 1I7NA 3ORRA 1PK8A 3N8DA 3U54A 2VHEA 5CB4F 4YAJB 4O4HF 4MV1A 2I87A 1SCUB 2R7MA 3KAJA 5JVLA 3OUUA 2XD4A 3KREA 4O7ZA 5HBRB 4TUYF 3TIGA 2Z02A 3R5XA 2W6PA 1JLLB 3RV4A 1JDBB 2GQSA 3HBLA 4NYEA 4QSHA 3GIDA 4XX0B 4O4LF 5IYZF 1T36A 4Y8VB 4C5CA 1CS0A 4DIMA 2NU8B 2R85A 2YL2A 2CNUA 5LA6F 3VOTA 2R7NA 1M6VA 2W71A 1UC9A 2XCLA 3LP8A 4XZ3B 2R82A 2PBZA 2W6ZA 2HGSA 4IWYA 1Z2OX 3TW6A 3G8CA 1KJQA 3RUPA 4IIJF 3I12A 3BSSA 3VA7A 1BXRA 1KJIA 3E5NA 2VPQA 1W93A 3JRWA 5JVDF 1KEEA 1E4EA 4FGRA 5BMVF 4O81A 1CQJB 4FE2A 4FFOA 3V4SA 3N6RA 2NUAB 2W6NA 4FFMA 3LWBA 5K2MA 5EZYF 2R87A 3OUZA 3RV3A 2ZDGA 4HNUA 4O7NA 2V59A 4YJ3F 2CNQA 3TINA 4YJ2F 1EUDB 4MV4A 3MJFA 2QK4A 2R7LA 3QFFA 1B6SA 2CQYA 4O7WA 4O2AF 4O7RA 4TV9F 3K3PA 2NPOA 2WYOA 4EAAA 4O7SA 4L1KA 3WNZA 1VKZA 3VPCA 1OBDA 4O4IF 1GGOA 2YS6A 3VPBA 5DMXA 4FFPA 2NU6B 4MV8A 1KBLA 5LOVF 2GQRA 5C1PA 3U9TA 1DV2A 3U55A 3U9SA 5JH7F 4I4TF 3WO1A 1EYZA 1PX2A 2YWVA 4WD3A 2P0AA 3Q1KA 2FPIB 1AUVA 1A48A 4M9CA 5LYJF 2W6QA 1A9XA 1KJ9A 1W96A 1I7LA 4XYMB 1C3OA 5CA0F 3ORQA 1IOWA 1WR2A 3JZFA 2I8CA 5CA1F 3VMMA 1EZ1A 1JKJB 5HV6A 5FNVF 1DV1A 2CZGA 4YAKB 3TIIA 4FFLA 2R7KA 4YBZB 2HJWA 3BSWA 1ULZA 4HQ6A 2R6FA 4IZOA 2X0SA 3NUAA 3ETHA 2I80A 3MWEA 4O7YA 4M9UA 4O7TA 2IP4A 4ZHQF 4C5BA 4MV9A 4HNVA 3R5HA 4I50F 3BSYA 2R84A 3AW8A 2NU9B 2C00A 2YS7A 4MV6A 1VBHA 2FPGB 4EA7A 3SE7A 5J2UF 1KJJA 1EHIA 2SCUB 2W6OA 4FU0A 4O84A 2YW2A 3JZIA 2DZDA 4EA9A 4O7VA 2NU7B 4ZOLF 3VPDA 2VQDA 1CE8A 1KJ8A 1E4EB 1JDEA 4ZI7F 3GLKA 1EUCB 2FB9A 3R5FA 1OBGA 2CNVA 2YRWA 2YZGA 4O4JF 3MWDA 1Z2NX 3WO0A 1GSOA 2VR1A 4M98A 4M99A 3HB9A 3V4ZA 3AX6A 1KC7A 4EGJA 2ZDQA 1VBGA 1GLVA 4O86A 2W6MA 3K5IA 4E4TA 4O2BF 4ME6A 5J2TF 3JRXA 1DIKA 3KAKA 3Q2OA 3BFPA 4MV7A 4YB8B 5H80A 3UFXB 4C5AA 4FFNA 1KUTA 4RZQA 3HO8A 5KX5F 2DLNA 4DLKA 3DF7A 2PN1A 3KALA 2ZDHA 3R23A 4EABA 2YZNA 1CQIB 4I55F 2YYAA 5C8YF 5CAEB 4EGQA 1GSAA 4HNTA 5BPFA 2J9GA 2YZMA 4MA5A 4J6EA 1C30A 4O7LA 4EA8A 4WBNF 3BG5A 1M0TA 4HR7A 4ZQIA 1IOVA 4IWXA 2FPPB 4TV8F 5C1OA 5JQGF
chains in the Genus database with same CATH superfamily
2C9CA 4HHEA 1PR1A 2BEJA 1PTJC 1J0DA 2WAMA 1A82A 3FGPA 1IWBB 3LDUA 4Q15A 3UC9A 4B74A 3C0KA 3D2LA 1EK2A 1PN3A 1XZKA 1S6YA 3DW1X 5C34B 1ZG3A 4Z7OB 1ACLA 2CZCA 4OLAA 5D1OB 2LCIA 1QLWA 4YVFA 2GGSA 1QIEA 3K0KA 4K28A 3HB4X 1N8NA 3JWEA 1U1DA 4RWZA 2I6GA 5L9AA 5L8VA 3K5HA 3WKEA 2KQUA 2O14A 4J8PA 5H1SO 4G37A 4F38A 3EFOB 4I0WB 3U09A 1OWTA 3IELA 4MROA 1JG1A 4CM8A 1X7WB 2W9CB 1ZD3A 3Q6MA 5FHRA 2M6LA 4EEQA 2EG9A 1W4AA 2XUDA 3WNBA 1MAVA 1ISPA 1CXZA 3D4PA 3WLOA 4EY6A 3AF6A 4MVJA 4C4AA 4NZYA 2XUAA 5A2QA 5FTNA 2PX5A 4U1RA 5KFZA 2YYSA 3H9UA 4F56A 3EQ8A 3SHWA 2FKLA 3I6BA 1H1DA 1CJCA 3L7MA 4AY3A 4Q4LA 3HB7A 5E7IA 2QP3A 2ODPA 3RFUA 2JASA 2RHTA 5A05A 3IT1A 1YR3A 4I6EA 4Q3KA 4X60A 3MXOA 4RK7A 3O95A 2IZOA 2C7PA 3EIWA 5CTAA 3TE7A 4B44A 1E4OA 1HT0A 3VTKA 4ZYXA 2M6SA 4EEXA 4ETMA 1TO6A 2DMRA 2X0JA 3EGDB 1GUDA 4FBLA 4H1VA 4EHJA 4Z4HA 1IZ8A 4I9FA 2OYRA 3FDFA 1SUFA 4I4NA 2CLSA 4AM8A 2JLXA 1PK8A 1JHMA 1UXHA 3CLHA 2J33A 3H13A 3IMEA 5KFOA 3IILA 3G2MA 5FL3A 4ZIRB 1Q3TA 1GQOA 1Z5WA 3A4VA 3HV0A 3LV8A 4I99A 4YAKA 2R11A 2AR0A 2H06A 4ENPA 3H04A 1U4SA 1F38A 4K26A 4M54A 4CI9A 3BACA 2UVWA 3U5TA 1JB9A 3DTGA 4JYBA 2HRZA 1W73A 5BSHA 3CPEA 4HBGA 1A27A 4PQYA 5ALWA 1XZDA 2FSGA 3NHLA 4PO8A 4QTTB 3S2ZA 3F5MA 4NH0A 3D54D 2P2ZA 2YN4A 2OLJA 3IVGA 4XJSA 3FCEA 5LBUA 5E6UB 1UXGA 3TIGA 3R6GA 4M86A 3F46A 4MJXA 5GY7A 3OCVA 4CM6A 3B6MA 2HZ7A 3G17A 3JQ7B 2Z02A 3HACA 4G0VA 2XY4A 2D5LA 2J0VA 3CHYA 2VQSA 3IA7A 4CN8A 1DXYA 4LHZA 2ECKA 4J9NA 2QGFA 2WPDD 4GOOD 4NVRA 4OY3A 4CLRA 2HLNA 4GM1A 1J1UA 4G0YA 4PHFA 5AM1A 3RK0A 4KHPB 2XHZA 2ZM6H 3I4LA 2YC2C 3WWEA 1IMOA 4D9MA 1RLJA 4Y6PA 2ZZNA 1DQZA 3G7SA 2WTUA 5AQEA 5KQSA 1Q22A 2WJ4A 3DQPA 4PZCA 3MF4A 1V0JA 4P9NA 4E5NA 4TS4A 1SXJE 3L6RA 5F5LA 3UFXA 1KO8A 3LHIA 1E6MA 3G23A 1T36A 3WWPA 3FHLA 1E4YA 3MLEA 4CHTA 3D5EA 2WTAA 2DQKA 3CVWA 3THXA 3S2EA 1FDRA 1WW2A 4EY7A 2TMDA 2H59A 2DKOA 2P2NA 3TXAA 5CA0B 2VNIA 3MJTA 4TLEA 1HZZC 5E7MA 3T1VA 5JUMA 2DPLA 1N32H 4ZT6A 2ZRGA 3CO0S 1PU2A 4CCAA 3V7YA 1ZMRA 3Q3HA 1V8PA 3LAWA 4JSRA 3VOTA 2QTGA 4LDJA 4LYAA 4UPDA 4EYOA 3OQOA 4FIDA 3W3AD 1A7AA 5LJLA 3PC3A 1JHQA 3Q0TA 2D74A 3J80W 3GPLA 1WZCA 4DR3B 1M1YE 3TCNA 3TQRA 5JW6A 2XCPA 4OL0A 1DTEA 4CM5A 3GN2A 3GV5B 2ZPTX 1V48A 4CIDA 4K40A 5DO9A 1NUQA 3O6VA 4IXWA 2W6ZA 4GZLA 3ANNA 1E9BA 5HWSA 4IWYA 5F23A 1YRAA 1S2IA 5KT7A 3TW6A 3OSPA 1R7RA 4O3OA 1F8YA 3WWJA 2V03A 2ZJ6A 3BHNA 3ESQA 3IHLA 1R0RE 2RAFA 3TLGB 4A4DA 4X65H 4KXVA 1WPXA 3CRNA 2PD3A 2CXPA 4M1WA 1SXPA 3L06A 3JQDA 2QPTA 3EFBA 1N25A 4C3UA 3SAJA 5AYXA 4RNDB 5KFNA 4GZ5A 3OP4A 1FP2A 4TUYB 4S24A 4JKYA 4V24A 3NAMA 3PRHA 1PRYA 4WI1A 1XI2A 5FPPA 4PLCA 4QUAA 4AJOA 5KYYA 1WV0A 4UNIA 1SNYA 2VHJA 2BTQA 4QU9A 1DKNA 1TIBA 2E48A 1Z5UA 1EKXA 1U3WA 2AGOA 4RSGA 3KXYT 1FQWA 3HH8A 3MTDA 4Q02A 2XUOA 1BE1A 1VQPH 2B1JA 4R7RA 4DIDA 3PVXA 1V8FA 3O1HB 2CNLA 1HNZB 3MWDB 3FI9A 2FMUA 1KXJA 4LH6A 4YAOA 4G1EB 1E1RD 4LK2A 1FBNA 5EZYF 3AESA 3H2BA 4K6NA 1XV5A 4M6WA 5J5AA 4YUVA 3EDQA 4DW8A 3W5SA 2ZZKA 2FWPA 3CKMA 3MGKA 5AW4A 1OLUA 2IYVA 1HLGA 5L9XA 1TXGA 3N70A 3GRPA 3PYXA 4MTCA 2JKVA 3OJLA 3PNKA 4WVLA 5AJXA 4UKDA 1EVEA 5AI0A 4D0SA 1O87A 1XU9A 4R3NA 2JCVA 2A0KA 1JR3A 2QTTA 3HYRA 5E6SB 4JB0A 3O31A 2W2OA 5JCJD 3RVRA 4UVIA 3NUQA 4KIJA 3UPUA 2G1AA 4RU1A 5FUXA 5FUBA 4QM7A 2DYKA 4V0SA 3TKAA 2EJUA 1Y14B 4DV4H 3GMSA 1GRVA 2OPHA 3UT6A 4US1R 3CVYA 1M6WA 1CRPA 1M76A 1PJAA 4EJSB 1CUFA 1CP2A 3QX3A 4EI2A 4UCOA 4MRVA 2Y0SA 1AT1A 3K1YA 5FI5A 3B6IA 2LVBA 4TV9F 1R00A 2XBUA 2FP4A 3L8CA 1JX4A 1GPH1 1C8BA 1VAJA 1VPDA 3L0YA 5GONB 4JYAB 1L5OA 2WJAA 4BZWA 1DSSG 1JHPA 3WGHA 3FCCA 4IRKA 1BXGA 3CW8X 4XCXA 4ENQA 2PNFA 1ZDMA 2BR3A 3CMEH 4Q1BA 4L1KA 4HFNA 4B3BA 4CF7A 4OXXA 5DBEX 1QR2A 3MWFA 3VHXB 5TX7A 4CI0B 1DO2A 5JMTA 3FIJA 1P18A 3AEUB 2QYHA 3B8HA 1VPWA 2V4ZA 3GXBA 1KRWA 1AG9A 1E9AA 2GNOA 3ETCA 1QHXA 3G2QA 4ITRC 4P22A 2Q9UA 4WBXC 1QHNA 3AI3A 4AAYA 1OH8A 4N48A 3NTUA 2QQ5A 4PCLA 3O94A 1PR5A 5AKHA 4BFWA 3CZRA 1XDUA 4D44A 4DUYB 4OB6A 5BN1A 2B4RO 3QZUA 1AGXA 4KQ9A 3GT3A 4PINA 4BUZA 2OG2A 4JJIA 4QXAA 2B1QA 2CD9A 4LNAA 4D3XA 5DMXA 2EKLA 5B1SA 2IS4A 4EG3A 3C3DA 5CYOA 2JBAA 4Q4DA 4P54A 4LZLA 3MQFA 2ZRMA 5BVGA 4MYRA 4J07A 3H20A 1DGSA 4U7PB 3NVWC 3LF2A 2FJZA 2QAGB 4BP3A 3C70A 4U67J 3RS7A 2A5LA 3RTAA 2K4MA 3U55A 1UKAA 1Z38A 2GKGA 4HS4A 4AO6A 4NL4H 5DHFA 3L1VA 3WO1A 3O4JA 2WU8A 1HYBA 1N3YA 1RS0A 3L93A 5K3FA 5KDDA 2BWJA 1EK5A 1ID1A 5KX5B 2H57A 1S2GA 1WX1A 5J58A 1DIRA 3T95A 2V3CC 3WQHA 3T3OA 4I55A 1QH9A 2CXSA 2AEMA 4MS1A 1QVWA 2OCGA 4CMAA 5EC8A 4EHBA 4YAEA 3GCGA 2FPIB 4Q4JB 5CP8A 2HSDA 3THWB 1Z4PX 2C5GA 2IY8A 3C7KA 3E70C 3F78A 4PYMA 4X92A 5ADUS 5FQOA 2F8TA 3TQFA 3NHJA 5AHKA 4YAJA 4B7XA 5KAMA 5E7JA 4IEFB 4U2BA 1XAJA 2XZTA 1F0YA 2VJMB 3T94A 3IE1A 3HKBA 2JCSA 1B3RA 3PUXA 3WRXC 2VDLB 2V1UA 1O6ZA 1ZRSA 2RDMA 3DOJA 2YJZA 4X97A 1B1CA 1GUFA 3KUCA 2E5WA 3HVJA 3NTVA 1OLSA 3B7PA 2WYIA 4J9OA 4G0QA 4GSYA 5K4GA 5LL6P 2OCXA 1TVEA 3N2GB 1CZHA 3T9FA 5BXYA 3DSRA 4JP5A 4DV1B 4ENVA 4GMFA 1NDQA 1YV9A 4C7VA 4IRMA 1DJMA 5CA1F 2BEKA 2B3DA 1TF5A 3H1FA 5B37A 3AWDA 1CQJA 1EJ6A 1L4UA 1OPRA 1F12A 4QWEA 3D8HA 3P2KA 4HATA 3H0GG 4ZYWA 1L7NA 3JAKA 1C0LA 2JFNA 4BTEA 4OUDB 1RM0A 2A3RA 1AMNA 3PKIA 3ROXA 1R9MA 5HBGA 2EFGA 1PL7A 4CKZA 4IWNA 4C78A 1VBKA 3VDQA 3VJKA 4ALNA 4RNMA 1PDVA 3MJSA 1ZOLA 3GEHA 4EAQA 1FFCA 1BQ3A 2CL5A 4RTKA 3B20A 3F4BA 2QDXA 4OK5A 1U1EA 3E81A 4P08A 2IH4A 2XQJA 1ULZA 1KL7A 3BN3A 1N56A 3H9JA 4JBLA 4Y6OA 1A4IA 1CZNA 4QXMA 2WIJA 3IPYA 2JK1A 2ZSKA 1P77A 1TMKA 4R51A 1QE0A 3WFJA 2C7RA 5BVHB 1XXLA 2Q2VA 2ODNA 2AGQA 1NMZA 4PM4A 1RYYA 3L3BA 3M6AA 3B1YA 3GAFA 3O92A 1DIBA 1ETUA 1OZFA 2I80A 5EPEA 3RJTA 4JB8A 1TJYA 1USWA 2FWRA 2HNAA 3GLHA 3EASA 4WVFA 5EVCA 2XXAB 4G4GA 1NE7A 4TL6A 1GITA 3M2TA 3JQAB 2YVAA 3SDZA 1NI4B 4LWQA 2EFHB 1YHNA 2P1ZA 2G9VA 5AKJA 2X0DA 1YTDA 1N5MA 3FNRA 3AR4A 2E4AA 3K4QA 3FSRA 2AX4A 2R4UA 3TLJA 4HL6A 1BHJA 2HT6A 1QYCA 1V2HE 2VYVD 4U00A 4Y2JA 3TEMA 1MQAA 3QXGA 4J9PA 5EKUA 4X8MA 4ARCA 2XDQA 3CNOA 2ATVA 3L0SA 4OEHA 1L9XA 3PGA1 4EMUA 3RIXA 1L8LA 3W7AA 4O84A 5KHLB 2V6IA 3JZIA 2L18A 4X8HA 3T12A 4NPHA 4L6CA 1UT6A 3KTDA 2RKWA 2PT7A 5KTOA 1BGVA 1WUIS 2ZB8A 3DE0X 2MSLA 2AMYA 2VQDA 4G36A 1ZCFA 3DTFA 3GELA 4DJAA 3ISJA 2FUNB 2DSTA 2RHGB 2KBEA 4JY7A 3DYVA 1WPQA 1N5JA 4JL8A 1MFZA 4YALA 4DQDA 4C3OB 5JZMA 1Q0TA 1D03A 4PN3A 1XDNA 4QIWA 4CE5A 3A4YA 3WMRA 2IXFA 3TK1A 4GM0A 1DELA 1MENA 2YRWA 1SUIA 1WF6A 2RGWA 3AR8A 5EJ8A 2VF2A 2O6LA 4Q1DA 2WMNB 4N01A 3G2JA 3W8RA 4DMHA 4JX8A 4KAJA 5SY9A 4G0NA 3LE8A 2EOAA 1E5LA 5JTTA 1ISJA 3H99A 1NJ6A 3AYZB 4OA8A 4MPPA 1ESMA 4M8SA 3ROFA 1G2WA 4K6GA 2OFPA 3HL0A 4M99A 3BE4A 4FYXA 3ZIAD 1JFRA 1QCZA 2OBLA 2NVWA 4EGJA 4EADA 4MEJA 4CEHA 3DEHA 1I6KA 1OPXA 3M6LA 5T6BA 1G7CA 1W0JA 4BLRA 3IEXA 5E4TA 1Z26A 2B8EA 3L43A 4KNYA 3N07A 1LLQA 3BWMA 4KQCA 4G23A 4DCNA 5JFTA 4M55A 4DBZA 4HQFA 2GB4A 2HF2A 3QKTA 3EIEA 1C0EA 1QMGA 2PLAA 4QJ5A 1YB1A 4D82A 3WLJA 1J8QA 3G6VA 3HE3A 4ENWA 3IKTA 1MZPA 3E0XA 1SCAA 2HEIA 4O63O 1VKOA 1U0OC 3ZHCA 5JLJA 3ZCXA 1UBLS 1I5OA 1ND6A 4BQEA 3GV0A 3PCTA 3AUKA 4HGRA 1Z39A 4IIUA 5B57C 3FKQA 4ZCQA 2XVXA 5IJ0B 3WE7A 4PGFA 4QPZA 4MVJF 4ARZB 3MJDA 3IUSA 4NZNA 4ZV7A 2XOKD 2DSNA 4JJ8A 4ZDJA 1SEIA 3FCSB 4BXOB 1HF3A 2ZYDA 1U28A 3FZNA 3DE3X 1SQFA 5BR8B 5IP5A 4BN4A 5I5TA 4PIMA 2QBYA 4MDHA 4RK0A 4DG9A 1RZ3A 4DLKA 5J3JA 3FNBA 1KTIA 3KJQA 2KBFA 4YJFB 2R62A 5ULLA 4A03A 1G5PA 3WNDA 2D3TA 4N0MA 2D1SA 2ZXFA 2HA4A 2H1LA 3BJEA 4ZOAA 2F1OA 4YXWA 1DKRA 2F1IA 3KKEA 3U7HB 2VHCA 3GFRA 4EI9A 1E1YA 1B00A 1OC2A 2OK8A 1XMOH 2GK6A 4KV9A 1QBKC 3QU4A 3P26A 4MZXA 3UF0A 4BRWA 2ZJRJ 2Y4RA 1GU7A 3AOEA 3AKCA 3KZCA 4IIXA 2GD0A 1DP4A 1WV1A 3E9YA 1JR6A 4F4IA 4XYMA 4AWBA 1T9KA 4BNJA 3DYIA 3VFDA 2RBKA 4GMGA 1DHTA 2IPLA 3BQMB 3I2JA 4R54A 5LQRA 3WLFA 1UKZA 4CL3A 3QE9Y 4U2KA 3W8NA 4LOHA 3VR4A 1RI3A 3GJ4A 4NHOA 5K3OA 4B3RH 2POCA 3EDYA 1C7FA 2DFVA 4LMYA 2V0GA 3DTVD 1RHKA 2YBDA 3QYJA 2IW1A 2JZOA 2XTJA 4BNVA 2QORA 4EA8A 3PPXA 5GWXA 3DWFA 1I13A 2XCTB 3MQ2A 3IJPA 1KKMA 3C4QA 4R7TA 4BOYA 3K31A 2AE1A 4DOMA 2AMJA 1OHHD 1GV0A 1FUEA 2SCUA 3MT9A 3TBHA 5L3QA 3AU8A 2EEPA 4LNUB 4FGUA 4MW2A 3QLUA 3I9KA 1IXYA 4HO1X 1Y7TA 3EFEA 4KXMA 4MV5A 3RBEA 1VLHA 5KKNB 2HLDA 5ERGB 2GZSA 5C80A 4CNBA 4JV2A 1KI9A 4YA6A 3HN2A 5JQWA 3E9ZA 1O95C 1FYFA 2PZKA 2D1QA 5JFGA 3HMQA 4C4RA 4YQWA 2AG6A 3NVDA 3LWDA 5F2NA 3PXDA 4OL9A 2XVZA 3TZLA 3VZCA 5A4AA 7MDHA 6REQB 3N39C 4U0KA 4EG8A 4AG3A 4LMBA 3HCRA 2YZLA 3QENA 4LJ5A 4M46A 1QOQB 1EKPA 3IEIA 1EGVB 4R81A 2YWGA 1B6RA 2OP0A 1L5QA 1IWPB 4QC2A 3MTQA 4B2PA 3UNXA 1OVMA 4UFPA 5L7YA 3AIOA 3LBFA 1UT8A 3PLNA 3F73A 1UBJS 1JQ3A 3PL5A 2PM8A 4JCCA 4LGYA 3RJMA 1YJAA 5FWDA 2W6JA 5B55A 1Q7YJ 3ICVA 5K6AA 4IJKA 2PZJA 2INGX 3TW7A 2NVOA 2HK9A 3DD1A 3GT7A 4JUIA 2BMJA 3ELUA 4AN1A 2V58A 2A9OA 4UFOA 4F71A 5HKAA 3PIPJ 3Q5GA 3TPFA 4B3CA 1VYTA 2BGWA 1ZJJA 2PWPA 1AXEA 3MR5A 1L4MA 2H7YA 3U7QB 1BNCA 1UT5A 4HRAA 5I47A 4NU0A 4EHIA 3GRCA 4LOLA 2OQ2A 1W8DA 4J3JA 4YXWD 2QE6A 3KR1A 3DV9A 5EMJA 2CNOA 2CXOA 5AVYA 3FETA 4YJ2A 1ZHQA 3KV3O 3T5MA 3VU3A 4DYVA 3UB2A 4E2WA 4XGKA 1L1RA 2C8LA 3IQDB 1M1NB 2JAWA 3M4YA 3DFMA 4H7PA 3BXEA 3DFKA 2BM9A 2V0CA 4TYNA 1JHUA 2Z9CA 3C1UA 4HB4A 1KJNA 3WMWA 4CEJB 1A4UA 3GFVA 1JDPA 2W8BB 1REQB 2DFLA 3SXUB 3ICQB 1P1IA 4RF2A 1MT3A 4XUDA 1V5EA 2ECPA 3HKEA 3HVIA 3JQ9C 3P9QA 1G4HA 4AQDA 1FVFA 2YH2A 3AHIA 1GGVA 5T67A 3SI8A 1EBBA 3DMDA 4OYYA 3RI3A 1C9KA 3QZ7A 4YY3B 1FP7A 1FKAH 2VHVA 2WTEA 3C14C 3K16A 4RUKA 3WJ2A 4ZZ0A 3U3XA 4E2ZA 4DADA 1SCUB 4D8VA 2WMDA 3DBLA 1P1BA 1TUEA 1VJ1A 3B1WA 3L4PA 3RF2A 3BXXA 2FCAA 1DI0A 2HLHA 3LYHA 1YE3A 1OQAA 4V2UA 1Q77A 1QGOA 2XD4A 1RWWA 1OLXB 3GFOA 5HEKA 3RARA 4AI6A 1IJBA 1W36B 4MRNA 4EY4A 3BGVA 3DV0A 3U4AA 3C16C 5EWJB 3MT8A 1XD9A 2FKNA 1HYQA 4ARBA 5BNFA 4DEYA 2E3TA 3KPYA 3LT4A 4Q4CA 3RPEA 4BU0A 1PV2A 4ZYTA 1E63A 3OZRA 5D5HA 5HHTA 5DHQA 1DBVO 3EOZA 3RUFA 3KOMA 4CL8A 4QQFA 1N63B 2HXGA 3RRFA 2FEKA 2QYOA 1T4CA 2J5KA 2W2LD 2BONA 1IBLB 1S96A 2W98A 3H4IA 4KO3S 2A14A 4G81A 2ES4A 4EB0A 5E1MA 1U8TA 4BN0A 3AQIA 3SNKA 3ACCA 5DV9A 5HZHA 2NPIA 2P8JA 1X7XB 2R4QA 1DZ3A 3HDTA 1J0AA 2CEAA 2QNBA 3EZ7A 4NBNA 1L4NA 2VSXA 1KMIY 4ZAVA 1LUAA 1NM5A 1DQNA 1G8KA 5KFIA 2VYND 5DBFA 2JFBA 3SHOA 1Q2UA 3OQHA 1K8QA 2NT3A 5FPKA 5IN4A 4GHWA 3LYLA 1Z63A 5FNVB 4QUDA 1R37A 3IP8A 4KV7A 2HMUA 4XSVA 5ALVA 1XJQA 2ID8A 3QWUA 2VK1A 4GVPA 3D0RA 3RHZA 3WYBA 2B34A 1FMFA 4DLYA 1AHPA 4WCFC 3CINA 4BVHA 1TA8A 1Y3DE 1X77A 4XCQA 1KQFA 2XKKA 1A4RA 1R4NB 3UK7A 4YRZA 3PGXA 5TLSA 2D5AA 4N5MA 5AK0A 2O07A 5H81A 1N7IA 1RAEA 1U5BA 2J5BA 2QNIA 3FG9A 3P0IA 3UWMA 3KU4A 5JISA 4KFCA 3FTNA 4F8EA 4DCTA 1E58A 1UJ2A 1ZUIA 3P27A 3FJYA 5JLAA 3T5LA 1T0HB 3TOXA 1IRXA 1Z0DA 4G5HA 4FZ3A 3UTDA 3PPWA 3DOEA 1E69A 1J9GA 1BOFA 2BDUA 3FOCA 4H3SA 4J49A 4Y6LA 2FXIA 5A6VA 5I01A 2REXB 3ABIA 3GGOA 4GM4A 3RIZA 2RCNA 5FQNA 5TJHA 3G0HA 3BQ2A 3E9NA 3FVVA 4W1RA 2ISQA 4LUCA 2I1OA 1U90A 2DH5A 3A6GA 2FWIA 3KVVA 1E7SA 2FSSA 2PZAA 3AFIA 4XSGA 4GX5A 1D3AA 3SJCA 1KEEA 1S9FA 5JCXA 1Q3KA 3LCRA 1Z74A 1ZH0A 2Q9CA 3FMGA 4MI6A 4ZK2A 2XH8A 3I9OA 1VL2A 4NU5A 4B6QA 1O0BA 1YGPA 2R7ZG 1JH9A 2ZK7A 3AF2A 4NV0A 4DUPA 3U62A 1RFLA 5BP7A 3GPIA 5AVKA 1O96B 4BWGA 3QU5A 5M29A 2I3AA 3TLKA 4LF5H 2IEIA 3BKXA 2VJOA 2P9HA 1RQPA 1E2LA 1DADA 2EZ4A 3ESYA 4ZT5A 3SIRA 4M1TA 4XGNA 3UT0A 1X1SA 5AW3A 1UBKS 3CLKA 3O7MA 2I78A 4URXR 1NQAO 4G5OA 4B3DA 4AKSA 5FIUA 4LV6A 1II8A 3BK7A 4QQ8A 5EE1A 5AXBA 3QQMA 2DQSA 3EZXA 1VSUA 2TS1A 4JWKA 4YAFA 3S8MA 1QVRA 3A0UA 1RYDA 2CT8A 4ZXFA 1SU6A 5CM9C 1MIOB 4LGMA 4RE5A 5TQ0B 3K5WA 1EA5A 2XKBA 2IZZA 2EV9A 4UOQA 1NE2A 4U4AA 4QOGA 5JSZB 3NJRA 4M8KA 3I0ZA 4HAVA 1Q7GA 3OCCA 5HJEA 3Q8MA 1GPNA 4IDDA 3RJ5A 2JA6A 4PYIA 3WK5A 1DOAA 2X8AA 4HH0A 4N18A 3ZDQA 1BS9A 2VJDA 3MA0A 2GXUA 5CDSA 3SQWA 3T3NA 3FDZB 4IHJA 2PVCA 3IXMA 3ZTYA 1BA2A 2VPTA 4G0PA 2LWIA 2P0EA 5DH9A 1FFYA 5IM4F 1PG5A 3ORFA 4L4UA 1NR5A 2DOKA 4QBFA 1XZIA 2H4FA 5MN6A 1R2QA 2O3QA 1VKZA 2KSWA 4HJXA 3S3TA 4Z7JA 1NPTO 3UBMA 5FFNA 2FWBA 4ROSA 1JT2A 1KIAA 5IS2A 4C7YA 1X1BA 4DRXB 4EVQA 1POWA 2VPWA 3UIEA 2XYRA 3OFND 4PG6A 1VE3A 1EX1A 1LH0A 4GLOA 5ALZA 5JVHJ 2PKCA 2A1UA 2CLOB 2OWEA 3LPLA 4X8LA 5K0JA 3Q3EA 1PHRA 3SC2A 3WKBA 4C14A 4DR2H 2H11A 2XMGA 3CPHA 2A4MA 3KYDA 5BV0A 1M1KJ 4BE9A 3WJAA 1Z36A 3EVEA 2GYVA 2IVFA 4A8JC 3I2KA 2BE7A 3IR5A 4V1CB 5J4KA 1X7DA 2J9YB 1QV7A 3WYEA 3ZG6A 2E21A 2ZPAA 3SYRA 4BFSA 2FU5C 5LMUB 3KUKA 2UUOA 4R1PA 2X3FA 3WB9A 1RAAA 2J0UB 2RAPA 2EW8A 3IX7A 4YO7A 4WCVA 1WRVA 4LYJA 3X1YA 4KSYA 1F9AA 2PZ8A 4M0UA 3X1KA 3M6IA 1JDNA 3FHCB 4LC9A 3HOVG 3WOHA 1WZNA 1JKIA 4OKSA 4J76A 4AB1A 3BCUA 4DWOA 1KETA 2AJCA 1M7JA 4I8IA 3GLGE 2F1HA 5FH9A 1LBIA 1MX1A 1R0KA 3D5TA 3LGSA 4GH5A 3H5WA 4GL4A 4X1YA 2E49A 4HQKA 5I60A 1M2NA 1PW7A 1XJWA 3RSZA 3WS7A 1IYEA 1TKBA 2ZRHA 3W9UA 1X42A 1DLIA 1YVUA 2R8KA 1XDWA 2R5NA 1NPYA 2E1PA 3BE5A 3T1QA 4FNOA 4AWXA 5MGBA 3N40P 3L4BA 4BEJA 2GT1A 5H68A 3HRIA 3TF5A 3B78A 1OAAA 4RESA 5FUWA 1ZAKA 4FQ8A 4JUDX 3S55A 3HYLA 1RMTA 2WE7A 4EP1A 2Z6QA 2I62A 1KDZA 3R76A 5EPUA 4MKFA 4J4TA 4TYMA 2WKQA 5IANA 4D0NA 1EFCA 1FA9A 1TJ4A 2J4FA 3SSMA 5KMGA 3CG0A 1C2YA 1ESDA 3INNA 4FMDF 3K2IA 2DUUA 4ZMRA 2XA9A 3AFHA 2OORC 1KBZA 1O54A 4UQLA 2O1XA 1SZJG 1T8RA 1WD7A 1OXUA 2GCNA 4WAUA 2OUKA 3C1AA 4OP3A 3MJEA 1SG9A 1YUMA 2E37A 3AU9A 4IBOA 4LN1A 3V7UA 1YITH 5JJKA 3EJ6A 4B32A 4CT5A 3K72B 1Q0PA 1HG1A 3BC1A 4X8OA 2HFJA 5FLYA 1ESNA 5F9MA 4F6RA 3IRVA 5PGMA 3IO3A 1X3SA 1N36H 4DJFC 4HQ6A 5JANA 3C8MA 1L5WA 4MI9A 1VQMH 3KFXA 3KLNA 2H2IA 1K68A 1HUQA 2QY6A 5CNIA 2P65A 2ZJ1A 1LBHA 2VZ0A 4E09A 2O5EA 5K8JB 2BFWA 4DA4A 2Q6OA 1XTPA 4B79A 5B4VA 3LQSA 1LS1A 3K8QA 4Z3KA 1A2BA 1KMHA 2FE1A 1Z6QA 3W77A 4UOZA 4H15A 4UHHA 5DSXA 3UVEA 1Q21A 2GH1A 4WERA 4M1OA 5E9QA 2XZLA 4CQMB 4BFLA 3EGDA 2JGJA 2QUJA 1Y34E 4IZIA 1CPYA 1NUTA 1O5TA 1U0GA 1BGWA 4FYYA 3WK8A 1GAJA 2A0WA 2CHQA 3LECA 4FOOA 1I14A 9LDBA 4IW3B 5IUNC 4FM9A 3CYFA 5LWQA 3LBIA 4KIFA 5EXDA 3VSEA 4M7EA 4A1OA 3TZHA 4KQGA 5BR8H 2JA1A 1ZI9A 2Z57A 3FPHA 1OH6A 3E05A 1UOOA 2BGJA 3BXOA 4YQEA 3PHCA 1FQKA 1Z34A 2H65A 3DKKA 3P52A 2VYFA 4NV3A 2CHUA 1J49A 3IIKA 4NYMR 3O03A 1O58A 3ZE7A 4XI9A 4ZCSA 1KJWA 2C61A 3E3NA 4FEAA 2LRHA 3KWFA 4RC9A 3U40A 3IQEA 1GARA 1IB0A 2EBFX 4RTRA 2E5LH 1RJGA 1ABEA 1ZJYA 2QTNA 2JAOA 1BA3A 1TMGE 2RGBA 4XUGB 1MPXA 3ZJUA 2NP7A 1FZTA 1GGNA 4IH4A 3RO7A 3W06A 4EB6B 3JQ7A 2RD2A 2L17A 1L2TA 3OURA 1W2WB 2QYTA 4CC6A 1OU0A 3DDZX 3RGGA 3M5CA 4JP1A 4KQMA 5HUHA 4YDRA 3UK0A 3ZCUA 1D4AA 2A1TR 4YYZA 1V45E 4RXUA 3OTOH 4UY8M 3NC0C 1T0JB 3PQDA 3T7SA 4MQFB 1YT5A 4Q0MA 5FI3A 4TXLA 2ZJOA 4CFYA 2CHGA 4RV5A 3ROEA 3TJRA 3CLVA 5E9WA 5C81A 5IPFA 1MC5A 4RFSB 3IV7A 2R4TA 2PX2A 5C2JB 3N8HA 1L5LA 3ENVA 2XVYA 4JP2A 4M1YA 3GLFE 5TF0A 3ZZNA 2XTZA 3BCSA 3X44A 4TROA 4GLJA 1KZ9A 1GLVA 3JYHA 1W85B 3PQ5A 3EPPA 1XVTA 4RENA 2P68A 2G80A 1JEEA 3ZWOA 2IYPA 4CIVA 2O52A 4TMFA 4X62B 2IEDA 2V7PA 1UZAA 2P2SA 3DE4X 2O48X 2D06A 5LWHA 1VBFA 2GBCA 1JMKC 3CZPA 1SBYA 3W6OA 3HFRA 5J2TF 4ID3A 4OYRA 4XTRA 3FJOA 1G55A 3OCJA 1Z6YA 2FEMA 2GETA 4FFBA 3BFPA 4KWWA 2Y4NA 4PRKA 2WF9A 3R6DA 5JMPA 4PZ8A 1KMMA 2EFYA 3FFTA 4C5AA 3ROMA 3GBPA 3UATA 4BQSA 2ZI6A 5LJIA 4IJVA 4IEIA 3NKFA 4QEKA 1QVVA 2B83A 2ERCA 1QKJA 3GRRA 4W5HA 1S10A 1QV9A 1TDJA 4KSBA 2DT5A 1LDNA 2C5LA 2H2AA 2JFXA 2JPDA 1YA4A 1ZLYA 2MDTA 3BJMA 2FR8A 3QE3A 4G26A 4TMZA 4MK4A 4X64H 2BC9A 2YW9A 3TLGA 2JGAA 2H1CA 3VR0A 3EEYA 2PNJA 2AGPA 3VO1A 1D4ZA 4GLWA 2VJYA 3NGDA 2ZCUA 3L01A 2HRCA 3RYFB 1HURA 3EQ7A 4ZI2A 3L5OA 1FYEA 2G6BA 2QT9A 5TQ2B 1N2CB 3T41A 2YIJA 1NVGA 3BAZA 3HDQA 3DF7A 5A4FS 3DLIA 3DYBA 4W1SA 5ES4B 1K66A 3GQBA 3IPXA 2Z08A 1P9RA 1H2HA 3P9ZA 2RH4A 3M5DA 5K8IA 1LFAA 1Z13A 2ON6A 5IC5A 4TKZA 3G2IA 4FMCB 4I9UA 5KYYB 4FGSA 1GUZA 5CH3A 2WU1A 1PR9A 2HMTA 2IK8A 2ISCA 5GJWC 1CTQA 2NACA 3QYFA 1WJGA 1JROB 3MAAC 1VL6A 1H6BA 5DHRA 5K0ZA 2O8NA 2B20A 2QUHA 3MFQA 1HO3A 4INJA 4DMUB 5KU1A 3QEBZ 4OJNA 4GR5A 3V1LA 4EYGA 1BDHA 3CRW1 2II6A 4YXFA 2NMVA 4ZTUB 3OC6A 1A76A 1YZQA 3KQYA 2Q28A 3V6JA 4FDLA 4OQYA 2QW0X 2J9GA 4E5UA 2FMAA 3HG7A 5JE8A 4O2BB 3UJPA 2Q7DA 2PUEA 4JJKA 4O7LA 5FTMA 4GLXA 4Y2SA 4FR5A 1QSGA 2BKXA 1JAHA 1XAIA 2P9JA 4K3VA 2CE2X 4E3WA 3HJAA 4C0AC 1IOVA 1Y5RA 2QNRA 5E6SA 5GV7A 1GGMA 5D7NA 5KYKA 2OTJH 4UREA 4U2CA 2ZT5A 4GLLA 1SU7A 4TV8F 2Y0DA 1WNFA 2ADFA 4RSHA 4BNFA 1E0AA 1ISMA 1EXDA 3UG7A 2FLLA 2NSJA 3PHHA 4P82A 2O4CA 4P83A 4QARA 5FBKA 4J0GA 3SJZA 4RXTA 1ECJA 2R00A 4HBZA 1X9IA 4NS1A 1ORRA 2PD6A 4FS2A 1Q83A 3KPJA 4K3UA 3L1JA 2YHBA 4YCAA 4Q1FA 3QIVA 3KJZA 4R8MA 3SG0A 4DAOA 1PJZA 5ERXA 3E8SA 2JBMA 2CMFA 5L51A 4LAFA 4RK5A 2ZRDA 1S0NA 2Q5HA 2ZYWX 1XOIA 2QF7A 1H8HD 1AKQA 2OXEA 2Q7XA 4GRDA 4I1IA 1KARA 1QRSA 2R2AA 1CULC 1RWOA 3MGCA 2XEDA 1A9PA 3WY9A 1AKYA 4XTCS 4KIWA 1Z0FA 4WKBA 3PWTA 3KTAA 1CUGA 1XF9A 3QOWA 3U3ZA 1N3BA 3AETA 4NZOA 2KSQA 1MD9A 2HTEA 3EEBA 3OEED 4L8VA 5GVSA 2B98A 1JG6A 3EH1A 3NBMA 3ROKA 1B6TA 1IZYA 3QF4B 4M21A 5I9TA 3K0FB 5FBQB 5AOCA 3P45A 3TXXA 3G8DA 4CIYA 2JBAB 4DL4A 1XK7A 5ICEA 3FKIG 1E3SA 2CW7A 1XCOA 2IXAA 4B2LA 4BO5A 3U4DA 1M75A 2GXQA 4FN4A 4K2AA 3I5XA 3L0IB 3AEQB 3WX0A 1JHOA 3TRKA 3NNDA 1LC0A 2EF0A 3DVLA 4HNRA 4ZQHA 2FG7C 4MAAA 4CL2A 2R1TA 2VYNA 1MW8X 3AJAA 5ALYA 4B3SH 3ZGOA 2HVSA 4HF7A 3QPWA 1G4AE 3A31A 1GG8A 1RI2A 3QJGA 5CFNA 5K8TA 5K3FB 4DQXA 2HXYA 2C20A 2EARA 2RHRA 3C5EA 1B2RA 5FUVA 3NRCA 4AYBA 4ER0A 5DLPA 1IUOA 2AD5A 4HOYA 2J6IA 2GRJA 3PXGA 5J43A 2ZBUA 3F4KA 4COOA 2VPYA 3OZDA 1BROA 2V7WA 3RGXA 3HBMA 2GJAA 4NK5A 4RETA 4YAJB 4P3KA 2EJTA 1M9NA 1H1LA 2Q2TA 1V9LA 2VJMA 1UC4B 3IDQA 5JCJA 3HUEA 2BR5A 3HKBB 1E18A 2XB2A 2YIMA 1XMQB 2BR4A 1YI1A 4O0LA 1UJ6A 1M5UA 1UK9A 1ZD2P 4LV5B 4ES6A 4F46A 4O3PA 2F6RA 4MUXA 3U13A 1ICEA 4MO9A 4U2FA 3DXYA 3HADA 3CH7A 2IUTA 4FSDA 4QYSA 5EE3A 3TSOA 1JFFB 2XCQA 1ZK3A 2IELA 3N2GA 4PYOA 3ZCQA 1NP7A 5AW7A 3GUUA 4YP9A 2ZWMA 3E15A 5DOVA 4QHSA 4DYHA 5KWEA 2J0EA 2DQZA 3EISA 4GC5A 4R4JA 2CFTA 5ADVA 4ESOA 1C3JA 3IS3A 2GQSA 1DFGA 1I4DD 3AM3A 4FNMA 1PJLA 2XNCA 2G88A 2Z4RA 3QJYA 4UEJA 4O8CA 2WTBA 3LQKA 3PS9A 3DDOA 3T0GA 1ZUNA 3O75A 5M5BA 5U4QA 2BH2A 3T0FA 2VHQA 3K4HA 4EUFA 4BDTA 1UH5A 1RKXA 3P71T 2G77B 3O74A 2UXDH 2JGNA 5DNVA 5FL7A 4ZCPA 1QVFH 3OM1A 2CB0A 4KK3A 4EOGA 2GZRA 3C2EA 1K9MJ 2AYXA 2Y92A 4JN6B 3AUAA 1B4DA 3NEAA 4F8JA 5NULA 1DRJA 3N75A 5A4IS 2JFHA 4ZRDA 5GAJA 4MDFA 1V37A 3KHTA 3U6KA 1YR2A 4FW8A 1V9CA 1K27A 3I28A 4HX9A 2DCMA 3RB0A 2Q5QA 5PNTA 3UZUA 3GNSA 1J5XA 3NIFB 4DNPA 5BQXA 1XL1A 5H3LA 1O4VA 1YRBA 3DEIA 4HUTA 2N46A 2EKBA 3C7CB 3KKMA 3H1AA 3OWOA 5I5GA 3D3NA 3ONEA 5B4UA 1GL7A 3KQOA 1FTSA 1SXIA 3ND8A 2J9ZB 3FTDA 3JVEA 3GCZA 4G0WA 4NXMH 4ARSA 2Q1YA 1Y5LA 1NQXA 1FX0A 2YBEA 3AUYA 3C8DA 4PQGA 1JGTA 2WWVD 3NIWA 4NX2A 3VU1A 4DWWA 4TM5A 4EO9A 2VRCA 3V4LA 1LPSA 1YNSA 1KZ7B 2CUZA 1YZNA 3UW3A 1O6CA 1YSCA 4B6JA 2BMEA 2CXHA 4MVJH 1X1EA 1ORDA 2R8HA 2GXSA 2B8TA 5K8LA 5KNCA 4INOA 4KZKA 1KJIA 4A8HA 2E2WA 1WETA 3PSHA 5TPWB 3VJRA 3M9NB 3RB3A 3ABZA 3VSBA 1DE0A 2VJNA 1STOA 1EFRD 3P0JA 4GX2A 4UXJA 2VPQA 1HDCA 3H16A 5A3JA 1ULTA 5C52B 5DT9A 5GTDA 4CDGA 1L5FA 2OHFA 3B6JA 2HQ1A 3DCJA 4FGRA 4IDQA 4RHCA 4R2MA 1KE1A 4Q16A 3MS2A 3S40A 3BTUA 5FPRA 3GGDA 1E7YA 5EXXA 2OCLA 3FDJA 2VOBA 4FE2A 3F5QA 1C4KA 3IOYA 3OH8A 2XNDA 1KFCB 2GF2A 4MNTA 4BB5A 5HOQA 1R6UA 3W5DA 1DKLA 1I6WA 4O3MA 1DNPA 3CIOA 4XWKA 3O4RA 1SD2A 2ZTSA 3FB4A 1P0PA 1BFDA 3L8GA 2PO7A 2WWGA 2XQKA 1JR4A 3LXUX 3TOVA 2JLSA 3CCRH 3ZD8A 4RVOA 4CMIB 4ERNA 4AMZA 4YJ3F 2RH9B 4RNCA 2V6JA 4O29A 2Y77A 2ONYA 1KNXA 2CLLB 4ZQEA 1THGA 4AZ3B 5ITVA 1CQWA 2R7LA 3TOZA 4A3MG 2VYCA 2Z2IA 3GXOA 4Q0YA 4KRGA 4U7FA 4OJMX 5LZ8A 3VX3A 1YWGO 2NZYA 5JUWA 4POAA 3P2EA 3SYTA 1VHWA 4Q3CA 4IIYA 4YMSA 2PKRA 5JSFA 1V5GA 3IPRA 4YLYA 4UCUA 2QX6A 1AGNA 1C4WA 4KXUA 3ZKWA 4DSAA 3ZU3A 2QLBA 1JN0A 3IAEA 3KV1A 3S2IA 4BTVA 2PKXA 4RWEA 2PMKA 3N6VA 4PNEA 1Q0LA 4OQDA 4P3PA 5CB4A 2ZUSA 1YRLA 5T3YA 4IV8A 5B12A 1Y9JA 1M2VA 1QYIA 5CTJA 1N2CE 2QTRA 5AI9A 2J67A 4RGVA 3TSYA 2AQ8A 2BFBA 2EW2A 4PX3A 2ZRNA 3RIEA 3U0BA 2C5SA 4O7SA 1PJ2A 2ZYGA 1JLLA 2CVHA 2J9FB 2RI6A 1LC3A 1OA0A 4Q6BA 4BKPA 5IX8A 5BW6B 1O4UA 1PYOA 9LDTA 4KIUA 2A8YA 2H5IA 4ND3A 1N8KA 1K4MA 1V25A 3CCFA 3GNNA 1JJ7A 5KNCH 5LMNB 3T1HB 2JJ8A 2FQWA 4AROA 1MJFA 4ILEA 5CD9A 4DVJA 4M9ZA 1DL5A 4NJMB 3VO2A 1OBDA 1PR2A 4O4IF 3PJDA 4YRJA 4IMIB 1PL0A 2HK7A 5ALPA 3CPSA 5DRTA 4OMFG 3K6KA 4UCRA 1C9NA 4YJFA 1RQ7A 1XP5A 3GRFA 4RVFA 1WCYA 1IN7A 1LRKA 3UV6A 4RB1A 4L4RA 4OV6B 3GI1A 2CHVA 3NI2A 3T4PA 4FONA 4ZRNA 1KY3A 4J9VA 3TY8A 1UJNA 3ZDZB 5JZSA 1W6UA 5J47A 1E1DA 3BE8A 5K0SA 1Q74A 4M1SA 1DGQA 3QIAA 4G9GA 4Q9JA 3ZYZA 2FY8A 4NE9A 3EG9B 1AKNA 5AMXA 5EJIA 4B85A 1RP1A 2ZYUX 1N8SA 3HJNA 4O2AA 3FSGD 2ZM6B 2AUTA 1OAKA 2ZWVA 1TU3A 1N2XA 3T5TA 3VVCA 3THYA 1NNSA 3FAHA 3CR3C 4LMPA 5CEJA 1N7GA 4OPMA 5JO0A 5KNCD 5LYJF 4Y67A 1X94A 7AT1A 5E38A 3CX4A 3OHMA 1U8XX 1CJKC 3SZOA 5CDFE 1PKEA 2C4KA 1UXKA 3KWLA 2IHNA 3BIWA 3LUGA 2IUEA 4G0XA 5T57A 1E0JA 3HY4A 5E0OA 3EWNA 5L3QB 5E8RA 1DJNA 4X45A 1C3OA 4I1SA 4E94A 1T5SA 4D9KA 3WRWA 4UU0A 4EFKA 2A3NA 3TCKA 4B48A 3COZA 1YUBA 2X76A 2GQ0A 4BKUA 4C0SA 1M7BA 2FUG6 1A04A 3GL9A 1PTKA 1NU8A 1P45A 3TLCA 4ZAYA 4WQMA 5F21A 2Q6TA 5BV1A 1D1PA 1OE0A 2OGUA 3FYUA 2YJNA 1QUEA 2ZI9A 3GH1A 4M38A 5JCOA 2H08A 2XT9A 3KB8A 2OORA 3NHWA 1Q1NA 6REQA 3ZDAA 3PHBE 2C8KA 4KI7A 4TKVB 5HKBA 4U7CA 2R6JA 1NBOA 5B58C 3RRZA 2X0IA 3TLYA 5IFLA 1RXWA 3L8MA 4B3JA 2X7HA 2ZLBA 3OEHD 4PSCA 3ZE9A 5A0VA 2P9QA 4F5WA 4PQFA 2XRZA 3T1YH 2AS0A 4HFMA 4QG3A 1W47A 1XD2B 1XTUA 3L6UA 1V6CA 1Y1WG 1N6RA 3E8XA 4CLOB 3GRUA 4LJ6A 4QUBA 4DLWA 3GUCA 4YQZA 4Y7DA 4AULA 2AF3C 3S8EA 1RHJA 1XVAA 5KFKA 3BSWA 3TEJA 3OBIA 3ZLUA 2PBFA 1FP4B 1PNVA 4BQIA 1OV6A 5DFAA 3FE2A 3IMFA 1XK6A 3N2KA 3ZWVA 3DDWA 4IJMA 1U2RA 3PDWA 3U7QA 2E5LB 4LYHA 3VZPA 4JYMA 2E4VA 4BQFA 5BOSB 3IP7A 1JHDA 1W0CA 2BF4A 4DCVA 4E51A 2VNSA 4RIHA 3AF1A 1RTKA 3PQCA 1DAIA 5CMLA 1SR8A 3MMPA 2O2XA 3EZGA 4R9VA 3FCXA 3Q7SA 3MWGA 3SJBA 4GICA 5T41A 1ECGA 1PWEA 2Q5OA 3F96A 2IV2X 4LVCA 4TT8A 1AZWA 2VUMG 1ZGCA 4FR2A 5DX1A 3V2UA 3X43A 2R47A 2W8BA 2OHJA 3O8QA 5E9JA 1AK2A 2LNDA 5KQGA 1R5NA 2E9SA 4A8JA 1GNVA 4F4XA 3D4NA 1ZSYA 3IQHX 4K46A 1FXUA 2WG0A 1KJJA 1LBTA 5U9CA 3O82A 2FJ0A 1M8KA 3KT6A 5I5XA 3ITEA 4HMQA 1GL3A 5AXCA 3V4FA 3OJFA 2I7CA 4WLVA 5AJTA 3E03A 2HX1A 5JYBA 3RWMB 4DV7H 3CE9A 4RULA 1CR6A 4YFVA 2IRWA 1TZBA 3AERB 4J0FA 4QWWA 3B8EA 4XM2A 3STWA 3EGIA 1QIDA 1LVUA 4B4UA 1JYFA 1H0SA 2AOUA 2HL6A 1Y8ZA 1E4EB 2FSUA 1N34H 2VJAA 4DHEA 1QPQA 1AKEA 4DNXA 1YTKA 2H00A 2RJNA 4J91A 1I1LA 2RI1A 5AVTA 2FFHA 3GVCA 1M6YA 3LQRA 3OEHA 4Q24A 1E66A 1VXRA 4YH1A 5DNAA 1PT9A 3ZXUB 2BM0A 5LZ2A 3EOBI 2FPOA 4RS3A 3IOEA 3SICE 4D0RA 1OXXK 2Y9PB 3H42B 3FKSD 4IGEA 3K1JA 2JFPA 4DDMA 4BECA 5HKKD 1OH7A 1PGJA 1K8AJ 5F9NA 4TQSA 2IITA 3R3XA 4MQ6A 1JYSA 3HGMA 4CM8B 2CMHA 2IJGX 2W9CA 1Y8CA 3SNHA 1UKCA 1GSOA 5DOZA 1SELA 1TF7A 1DG3A 2IYRA 1J7KA 2HNBA 4R1LA 1RM4A 5CXXA 1OFUA 2IYYA 1HEYA 2JVIA 3V4ZA 1YOVA 1RZUA 4MKIA 5JEDA 5BN5A 1ZIYA 1ZOOA 4G5RA 1ZH2A 1MOSA 2G9RA 3PRJA 2ATLA 1ODKA 2BKAA 3DMNA 4OQNA 4CLEA 3ZI0A 1C14A 1XF1A 2TECE 4U5QA 2QE7D 3QKUA 3WL6A 4X90A 1RJWA 5TGTA 2AHRA 1Z3IX 4QXOA 2QLFA 5IVDA 3A26A 1HWYA 3R6TA 3K20A 4RCVA 5FNVA 1KPHA 1GZVA 3GJQA 4AICA 2V54A 2PJRA 2JIQA 4FX5A 3UTCA 1OKKA 4C01A 1M54A 1AXRA 2ORED 2X8BA 1HKUA 1ZI6A 4WPGA 5MF6A 3D3KA 4B3TB 3CZAA 3Q6NA 1X14A 1M8PA 3LI2A 3WSVA 3DP9A 4FBUA 2W2VA 1FJXA 2C57A 2BHNA 2SKCA 5DE3A 4ZZIA 4FFNA 1KSJA 1JF8A 3EHDA 1K8RA 3DS8A 1LD3A 5FLMG 1WUHS 3U5ZB 2VUUA 3G5TA 2WJZB 4R2JA 5CFOA 2YXEA 1TCCA 1XEFA 3CB4A 2YMQA 4XB1A 4DLZA 5CIYA 5HGXA 1LDGA 4HEA6 4LF6H 3IE0A 1R12A 4M9RA 1KC3A 2I8LA 2QN9A 2D5CA 3EFHA 4MR9B 2JG3A 4I6JA 5E6UA 3M6FA 4G1CA 2FZGA 2GN2A 2DTEA 3JQCA 3P9RA 3WBBA 4O4LB 2E82A 4GSKA 2GWRA 1FRVA 3FPEA 3LSTA 3MJVA 3CVOA 3R7AA 2Q46A 3CMAH 4L22A 3QUBA 3RODA 3VU8A 4B9AA 2I2DA 3O83A 2YZ7A 1P33A 2PH3A 5P21A 4ANFA 1I1HA 1NVAA 5IDVA 2JS7A 4R84A 3TTYA 1QH8A 1Y8QA 4EMTA 1FXWF 4HTFB 2BFCA 3DFUA 3UB4A 2YYAA 4MLDA 4D9BA 3RC1A 2AGVA 4JC5A 4ZVOA 4PCUA 4RANA 2HSJA 1KDRA 1UBSB 3FYHA 4UHCA 1DWQA 2NG1A 2TMKA 2A4KA 2PU7A 2P35A 3IKLA 3BDAA 3PVCA 3CR7A 3R3SA 1IYDA 2HA7A 3G59A 3N0WA 4TS9A 3I4CA 3RBZA 3WKAA 5B1YA 4OHYA 2PEZA 3QUTA 1JR2A 1W5EA 5CXSA 3FOFC 4K9DA 4MV0A 4UULA 3F6SA 2P75A 1DC3A 4MQUA 5KINB 3FR8A 4ZO4A 3DBRA 3TVTA 1B16A 4EHFA 3AVTA 1IVNA 3PU6A 4DR6B 5ER6A 1MIOA 1BOOA 3FBTA 5TQ0A 3L6OO 1S0UA 2WWFA 2O1SA 3RFTA 5JSZA 3R74A 4PYKA 3JD3A 3MRVA 3DKVA 3UT5A 1UNNC 5JQGF 1LF5A 3EYYA 3K6RA 3H2IA 3P5SA 3VV2A 4BGUA 2RDIA 1VJ5A 2PY6A 3AEZA 3WBKA 1AGRA 3HHEA 4C4XA 3QTBA 1TAUA 3IAHA 5K2OA 4L15A 1ZBDA 3HEMA 3NT4A 3NTLA 1ADJA 3V8VA 1EWKA 1ZD5A 4NCAA 4NSNA 3DZCA 5A5GA 1VZ3A 1E20A 3VU0A 4D9NA 4LQ4A 2YWBA 5KVQA 3PF8A 3D3WB 4IMRA 4AN4A 4URWR 5DSTA 1O03A 3INTA 2PTGA 1QQAA 2FQQA 1FJGB 4B6FA 2IS1A 4LBWA 3FCAA 1BN7A 3EIXA 1OTXA 2EAUA 3EGXB 4QYMA 3EX7C 1QTNA 2WSIA 3COYA 2JAPA 3FPJA 4PGHA 3WL5A 2ECFA 4RKFA 1U8CB 1UZNA 2P41A 4TUYA 5IJ0A 2XGMA 1OZHA 2YVLA 3VH1A 5E6RA 3ZUPA 4EYHB 1E8DA 1S3SA 4XVUA 4UHJA 1QP4A 4MA0A 1E2HA 2J0QA 1D6JA 4LCEA 1WOMA 2OBMA 4N7BA 3GRVA 5EMNA 3PXCX 4XB2A 1IAVA 4BNUA 3KQSA 1K3UB 1VG8A 3QVMA 1RJFA 3UWSA 3KEQA 1DAOA 3N8KA 3K6SA 3MFIA 3JQ9A 3K30A 4ZEOA 1LJLA 2A0XA 1S7GA 2C96A 4Y6SA 5JS1A 3MFYA 3A1WA 3Q9NA 2RH5A 4GGMX 1YRHA 3OTWA 1E2FA 5K05A 1Y8RA 4A27A 3GA7A 4P32A 3ROTA 1F5SA 3ILHA 4IJQA 5M7EA 1P1FA 2AI2A 2VF8A 1ITZA 3LLVA 4FFRA 4XYLB 3PE4A 1P39A 1KEKA 3EJWA 2N47A 3DV2A 4FE3A 2YDXA 1I7NA 1PLLA 2Q7OE 1Z18A 2QVYX 4MQEA 4C0WA 1OFGA 3P0RA 3WQSB 1IONA 1KZ6A 2VHEA 3MINA 2C3UA 1NZFA 4W63A 3NJ8A 4Y2PA 5CVJA 4X1YB 1UMKA 4Z49A 3FLMA 2C84A 3DAYA 1TUBB 4FP9A 4XIYA 1DXHA 4B76A 1G59A 1W1UA 4RM3A 1JXMA 3I73A 3QELA 4RF5A 4BMNA 2ZB4A 4O4HF 4BFTA 4BBSG 3DAFA 4BVEA 4ZZ3A 3KUDA 1A8HA 3GYBA 2Q1UA 3RKUA 2NQ2C 1IL0A 3CPJB 1QO7A 3GZNA 1ZRMA 4XDYA 3G0CA 3I04M 4MKZA 2Q62A 3QKRB 3PUZA 4BX2A 5ICGA 3OLQA 4RK4A 5G0TA 2FEOA 4QPPA 1WXFA 4PHCA 1QYVA 2EIHA 2D62A 3RC3A 4MPRA 1N2JA 3VOSA 2LDBA 5EHXA 2QM0A 1BEZA 7MHTA 3NBUA 3PTAA 2YHIA 3GFSA 3NWJA 1PLJA 1VZ2A 5AUOB 2FSHA 3S7ZA 1O95A 1VMAA 3HU1A 3ILSA 3VYUB 4NYEA 1K63A 1SURA 1W5TA 1OAOA 1W9HA 2C5BA 3EZ9A 5DT2A 1CBUA 3Q8XB 2VBFA 2C3MA 4CEIB 2HHFA 3O91A 5DP1A 1RYNA 5JALA 2AG1A 4LXYA 3T35A 1GA1A 2R8JA 1T10A 4DV3B 1OBFO 1CRLA 1ZUWA 4XVRA 2FW6A 5JXIA 4MB2A 5EIHA 3K94A 3KOYA 1W59A 1YBHA 3SQNA 4C0HA 5FUYA 2WA1A 2JLYA 3MTGA 1VS0A 3BMNB 4GBED 2OHGA 3WYNA 4JVLA 2UZ1B 2Z2XA 3R9IA 5K99A 5ECDA 5CNJA 2FQXA 3R0VA 1G7SA 1U3GA 4JQSA 5KC8A 1K6IA 1EFHA 1YDHA 3WTBA 3EF3A 4CJXA 5HNKA 2EQBA 3PGJA 3UOGA 1NVTA 1OY1A 4DANA 4QLOA 5KQRA 5KOYA 1NXTA 4YECA 2GAAA 3IT0A 3K0EA 3RS0A 2YN0A 2VHTA 1Z15A 3BH6A 5KTMA 1WTAA 3CGWA 3WLKX 4PBSA 2V7QD 3AOEC 1R6AA 1W0KD 2QM8A 1QP8A 3S4YA 3UQ8A 1KNQA 4Q19A 1CUHA 1S1CA 3EPKA 4DM4A 2Y76A 2Y1XA 1UFQA 5H02A 4FGZA 4OHUA 3FB1A 3RUPA 2X2EA 2ZBGA 3W2GA 3ODPA 1N9ZA 4ZODA 4GI3A 4UE2A 4MA4A 1DO8A 1JILA 3RKSA 4G4SO 1Y33E 2GNPA 4EX6A 4Y7CA 5JVDF 1CD5A 3M6WA 3DPUA 1PLKA 2ZUDA 1PYDA 3U7JA 1CIVA 4LY3A 4N0QA 5KWJA 1J4AA 1M5TA 1AUQA 4FOSA 2VSNA 4MP6A 1ZD4A 3DT6A 2HDHA 3KETA 3UJ3X 4KGXA 4PGGA 3EULA 3KL2A 4IF4A 4UDYX 1CQJB 3H5QA 2JA8G 3CWCA 1QNLA 2Y1OA 4PGAA 4BWYA 3MCZA 3DKIA 3OHPA 4NBRA 2W6NA 2ZB7A 3D7LA 1JJFA 4GLFA 4QJBA 4HNAA 4RV9A 4GPD1 4QREA 3ITNA 4FD3A 5ALRA 2FOIA 2QVGA 2YFHA 1WCMA 2E55A 2Q5FA 3LXXA 5C44G 3D6HA 4EECA 1BCRB 4DJTA 4DJDC 3NBAA 1I2BA 4DN6A 1GTG1 3EMBA 2X4LA 4HDAA 5DLGA 2XUHA 3N3AC 3ZIUA 4UM8B 3LVBA 1AQJA 2R8XA 4Q3AA 1E3IA 1JU9A 2P30A 4V0OA 3M6VA 2FF5A 1L5VA 1OFUX 2C0QA 2DAPA 3HCWA 4UCSA 4EO4A 4E0BA 4J29A 5C8YB 2ADMA 3C74A 4FNAA 1RKQA 1T15A 4ZN6A 1QFSA 2X13A 4XUEA 4I4TA 1KSGA 5FPQA 3RHTA 1PF7E 1S2OA 4EJ6A 4RHEA 3L8FA 4GDFA 2FUEA 1DWUA 1Y0BA 1XJ0A 4IXMA 1YK1A 2I33A 5BQOA 3STUA 1U11A 1KPGA 2WYOA 2ZSFA 4M89A 2CEKA 4DA6A 3TVYA 2WM9B 4LSXA 1VE9A 2QR2A 3G6YA 4MWGA 4Z5XA 5IDQA 4FCWA 4QA9A 3QXXA 2ARKA 3H4VA 4Y0NA 2VSQA 1AMUA 4F06A 3DG9A 1C4OA 2DFTA 4B3RB 4V0NA 4ZKDA 5B7PA 1ABFA 5AK5A 3KYHC 3ZY2A 4ND4A 5ED4A 3H2ZA 3LHFA 4N7JA 4PY2A 1AKUA 2BFPA 1ULHA 2Z8YM 3EF0A 4Q21A 4YN3A 3RYHA 4EMSA 4XSHA 1O94A 2L19A 1D6SA 5E2IA 3RYFA 4B7ZA 4OJKA 1H1TA 3M3HA 3L0PA 2JZCA 1SZCA 4IUYA 1X86B 4HVTA 3TW8A 4LHSA 3E2PA 3GQBB 1VYVA 1IK6A 1OIVA 3KSRA 3MWLA 5JRJA 1XX6A 3D6VA 1A8QA 4OSEA 5TQJA 4EUKA 1U94A 2H4WA 5CG1A 4MUKA 4C7KA 4KR3A 1V3UA 5JATA 1CJMA 4V2IA 2UVDA 5FA8A 3VJMA 3I61A 1SWWA 4CG2A 1Y1SA 2XUKA 4TMXA 2HDKA 3C0FB 1MJGM 5JBNA 4CEIA 5FBHA 4G8JA 2PJDA 5EHQA 4TSFD 5TSDA 2CFMA 1W5BA 2GEJA 2QMYA 2Y6VA 1Y6JA 3OIDA 1ZMBA 4ZOBA 4HGNA 3T34A 4JDPA 1SD5A 4DE5A 4YJ3B 3CUTA 3MAGA 2HAEA 2C4NA 4QDUA 1L5NA 4KRXA 2YOFA 1T0BA 3VUFA 3Q1KA 3X1DA 1XMQH 4O2BA 2NVUA 3CNQS 5AW1A 3EXHB 1AKTA 3FWZA 4L85A 1EKFA 1Y48E 3F8WA 2W00A 4HAXA 3TNJA 2QGZA 1PNTA 3PW7A 1YDFA 2IEGA 4HSEA 3AUTA 3M4XA 3UGQA 2W2KB 2XD9A 3LCJA 2DR0A 1CY1A 4TZ6A 4IXTA 1ZX1A 4C06A 1XZNA 1NW4A 2OSBA 3ILYA 4INPA 2A5YB 3QXSA 4MITA 4WK0B 3ZCPA 3AIIA 1LJUA 3SY8A 1Z4NA 3GLVA 1EK1A 1EDEA 1UOPA 3R4VA 1Z4KA 3ER6A 2W55B 4LYEA 3IJEB 4P35A 1Z7GA 2QVXX 2IDJA 4YMLA 5JI2E 2EZ9A 3F49S 5JBIA 5K8UA 1G21A 1P9OA 3ZK9A 4C2AA 4RAZA 4LQCA 1YZ3A 2AD1A 1P4RA 3IOCA 4EYSA 2IYEA 1P1HA 4S2EA 1JTFA 4CMHA 1L3IA 4GR9A 3RS3A 1JL3A 1N0VC 1QDEA 2W93A 3G2KA 3WIBA 5HQ3A 5DM7J 2NVBA 5F1YA 4CV2A 1SVNA 1YE8A 3HYNA 4OQEA 2WJWA 3QHAA 3S1LA 3ABRB 1HQKA 3R7NA 4D2IA 1T2CA 5C3UA 4DQNA 1PSWA 5JDCC 3SIPA 4U6SA 1LWNA 3F8TA 3W5CA 3R9KA 4J0DA 1DHRA 4FC7A 1AC5A 1R88A 2PZFA 2BSXA 4Y2HA 4GGPA 1MQ9A 3VAZA 4EQ6A 3WAJA 3CVXA 3FFBA 1TCUA 1MAHA 3WB0A 3HKDA 1QNFA 3MQ4A 2IA6A 4KGZA 1Y3BE 2W90A 1UEXC 4JI7B 3MRSA 2BPOA 1CB7A 3AO0B 3O3CA 2VDNB 4LDNA 2EYUA 2MYPA 4YCBA 4MGEA 2XKJE 3ZYCA 1YZTA 5L53A 4US8A 4P98A 4BIMA 5JSUA 1M34A 3QEMA 1OYVA 5AKKA 4EWLA 3KRTA 3O38A 3OY7A 2RE8A 4OFXA 1R8JA 2C3PA 1UAGA 2PK3A 2P11A 2ZUBA 2W6ID 5A9TA 1Y42X 2EJ2A 4CW7A 2CUNA 3OEWA 2CF6A 2JFOA 3LBNA 2ZBPA 2NU9B 2ZBEA 2F8LA 4HVAA 4JT9A 1ND5A 2ZS7A 1Y7HA 3CCLH 2C07A 2YS7A 3DNPA 5GJVC 4B43A 3OQNA 3NVZC 1AX9A 3HEAA 3D2CA 2F9FA 5EIBD 1QYXA 2JGEA 3ABSB 3M33A 4Y8VA 1H8EA 1G7TA 1KKUA 4GRIA 3AJEA 4I5IA 2I7TA 5DI3B 2M98A 1QIHA 2NO5A 5BSTA 2G28A 2B61A 3G89A 2ID4A 2SCUB 3O1IC 4X91A 5CLGA 2WJPA 4B3IA 5C35A 2BJWA 3DGEC 3RVJA 1YIDA 4RE6A 3GFTA 3P9SA 1V3QE 5FBVB 4RBNA 2NU7B 1NLZA 4KQJA 1WB5A 3R8XA 4DA8A 3IESA 2XMCA 3L1KA 4M8LA 3PWZA 5EUCA 2FPXA 5KFEA 2R93A 2VRCD 3EZ2A 1JDEA 1N1GA 3Q1LA 2OCBA 4TLBA 1F3OA 1HE4A 3PKZA 4OGKA 3R7FA 5J59A 1CJSA 1KDVA 1Z0JA 4BLPA 4KBGA 1HT1E 3KBOA 3OPXA 2ZYRA 4ZVKA 1Z68A 1YQDA 1RYEA 1TWAA 4PCAA 1NVMB 4X5OA 4QASA 3W04A 3GTMA 1ZIXA 2WV9A 3L7KA 1CNEA 3NHSA 5THKA 1LBQA 1ONBA 1Y1QA 2BFEA 3G49A 3DF9A 4JP3A 4G07A 4LTNA 3DOIA 4NC9A 5HF9A 3U4MA 2FOLA 3DQQA 3QWFA 3B6EA 3IVXA 4K87A 2YR0A 4RIGA 3SKVA 1W8IA 2HPZA 3G5UA 4RPIA 3P94A 2ROQA 2AG8A 2VBIA 2DHCA 2HREA 4FZRA 1N92A 5KG7A 1J20A 1ZLXA 4E2XA 3HPQA 4W1QA 2PSHA 4HX2A 5LIPA 4RNNA 4PLTA 1Z5GA 4IKEA 1Y1PA 4OIMA 3SP1A 3HXOA 4C0QC 2COUA 5TB5A 1U7WA 4NNPA 3RVSA 2OXCA 1VGQA 2IKQA 1J2TA 3S5JA 2ZRKA 2QT1A 3T5DA 2ZJ0A 3IAS6 4CL0A 2BR0A 3JYOA 1UDRA 2H07A 2HB6A 1ZM9A 3VO9A 3B9RA 4WLFA 3SEZA 3K5PA 4PFSA 5JECA 4DCPA 2HRRA 5HTKA 3IPCA 4R5MA 4Q9KA 1O6FA 5IT5A 2CFRA 5LD2B 4ZAXA 4GKKB 4UBIA 2GCOA 1DEKA 4Q1AA 3RT1A 4HAWA 1KYQA 1N4AA 2V98A 4QQRA 3H3XA 4P36A 2ZM5A 3ZDEA 1WYGA 3PGLA 3PNQA 5TT1A 1X2BA 2X9LA 4C88A 5DCLA 4UU8A 3OOJA 2F2TA 3GP5A 3RUDA 2FSPA 1UBRS 1N9GB 4NCIA 2ZVQX 3CEAA 4KE9A 4KQWA 3VPGA 3HO8A 1JAXA 5DGHA 3O8LA 4KWEA 1D2EA 1V7ZA 3GW8A 4TZ0A 4QNNA 3UZOA 1Y81A 4GZMA 5ALNA 5KT6A 1YZFA 4MMXB 4BEWA 2DE0X 1K0FA 3D8RA 2AW5A 1SIOA 2WHPA 5I7RA 3ZI4A 4G1MB 1JU4A 3UKOA 4TVSA 3EDOA 2HHCA 4PO3X 2A9QA 4HUQA 4FT4A 5KVSA 2JCXA 2Q8PA 3U7FB 4DS3A 2AKEA 3HI6A 2PRIA 3L0BA 3M9WA 3NG1A 1K1QA 5EWJA 4WN3A 3TMYA 2JJQA 2H2DA 2G09A 1BMFD 4D25A 1SVOA 2EL9A 1T5DX 1Y3AA 8OHMA 1CKMA 1UP6A 2BI7A 3CUKA 3IAXA 3KG2A 4U9UA 3AM9A 3HCCA 5DDIP 3ON5A 2W8LA 1J2YA 1NNUA 3OZTA 1VL5A 4HNGA 4UHEA 5EKTA 5K4AA 2IE0A 2HV9A 4EKEA 4WZBB 1KK3A 2FRDA 2COJA 1Q1EA 3C4JA 4EHHA 2NTNA 1KI6B 2WAAA 3IIMA 4Y2VA 4YDSA 4BLWA 4DG5A 1L9KA 2KPOA 1TQ6A 4AQYH 5CW2A 4MTEA 4MA5A 3QQPA 3VYTB 4GUAA 3A6LA 3LU1A 1NA5A 5AUNB 1SIUA 2LKDA 4FHGA 1JS1X 1YFZA 1P17A 1TQ2A 3WKCA 4J4BA 1FSSA 3GC6A 3SFVA 4CKCA 1RU3A 2FVYA 9ATCA 2FPPB 3TXYA 2ORIA 3QU2A 1LF0A 4QHTA 2OZEA 3T3HA 5IF3A 3D7NA 1QFXA 2OC9A 3D6NB 4LJKA 4YAIA 2IZ7A 5KHOC 2YNMC 3KX2A 2R8YA 3COVA 3E9RA 1WY7A 3KNZA 1NSTA 1YJCA 3S2YA 1UIRA 1QX3A 1PL8A 3SN6A 4BUCA 5CB4B 1HL3A 3AILA 3NEJA 4QTZA 2OLSA 5LMCA 3D9QX 1M2VB 2GZ3A 2WAQE 3QBDA 2FEPA 4KBFA 3VNNA 1KDTA 1GPYA 4NI5A 2W2MA 4L0MA 3CF4G 3WBJA 2ZTHA 4F6LA 1AXGA 5F4BA 3U44A 4K0KB 1YFJA 3VNSA 4LRWA 5DGIA 2UYQA 3GQCA 3MTBA 4IHJF 2QMEA 3TDMA 2GPSA 2P5TB 4L9SA 3OE5A 2Y27A 4UTXA 1ZIOA 4UUQA 3F7TA 1T6XA 2ZRBA 4BJ3A 1HNZH 1FYXA 2A9VA 3EQ9A 4G89A 1R0CA 3CCMH 2AJDA 3GGCA 3ADBA 1KEEB 4DUYH 3QI7A 4DLPA 2VC2B 3PXEA 2H4JA 2B63G 1XZBA 2WTFA 5EEHA 3T5AA 3RFXA 1Y1VA 4JD5A 4A2QA 4OKNA 1WL8A 3CCVH 2GPNA 2Y1EA 3PFKA 2AZDA 1OU4A 2V65A 4LDRA 1YOBA 3ND9A 5ALJA 3I6QA 3GLHE 1CUXA 1D7OA 1NI5A 1D8TA 1O96A 3KXPA 4UEWA 3IOBA 4KR6A 1S72H 2WD8A 3S24A 4WXHA 2V9WA 2B30A 3DEZA 3QV1A 1NLFA 4KN5A 2ZSDA 5D01A 1DOZA 5FUQA 4MGHA 1XU7A 4MW5A 3ZK8A 2OT3B 3NVVC 3ZLJA 1QK4A 5B3JA 3MFHA 1ZOSA 2P7HA 3FNIA 4YLGA 521PA 4BO7A 5K4HA 2ZAGA 1L7XA 2Y71A 4TTIA 2WM3A 2EDAA 3B1KA 1DIHA 1J07A 4IZHA 2DHDA 3QLVA 4DCSA 1WTCA 1E2UA 1E96A 4MWCA 3PW5A 4QRHA 5IKOA 4NZMA 2OWDA 2XUGA 3ET4A 3OZIA 1WXHA 1P2DA 1N5LA 1BH2A 1TVCA 1P91A 3MSCA 4G41A 2A94A 4PYQA 1TWHA 4L8YA 5ENDA 3VH3A 1NP6A 4F91B 4LZPA 4WDRA 5AYZA 1HTTA 4E31A 1YFLA 4OHXA 3SCZA 5JYDA 4CR8A 1XQ9A 1XTQA 5EAIA 1X7YB 1UC5B 2WAYA 2V5UA 2VAMA 1N2EA 3TX2A 3DUFA 3FYUB 2Q1TA 3GEPA 3S1AB 3WISA 3FUXA 4ASUA 2EKZA 5EY3A 2W6PA 2DHQA 2DPXA 2JFQA 3P2JA 4HGYA 4E33A 5MFPA 1S4QA 2P9TA 2FN3A 3ZWNA 2D0PB 4JBIA 5GVRA 3SOZA 5FX2A 2ZJ4A 3G4SH 4FJ2A 1WABA 1X1TA 4GP6A 1CEYA 1Q50A 4MIOA 4FWBA 1NVUQ 4WN9B 2GO7A 3RBVA 5HJ7A 3TTTA 1D6NA 1SA0A 3GN1A 5ELMA 3RVDA 2FX3A 4CCSA 2CVZA 1PTJA 1I94H 1KRHA 1NULA 1VP3A 1V51A 2BEUA 3A6FA 3GNQA 4ND8B 3RGZA 3B60A 3SGLA 4RAQA 1KJYA 1MDBA 2A1UB 2QD1A 3KOUA 3HEBA 4ENTA 3ICEA 1FIQC 4OAOA 3KHRA 2WHQA 3DO6A 1AU9A 4H1UA 4XASA 4F84A 4OXYA 4JJEA 2ACVA 4GBJA 4J9KA 1JPVA 1XRNA 2PXCA 2YWJA 4B81A 1W87A 2GLXA 5AP9A 3LQFA 4KUEA 1P4HA 4G97A 3W6UA 6Q21A 4A3IG 4WFKA 1KOLA 4DQ0A 4ECRA 2BTEA 4PONA 1K83A 1F17A 5EWLA 5FP0A 2NO4A 1X1RA 5SYNA 1VDZA 1AF4A 3WGQA 1FQJA 3JZMA 1CZKA 1E1MA 1FW8A 4EKGA 3AR2A 2HLPA 3JYLA 3AVQA 2YCBA 5E3IA 4FWTA 3CLRD 1TMOA 3L92A 1U9JA 2IPNA 2W6CX 3R9WA 5L3ZA 4H77A 2WR8A 3A36A 1MABB 421PA 4I4CA 4L3OA 2HYDA 1T1IA 2Q4BA 4H08A 5FOTA 4ZYZA 2MIIA 3O8CA 4Y2XA 3HGTA 1C7JA 3MBKA 4FMCF 1L2ZA 2YVUA 5ECGC 1HYGA 3NS1C 4LBYA 4V0RA 1P8LA 2SKDA 3V9PA 4D99A 1K7EB 1DS6A 4X6LA 3BGSA 3FNEA 1WB9A 1FX1A 1I7DA 1Y6FA 4PCVA 5C53B 3Q3GE 3PNOA 1SC3A 2VEOA 5GMOA 2PX3A 3AHJA 3FAKA 1Y1TA 5JPIA 1E4EA 3QKWA 3U31A 5K8VA 3U48A 5FWYB 1E2PA 4JLUA 2IHVA 5JPDA 5AKIA 2GVZC 1MQ8B 2G4CA 2VDVE 1KGDA 4I8DA 5KB3A 2CDCA 1C3XA 2HA0A 1Q82J 1DC5A 2WEKA 3FMIA 4MWBA 5BWVA 1Z0SA 4FFOA 3LG2A 4KVZA 3WZ2A 4TYYA 3LQ1A 3S6JA 4NIMA 3PT5A 1ZHOA 2D1TA 3OJEA 1HTWA 1GADO 3Q3VA 3WZLA 5K2MA 3Q7TA 5DLFA 4QKQA 5CU7A 5BYBA 2CKZB 2BV3A 1ZU5A 3RC9A 4QVIA 3L07A 1ZH6A 2FWMX 3LMKA 4FEEA 5KVCA 1E1RA 4F21A 2A7XA 4DCMA 1J8FA 1YOVB 4P4NA 4ZYUA 1V8ZA 5K6TA 1XCBA 5BN5B 1D5WA 1NJ8A 1NU6A 1EQAA 2ZBDA 3BMQA 2DBRA 2QK4A 5JADA 2XQVA 4OA5A 3UEOA 4HYKA 3E27A 4MUYA 1XZJA 3HUDA 2WFLA 3FNHA 4GDMA 1NG9A 1F0NA 2IU3A 4RTOA 4UNRA 2HK8A 4PBTA 4G1UC 1QHHB 5DBOA 1SJ9A 1CY8A 1EZ4A 2EEZA 2LBPA 3EAFA 4N39A 1V4YA 2C4MA 2RKBA 4XXHA 4EFMA 2AJLI 2EP7A 2QTAA 3CH4B 4G5GA 4MYSA 2AX3A 4YJGA 3C39A 1C1XB 2BGUA 1LRJA 3R5KA 3R7WA 2Y2VA 3G79A 3A6PC 1IWOA 2O3JA 2IYXA 1Q81J 4B7AA 4YRDA 2NVXA 1IJEA 1UKEA 3WICA 4CM9D 1SBIA 3TG8A 1Q84A 1L1FA 2IA5A 3E9EA 3ZXXA 2WJ6A 3MWJA 4G09A 3PUVA 3JR3A 3IV6A 3K9NA 2NXNA 5TMPA 4R8SA 1NTOA 1VCNA 4P31A 2WNIA 2XMQA 1A0IA 2VYQA 1LNSA 3FW1A 4WFIA 5CVVA 5FORA 3SU8A 4B75A 5L7TA 4J2TA 3EB9A 2IZ6A 2QS9A 3DDUA 1C2TA 1Z0ZA 5JZOA 5DNEA 3NVYC 4BP1A 4DSUA 3VPCA 5EP8A 2ZP1A 3QVGA 5K3DA 1ADFA 4JDUA 1E4VA 3HZOA 4XW2A 1ZNQO 4D7AA 5B3KA 2YS6A 2D8MA 2GRAA 2QSYA 5JDIC 1RJQA 1MN6A 4HPWA 3WSWA 3X1JA 5ITWA 1FIUA 2FPUA 3D5QA 1NJ5A 4DILA 4DPMA 3V34A 5LOVF 4Z9FA 2AN1A 5C1PA 1YAJA 4A3JG 2QJFA 4A36A 2ZRIA 4WZZA 2RK3A 1DB3A 1D1SA 4MOWA 5F2OA 5KCZA 2XYQA 3UO8B 5CCEA 2QJTA 1CG6A 3LC0A 1PL6A 2WZDA 1BO6A 4MUIA 3PR2B 1B8VA 1IEWA 4MLZA 2OTLH 2OO5C 4CKEB 4UARA 3RQSA 3HXPA 3WGYA 2YWVA 3TAUA 4WD3A 4NDNE 4XWTA 3T6KA 1SU4A 4MMZB 3UJ9A 2H85A 1BE0A 1LNQA 2DHEA 2AV6A 3NYRA 4YYEA 4LOKA 3PX3A 4R83A 4A26A 4C2UA 1ZU4A 3PB3A 1SC9A 4JQCA 5DYNA 2D7DA 3M3DA 1MZVA 1EIZA 3ZWYA 5AKEA 4R7ZA 3F67A 4I08A 3B53X 5KYXB 2GZAA 2YYYA 3LT0A 2HIMA 4XM1A 3ZHOA 4BNIA 1Z08A 4XYMB 3QKSA 4F97A 1JSZA 1SKAA 1MOPA 5CT8A 3LZ6A 5KSYA 4ISBA 2GASA 5BW5A 3UT5B 4K81B 2XE4A 5DTMA 4XR9A 1H8ED 1WO8A 5K3SA 2O8FA 2IHYA 3FMFA 2X1LA 2XNJA 3NBYB 5LQJA 4O3NA 1O0SA 2Z3WA 1O89A 2XUQA 1E7RA 2GK7A 5E3JA 4DEXA 5EGSA 3SR3A 1TQHA 1NSYA 3FZEA 3UJ7A 1VBNA 3N87A 1TD1A 4AURA 2QN1A 4E13A 3I1JA 4MGZR 1U6KA 4N76A 1KQ3A 4C4YA 3U6BA 4TWRA 1XZFA 1E8MA 3E7DA 1PFWA 4MDEA 5DKFA 3LVFO 2BYTA 2PMBA 5LBTA 1Z8NA 1DCKA 2YMLA 4F4UA 5HV6A 2H1SA 1MB0A 5EPOA 4MS4B 4MKRA 1FS5A 1ADYA 3ZDYB 1AN7A 1DRWA 4KYIB 1SHUX 3EVFA 1HKHA 4O5AA 3TFQA 3V3KA 4PS1A 3AM1A 3AR6A 1DWPA 4QU0A 1R66A 1WW3A 1TJNA 4YBZB 1MB4A 1FMTA 4Q7LA 1OXKB 4RIEA 1FFDA 2GN9A 3A3OA 3L05A 1T5LA 2OZLA 4BAUA 2HU8A 3FXAA 3W6PA 2UAGA 3DHVA 1YAHA 5IZ4A 1YZLA 4UHKA 2JAUA 4QOHA 2RI0A 5CBKA 3ZJVA 8MHTA 1TWCA 1Q0QA 5TDHA 2GWHA 3AONB 4K2HA 5D00A 3FGZA 4Q3BA 3R9XB 1N2OA 4HNVA 1H5QA 3EC1A 2DLDA 2JEJA 4UFZA 2R84A 4NLLA 4AIRA 2KB0A 3BXGA 3L04A 3Q11A 4MARA 4QGHA 1TW2A 1UIMA 4DR1B 4GFDA 1N5KA 3DWGA 4HAZA 3RSFA 2P9ZA 1TUIA 3U9LA 3H0KA 4LF7B 2D5BA 3MINB 3NHYA 4A0RA 3H05A 4CIBA 2DXIA 3DZHA 3CCUH 3JAWB 1NONA 1XTJA 1GPLA 2M05A 1QIKA 2PV7A 2QGNA 3JU3A 2BGKA 4J94A 2HA2A 4KE6A 5JNLA 1LX7A 1MQSA 3DVSX 5FLXW 4ED1A 2AF4C 2Q3DA 5IBPA 1SXHA 121PA 4HS9A 4RD2A 1T5BA 4LYYA 1XXHE 1ML3A 2XXJA 1JECA 3E9DA 1Q6YA 1BWQA 5L1LA 1T3ZA 1XA0A 3Q12A 1CE8A 2Q2QA 2FN7A 4HEHA 3RVLA