3WO0A

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-ala
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
465
structure length
465
Chain Sequence
KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords Alanine-anticapsin ligase BacD
total genus 140
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wo0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wo0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wo0A01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wo0A04
1KJJA 1C30A 2YZGA 5KX5F 4O7SA 1OBGA 1EZ1A 4EGJA 3I12A 1CS0A 2NU8B 3BSWA 1E4EB 2HGSA 4J6EA 3VPBA 2J9GA 2R87A 2R7KA 2V59A 5FNVF 2ZDQA 1GSHA 2X0SA 1KBLA 1GGOA 4O7TA 1WR2A 4YAKB 3JZFA 2I8CA 3ETJA 4O84A 2W6NA 1BXRA 3R5XA 4O4IF 4O7WA 2QF7A 5HBRB 4IWXA 5CA1F 3G8DA 3VPDA 2YW2A 3JRXA 3RFCA 4FFMA 2DLNA 4O83A 3U9TA 4IIJF 5I47A 4WD3A 1B6SA 2OLSA 2DIKA 5C8YF 2YYAA 4EA9A 3BFPA 2PVPA 2W6OA 2FPGB 2NPOA 3Q1KA 3RUPA 5IYZF 1KJQA 1CE8A 2R86A 1UC8A 4QSHA 4HQ6A 3NUAA 2W6QA 5LXTF 2VR1A 4I50F 2W71A 5GONF 5J2UF 4IZOA 4MA5A 1I7NA 2R85A 1JDEA 4XYLB 2R84A 4MA0A 3MJFA 4MV3A 1A48A 3E5NA 4I4TF 3K5HA 4HNTA 2DZDA 2VQDA 2PN1A 1AUVA 3ORRA 3LWBA 1Z2NX 3K3PA 4MV4A 3MWEA 1OBDA 2VPQA 2W6PA 4YJ3F 1M0WA 2YZLA 4M9CA 1PX2A 2IP4A 3HB9A 1GLVA 3QFFA 1DIKA 3DF7A 2VHEA 1PK8A 2NU9B 4FE2A 2I87A 3N6RA 4EA7A 1DV2A 1Z2PX 3TIIA 4FFRA 5C1PA 3R5FA 5BPHA 4FFNA 4EA8A 4O7ZA 4O4LF 3GLKA 5JH7F 2GQSA 1KEEA 5D8DA 4GGMX 4MAMA 2P0AA 2YS6A 1VBHA 3WO1A 3UFXB 2W6MA 4HNUA 1KUTA 5K2MA 4FFOA 1CQJB 3WNZA 4O2AF 4O7RA 1W93A 2R6FA 1EHIA 3U9SA 1KJ9A 2W6ZA 3U54A 4IWYA 2CNUA 2ZDHA 4MV1A 1M6VA 1KC7A 5KKNB 2XD4A 2FPPB 4RZQA 1B6RA 4O82A 3G8CA 1VKZA 3KALA 2FP4B 3HBLA 2FB9A 4M9UA 5C1OA 2YL2A 3ETHA 4HNVA 4ME6A 3R23A 4O81A 1JLLB 3BSSA 3BSYA 4FFPA 3OUUA 3TQTA 1E4EA 2R82A 1T36A 2WYOA 2CNVA 1ULZA 3GIDA 3KAKA 1DV1A 4C5BA 5HV6A 4FU0A 5DMXA 5CAEB 5JVLA 5LOVF 3RV3A 2XCLA 3R9RA 1EUDB 1CQIB 1UC9A 4FFLA 2Z02A 1C3OA 2YWVA 1BNCA 2R7LA 2I80A 2PBZA 4C5CA 5JQWA 5BMVF 4MV9A 3U55A 4ZOLF 4L1KA 4ZHQF 2FPIB 3HO8A 3TINA 1KJ8A 1GSAA 2NUAB 1AUXA 4ZI7F 2GQRA 3SE7A 4IHJF 3OUZA 2YRWA 4TUYF 3BG5A 2GPSA 2GLTA 4Y8VB 5J2TF 1Z2OX 3TIGA 1IOVA 3VPCA 4EAAA 5JVDF 2Z04A 5BPFA 3K5IA 4MV8A 5LA6F 3JRWA 2SCUB 4XZ3B 1EYZA 2DWCA 2R7MA 3Q2OA 5LYJF 4M99A 3KREA 3V4ZA 3TW6A 5EZYF 2YRXA 1I7LA 4MV6A 1W96A 4XYMB 1A9XA 3VOTA 3WO0A 3N8DA 3R5HA 3ORQA 2NU7B 4EGQA 5LP6F 4YB8B 4O7NA 3LP8A 1IOWA 2CZGA 4NYEA 4EABA 5H80A 4MV7A 1JDBB 4C5AA 2YZMA 2ZDGA 4EG0A 4ZQIA 2CQYA 2YZNA 1KJIA 2CNQA 3AW8A 3VMMA 4O86A 4O7LA 4TV8F 1VBGA 2C00A 2GPWA 4FGRA 4O2BF 4DLKA 3V4SA 4M98A 4O7YA 5CA0F 4YJ2F 4O4HF 4YBZB 3VA7A 2W70A 2HJWA 3JZIA 4YAJB 1SCUB 4XX0B 1JKJB 2R7NA 5CB4F 2YS7A 4O7VA 2NU6B 4TV9F 4E4TA 4O4JF 2V5AA 2V58A 3MWDA 1M0TA 1GSOA 5JQGF 3KAJA 4DIMA 2QK4A 4HR7A 4WBNF 4I55F 3AX6A 1EUCB 3RV4A
chains in the Genus database with same CATH superfamily
1DKRA 2VDNB 2PSHA 3VVLA 4M76B 3WK5A 1HFJA 5AESA 2E3TA 3A70A 4P35A 5T4FA 1TEZA 1TUGA 4DCJA 5FUMA 5LKRA 4K5QA 1TCAA 1A9PA 5L4LA 1KO5A 1PR3A 3EXG1 3T3IA 1A9TA 5IP9G 2OZKA 1Y6QA 1F06A 3K9HA 2I7TA 3IJEB 1GA1A 1NUSA 2REBA 2Z98A 2PKRA 5EMMA 1T24A 3Q3CA 1ZHFA 3FOWA 1JPJA 1I1HA 2FEXA 3UTCA 4BWFB 1M6VB 4BY9E 4C80A 1OLSA 3K8ZA 4NCHA 5F3RA 1PDVA 1DG1G 2ABWA 4KBYA 1PQWA 4S2UA 5AM3A 4RTOA 3BXXA 1DHTA 1HMYA 1M5UA 2ZBRA 3N28A 5B58T 3B6EA 1ECGA 1UXGA 4LCBA 1HL3A 3W8NA 1JU3A 3HU2A 2WK5A 2BI8A 1IYEA 2ASVA 4AD8A 1YE8A 2F4VH 2OK7A 3CE9A 1O4VA 3ONDA 3ZW8A 2WU1A 1NULA 2BEVB 2J3QA 2B78A 1C4OA 4PINA 1Q2XA 5FNVA 2Q7DA 3MLBA 2PWYA 4QRIA 1U7PA 4KRYA 5B12A 1G2QA 3GRYA 4DJEC 4O7TA 4DDVA 1X0XA 1ZGGA 3LXXA 5T8KA 2HHFA 3DZKA 3JZFA 5HF6A 3LQYA 1P72A 2UZAA 1ZH8A 1QQ5A 2R62A 3VPHA 3GV7B 3E8SA 3QBEA 2Y6UA 4G81A 4HMPA 5BMOA 5KNBA 2PKQO 2VHXA 3LMKA 1X0VA 5MDHA 4D26A 3T7EA 2HA5A 1LA2A 4B46A 3EF0A 3SDBA 3FBGA 3QX8A 1TWFA 4UTPA 2EJ0A 2X2PA 4RJKA 3G8DA 3LC1O 3SZMA 2ZVPX 4E12A 1E62A 1IBSA 2BMAA 2JGEA 3BF7A 3GR6A 4FZRA 1QCDA 1U0JA 3RJZA 4QTXA 1ECFA 1Q17A 2ZJ8A 2DSNA 4ZI7A 1AA9A 1RLIA 1G9XA 1YZ3A 3W05A 4FCVA 5CFOA 5AICA 2EAUA 1PQUA 4EVQA 4LHZA 2YHAA 5LWHA 2YHIA 3X1WA 3RS9A 3V7FA 5JFTA 2JJ2D 5AYXA 4DUGA 4N5LA 4UTZA 1NP3A 4EMSA 2FE3A 1AN0A 1Y33E 4PNZA 4WDQA 2GOYA 5JBQA 1Y4DE 5JY1A 3OCWA 1KI7A 1MN6A 2X19A 4LTMA 1ISHA 1Y6GA 1E1DA 4HXFB 3BB3A 1C1XA 3EHEA 4ZRNA 1CV2A 1HYBA 3MJRA 5IKXA 1GFSA 2LTAA 3JR7A 2AYZA 2WKSA 3D81A 1KH2A 1C1DB 1XSEA 1TRKA 4NMXB 3UJ3X 4IY1A 5EZ5A 1DPFA 3QPDA 5BSUA 2P2DA 5KZMB 4KQ6A 1XD2B 1MQAA 3M0EA 3OU2A 5BSKA 5IYZA 3VKGA 2WZBA 1SBHA 3G8AA 5LA6A 3RKRA 4E5KA 4G0YA 5HJ5A 2BT4A 2VR1A 3OO1A 2CD7A 1N0WA 1ZJ4A 3EGWA 1Q74A 1FX1A 1MTOA 4X00A 5I4KA 4BRSA 5KHLB 1EAMA 2HV9A 2RBKA 4W7IA 3P2KA 4O29A 3GCXA 5CHYA 5BURA 5JZVA 1L7XA 4P3PA 4US8A 4UFPA 4KYUA 4AJ1A 1NJ8A 2J32A 1UXKA 2Q2WA 3LLMA 1HQYE 1QAPA 4R3NA 3W2GA 3KKLA 2MR6A 2OLEA 1NNLA 3ABZA 2OCBA 3G9ZA 4J16C 4K46A 4LK3A 4QDUA 2N9UA 5CT8A 4NU8X 4MVJP 4YROA 1TU4A 1V3TA 3RS7A 4CYMA 4ENUA 4B3XA 4URVR 2CHVA 4WZAA 4HRVA 2VQDA 4RGYA 2HJGA 4LNUA 4ZOLB 1NT2A 2PN1A 4HL6A 3EG9B 2YWJA 2ORED 3KV3O 1KP9A 3B6MA 2JLSA 3QLUA 1XE3A 2WF7A 2H2FA 2GCNA 4ZPJA 5JI2E 2WMOB 1Z2NX 1K7XB 1KMHA 1NNUA 2E18A 2H00A 4UDXX 4F5DA 3T7SA 1KPGA 1A82A 1P5RA 2YWGA 3M6IA 1G60A 3EYYA 4R69A 4DLLA 4QW8A 5AKYA 1K7EB 3CZPA 4TZTA 1XDGA 4GMKA 2ZT7A 4XSGA 1W34A 5CH3A 2Z8XA 5FAXA 3H8SA 4PAGA 3NEAA 3BIFA 5GQSA 4C3VA 3TFOA 1X3SA 4RK7A 1CUWA 1WXGA 2FSVA 2YHIB 4GYKA 4M53A 4Q3LA 4U9HS 3ESAA 4JI0B 1F2DA 5THQA 2GN1A 4A8TA 2H7CA 3KTFA 1JIKA 2ZB3A 1S1MA 5ALXA 4X24A 5B53A 3GLVA 3IBFA 4IJKA 4N39A 4PZLA 4EELA 4PLZA 5EFZA 5KFEA 2Q9BA 3EQ2A 2ZUFA 4F2DA 3HCWA 4JI3B 5L7TA 1T4GA 2EX0A 4V0KA 3LUJA 1KI8A 1DZ3A 1L4EA 3AVOA 1SWWA 4BB5A 3COYA 3C3CA 4NV0A 1TTHA 1E79D 4JI7B 2JJ1A 4R98A 1W1UA 1WPXA 4Y2GA 1RZRA 5CVCA 5A4AA 3ZHRA 2ZSFA 2YUTA 1NYRA 1WB4A 3A6LA 3BQ9A 3V9AA 4INPA 5D3ZA 3HCNA 4IR9A 3ER9A 1TRHA 4FWIB 5HEKA 2OZLB 3V00A 1U5BB 2DLDA 2D5IA 3EF1A 2F17A 1IEWA 3GAMA 3OLYA 3WB9A 2EHJA 1W4RA 4QDJA 3TE7A 3FPEA 2AOXA 4QOFA 4ECQA 1L5SA 2QTHA 3V6JA 1F5NA 1JIQA 1KI6A 3GWZA 5GIPE 4GYWA 2ZCUA 4V0MA 4R2XA 4C29A 3Q3JB 1E2JA 1M75A 3AVPA 4DDKA 1QH1B 1KO7A 2VDMB 4UREA 1MXFA 1JA1A 2OFFA 1MH1A 1Z2EA 4RKYA 1BO6A 3ABQB 3NU1A 4KITB 4BKOA 3PQ7A 4LWQA 3DTVA 1H2EA 2PLAA 2W93A 1LF0A 2CGEA 3LH5A 4RTQA 2VDOB 3C6KA 3G5LA 3U26A 1GU0A 3B2NA 3AJAA 4BATA 3QEKA 3QKSB 4EVIA 1OB2A 1MRSA 3VNRA 1ZG3A 2YV3A 3QX7A 1YKFA 1KUTA 2J6BA 1GQRA 2Q28A 3QMPA 4IDNA 1VLHA 4J9MA 2C5FA 2SKDA 3DYIA 4X1OA 3OJXA 4YJFB 1QDEA 1V8ZA 2VEOA 2HSGA 2OL4A 4L9WA 3GI1A 5HUJA 2E2IA 1LNSA 2EBFX 4OHRA 4C2TA 3ADDA 2B4RO 1T9CA 4O7RA 2QN3A 1LPPA 4CDNA 3C85A 4BN0A 4IMJB 1AZLA 3OM8A 7ABPA 1MJHA 2OXRA 4PS0A 1MABA 3WNDA 3RO7A 3WK8A 3W5CA 1NFQA 5AM4A 4JT9A 4FINA 1GT6A 1XZGA 3ISVA 3UKOA 4C0KA 2YIVX 4BEBA 1WHTB 1Q3TA 3BM5A 4EOGA 3K8YA 1GPMA 1KYWA 2XPCA 1X1DA 3IELA 3CC8A 3QG5A 4M1ZA 2X2EA 3TUIC 2GDJA 2BHRA 5L1IA 2Q8PA 3PGA1 4Q7MB 1KS2A 4G4GA 5GV7A 4TVSA 1DJNA 1SKQA 2CLOB 4JBYA 2FDXA 1NRWA 1HL7A 1U0EA 3SN6A 1MB3A 4IF4A 5JJCA 1XP8A 2AIRA 2X0FA 3WLSA 3X1MA 4EDFA 2PBLA 1VQ6H 3WQBA 3QU9A 1KO1A 2PEYA 3E1SA 4Q3DA 1XMIA 4S04A 1SUWA 3KYBA 1Z4NA 2K2WA 1C3VA 4OGFA 1P0IA 3SDZA 2YL2A 1RRVA 1T0IA 3WY9A 3DW1X 4JFAA 1ZHSA 3DMRA 4L5AA 4A0RA 4B75A 4ZMBA 1S8FA 2OV6A 5JW6A 4XOUA 3E22A 1WMEA 2ZWAA 5K7SA 2Z83A 1J7JA 1QHNA 3BQNB 1YD7A 4C7JA 2Z1NA 4RSMA 1ORRA 2RGNA 2Y77A 2Z9DA 4QU8A 1YI2H 3LPDA 2JBMA 1UBGA 2X0KA 1ST2A 2CV2A 1YZVA 2R9VA 3ELWA 4GPTA 5CYFA 3PIRA 3T0FA 1E2QA 4HYYA 4CL2A 4HUQA 2JDID 1E99A 1PJ8A 3W6ZA 4WL0A 2GPYA 3CCCA 2JHGA 1SYXB 3GFSA 3SBXA 4W5QA 4YGXB 3BQ1A 3DAYA 3EWAA 1NUUA 4KIJA 4H1UA 2PMDA 4O0MA 3O84A 1AHIA 1LLDA 2ZU6A 1TKBA 4H08A 5FTLA 4CEIA 1TUIA 1F2TA 3DFMA 2Q21A 3EQZA 4DSZA 3UVEA 1G3IA 2AGVA 2H06A 3DQZA 2OY0A 2Y27A 2FPPA 3A3YA 3P4YA 5DTMA 2NSHA 3DMNA 2XITA 2OCKA 1N5JA 4J0HA 4HDRA 1FNDA 5BWOA 3CF5J 1EUZA 2XCPA 1XOIA 3EIOA 4R0MA 3C24A 5AVRA 2I4TA 5AVXA 2XZTA 3CUSA 4P6VF 4AXXA 2EJCA 3CGWA 4LF6B 4FKZA 3DVAA 1CR4A 2MIIA 4QWDA 2E37A 4DTIA 2IXGA 1FYXA 2JEJA 3FTQA 3HN2A 3OZAA 1MC1A 2RAFA 5FL7D 3SK0A 2JGRA 1IN1A 3IPXA 3EY4A 4EI7A 2XWBF 3WIUA 1YQEA 2E1PA 2HA3A 3PUIA 2ONJA 1AKQA 1NN5A 1E2HA 1V5IA 1I9CA 4PSKA 3GELA 4WCDA 3F2IA 4AAYA 4H3SA 2GZSA 3W1WA 3VBEA 1FDOA 3WTCA 2QW1A 3EDYA 2HSZA 4G4JA 5CMLA 1MIHA 1XMSA 1WU7A 4NEHB 4EZEA 1BROA 1YS4A 2YH2A 3EGVA 3HR4A 1FMLA 4GVPA 4RKFA 3X1XA 2NO0A 2VT6A 1YR1A 1Z4MA 1GRRA 1P9NA 3ILHA 2ZIWB 3G1UA 1EVIA 1Q11A 3IIMA 3VHQA 4BQSA 3JZDA 4GLFA 2IU3A 2E5LH 2QN2A 3C3KA 2GQRA 3SE7A 3WV5A 1GPWB 3I39X 4RFSA 3EGDB 4YQYA 2HIGA 3Q8PB 2V8BA 3M4ZA 3D5QA 4N7MA 3E1GA 4F45A 5MN4A 3BRSA 4WKBA 2P62A 5IANA 1PJQA 1VSQA 4F8JA 2YRWA 4K9DA 5D6NA 3WMWA 5LQUA 4K0KB 3CQZA 4MW1A 4II7A 1MENA 3P32A 5NULA 1CK4A 2W2LA 1U2EA 2QQ5A 1E3TA 1IOVA 1E7SA 3N40P 2G4LA 2OESA 3H99A 3KZKA 3WISA 1CEYA 1JIHA 3MELA 4QD3A 1YRYE 1NW3A 3W9YA 4UVEA 2VTDA 4GX1A 1CHNA 3H4BA 4C4XA 2IYQA 3SEZA 3TDKA 3W5JA 5IVPA 5M34A 4OHYA 1POWA 3FCEA 2O0JA 3CZ9A 2ERYA 3MMSA 2J41A 4KLNA 2HDOA 5ES4B 2ZYVX 3L6CA 1I2DA 4NNJA 5DTRA 4YY3B 4B3FX 4IXTA 3NWEA 2B4KA 4IXDA 1C41A 2DM6A 3ANTA 3M70A 4FFVA 5J4VA 4D9FA 1I36A 3IP8A 4A91A 1VM6A 1MNAA 5TT0A 2G4CA 2NIPA 3D0OA 4WCFA 5DN6D 4RB3C 4MQ4A 2HCJB 3FCSB 3QKTA 1CUJA 1J2TA 1GRQA 2C5GA 2CFMA 2PLNA 4FMCF 5EKDA 3GDWA 4B47A 5TJHA 4CRWB 3FAHA 4GMFA 1D4ZA 3O4HA 1ZAUA 1PLKA 4NY1A 4OQLA 5ICGA 4RF3A 5EZYF 2COEA 1XD8A 4HH4A 1WIWA 4MV6A 1U3VA 3M6MD 5ANRB 3WDSA 3IRVA 3WGNA 1A1SA 3GTJA 5C3UA 1F51E 1I3NA 3GCDA 5AK3A 4O4IA 3SJCA 2B7CA 1GL3A 1HUQA 4Y6PA 5JISA 1UP7A 2QRPA 3QV2A 4O02B 2HHAA 3OJLA 3OZWA 1MUUA 5IAKA 1JYSA 1KSJA 2J9FB 3ETDA 4K3VA 5F78A 3URMA 4EW6A 1IZZA 1PJ2A 4ND2A 2ZI4A 3M3HA 3EEOA 3LZCA 1ZXIB 3R8XA 1OF1A 5CBPB 3L0OA 1F20A 1TYZA 2EGHA 2LGJA 4GF5A 5L95A 2FFBA 4J16A 3TRJA 2MMCA 4O1IA 1ZZEA 1QAQA 2H48A 2R0QC 1N6PA 1LLQA 3WA6A 2FI1A 4TSRA 1QFYA 1JJAA 3P0EA 3GCGA 5B1HA 2ZB2A 5HBRA 5IXSA 5BVGA 1SG9A 2B92A 3DDHA 1P3Y1 3H2SA 4MGHA 3ZZMA 1E4GT 4RTLA 4UBIA 4CF7A 5KTNA 3KSAC 5IX8A 3KQNA 1J2EA 3P2MA 1FLNA 2VLIA 3ESCA 4B4VA 4RFLA 4HNGA 1FP6A 2CBZA 2XIQA 3TW0A 2ZT5A 4G4IA 5JCXA 1DSSG 4IM7A 1YZHA 4JKYA 4KI7A 3H20A 2C00A 1Z18A 3HA7A 3MJSA 4XVRA 4W9RA 3ZE1B 1DTEA 4CQLB 3V4SA 4H3VA 1Q1ZA 5K2OA 4TKMA 2FG7C 1DTSA 4P82A 3PJDA 4JBWA 5BQ3A 2V55B 1MQ8B 4R40A 5GMOA 5A4JA 3OTOB 3AYZB 5GJCA 4PRLA 3HV0A 2JL1A 3GW8A 3N2GB 1SCUA 2JFOA 1LX6A 4PNHA 2GPAA 4NXNB 1NFFA 2YFHA 4YBZB 3FYUC 2AEFA 1B93A 3UT5A 1B04A 4OK5A 4LMYA 2UUCH 5D51S 3A4YA 2HV8A 4PPFA 2O0MA 2W4IA 4KUEA 2O3QA 1NHWA 3KPYA 3TLGA 4B32A 1K7FB 1JKJB 4WACA 4ARAA 4WY5A 4M8NE 4FZ3A 5IFKA 4G23A 1JHPA 2OHJA 2YS7A 3ZDYB 4A4DA 4O7VA 1ZRNA 4JWTA 1EFTA 4GXTA 4K9PA 1QIIA 4I66A 4AUNA 3WYCA 5IJZA 2VQEH 1UDWA 3QX3A 1GSIA 3VNBA 4EG7A 1EWYA 2OBBA 4PC2A 4XYGA 5JPDA 1N63B 3J7AK 2ZAIA 3G2LA 4L6IA 2VXOA 1E3QA 3PKZA 4C6TA 3MWDA 1ICEA 4C06A 4JX9A 5DXAA 4ES6A 5IWAH 3BFJA 1MU0A 3GZTB 1NJ1A 1GSOA 4YXWD 5ADVA 4E51A 2H5EA 1J2YA 1C7EA 5K51A 1P9LA 5BXYA 3JSAA 4Q3KA 3KVOA 2V1XA 3OHBA 1OVMA 1QGOA 1TYBE 2XVXA 3NHPA 3MQFA 4FD2A 4QXRA 5DF1A 3R76A 3R3JA 1ETHA 2P2ZA 3M9XA 4UBLA 3HK2A 5AOBA 3GXOA 1EX6A 2XW6A 3UWPA 2EZ9A 3FCOA 1U8UA 3V2IA 1BRWA 1DADA 5DNDA 1C7ZA 3HGTA 3P9IA 4DLUA 3ZJ4A 2I2WA 2XSZA 1I7SB 2PUCA 1OBGA 1MIOA 1R18A 9LDTA 1VLLA 4JI1B 3MRSA 3I12A 3BGOS 1ZICA 4GRIA 3GGOA 3N9IA 2O19A 2PBRA 1T6ZA 1G7TA 3ZZUA 4XIJA 4BPRA 2OFOA 1RXCA 2JI6A 5JI3E 1GTJ1 2P4UA 4W7SA 3HVUA 4K9MA 1T0UA 1K92A 4XGNA 3OZFA 3DWIA 1JAZA 3F5DA 2PT9A 3A6FA 4M21A 1GGFA 4FHGA 4HB0A 4O5OA 521PA 1PNVA 4RGQA 2PS1A 3PDUA 1OBFO 1X1AA 1CHDA 1G66A 1FS4A 3NASA 2BMJA 5FTWA 4AMVA 1CSEE 4RTJA 3GFVA 3H84A 3RTXA 4WXHA 3RS5A 1TKCA 1R10A 2DFKB 2ZOSA 1Q5PA 2R7KA 1TQ4A 1M33A 2X8WA 3BHIA 1I2LA 4DJJA 2X22A 4B3HA 1FFUB 3A9CA 1V6SA 2W42A 4QM6A 3FXAA 2I4RA 5LOVB 3SS9X 3AN1A 1D5WA 2H1FA 3H13A 4M9XA 2R79A 3KWMA 4Z9FA 1PJLA 2PUGA 2FSUA 4MOWA 3LQ2A 2BMWA 2RJOA 1T8SA 1TECE 1AY0A 1TK3A 5B4TA 3NHLA 2J7PA 1T4DA 1ZJYA 5T6MA 4OG2A 4HWRA 5IEBA 1CF9A 2SCUA 2ZSAA 4R2WA 5J4LA 1JEQB 4YMUA 5LZ7A 4TZKA 2OCYC 5BW5A 2VS1A 3L8YA 1TAQA 3UWDA 1ZH6A 2W2QA 1PTJA 1U0RA 4A3BG 2XWSA 3MOIA 3UM9A 2F3UA 4G0XA 5DW3A 1OUMA 2WUEA 2BSQA 4L27A 5C35A 4RH3A 4MVYA 1R0ZA 1DT3A 1UMDB 3F8WA 3HC7A 3IAEA 4ESVA 1U9ZA 1W7AA 2QVGA 2XDWA 3FKJA 5C1BA 5ILQA 5LLTA 2VRCD 1L3BA 2VAXA 1KETA 1M2JA 4U3JB 4FFMA 4L9AA 3KQSA 5C46F 3ZKWA 1H1TA 1PGJA 2I62A 2V65A 3KE9A 3D4PA 2ZBQA 1C9YA 2PAAA 3LBAA 2PGLA 3O83A 4MUJA 4BP8A 3B9PA 4ZPXA 5A0FA 1JIXA 4MO2A 5HMLA 3KKNA 1XPUA 1V7ZA 3AR7A 1DOZA 2KHZA 2V3WA 2X5NA 2LZ0A 2C84A 4OD0A 4B35A 1UH5A 1RPZA 4UCRA 2MINB 2QW8A 1N56A 1ZH0A 3DCYA 3IT3A 3LM8A 4HDKB 1R6XA 3DO6A 2X1HA 3WE7A 3CZCA 3TOVA 4ZYLA 5TPWB 3MLEA 4LPSA 2XHEA 4DR1H 1CDEA 1RQ2A 2ISSD 2QPTA 4B34A 4ETIA 3B70A 5FV7A 3O1IC 1WNFA 5CJPA 1VQ9H 3AL0C 1OVGA 2ERCA 1BDJA 3NBAA 1R4ZA 2B9VA 1S8OA 2OWEA 3FVQA 4HG2A 4MRMA 4QEDA 4Z9AA 4ZV7A 3OBIA 1AUQA 1SVUA 3BMCA 5AHOA 1X6VA 2JA1A 3C8HA 3OLCX 2OPHA 2O8CB 1DRUA 1P0CA 1SD1A 3KQTA 1R3DA 1YJQA 3PNSA 1EFRA 1AS2A 2H4YA 5AJZA 4PBSA 4HNAB 3TF5A 5A3SA 2IA6A 1TO2E 1WV1A 2D8AA 3RBDA 1AO3A 3D1JA 1ZUD1 3MJTA 4B44A 4DCMA 1UK7A 3OF2A 1U2RA 4WFAJ 3MJFA 1N5RA 4FR2A 4D0RA 3NATA 1PR1A 3I6BA 3I4NG 4N03A 5IAGA 2XDYA 5FULA 2EGGA 3JQAB 1QJCA 3L77A 3EN0A 3IG0A 1X1OA 1LSOA 2WIDA 5EJGA 4JODA 4N47A 5IRCD 1ZRHA 4IO9J 2NV6A 2DTDA 1E2FA 1WZNA 2WJJA 4EPXA 2X1VA 1YJXA 2AZMA 1CUVA 5DX1A 2WJWA 5HE8A 1NW4A 4LHYA 1HNXH 1RZVA 1E0AA 4K9LA 1DTWA 2DP4E 4L0MA 4PX3A 1Y3BE 4MCAA 4WY2A 4UZEA 2V9PA 4B81A 3MJ4A 1IZYA 1CFZA 2NXEA 5IKPA 1IHUA 1FDVA 4RSHA 1FQOA 1JG2A 3E3MA 3QU4A 1BJRE 1V8BA 4D4JA 2ZB7A 2R1VA 1G20E 3LVBA 2C7RA 3TYXA 3AHGA 4Q34A 3CNHA 1EB9A 5CX4A 4BGUA 5J4HA 1UP6A 1HDGO 2FUNB 1WXXA 1YIAA 2H4FA 4GIBA 3PSAA 3NYIA 2YBEA 2MCTA 4KUHA 5BN4B 1ZCJA 1HYGA 4FGLA 5AUOB 1VPTA 4XKJA 3FYUB 1GTL1 4HMQA 2FZVA 4TMXA 1JU4A 1H2FA 3KKQA 4CE6A 2OPBA 1QVAA 4PYMA 4BQEA 4HYTA 1M8KA 1RVDA 4OMCA 3JAMW 1DB3A 1E61A 2R1TA 3HBNA 3TNLA 1KVUA 2ZSIA 1OFUA 3VYTB 1Q0SA 3M6WA 1W85B 2ZT6A 3LRXA 3NJRA 4JOCA 4HPXB 4NENB 1XRPA 1JUDA 3BIJA 2JLWA 4B85A 3JYQA 3RQIA 5TEWA 5JV5A 4QPPA 5DBOA 1NVMB 4NVRA 4BMXA 2NNWB 1W87A 3V8NA 2NZ2A 4RGVA 1N4AA 1DOHA 1KEKA 4I55B 1ML4A 2PKYX 4LDNA 4UM8B 2YMQA 4ZCIA 2EJTA 3ELUA 3SSNA 2B5WA 1R16A 2VSNA 1GUFA 4A23A 3DXZA 3R3WA 4HDNB 5EWFA 1EHCA 1Y4UA 5B36A 1GADO 1XTSA 2A30A 16PKA 2PRYA 3B3FA 3C3YA 3JATA 1SXJB 4JR2A 4D92A 4E07A 2VTBA 1X3LA 4QDZA 1ORTA 2YS6A 3HRIA 4DYVA 4JMPA 2W9AA 5TJ9A 3R6WA 2FSIA 1E60A 4TTAA 2IVZA 3C3MA 5GIOE 3TQVA 5HGXA 1HURA 4IIJA 1QG2A 3EASA 4JSYA 4YAOA 2AYXA 3Q6IA 4FFOA 4FM9A 1LRKA 3DSRA 3HFJA 3IXMA 4P4LA 5BWNA 3EH1A 5LMNH 2YXBA 1NVFA 5KG2A 1E1NA 1GG8A 3WGHA 4HYKA 1JR4A 1IATA 1U0FA 2FZ5A 2OXFA 2WUGA 4PDBA 2X13A 4I6GA 4MP8A 1DWQA 5GJVC 1CS0B 1D2NA 2JHAA 1U63A 4JUDX 1JLSA 1NVVR 1OZAA 2HMYB 1KARA 2QSJA 2VYQA 1JE0A 5IDYA 3UIEA 4ER5A 2AKAB 4F06A 4D0GA 4ZYUA 3V6KA 5HZHA 3OQHA 4KYTA 3ZJYA 4GQAA 4P33A 2JKVA 1M6VA 1E3IA 2X6TA 5LMZA 1KC7A 3ZY6A 1DHRA 1J1ZA 3EQ6A 3FOCA 1SVKA 4JP8A 4RMHA 2G7ZA 4QIWA 5LD2C 4F6CA 1R4AA 1VKZA 3RVJA 4PVDA 5EHNA 1YGYA 2PXCA 4R1QA 1TLFA 1FNSA 1ZD1A 2AR7A 2NUPA 4G1BA 1Y0BA 2QG4A 2Z5FA 3T95A 4BU1A 1JRLA 3GBSA 4DV6H 5L40A 5CB8A 5JECA 3MJCA 4P22A 4BZPA 1JTVA 1M54A 1TW3A 4DSTA 5B2EA 4FGUA 4D4HA 3H9CA 1LQUA 1QZZA 2O0HA 2BEVA 4ZJZA 1BFUA 1N2OA 2V9ZA 1EUCA 3I4CA 1FJGB 1SXGA 1UWVA 1L0BA 2WTBA 4G9EA 4G07A 1KAMA 5L9XA 3D2BA 4KVFA 1NPDA 4BECA 4CZ2A 1GZDA 3GH1A 1Z7BA 3Q12A 4MRPA 1R6TA 1VP9A 2PMCA 3O7MA 3L07A 4HAYA 4CMEA 4I4NA 1CKMA 1I3QA 2EATA 1SOUA 2JFFA 1U98A 1UFQA 3BSSA 4AZWA 3AESB 1R6UA 1XZIA 2R2GA 2C03A 1F1JA 1ISSA 1PW7A 2EC5A 1RYMA 4TVIA 2GHIA 2X40A 1EE9A 3EDQA 3G68A 3M81A 3N7AA 3P4UA 4BB6A 5AHRA 2QX8A 1WXQA 2WC1A 2IY7A 3OP1A 3HPQA 4I1PA 2NQ8A 4B7UA 5LQDA 1Z5NA 4IJWA 1UZLA 2QVCA 5FTJA 3T5PA 2HU2A 5E1OA 4H16A 4NPHA 4UMVA 3UH0A 4KR6A 2F1RA 1IE3A 1DDIA 1G1AA 1OZHA 2WYIA 3AM3A 4AN1A 2X9VA 4QUHA 3QPAA 5FWYB 3FG9A 3JPWA 5CT5A 4HJRA 3VRHA 3RJ0A 4J29A 1OH8A 2AYYA 4TM7A 1FNBA 5KYUB 2CW7A 3PL5A 4LXGA 4OQFA 1G16A 2QTVA 1ZN7A 3IBSA 1NU8A 3B9RA 2HGZA 2D2EA 4KZPA 5DM60 5JVLA 1BVHA 5LOVF 3TJMA 1Z62A 2XCQA 1ZHOA 3CF0A 3N8NA 2XUHA 4Q16A 3H6KA 1P7CA 3DPSA 4YHBA 3RTAA 3WP0A 1EUDB 3R5SA 3ZWVA 4BDTA 3RHTA 3BKXA 4DR7H 2W9CB 2CF5A 2NTEA 4J9UE 5JZBA 2G40A 3OQIB 5JHHB 1TAUA 1LDEA 1PZXA 2WT9A 1LLUA 3OZTA 4BNKA 4HC4A 2VCYA 3K9GA 1F5SA 4H35A 4DHWA 2WWYA 3DDNA 3EXEB 3M49A 1EP1B 4XFDA 1BHJA 1YJ5A 3ZYZA 4C89A 3RTBA 1IZ7A 4RE6A 3ABSB 4QBTA 3SLKA 4C0XA 1RWVA 2B8NA 13PKA 1AN9A 1BW9A 5IC4A 5JZ9A 2Y66A 3ES9A 4LJRA 4ZYVA 1S0NA 4PW0A 5C4MA 4ZHQF 1GQQA 1OTHA 3W90A 4K6OA 1VYUA 1Z37A 5FP0A 2XZLA 2H2AA 1UM8A 2CFRA 2Z4TA 1HDIA 2ZRAA 3PC7A 3SIPA 3GJ0A 3BGSA 3HJHA 1J9EA 3EMKA 2CVPA 2X0NA 5CVJA 3WJ1A 4J0IA 3AEXA 1HYEA 4J0QA 3OZVA 4BWVA 2RI6A 2XB4A 1X7XB 4JITA 2R4UA 2VYVA 1G8MA 2NP7A 4HWGA 2PFKA 3ZY2A 2AB0A 3IIJA 3LYLA 1U7OA 1CY0A 3EVNA 3HBFA 3T7DA 2Z56A 3CY6A 3A28A 4RWZA 3ZV4A 1GTSA 2CHUA 3DTFA 3MCWA 4LYFA 5DGTA 3K0EA 2QD2A 2ZR0A 1P77A 3N76A 3RK0A 4YEKA 1TCBA 1FL9A 2QNBA 2A2ZA 4TXJA 1LXCA 3SQNA 2A3RA 1OYWA 3SF0A 2UVWA 4TLDA 1DQYA 5DYIA 4XEUA 4YMLA 4YECA 4ECSA 5CVUA 3WIBA 1G8JA 4I7HA 3T5HA 4CODB 4W82A 1J2RA 3N0RA 2G70A 1P9OA 1FFGA 4YREA 5JMWA 2G25A 2QTZA 4TWBA 1SPBS 3O0DA 2PJRA 3FY4A 2PUTA 1RI1A 2VH1A 3MWMA 2P91A 3KYCB 3RB8A 3K0AB 3BA9A 1PV2A 1MTZA 3IQWA 4JUAA 4MH0R 5DLEA 3M5WA 4BNUA 5BPFA 4BUCA 2B3TA 1WOMA 1V16B 2CVOA 2FW7A 2OBNA 5DK4A 4QOJA 5E6SA 4RLHA 5AYVA 4BV9A 3IULA 5DNVA 4OAOA 3BKWA 2NYUA 1IXZA 4XQEA 1G5TA 1RCFA 1DBRA 1P18A 4URHA 4D9GA 3HU1A 2C5SA 1YVRA 3RBVA 1S2IA 1KY5A 1GDHA 3NVZC 3DNPA 1R6DA 3H1EA 2ANCA 2REXB 4M86A 3GP8A 1PD1A 4M1SA 1NQOA 2C83A 3ZU4A 1BDBA 1LUAA 3V6LA 3M2PA 4X85A 4AS1A 1NR1A 2JEGA 1E2PA 1KFBB 2QL7A 2ZJOA 1Y1VG 3HLTA 3CPEA 4KIUA 4Q7JB 4RMIA 1VQ8H 1DQZA 1X39A 3LUGA 5GINE 3FMPB 5ALLA 1WBBA 3W2IA 2FPKA 4DCUA 1L4GA 1MT3A 1T9BA 1S2MA 2XYPA 4XWTA 4BO3A 2ORIA 3PS9A 4I99A 3IOBA 4JLUA 4EGQA 2DQKA 3LQ4A 5HTKA 4I3FA 5EHZA 1EAYA 1N8RJ 4CMGA 4O7NA 1CJTC 1HPLA 3GUZA 2CZGA 1SA0B 1FYDA 3O8NA 4IV8A 4PSDA 4G2NA 4EQZA 1T0HB 1IFXA 1ZI9A 3JYLA 3DBHB 3MZ0A 2C28A 1Z06A 2NXNA 3IDAA 2P79A 3N1UA 5EJIA 5L9AA 1NDHA 3J80A 3VO8A 4MLZA 1Q7GA 3LNCA 1RRGA 4H7PA 4J3FA 3OPVA 4JVMA 2ZM6B 4EG0A 2JEIA 1Z0JA 3FWZA 5ALHA 1BE0A 4F97A 1KTVA 4YRSA 1TM1E 3NGMA 1V8PA 4PSAA 4QPZA 2IS6A 2AG1A 3FMOB 4EJSB 2OKGA 4F2WA 2PUDA 1G20B 4MUKA 2WD7A 3MAAC 1JQJC 2XVMA 3A27A 1YC2A 2EJBA 1UWLA 4Y9SA 1LBSA 1PUJA 1R8YA 3IP9A 4HDSB 4JJGA 3WNVA 5FH9A 5K0FA 5KG0A 4V0ME 4NE7A 3ZHYA 3EPJA 5KU7A 1QKKA 2AN9A 1UPAA 4MKGA 2VXCA 2XIGA 4N18A 3HO1A 1GRNA 2FN3A 4NV1A 3OHMA 4WA7A 5EMLA 3ZVNA 3KDSE 2HCFA 4GL4A 4IRCA 1JEOA 4A5OA 4O5AA 4UCQA 3CURA 2LCFA 4UCUA 1RRFA 1C9MA 2WHQA 4YAJB 2VDUE 1ZR2A 2RDMA 2I6SA 4PWYA 1FRQA 1BXGB 4QOEA 4BX3A 4BFLA 4GZ3A 4DIOA 1G3UA 3NAZA 4XWKA 1ZN8A 2R7NA 1R9TA 4O2RA 3CSWA 5KU1A 1S8NA 5IULC 4U2CA 2GZDA 2VKQA 1A4IA 1ZMBA 2A0KA 3ROEA 5JSQA 3AP1A 3JQ7A 2FPOA 1WCXA 1IYDA 4NBKA 1Z5WA 4IQFA 5ENDA 4WFNJ 4EECA 3E03A 1TFUA 4GO1A 2WYWA 2PG3A 4UZSA 2PXAA 1T2AA 1BMFA 1J25A 1RXEA 5GWXA 3BDIA 1JDJA 2I2FA 1LDYA 2W37A 4ECZA 4O2AB 3HZHA 4X7MA 2VAMA 4USAA 2DHRA 5I51A 2HBZA 1YDMA 4HEHA 4OYYA 1ZW1A 2AUTA 4Z0NA 4EFEA 1B2LA 2G5TA 3FR7A 3QF4B 1EA5A 3VDQA 3A14A 4X62B 2JHFA 1GL9B 5K3CA 1XB2A 2C4TA 1T4CA 3EK2A 1GD1O 1KF0A 2BL4A 4GR5A 4LY9A 5DBFA 5EGNA 1EFRD 1NW6A 3MVEA 5TGDA 3S99A 4AN4A 1PZHA 4BLTA 6REQB 5JJBA 2GAJA 2YW9A 3IE0A 3M9NB 4PN7A 4DIEA 2J30A 2YZGA 3JQBA 3C14C 2CXPA 3VVCA 1NXXA 3AMZA 2RJNA 3QG1A 4NPAA 3CNQS 5I4IA 1S7CA 2JLAA 2MYUA 5AK5A 2B36A 3OW2H 2I4NA 4AKSA 3ESRA 3G5TA 5TF4A 4DN6A 3NGXA 5AKZA 1YV9A 1Y5IA 2G1KA 1QK5A 2JGDB 2R6JA 2WNHA 4NJEB 2L2QA 4FBMA 2PSSA 1P39A 4TQSA 3ZHCA 1F2TB 3B5EA 3FUUA 3QUCA 5KFAA 1SMKA 3A3OA 4HOYA 4FEYA 4C22A 5IF3A 2C0QA 4Q0YA 4ZA2A 3REGA 5I7HA 3QLVA 1Z5ZA 1THZA 3FSEA 4LVUA 1L7PA 4OJNA 3DCJA 1T6XA 2JH9A 4GZ5A 3TGWA 4ARZB 3BHMA 2WJ6A 5WRFA 2HK6A 3A31A 3BMNB 3DOEA 4FS1A 3BCSA 4P36A 1Q3KA 2Z5GA 4CT0A 4Q45A 1MDFA 2BJVA 4D0LB 2QD4A 3EULA 4H17A 1FDSA 4MK4A 1YO6A 3TLXA 2V59A 2HA7A 2FLVA 2ZTLA 2P78A 2ZDQA 2YVUA 3HCPA 3Q85A 4B4WA 1XTJA 1T2CA 4EO7A 6YASA 5IDXA 2WTFA 3P97A 1J06A 4H0CA 5FO0A 3A7DA 5MN6A 5H9VA 2P9HA 3MUNA 2WQ6A 2P5YA 1TA9A 5E6RA 5EESA 1S03G 4IO1A 1JPUA 4JYZA 1AO0A 4F86A 4OYHA 2O2SA 1P45A 3EOAI 5DVZA 1FRVA 1BXRA 4KGZA 2RMKA 4EUSA 3A9TA 3AY3A 5A1TA 2COIA 1CETA 2QHXA 3JYNA 4OPMA 1YI1A 4XQ0A 5EMHA 5P21A 3R0ZA 1CZNA 1WE2A 1XL0A 2C57A 2O2YA 2VIIA 3FTCA 4AMBA 5EP1A 5DX0A 2YYYA 3LXMA 1JZTA 1WW2A 3HH8A 4M8LA 1U8EA 4NNPA 5CIWA 3IMEA 4A6DA 1W19A 5DLFA 2GRAA 4Q48A 5B5SA 1HT1E 3QITA 5TF0A 4OU5A 1QIHA 3PO3G 1EK6A 2DRIA 4A0FA 1JGTA 1MVNA 3THSA 4HMOA 5DTJA 1PVOA 5CFRA 3A6GA 1CBUA 1W25A 1SD5A 4ECRA 4PYJA 1JAYA 2VQ3A 2ASEA 3SR0A 3DM5A 1TK2A 4KQXA 1ZS9A 4TKVB 2BM0A 3WGYA 2WAOA 4LXUA 2ACEA 3WGKA 5FBLB 2G07A 3PK0A 2Y2VA 3CEHA 5KMGB 5DM70 2RKBA 3L4BA 4A6PA 1WULS 1GAWA 3H65A 1CUSA 1CUGA 1JALA 1UIRA 3CRMA 2E4XA 4NCNA 3ZPXA 1W581 5BN5A 4GA4A 2P9TA 5BV7A 4C7YA 3FSJX 4R3UC 4QQFA 3G6EH 3M2TA 4G0NA 5HFJA 2XH8A 5BWXA 3K9LA 5E3JA 4BFUA 4YMVA 3VDNB 1PUXA 2YWRA 3R2JA 1QORA 3OE7D 5G0WA 5IYZF 1VIDA 4B9AA 1H66A 2GXAA 4BGDA 1G2PA 3WWHA 2A9OA 3U81A 4LBVA 1IHOA 2VF2A 3GB9A 2ZRMA 2FU5C 3OEED 4ENVA 3ULKA 4R7GA 1R88A 3LS2A 4A6XA 2LPMA 4XDGA 2HH9A 3K3VA 1SELA 1WZUA 4DC9A 1FMTA 1G3QA 3KUDA 3E8XA 3P45A 1ANKA 3C0KA 4OAPA 1MQ9A 1SEVA 4TWAA 4FYKA 2MU1A 4JQCA 1I1LA 3G0DA 3LAWA 4TKUA 4I46A 1K1QA 4OQNA 3Q1LA 1LI5A 2ZJ4A 4LOAA 1NU6A 3R1IA 1ZJZA 4LFCB 3RYHB 3SM9A 4A10A 1V4NA 2UYHA 5A0VA 5IS2A 4OLBA 3PNLA 2C9YA 2QZ9A 4XVQA 1O9HA 4EI2A 4ZI3A 3TRDA 4IDBA 4V0OA 3PWSA 4OQEA 1KOJA 2X4GA 2GBGA 3EA4A 3IHWA 3PNVA 1QP0A 3WHLA 1Y1LA 3VO1A 4DR4B 5COAA 1MLDA 2G72A 5ALUA 4LF8B 1KHHA 1E3EA 4UEJA 5JEEA 2MJLA 2HRBA 5EWGA 2M6SA 1WUTA 3CKLA 4YP0A 1QK3A 2C5AA 3UJCA 1L1RA 1ZM2A 4Z7OB 4ECVA 1EJ2A 5A9RA 1KQPA 2HBYA 2ID4A 4DRYA 2ZETA 1M1ZA 1NW9B 2MSLA 4JXXA 5CJJA 4ZU3A 4DG5A 4FDVA 5DMHA 4B3SH 3ILYA 4J2HA 3NUQA 1ONSA 3U13A 3QFCA 1K7CA 1C7JA 3MTGA 5G0TA 5AVYA 1JJFA 1HFWA 3KXDA 4LC9A 3OSPA 4IFBA 3RT9A 3AF3A 5FA5A 1J0BA 1QYWA 3IXLA 3H19A 3B9QA 5HG0A 3U7QA 1SZPA 4FE2A 3UQYS 4KKXB 1Z0AA 4OXQA 5BWTA 2DPXA 4BAUA 1UDRA 3V46A 1FXUA 4N5HX 5L3SA 5EP2A 4DM4A 2BTQB 3HJRA 3MTIA 9ABPA 5HW0A 2G0TA 4KOEC 4U7DA 5ALOA 3CMEH 4GOJA 1NA5A 3E4DA 3PGLA 5F64A 3RC2A 3ZG6A 1Z2PX 4INZA 4ER7A 4O4LB 1OGIA 4J0FA 3H9UA 1NI5A 1A27A 1T0JB 4FLFA 5KBYA 3CJTA 2EQBA 4E2XA 4FFNA 3R0XA 1Q0QA 3KXPA 3Q7QA 4NX2A 3S2FA 4O7ZA 1SOMA 2HT1A 4HBGA 4FX5A 4F8EA 2V9CA 2ILVA 1XQVA 3AXSA 4S2EA 5EMKA 4AK9A 1GZ4A 1QTIA 4RX1A 1N2XA 1Z45A 2XMRA 3PLNA 4EG4A 2YN0A 4I5DA 4KE6A 4JLPA 3H3VH 2JAXA 3EGDA 4J4TA 3GGGA 4EMUA 3VDMA 1TJ3A 2QE7A 2WU4A 4M0PA 3ZU6A 1QV6A 3HABA 3ABIA 1TJPB 4ZKDA 1C2TA 1LPNA 3IEIA 3VJMA 3ZDRA 3IYLW 5G41A 4HS4A 3UENA 2Q3MA 4C6TB 8GPBA 2V7UA 3OURA 3WADA 2VTBB 1XZBA 1PTKA 2O0KA 4I1RA 1TM4E 4XDYA 4KCGA 5HS6A 3ZQJA 1RHMA 4QDOA 4BPBA 2B0CA 1QQ6A 3AERB 1GYPA 5DQHA 4EEKA 2VJQA 1OI7A 5BOSA 3Q3VA 1Y69K 3ZBQA 1WXEA 3EAQA 4XUEA 4QXMA 4BAGA 2YYSA 3DBRB 4TRNA 1U6KA 2ODTX 2AOUB 5T4EA 2WV9A 3CLUD 1B0ZA 5B1IA 4M22A 1S4QA 4Q1EA 2GRJA 2B2CA 2KW5A 3GJQA 4IJUA 1ET0A 1YZLA 4J49A 5J1SB 3T3OA 3P0HA 3GHYA 2CY0A 4HY3A 4Q4HA 3KIPA 3QVXA 4MUGA 1QONA 4WBNB 1ULAA 3MTBA 3CT6A 3KEFA 2P65A 1VQ1A 1G9TA 5E8RA 3AJEA 3O47A 5KHAA 4B79A 5KKNB 1BSVA 3GIJA 4MS4A 4H3HB 5C32A 4J2TA 1RAEA 3EBPA 4DF3A 4IUCS 1Y8AA 1XKLA 3AP3A 3EZNA 5C7OO 1MW8X 1SURA 3WWZA 5ELXA 3PQ5A 1ULUA 3SBEA 3OFNA 2LR0A 3KRTA 1ORVA 3D3QA 5CX1A 4OF4A 2ZR8A 4RU1A 1ZA2A 3THOA 1YRQA 2CCGA 3D4OA 4IAOA 5SYNA 5JNVA 1YHQH 1IJBA 2EWVA 4X3OA 4GMXA 5H81A 4DPMA 2IQIA 4M9UA 3UKDA 3T7JA 5A2QW 3EVEA 2NUBA 3G5UA 4H59A 3F9CA 2LKDA 4HGRA 3RGZA 2GK3A 3WGTA 1DXHA 3T1HH 3S0JA 4C21A 1T29A 4ZO6A 3O03A 3WRYA 3CEAA 1NC1A 1EB8A 4IPTA 4DQUA 1PLLA 4FE4A 4QSMA 4KSCA 3UV3A 3UH1A 2BI4A 2AWOA 4LXYA 4RVNA 4I19A 4TV9B 2F43A 4NJMB 3WKEA 2BGWA 5LYYA 1X86B 2H5JA 5KFYA 4MPTA 2EQ5A 1IOZA 4CFZA 4QWCA 4M54A 1P0MA 2DT8A 1QVWA 4KN5A 5J59A 2KMLA 3EJ6A 3BXZA 1U80A 3PWTA 1JEJA 2W8KA 3AKCA 1FKAH 1SFRA 3OT1B 3SYLA 3ZBTA 3IEMA 3C7CB 3EJWA 2GUGA 5FWYA 3OH8A 2I6UA 3T3DA 3LJKA 1LPMA 4FU0A 4YT2A 3UZBA 2VTEA 3AR5A 4A3CG 2HU5A 4GPAA 1SZJG 3PJEA 3LCUA 5EXPA 3HDVA 4X71A 1CUIA 3OT5A 5GADN 2P27A 1GGHA 4IXNA 5K4GA 2IZ5A 3R3UA 4ID3A 4P84A 3HS3A 5CR9A 4A73A 1IMOA 1PD0A 3O4FA 2CL7X 1L8LA 2P2CA 4ECYA 1D6MA 1E63A 1ECPA 1RLTA 3CEPB 4HP8A 4I8IA 1WMDA 4LZLA 1OAOA 1KK3A 1PSDA 4J1TC 2E1RA 5EWEA 1NJ2A 4JNKA 2XMZA 2REQA 2E9SA 4FFBA 4YONB 2YOFA 5EWMB 4DJDC 2NX2A 1U2DC 3NORA 3HGMA 2WWHA 3KYJB 2IK8A 4XH9B 5H59A 1AKYA 1K88A 4JQSA 2JVIA 2BDTA 4OXYA 5DT2A 3U6KA 1KOGA 4YEDA 2C4UA 2PX5A 2JBAA 2YJ4A 2QY6A 3F90A 2XCIA 3Q7EA 3TMYA 1FNMA 4PFJA 5HUQA 2UZ3A 3FW1A 4DJFC 2IPNA 3GNNA 1WR8A 5JLAA 3RH0A 2BTEA 5KVQA 5IC6A 1RMYA 4KH1A 2PS0A 2XF2A 3ED5A 4J0JA 3ZHTA 4DUZB 1Q1NA 4TT3A 4ZI7F 2PZ8A 3REQA 3B36A 2EW2A 4JY7A 4DCNA 1QO0A 1BH6A 3UMVA 1UWCA 3Q72A 5GZ1A 1KZ6A 3OM1A 1XNQB 5DYNA 2PKXA 4DY4A 3I2JA 4TUYF 4EHLA 3KUCA 1OZGA 2B8WA 2IIQA 3U3KA 1OLUB 1E3JA 2JFVA 5SZJA 3TQ1A 1EZ4A 1KYTA 5ILOA 4LC1A 1UKYA 3EXFB 3HDTA 4TV9A 5I8PA 1FQJA 2EL7A 1VA4A 1YQGA 2BEWB 2FFJA 5AI5A 1N4DA 5KTKA 2YWFA 2DE0X 1KEPA 1WZIA 2HI0A 4Q0MA 2PUEA 3IVMA 4FNGA 3IVCA 2GCOB 2HPVA 3KZOA 3M82A 4HDNA 3RAXA 2QPOA 3IEKA 4M1WA 4EKNB 1IY1A 5JVDF 3S2ZA 1FZQA 3QEOA 3N59A 3OT1A 1UBMS 4U02A 3X44A 3ZZ1A 3DZBA 3QNUA 1R0LA 2QU8A 4RK4A 2P40A 3C3AA 3EUB4 3OJOA 5LU9A 5HNEA 2YOHA 1KEWA 4R5HA 1SRQA 3IP6A 1IJKA 4Q21A 4WCVA 1HZJA 4OQ4A 1QOQB 4PXAA 4MEAA 3T52A 3TN7A 1ZHQA 4RB0A 1NJFA 2HQBA 2WIFA 1MGPA 2ZE6A 4WBSA 5ILGA 3ROMA 3TW6A 4JR1A 4MVJD 1OFIA 2P30A 5TLSA 6ADHA 1Z4IA 3WYFA 1MB2A 3CUVA 4XYMB 1SU7A 4U9UA 3AWIA 3OOYA 1VE1A 3C6BA 3SS7X 4MPPA 1BWPA 5HULA 1U7WA 4U39A 2NW6A 2REQB 1C29B 2FH5B 3G2HA 5DGBA 3WVNA 2CCJA 5DNYB 4GBGA 2GCGA 2FTKE 3MF4A 2WE6A 1GU7A 1S1CA 4H0FA 4TSFD 1TL7C 1KPIA 2P75A 3EEQA 5HDQA 4TLAA 4B87A 2PKCA 2GCEA 4L9RA 3T1YH 2RI1A 1KI4A 1ZPDA 2PMFA 1F9AA 2X3FA 2J0EA 4I8XA 4IHKA 3RF6A 3SAJA 3SZ3A 3EQ8A 1IPFA 2B4YA 3SI8A 3UFBA 1P4GA 3EPGA 5IJXA 2WINI 1M90J 2Q5LA 2HEIA 1Y98A 2COKA 1Y1SA 5HS4A 2HSWA 3FB4A 4LQ4A 5D5QA 1EG2A 4ZV9A 3QVUA 3GTQA 3DBHA 4PSUA 2YZMA 3PFHA 1U0BB 3K9QO 1L8XA 2CZCA 4HUQB 3SKYA 4CIBA 3I30X 3NWBA 3WKDA 1PS9A 1GGVA 2QA4H 3UJHA 3PCXA 4KL8S 4TV8B 3RUDA 3BE5A 3N74A 4A2PA 4AYBA 3WAJA 5T3UA 1Q91A 2FCAA 2HLPA 3G2QA 4P83A 4QBGB 1V16A 1WW8A 3S4YA 2R8KA 5KWIA 2SBTA 3MSCA 4O86A 4N65A 2C9OA 2KB0A 3TB6A 3PEEA 4RABA 4J76A 5CB0A 4GE0A 5BYAA 3CLSD 4WNAA 1N5XA 1FC0A 3IKJA 2O2XA 3KLMX 3L9XA 1TPYA 3I1YA 3IDFA 2VP3A 2NSLA 3N75A 4M8SA 3JZAA 1Q0UA 1UT5A 4O4HB 1P4JA 4M1QA 1MAUA 3QM1A 4R9SA 4V3CA 4ZVSA 5CBKA 1V1MA 4DA9A 3VNVA 5JZMA 3KQVA 1TO1E 3CTMA 1I3MA 2QRMA 5M2QA 3PA8A 3UJDA 5KNDA 4OH1A 3K1AB 4IDEA 5CT6A 1R0WA 3KB2A 3H7IA 4E31A 5IAOA 2QTVB 3SNOA 3FWNA 4LECA 1XKQA 3ANSA 5KYWB 3GLGA 2QYOA 3FWPA 3IBTA 1R37A 4S1OA 4FT4A 1GNVA 4M83A 1BVUA 1MHPA 3LBIA 2FZEA 4KO8A 3NAQA 4REOA 1VSBA 1F8XA 3DUWA 1I9GA 3IPRA 4R7ZA 4Y0NA 3M1YA 2KQUA 4AG6A 1KZHA 4RJJA 3WI7A 4TMVA 4C05A 2VF7A 4Q1AA 1NN0A 4AN0A 1RKBA 1XFAA 2V58A 3FGNA 3HB0A 3R24A 4RIHA 5CPBA 2PKEA 3RRXA 4GL2A 4DMFA 3WSVA 3DB1A 4UUPA 3V9PA 3ZQ4A 1BE1A 3K71B 1VKNA 5C51B 1BDHA 2AQIA 1T3NA 4MCIA 221PA 1TC1A 3BWEA 3DZIA 3KAQA 2QK4A 4CL3A 5AJHA 1T3HA 3HWX1 4KXXA 2XTZA 1IXRC 3SEFA 4PAMA 3RIZA 1X7GA 1PJ3A 1P2FA 1EEHA 1Y5RA 2RGGA 2XNJA 6CHYA 3UMCA 4YYZA 5A5FA 1S10A 5D1OB 2C1ZA 4HLQB 3T94A 2C54A 1TOAA 2IY8A 2H54A 3BWVA 4CG2A 3M8KA 3NIGB 4R8LA 2DAPA 5I4CA 1SB9A 1K63A 1RHRA 3EZ9A 1D4FA 2BR4A 1DAIA 2YC4C 1RI5A 1SIOA 4E1AA 2BH9A 4KYIB 2XCSB 2EWMA 4ZU1X 4HWSA 5FUBA 5G53C 2Q41A 4F12A 2XQKA 3I6IA 3RKUA 1ZBDA 3DTVB 1KTAA 2PUJA 3H6GA 3LPLA 2ORYA 4FP9A 4LISA 2DUUA 5I45A 5IT0A 5EZ6B 2J6HA 4AYXA 1GZSA 4UCOA 4XGIA 3KWLA 1LK5A 4DANA 1A04A 1UJ4A 2CDAA 2MT9A 2GXQA 2F6RA 3FHCB 4K28A 4URUR 2VHJA 4XJVA 4B6PA 3KX2A 3OQBA 4BBPA 1F0PA 3TTUA 2OG2A 3SGLA 2XRYA 1XI2A 4ZVRA 4R01A 1TQ8A 3LDUA 2WSIA 4D6PA 5DM6J 2C2ZA 5CXUA 3A05A 2B35A 2NO5A 2PX8A 3ZW9A 1HEIA 4TS1A 4A8JB 2GEBA 3AUYA 3C15C 4KV7A 4N8SA 1ZNYA 4TS9A 1FOEB 1RMQA 4RJ2A 4CMBA 1ZCBA 4G0ZA 4TMWA 4Q4CA 2P2GA 4JX8A 2VP5A 3FVWA 2PQ6A 4RF2A 1G38A 1AGYA 4PTLA 4TTJA 1ORIA 1SU6A 2Y6VA 4I1UA 3GEPA 3MT9A 3JVVA 1W1IA 1PJBA 4XARA 3W5DA 2X14A 4I1SA 4FSDA 2CLLB 4NMMA 4RW0A 1EFPA 4C30A 3WL5A 2QZSA 4D98A 1Z63A 2XA1A 3JVDA 1SKUA 2IBTA 1AXGA 1YNOA 1EVKA 2WFAA 3JATB 4O7WA 1O58A 2WG0A 1N6OA 1VPLA 1GVNB 2FFHA 2XNKA 5FQOA 4WSOA 1N2EA 5ALKA 1J99A 1EGHA 2QAGA 3K0FA 1JG3A 4RPHA 3QLUC 2CD9A 5CEEA 3D1VA 4XEHA 3IMFA 1F4VA 3WBJA 1U2QA 4EUFA 2FN8A 2FV8A 1NNSA 1S89A 3TQHA 4GLXA 1NNEA 4I5EA 3LFTA 2QTBA 3C7AA 4GA5A 4QG7A 4HX9A 4OV6B 2ZIGA 3VSEA 1NE2A 4K05A 4YRNA 5L3QB 4GQIA 2IX3A 3KHGA 4J9RA 3O74A 3G13A 3DEHA 3WB2A 3AUKA 2C7GA 3OZCA 2F55A 2W7TA 5DEOA 5EMJA 2JGKA 3ZZ0A 3IQGX 1N0UA 3TH5A 3W8FA 4IIFA 3PRJA 2OLSA 2QX9A 3H9EO 3LA6A 4X94A 1MO2A 5CK5A 5ESDA 5K3SA 2REOA 1SBNE 4R2MA 1T1SA 1LB1B 3ZU3A 3IRUA 4HS9A 1DELA 5EAIA 1EWRA 2W6OA 1GPJA 4LFBB 2LDBA 3F73A 2PL3A 4P2BA 4TXLA 4X54A 4YB8A 1NWCA 4JT4A 3JQ9A 4CFYA 4DM7A 3KXYT 1J0EA 2GYYA 4MR8A 2I4IA 1Y1PA 4UUMA 1EWTA 4PFQA 5GONA 3TZEA 5JVHJ 4YO8A 5F5NA 1Q86J 3OKAA 2RHHA 4OI2A 2WF8A 3PQCA 3INGA 2UYOA 4U63A 5TXGA 5L4NA 3EC2A 1YS1X 4FOPA 3F49S 4OY3A 4Y6SA 2W98A 1SQ6A 2ID7A 2O1XA 3H5TA 3FPKA 3C41J 4OA8A 3V48A 4RM3A 1N33B 1SEIA 4UMFA 4K87A 3B1YA 2D8MA 5AM5A 2YY5A 2EFHB 2HU8A 2BFBA 2V96A 3AEUB 5CRIA 2CK3D 3PDIA 2XT6A 2X76A 4N6NA 2H1VA 1N5DA 5D86A 4F21A 1R64A 1CYDA 2QNRA 1I10A 1HQCA 1YUMA 3IVXA 4ZO7A 1G8FA 2J5XA 1AUVA 1ISMA 1OXUA 1OX4B 1T4MA 2CMHA 3Q10A 4QBHA 1K6JA 2PH3A 2CLFB 5FLEX 5HIKA 1F8GA 3QLTA 1TAGA 2QL6A 4M1EA 5JCOA 1JJ2H 1BX3A 3IURA 3USZA 3DMPA 1N62B 1RYDA 3N2ZB 4JOSA 1RAAA 2AX3A 4RK5A 4RMJA 4KQEA 4WMLA 4MW5A 3W2EA 1DWPA 3ESXA 3U9LA 3WNCA 2G4VA 4D9MA 1DDGA 2OVFA 2B1RA 5JATA 5IYDG 3FUVA 2NV0A 2ZJ6A 4JHLA 4F46A 3PDHA 3QJYA 4ZREA 4DUPA 1R8JA 1T2FA 1DX9A 2H4XA 3RF2A 2LD4A 5IYCG 4QUAA 3UXEA 2UVRA 1QRRA 1T91A 2PU5A 4WY8A 2B83A 1G7SA 4I1IA 4IBOA 4HAXA 2QRHA 2QTAA 2Y1DA 1FB5A 3GBVA 5FLKA 1T9KA 1XTIA 3DLIA 1CZOA 1N8KA 3AUAA 3OY7A 2GGSA 1P8AA 1R9JA 2C42A 1PLJA 1PR2A 4S0XA 3OVMA 4WZ6A 1JFVA 3MHPA 1NRIA 1O5TA 5KVVA 2BV3A 4GI5A 5BN4A 3EX7C 1RI2A 5C1PA 1Y3HA 1NXTA 4J7XA 3T4XA 2QMOA 4MUHA 3P9YA 1N3YA 1K5DA 1YZUA 2J08A 4K6GA 3A1FA 2GEKA 5EWJB 4N82A 4C6HA 4B4KA 4KVAA 1K86A 4XUGB 4IVQA 1FXSA 3L1KA 1N7HA 3BMQA 5DRYA 4O2BA 2AR0A 2JAOA 4MYTA 4KNVA 3VKVA 2Z6AA 3G89A 1OOEA 4R2HA 3VNSA 3ZGXA 4EAQA 5IVHA 2EP5A 1P5HA 1OWTA 1XLTA 1KEEA 2X6RA 3PV0A 2HHHB 5CIQA 2YZKA 4Y3UA 1DLJA 2ZUSA 5GAJA 1YAJA 5DGIA 1GR1A 3EVAA 1YGPA 1N1DA 1LS6A 4F4WA 2VJMB 4AUEA 5BMVA 1UINA 2VSXA 3F1KA 3C8DA 4JLWA 5A5VA 4U6PA 4J9NA 3PD7A 4QFBA 3V7YA 3TVTA 2YV2A 4AP8A 4FOSA 3V1UA 3T9DA 1CC1S 1NVGA 1Z0DA 3F96A 3IAUA 4IDOA 4QYSA 1QGDA 3RD5A 4CN9A 4KW7A 5A03A 1WSWA 4ZVTA 3SZLA 3B1WA 1SN7A 1USKA 3BD8A 3NDJA 1CQJB 1JQ5A 3O95A 1X1BA 5GV8A 3PQ4A 5ER9A 4UEOA 4BQQA 1AS3A 4Z5XA 3C5EA 3ZH2A 1NMQA 3K9FC 1Z26A 4JLVA 3FWKA 1G21B 3O4GA 3EXFA 4D4MA 3DBIA 1YMVA 3IR6A 2X23A 3T9EA 4ZJPA 1XNRB 1OTYA 4MJ7A 2OZPA 3KLPX 2XX3A 4BUZA 1FLDA 1OFTA 3HR8A 3NZEA 3W2TA 1RQXA 4DZTA 2O7NA 3FKIG 5AI4A 4UM9B 2ZDHA 4KTTE 4MDHA 2D1YA 4CMEC 3ZWPA 2GJ9A 5KOYA 3GIPA 3THYB 1T43A 2CEKA 3SOPA 2FMIA 1NXSA 4DL6A 2EU8A 4EPVA 3WRXC 3RTDA 7YASA 2CNWA 1TT5B 1TUEA 1XTQA 3F67A 3VO2A 4A8JC 3KD2A 4UHKA 5HWSA 3K70D 3HBLA 3V8BA 4QVIA 3Q87B 4OQYA 1NBWB 1RADA 3EIWA 4WGFA 5L51A 3OX1A 2VP4A 1ECCA 1L7QA 2BLLA 2GJSA 2ZR9A 4IR1A 2B4QA 2QKYA 5K8LA 1RLJA 5DCLA 4P81A 5JBNA 3HWSA 3OOWA 4G1FA 1G55A 2QUIA 1QQ7A 2XV1A 2WIAA 3HU3A 3OQPA 3R4CA 3LKZA 4RYDA 1N0HA 1WNTA 3QWFA 4N0MA 2ZYAA 5FWXA 2CJYA 3T8YA 3SVZA 4D3SA 4DKXA 2G9VA 5KUTA 3HSKA 3UCFA 3O90A 2AN5A 2D06A 3PW4A 1H2BA 1GP2A 3JWGA 1XVLA 1GZ6A 1VOTA 3BA6A 1HX7A 4OXKA 2OA0A 1WQ1R 5AVTA 1Q21A 2PY6A 4JSTA 2QD5A 4D45A 1L5MA 2Y4RA 3MWYW 3WWEA 1JG4A 2DBZA 4JQOA 2GJ8A 3LZDA 4UFOA 1D2CA 3E2IA 1LLFA 5L3RA 1E3WA 2QYZA 4BJ6A 1IN4A 1RKQA 4R81A 4E0BA 3K0CA 3I5YA 1RRCA 1Z0KA 3JQDA 3KXLA 4M0UA 4X20A 4AWAA 4K3UA 1FS6A 1PK7A 3VX4A 3G0HA 3WAGA 4DLAA 2GM9A 4D42A 1BH2A 3H0EA 4M0JA 4HNQA 2VF5X 4YYEA 2VUMA 1QB8A 3UB3A 1XTKA 3IN5A 2VHVA 4JOQA 1T5BA 3MBIA 4FGKA 2AJ8A 3CZ4A 4NYJR 2XLBA 1CEEA 1JQEA 1SVLA 3PC2A 4RCVA 1FX0A 1OB5A 1H5QA 1X7HA 4LXXA 4FFLA 1Q6YA 3VSCA 4LMRA 1C3OA 1MP0A 2WVHA 1OV6A 1KNQA 2ILTA 3CR8A 3EGEA 2M1XA 4YRMA 4Q18A 3II6X 5EYPA 1NT4A 5TQJA 3VYUB 4MS1A 3OP4A 3MWEB 2LRHA 4C5CA 4CC5A 2R8OA 2JEOA 4RPCA 3VISA 4KFTA 2ACVA 5L6MB 1P3JA 4UE6A 2ZXUA 1UJNA 3JAWA 4G0PA 2NQTA 2POQX 1QYIA 3C74A 5JNLA 1QPNA 3KZ1E 2OKCA 2PJUA 4E5DA 4OBBA 1SUDA 1JMVA 3FMIA 1F8UA 2C4NA 1V71A 2DQZA 1AUXA 2C4MA 4J43A 3RFFA 3QXJA 2C3OA 4B3SB 2PU7A 1TC2A 4DV6B 5LZ5A 2YR0A 4OUDB 4EG3A 4WWHA 4AY6A 1GAQA 1PEDA 2PUFA 3WLNA 2Q5JA 4XWAA 4CMHA 1DIAA 3LF2A 3CO5A 3SSMA 2QBYA 5AKIA 3S1SA 2ZULA 4N0DA 5J5AA 4YH1A 3TSZA 3LTNC 3S2GA 2GM4A 4ZOHA 3EARA 1Z2OX 1XZKA 3IAAA 4I36A 3CZ5A 2NUTA 3BXOA 3JR3A 3RYFA 1ZVJA 1XZCA 2HAEA 1Z13A 2C9BA 1DO8A 2JD1A 3MMXA 4LKRA 4Q9KA 4D9IA 4Q9NA 4GECA 4KWHA 4NATA 3BJYA 2R65A 2HWXA 1DIOB 4BRZA 1QZTA 4DKJA 2DXIA 3W5BA 3LP6A 4NZNA 4Z4GA 1WWKA 3CEJA 3R9IA 3CX3A 4IGFA 4UDOA 4FC7A 1TZKA 3CX4A 1JMYA 3D6TB 4EQ5A 1AC5A 1E0JA 2Q0SA 1EI9A 1M10A 3DAAA 1IVNA 1QV9A 3OEWA 3C98A 5ERYA 3HM2A 3SXJA 3SHFA 3TO5A 5BOSB 3O94A 4LG1A 3SC2B 3V80A 4DUYH 4DMKA 1YT5A 4S0ZA 3ZKWB 3T0IA 4AIRA 5HL7J 2PMKA 3BD9A 4BX8A 3QE4A 4MVJF 5TS3A 5KEIA 5DG9A 3MTDA 4NICA 4RD3A 4ZP1A 2PGOA 2XVZA 3DL7A 3ZIAD 2JAUA 1XDWA 3MWFA 4UBNA 5JVDA 4BO6A 1Q0RA 2YRXA 1EQAA 3LNTA 1EVLA 2AFIB 2FJZA 3VH4A 3TZHA 5K0CA 2B4AA 3EVFA 3GT7A 3L40A 3NKFA 3T5LA 2FN7A 2O2IA 2Q6VA 4JIGA 5FHRA 2QX7A 4BTLA 4YXFA 3RWBA 3RLIA 3CVXA 1KMIY 1E1MA 1MGOA 2QRUA 3JTMA 1WSBA 3U16A 2ZJRJ 4EFBA 2PNFA 1NVWQ 1UDBA 3H9GA 4LBYA 5EEHA 5GP1A 5LDGA 4D96A 1V97A 1IK6A 1RQLA 1IMJA 4YAEA 3IUSA 5ECGC 3PIDA 3R74A 5CEJA 2PNJA 3ROZA 4CF6A 1QHYA 2Q3DA 3DZFA 3V8PA 1NPTO 1U8XX 2BHTA 4FOLA 4GD3Q 2IOFK 3ZXUB 3FE2A 4AF8A 4B17A 2NP6A 1I6MA 1M2HA 2WUWE 4AJNA 1E20A 4PONA 2PO7A 4N0EA 4IVNA 1RWWA 3STTA 3RSQA 4OBWA 2GN4A 5KPJA 1KMCA 2WEKA 4MRAA 1SUEA 1EDOA 1HMPA 4KXYA 5KAPA 2PMWB 4CNQA 4COOA 2YZNA 1GUAA 2UV8A 4CIAA 1Z2CA 2F48A 2V6BA 3DL0A 4WOBA 2HIVA 4ZCLA 1YQ9A 4M1OA 3V8RA 2NUTB 1ZRMA 2CW8A 1QYRA 4ENWA 2O8FA 5AVSA 4ZIRA 1G21A 4F9GA 4H1WA 4IZ6A 1YVUA 2FUKA 3ZXIA 3GROA 4DLKA 4ZEXA 4NPCA 1D2RA 5M04A 1EBUA 1VJDA 3ADOA 5CDYA 1XNRH 1M2KA 1XMJA 4YVFA 5KJFA 3AH8A 5JG7A 1L4BA 4JL8A 4QOSA 1N77A 2OXIA 3IAS1 2CL6X 4CM9D 4DLWA 1DAKA 5FPPA 1PV1A 1ZM4A 2Q4OA 1WCMG 3B9BA 3SBDA 4ZZ2A 5KQGA 1YFLA 2EG5A 3HNOA 1SCKA 4MGKR 5BWCA 2J3DA 3BH0A 5JS8A 4EO4A 2DB3A 3AR4A 4FWTA 2E2HA 3MD9A 1WVIA 3C5WP 3EIHA 4L5YA 1RBZA 1AM4D 3SC2A 4BLWA 5UKDA 5CLFA 1CZHA 2DU8A 4NCJA 2LVBA 1EFCA 2HQ1A 2RGAA 5CB4F 4XOIA 4HSEA 2X0JA 3L8GA 4G85A 3CWZA 3VGJA 4ERNA 4IVRA 3PITA 4UAUA 3W2HA 4KDFA 4A3IG 1VL0A 2ZSEA 4UNNA 1U2GA 3MERA 5AHWA 2PPVA 3ZCSA 2YMPA 2ZUEA 4IDFA 1SB3A 1Z7WA 1LJUA 1XEFA 1Z4OA 1PGNA 4H31A 4XASA 4CM8A 1Z6ZA 3GARA 1GPKA 3KQPA 1V9LA 3UHJA 2FJUA 1QVRA 2H1SA 3KFVA 5B3JC 4G0WA 3RGXA 3CS3A 2VJKA 2Y92A 3C16C 4Q4JA 4EVSA 1P5ZB 4E46A 3DZJA 1QIEA 1R0RE 2E4AA 4Z99A 4UPDA 1QNLA 2Y4NA 1R6AA 2CL5A 5DTEA 1Z35A 3SMQA 1A8SA 3DC7A 1PL6A 2FSHA 4PAOA 3ZCRA 1C9DB 4HQNA 2W2PA 2J6SA 5FOTA 4YCLA 2WAAA 2B30A 1QM5A 5B3LA 4A8PA 3AX6A 3RUIA 1QWSA 1E3WB 1W4ZA 4YRFA 3EZ2A 1DGQA 1S02A 2CMDA 3T9FA 2B2NA 2PS3A 5JAPA 4RTRA 3ZCXA 5CLHA 3BZWA 5AJWA 1ZJ5A 4TQGA 1C4WA 2JEFA 1Q0HA 5B37A 1U0GA 1TAHA 1XLUA 2GNOA 2GN0A 4PLYA 4HGPA 2OXTA 3E7FA 1ZVVA 1VCHA 2IU4A 2NXCA 4D99A 1YZFA 2R8GA 3BXHA 3LXRA 2AV6A 4V1CI 1G6HA 4X64B 1N5WB 1JQDA 4H7IA 1RM4A 1CWUA 1V48A 1HE5A 3CC7H 1HEUA 2IZ1A 1E1RA 5K20A 4BCBA 2K7ZA 3ZVMA 2HIHA 4ZJYA 5JNWA 4G24A 4ETMA 1KVTA 2YCLA 4OIMA 1B1CA 4G5RA 3SZGA 4A3SA 2ZSBA 5F3WB 1L7MA 1SKAA 3CX8A 3G8BA 3MR6A 3TJRA 2V4RA 2AD1A 5IHPA 3ESYA 3KLOA 4S05A 4H77A 4UXHA 2FFAA 1X7DA 1V95A 2XI4A 5I4BA 4S1NA 3V32A 5KYYA 4Q7KA 3F5SA 1L5NA 4PICA 5JASA 1B0PA 4HB2A 1L5QA 4JZYA 4AL4A 4CQLA 1OLXB 3K9NA 4YAKB 1FK8A 1O89A 4H7DA 4B4UA 4GSLA 1GTRA 4LJ6A 3NNSA 2NTNA 1KMMA 3RU2A 2WJGA 3TZKA 3U3MA 5I7FA 1A4RA 4BNXA 1YIOA 5F9FA 1XA3A 4UXJA 4H9GA 5IG2A 3Q7PA 5JT1A 4K8OA 2QTTA 3ETRC 1LW7A 2TRSB 4TKLA 4KWWA 3OESA 4HQFA 3F3KA 1YFKA 1RT9A 3R4VA 2NYRA 3JQPA 5F3DA 3PX3A 5HKOA 3TGPA 2CCKA 3FPCA 4BVBA 1FP4B 3MWGA 1TYEB 4FNOA 4ENQA 3OI7A 2IHKA 1N6NA 1U81A 3DBRA 4QJBA 1Y3CE 2KSQA 2BEUA 3ZGVA 2XE6A 3N6VA 4ZGGA 2UUOA 2I6TA 3UMFA 1PFVA 3RIMA 3GNLA 5HCNA 4B6EA 4G5SA 5DHFA 2ZE7A 4Q12A 3I4FA 1I2MA 1H0HA 3DZDA 3EMVA 3I2HA 4NL4H 1OIWA 3S3TA 2BZ0A 3QA3E 4BB0A 2DIKA 4OFZA 5C8YF 3INYA 3L7CA 3P0FA 3QNWA 3ZWQA 4YJ2A 2CYAA 4GAEA 4IRDA 4LRXA 3L8MA 4YJ3B 2NQ2C 5AM0A 4YS6A 5K0NA 3WGQA 3QVTA 1I5EA 3BA1A 1M34A 1Q16A 1XD9A 5M5BA 3VOSA 4O3RA 2OHOA 3Q7SA 4YP1A 1UFKA 3UWKA 4C0JA 3K15A 5A9TA 1M74A 3DDSA 1Y4SA 1Y6FA 2W3SB 2C4VA 1O96A 4G56A 3VI4B 2R86A 1GZVA 3HL4A 3P1JA 1UT8A 5J4KA 4HAUA 1N48A 2E3JA 3CRW1 1M7GA 2I5PO 4QWAA 1G8AA 1UEJA 3GUVA 3HDHA 3PQ6A 3VR5A 4B6GA 1ZUHA 4U5QA 4QTTB 3B9JC 4L73A 4MTEA 2UXBH 2Z30A 4LJ4A 4LXTA 3VNAA 5FWAA 3G85A 1CY7A 1EVZA 3R41A 3RREA 3HCDA 5BOVA 4LRTB 5IAJA 3VR3A 1AQYA 1MOZA 1UMBB 4FW9A 4ZZ3A 1ODKA 3RJ9A 4BNTA 1YZNA 5FL3A 2BE7A 3CMAH 5KYWA 4BEWA 2BCGY 3ZDAA 5AW4A 2FA9A 3CNLA 3MCVA 1H8HA 2J31A 2BFFB 3IH5A 3JD3A 1PG2A 4TTTS 4LA4A 1N36B 2ZBFA 1BRMA 3TW8B 4J4BA 1MEOA 1NR5A 1CUDA 3A1DA 1JHUA 1R4MB 4HTFA 5EZYA 3VU8A 1M1YA 4NYJQ 4W5RA 3K3PA 3M6LA 2EDAA 1BS2A 2PGJA 1AZYA 3PVCA 2QT0A 3NCHA 4BO8A 1L5HB 4X65B 3QEAZ 1I7DA 4RIEA 1JSXA 4JVLA 1LFDB 5BWLA 4M9CA 3CINA 3MC1A 3WLHA 3S29A 1J21A 3TD6A 2AF3C 3RVLA 2D3WA 2ZYHA 4R2IA 2IP4A 1XFDA 2P68A 3I83A 1OXVA 3WJ2A 1RABA 2BYTA 3HOYG 2Q3JA 5F5XA 4ED9A 1U7ZA 3HB9A 4DWJA 2L42A 5DSZA 2IJGX 4I6EA 5EEGA 1P0PA 1RYNA 4LMPA 5E95A 1ZQ1A 1TPZA 1VIAA 3H2GA 2BF4A 3OD5A 1J8MF 3FZNA 2RE8A 3K2BA 4NWIA 1JDSA 1Z75A 4MB0A 2VJLA 3HV2A 3VNQA 1YMQA 3RU7A 5B1EA 4ID9A 2VF8A 4XSHA 3HKBA 2AI3A 5HF8A 5LQSA 4EHNA 5ITWA 3DOHA 1DEXA 1QLWA 2P4HX 1P4SA 1MZPA 3L2PA 1U3GA 2C7BA 2WHXA 3JARA 2H9AA 3R3ZA 1XZJA 3DR3A 2OWOA 1HDXA 2A9RA 3LD9A 4Y6QA 4ZI5A 2R8ZA 5E9AA 2BGNA 1G6OA 4RD0A 3DEYX 1SIUA 1DJOA 5ADWA 4ZRDA 3GLKA 4GWLA 3OBBA 1YDEA 4QGHA 2BP7B 2CFTA 3HCRA 3E3NA 3QA9A 4B71A 4JLAA 3GL9A 3PG5A 1YIJH 5BWRA 2V74B 3LUKA 3RTGA 4HDRB 4ZDWA 1PG0A 1B0AA 4YRTA 2QV0A 1FNNA 4UQPA 1JLHA 4X46A 1BS1A 1ZKMA 3OTIA 1UBRS 3T1VA 4AP6A 4JYPA 4C4PA 4HWTA 1LVUA 1N2SA 1NBMD 4JH0A 3RYCA 2I1OA 5J1TB 1MW9X 4WZAB 2XAAA 1IG0A 2BGKA 3R20A 4IRUB 5L6LB 2W6MA 1V47A 2J3MA 3GEDA 1IBKH 2VA8A 4PU0A 5IF9A 4DPLA 1N92A 4K1XA 1G98A 2K7FA 5KNCA 4A0SA 3OD1A 5LUBA 5CB4B 1C8BA 1OI2A 2YX1A 2OAP1 3LLUA 1C7FA 1LTHR 5A02A 2R6FA 1ULBA 4V0LA 5IBCA 3OMWA 2JFXA 4PNPA 4AUKA 1QQAA 1Q0ZA 5ED0A 2Q1SA 3MBKA 4JGIA 4JYCA 1SVNA 3RAFC 3D7NA 5HJ2A 5HJEA 5F5LA 5DG8A 4EY3A 2Y1OA 2BTOA 4OL0A 1XUOA 2CB9A 2F1HA 2Q1UA 4FD3A 4INOA 1X1QA 4ODIA 3BTUA 4PYKA 3SXUA 4Z4QA 1D2GA 1VCOA 1FJGH 4RZQA 2IBMA 3N2IA 4R1SA 2QT1A 3AV0B 4OKIA 2R6ZA 4JI6H 1P81A 2WU8A 4FLMA 2HADA 4XYMA 2H29A 4A7PA 2J3JA 4X9XA 5EP8A 4DRXB 1GU1A 3OQIA 4AJ9A 3DVQX 3GMDA 1UJ6A 4H3KB 1H0KA 4L57A 5F33A 3V2GA 1ZGJA 4B3IA 2BFAA 3BULA 1S2LA 2BKXA 2EJUA 5KX5A 1ZINA 3DTVD 1PQPA 2H0QA 3NBXX 2E5FA 3HUFA 4ZO4A 9MHTA 3WRXA 3LK6A 2JA7A 1C30B 1AXRA 2XUPA 4RVOA 5DX8A 4B3MH 1GO2A 1UK6A 3A4NA 3HN7A 2Q2TA 1Z2DA 1DBVO 2QTCA 1NBHA 3HRKA 1F6WA 3I5AA 1WM1A 3KO8A 3OA2A 3L7LA 4KXLA 4UCFA 4K9SA 1JQLB 4R6XA 4X44A 5JR3A 4A8HA 2HUNA 3S8MA 4IJMA 4B2LA 1TDJA 2C98A 4GP7A 5KFJA 3PXCX 4QQ8A 3LX4A 3QPUA 5DWQA 3TQTA 3L43A 3SIRA 3KJQA 4MZXA 4BU0A 4YRAA 4MB6A 1E4EA 2EKQA 2GM5A 1WH2A 5J47A 5PNTA 2FG6C 2YYZA 4QATA 5DYTA 1QK4A 1L8QA 3AIKA 3K0FB 5T57A 1ULZA 1CQWA 1XZQA 1X38A 2BFCA 1P91A 3K5WA 1RWBA 4ZAWA 4DDTA 1P2UA 2PLWA 2I03A 2BEUB 2QRJA 3STYA 1Z6TA 3LE8A 5F1KA 1RYFA 5JWOA 3DFUA 4C5BA 1HI9A 2PWAA 3IJ5A 5CLQA 1CIVA 3S40A 2OHFA 5ICSA 4DXDA 4HZIA 1TF5A 1ZLXA 3QWUA 5I7WA 5BR8H 3U7IA 3DM9B 1BGXT 4BB9A 4FZVA 4ZAYA 3WB1A 3V1TC 5AJVB 2XIJA 3KL2A 1PKXA 5KJEA 3RAQA 2CN1A 4BQPA 2XCLA 1P7VA 2F2TA 5JMPA 5IT5A 4BE9A 2ZJ1A 3DV2A 3HMQA 3ZLJA 5INTA 4F7WA 5F9NA 1QHIA 1Q6ZA 3D4LA 3QFSA 3SQDA 3COSA 1WBDA 3ET5A 4PSCA 1S4MA 1N7GA 4ENTA 4US2R 5KYGA 3TXXA 4XQCA 1M2VB 1E18A 1H2AS 4YPFA 4ALIA 1YR6A 2PE5A 4JC8A 3D8SA 1PR9A 3U3XA 1XRMA 1N60B 2G83A 4OFXA 2OB1A 3GIWA 5F12A 1GKLA 4AQ7A 2QD3A 3KQOA 5CXXA 5E6UA 2F90A 2P1RA 2VSFA 4ZOLF 2FX5A 4C7XA 3WMRA 3B8HA 4PZZA 2C0CA 1VL1A 2RONA 3GLHB 2AH5A 4A3JG 2WSLA 3FM9A 4L8VA 4QNMA 1BGVA 1FTNA 2POCA 2WHPA 3DKKA 1Q92A 1W29A 1SHZA 1JXOA 1VRWA 4QA9A 5L53A 4XIYA 3RPFA 2O8VA 3EDOA 1WSDA 3V3KA 3CE6A 1T26A 3ORSA 4Q7QA 4DDUA 1Z83A 2DUJA 4DCOA 3OIVA 5CPFA 2H1OA 4L2IA 1W4AA 4TTPA 1TZBA 2G36A 2VCHA 2X5JO 4L4YA 5KCZA 2DOKA 2JLVA 2W43A 2Y1CA 3Q4GA 4ND7A 4ZN6A 3OPYA 3OUZA 4E08A 2WQ7A 3FNQA 3ZEAA 1LFAA 3P96A 2QP4A 2AMJA 4UHEA 3RE1A 3SNKA 5DWVA 1TF2A 2ZG6A