3WO0A

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-ala
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
465
structure length
465
Chain Sequence
b'KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 140
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wo0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wo0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wo0A01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wo0A04
4I55F 5KX5F 2FPIB 5BMVF 3WO1A 4MV1A 4O7RA 5C1PA 4HQ6A 1GLVA 4O7TA 3JZFA 4E4TA 2GPWA 2NU8B 2FP4B 2R7KA 1I7NA 2YZLA 4C5CA 3ETHA 1CE8A 4MV4A 4O4JF 1M0TA 2QF7A 4O82A 5KKNB 4MAMA 3U55A 3HBLA 1E4EB 5LYJF 2FPGB 4O7WA 5D8DA 5LXTF 1CQJB 4ZI7F 2VHEA 3R5XA 2GPSA 4O83A 1JLLB 3RFCA 2PVPA 4M9UA 5JVDF 2YRXA 2CZGA 3K5IA 5LP6F 3U9SA 2FB9A 5J2TF 2YZMA 4J6EA 5CA1F 4GGMX 2X0SA 2V58A 2V5AA 3HB9A 2SCUB 2CNQA 2VPQA 1VBHA 4IZOA 2GQSA 4TV8F 1KC7A 4Y8VB 1AUXA 2YYAA 4FE2A 1VBGA 3WNZA 3MJFA 5JH7F 1Z2PX 3LP8A 1E4EA 3UFXB 2R7MA 4WBNF 4O7LA 1DV2A 3VA7A 3V4SA 4MV6A 3SE7A 1AUVA 2CQYA 4YJ3F 2OLSA 1BXRA 1CQIB 3ORQA 3R5HA 4TUYF 2VR1A 5C8YF 2I8CA 4EG0A 2W70A 3HO8A 3VPBA 3BSYA 3QFFA 5LOVF 4MV9A 3MWEA 3VOTA 4L1KA 1PK8A 2NU7B 2P0AA 4FFRA 5JVLA 4IHJF 3Q1KA 2WYOA 4O4IF 1GSAA 4YAKB 5FNVF 2R82A 3TQTA 4ZHQF 4O86A 5HBRB 2GLTA 2YZNA 1SCUB 1M0WA 4HNUA 2NU6B 1GSOA 1EHIA 5HV6A 4MA0A 4YJ2F 4FFNA 1EUCB 4YAJB 3RV4A 4O7YA 3N6RA 3KAKA 2R7LA 5I47A 4EABA 4FFPA 1JKJB 4HNTA 4XX0B 2R7NA 3U9TA 4O7NA 4FGRA 4IWXA 2W6ZA 1EYZA 5J2UF 3E5NA 5EZYF 1W93A 1JDBB 4FFLA 1GGOA 2R84A 4DIMA 3ETJA 2YRWA 4M98A 2W6NA 3OUUA 2I87A 2W6MA 4ZQIA 2NU9B 4C5BA 3VPCA 3R5FA 2NPOA 3K5HA 3OUZA 1UC8A 3BSWA 1JDEA 2YZGA 4EGJA 4M99A 4EA9A 1T36A 1EZ1A 3LWBA 5BPFA 3AX6A 1KUTA 1DV1A 4XYMB 3I12A 3K3PA 1C3OA 3G8DA 4MV8A 5C1OA 4ZOLF 4YBZB 1Z2OX 4EGQA 3KAJA 3BFPA 3N8DA 4DLKA 4I4TF 3GLKA 2ZDHA 2PBZA 2DZDA 1A9XA 1KJ8A 2C00A 1DIKA 2DIKA 2PN1A 5IYZF 4O7VA 1KEEA 4O84A 1UC9A 4EA7A 4O4LF 3TIGA 1KJQA 3VPDA 4XZ3B 4HNVA 1EUDB 3U54A 3ORRA 2HJWA 2CNVA 2W6OA 3JRWA 3TIIA 5K2MA 2W71A 2R87A 2XD4A 5H80A 1KJJA 1IOWA 3R23A 3RV3A 5CB4F 4IWYA 2V59A 1B6RA 1I7LA 2DLNA 4O4HF 2R86A 1W96A 2GQRA 4XYLB 1OBGA 4M9CA 2YW2A 4ME6A 5CA0F 1KJ9A 2YS6A 4FU0A 4NYEA 4YB8B 4RZQA 1B6SA 4O7SA 3JZIA 5JQGF 1PX2A 2VQDA 4FFMA 3TW6A 3WO0A 1OBDA 2NUAB 1BNCA 3VMMA 4MV3A 1Z2NX 3RUPA 1GSHA 3KALA 2R6FA 4O7ZA 4O2AF 3AW8A 2DWCA 3V4ZA 4TV9F 4EAAA 5GONF 4HR7A 1CS0A 4C5AA 2ZDQA 3BG5A 5DMXA 2I80A 1KJIA 3DF7A 4WD3A 2R85A 4O2BF 1A48A 3BSSA 2W6QA 3TINA 3Q2OA 5JQWA 2HGSA 3G8CA 1ULZA 2YL2A 4FFOA 5BPHA 4QSHA 1KBLA 3GIDA 3R9RA 1IOVA 5CAEB 2YS7A 2YWVA 4I50F 2W6PA 2QK4A 4MV7A 4MA5A 2IP4A 2CNUA 3JRXA 1WR2A 3MWDA 4EA8A 1VKZA 1C30A 1M6VA 2XCLA 4O81A 2FPPB 3KREA 3NUAA 2Z04A 2Z02A 2ZDGA 2J9GA 4IIJF 5LA6F
chains in the Genus database with same CATH superfamily
5EZYA 1HLFA 3F8SA 1FDRA 3A6ZA 4KXXA 4RPGA 1I7NA 4URHA 3BTSA 1NQAO 1XLVA 3DMTA 3PJRA 3ZHOA 1T13A 5F98A 3PTZA 5B7GA 4GX0A 2IU0A 2VHEA 5ES3A 1PR4A 4C4SA 5AM1A 1QPBA 1NQXA 1SOUA 1LJUA 3M4IA 2QX8A 2ISCA 1BQ4A 1AJEA 1TCAA 1R2QA 5G0WA 2C04A 3S68A 3K9NA 5C52B 1BAPA 4G4JA 2WPNA 4QBTA 2WBLC 3A1EA 2JJ1A 4JQSA 4W1SA 3SAJA 3KZMA 2F4VB 4ZYWA 3TLMA 2D7DA 3G2OA 1B0ZA 4MQ6A 5GM1A 3O4HA 1R1DA 4XIJA 4BATA 2H0AA 4EY7A 2DBRA 5FBVB 1Y9DA 1E5VA 4J6FA 2ID8A 4DCOA 5G40A 2B4QA 5KQSA 1FJXA 1I9CA 1QH8B 3L8HA 4J9NA 5I7EA 4R05A 4YPFA 1Q0UA 2C03A 1B14A 2DJIA 5HUJA 1VA4A 3PNKA 3VKFA 2AHRA 3RSZA 2RDJA 1FUEA 1JFSA 4JJ7A 3H9EO 2XB6A 3N6RA 3Q10A 1FIQC 1O6BA 4LYHA 3OU6A 2VK2A 1M1XB 3G2MA 1EWYA 4DV4H 3WG9A 4XZ3A 3QVMA 3MTEA 4QBGB 1L4UA 2CKMA 3ME5A 1JMYA 4ZGGA 1BEEA 3O2QB 1LBHA 1WULS 5HKOA 3QZ7A 3DZBA 3ZDDA 1GZ6A 3AVXA 4EEXA 5DSZA 2VNSA 2JCVA 3EZNA 4ZI2A 3R5FA 1GG8A 1UQRA 2GEVA 3TNLA 4MS3A 3R3SA 4PONA 3WGMA 3L4JA 4RKEA 3MAAC 4EYQA 4ZRDA 3LCJA 4XLZA 1D2GA 2ZSFA 2Q4TA 4L07A 3TTSA 2PX8A 3IE2A 4TQSA 2ECQA 4X65H 1Z6YA 1JB1A 5LSAA 2OFXA 1FIUA 5JV5A 3L3BA 4FK8A 3IS3A 4IV8A 5FFFA 4FMCF 1NOJA 3P5SA 3RVJA 1OU0A 1ADYA 1T0PA 1LUAA 3LLUA 1A9XA 4MUGA 3PEUA 4PNPA 1XVIA 1ZMTA 3Q7QA 1VKJA 2X4DA 2GCOA 5KYWA 1YA4A 3NBFA 3H4TA 5B53A 3FFTA 3N58A 3T5JA 4ML3A 2ZCVA 2FEWB 4PLHA 2O5VA 2HUPA 5LLTA 3U0GA 4F2HA 1CNFA 2PMWB 5JTUA 5B37A 2DLNA 4L08A 3I9V6 2HDHA 2C07A 1C7RA 3I73A 3AV3A 4HQRA 4I5DA 3HEMA 5D1HA 3PQCA 3TLBA 2I03A 5DI9A 1D0SA 3PKZA 2M1ZA 4ZTZB 2ENWA 3H4BA 1M10A 4HZUA 4BNMA 1VL5A 3K9HA 3BL6A 1G0NA 3BIOA 3UCXA 4O7ZA 4RELA 3ELWA 2WWTA 4Z2YA 3VR6H 1TCBA 2GRJA 2LRHA 3ND6A 2KE5A 3AB8A 2GPAA 3A11A 2QR3A 3IAS1 4BNFA 3JVDA 1E1MA 5ESRA 3OM0A 4YRPA 1E5DA 5FWNA 2P6MA 5K3WA 4UUGA 4ZT7A 2BGRA 3MYRA 2HGSA 2Z57A 3KLPX 4NOJA 3HG7A 2R8PA 3LQQA 1SR8A 3KEFA 3EISA 3WISA 3HV0A 3DBIA 3PGA1 3CMCO 4FEEA 4ZMBA 5TRTA 1KDPA 2HMAA 4D8TA 4ENTA 5JAPA 1DRJA 1OHHD 1C5KA 2XDQB 4QOHA 2IZ6A 1NVVQ 1PV1A 1DJOA 1O5OA 2HSWA 4B6JA 1NRJB 1SRQA 4KR3A 2YWHA 2MU1A 2ORED 1CFJA 4A3FG 3PRKE 4PANA 4ZYTA 4KIUA 1OYYA 4QTZA 3TNYA 3ITDA 4COOA 2FR8A 4M1TA 3H9CA 1QGUB 4U2DA 1L4GA 3RYTC 2WTXA 1R0RE 1I3CA 1Q5PA 2O03A 2G04A 2P41A 2J48A 3IAHA 1Q50A 3AEZA 4NP6A 1VP9A 4CU2A 4MA4A 4LK3A 3F5DA 3I5XA 1ZS9A 1OILA 1RAHA 1RDFA 4GH5A 1TIBA 3STWA 1RU3A 4NJOA 2EW1A 1VPLA 1L5FA 1FX1A 4IGIA 1CNMA 3QE2A 4AKIA 1A8QA 3RYHB 2FLKA 1SQ0A 2XBMA 1OFUA 721PA 1VSUA 3QEMA 4FCVA 1W5EA 2ZM6H 1U5BA 4ICIA 3GGJA 1FX0A 1E5LA 2R1UA 1DO2A 2R93G 4ZEMA 3O8OB 5EFOA 2TYSB 5KFWA 5AR1A 1CIJA 5JS8A 1CLUA 3LRXA 1Q82J 3GHYA 5CIWA 2C9MA 5EP1A 2AGVA 4WOJA 2OVBA 3TZEA 3DXZA 5EKUA 4GLXA 1VLHA 4OM7A 1G1MA 4OXXA 1PJ2A 3CONA 4ZJUA 2R62A 4QPJC 4L16A 2V4ZA 3ZS8A 2DULA 4JNKA 1AMNA 3HHPA 4FGSA 3ZZUA 2IEAA 1ZK0A 3JQAB 3SHFA 3TW8B 3BZBA 2NZ2A 2XIJA 2Z3ZA 4I8DA 4L72A 5CP8A 4GOND 3R9XA 1WZ2A 3SWWA 4CC5A 2IOHA 3QPBA 4V0MA 1SCJA 4G8DA 5EC8A 3K1YA 2VTKA 5EKDA 3MPUA 3ISVA 5LB2A 5B36A 3F6YA 2D2IA 3NS7A 2HPVA 4W8HA 5KG3A 5HWSA 5IXJA 4UKDA 2D1TA 1J0XO 1G98A 3C7CB 4Y2RA 4H4EA 5JNRA 4HSGA 5COQA 4ZCLA 2WEKA 3KJEA 4HYTA 1M5TA 1A4IA 3G1TA 3ZWMA 1TM1E 4K9PA 5GZ6A 3DT9A 4PFSA 1RHRA 1MIHA 1OLXA 2YJZA 2JAQA 5BN1A 2PA2A 2WC1A 1EQAA 4OJKA 1RC0A 3WWZA 5LU9A 1CY0A 2JDIA 2IYWA 3BFPA 2GCNA 1KC8J 3GFBA 2GKOA 4H2DA 2JAOA 2IPXA 2FFQA 1H5QA 1B8VA 4JDUA 1Q1AA 5FR1A 4FB4A 5JUMA 4QUIA 4UHFA 2DCMA 1DIRA 4KLRA 2R4QA 5E38A 2G17A 3WGQA 3WGKA 3R5SA 3QZUA 1FFGA 3QELB 2ST1A 4NJMB 1LKZA 4I1VA 4BNDB 3CFYA 2EL7A 4H7KA 3UQZA 4LQLA 4F3YA 3PE4A 2DT8A 1MJGA 1I5RA 4MEJA 2CHFA 4NAHA 1U8FO 1A5ZA 1X2BA 3TRIA 3HZHA 3LQKA 2GPYA 2H7XA 3OLZA 4ISCA 3DNFA 2QIOA 1EVZA 1ZC4A 4ZXFA 1U6KA 1QONA 3L8EA 3GFQA 2P62A 2CJWB 4CM4A 3TTUA 1HYEA 3U7EB 1FZQA 1X80B 1S68A 1KO1A 1TTHA 3PQFA 5FO1A 2PFKA 3EW7A 3Q3GE 3NJ8A 4R2HA 5B30A 3TJMA 1PNTA 4UUAA 3LUJA 1TUIA 1ZRHA 2ZBDA 4OM8A 1FMCA 5KNBA 2KSWA 3MR6A 1QHGA 3LL7A 4Y9DA 1RCUA 1ZUD1 1TT5B 2FK1A 1LPBB 1LQ2A 1I2LA 3B7WA 2QVGA 1H5UA 1UZAA 1JQEA 4CMFA 521PA 4BMCA 4JB3A 1VCOA 2BF4A 2PGXA 2CLSA 3N8NA 1MHTA 3R5TA 3MD9A 5JBNA 1IDOA 3VKGA 2BKVA 2VA9A 2H4JA 4KXYA 3SLRA 1M5UA 1A69A 5C5DA 2X2OA 2EJBA 3R1IA 4K03A 2JK0A 2G1PA 1Q1ZA 3I05A 1U0NA 4XRRA 5TC4A 1WKIA 2C82A 3MTDA 3I64A 5FH9A 1PUXA 3OE4A 1BCRA 5K0NA 3GDGA 4N7JA 2E4WA 1X7XA 2FSUA 3TZ6A 1AS2A 1KDZA 3A9WA 4TYYA 4ZOQI 1TKRA 4DDVA 1CZNA 2ZTSA 5IRCD 4RPKA 4KE6A 4TQUS 4W9MC 2QD4A 4MCIA 1XDGA 2PZBA 3TIFA 4UOEA 3H42B 3BKXA 5AVSA 1RVV1 3ZBQA 2QW8A 1M1YE 2J3KA 1AXGA 1QTRA 2X14A 4YACA 4P1ZA 2VIIA 5C53B 4P4UA 2BPOA 1DCMA 1RCFA 1R6UA 4PU0A 2ZS7A 4F8EA 2BHNA 4JLSA 1VBGA 1N6PA 3EC2A 4YCAA 3WLRA 1RTTA 5MN4A 4W99A 4DDTA 4M9SA 4LJ9A 3RVDA 4IVPA 1V45E 4DL9A 3A7EA 2AE1A 2CGEA 1XU9A 4I9AA 3DE6X 1II0A 5DXJA 2XKKA 2QJOA 3O92A 1P9WA 4DR2H 1FMTA 1S72H 3ZLTA 2VCEA 4RACA 3EQZA 4X6YA 3A1CA 3MOIA 5E6UB 3HU5A 5G2OA 1T1EA 1D2EA 3DZIA 1TC2A 4U6SA 2JA6G 4MUAA 5HULA 2ONYA 3E18A 2R11A 1YVPA 1K7YA 5EIFA 3DOHA 1DOZA 3DE4X 5DH9A 3RBAA 2HNKA 2X0FA 4EZIA 5F12A 3WC4A 1CKNA 5JPIA 1ORVA 1T8WA 4A6XA 1IY2A 2UUOA 4G5YA 5DNCA 3PQ5A 4AK9A 3UPTA 1FFUB 2KQUA 2OCPA 1B3RA 4BBPA 3RVPA 4WCEJ 4Q9JA 4EUKA 4IJMA 4W5NA 2HQRA 4BB9A 3UGKA 2N0SA 1NVFA 3GNQA 5TQVA 4J2HA 1Q7GA 1MP0A 1S0UA 2EAUA 3UMCA 4BFTA 2XC9A 2Q9UA 3HBAA 4CHTA 4TWJA 2RAUA 5FUYA 4JD5A 4B32A 1JECA 1L7DA 2UZ0A 5I8ZA 1QV9A 1EDEA 3HB1A 1P4GA 2OZPA 5JSYA 1EFVB 3AM9A 4DJJA 4ECXA 4GC7A 2YIJA 4EYGA 3EHEA 2FLLA 4PY2A 3T5PA 5AESA 1X1SA 4HK4A 2CVOA 2H5IA 4Q16A 3CRZA 4HFRA 5KNDD 1E3IA 3IAFA 4G5RA 1TKCA 3RAXA 4ESHA 2EW2A 5DMHA 4RB3C 4IIBA 4H6VA 1EP1B 4JSTA 4X92A 3UGQA 4UTZA 3VJRA 1ET0A 4RZSA 2QNBA 3EXIB 2ZI6A 1D2NA 1N62B 1ZNYA 2EJWA 3HGMA 5ESWA 5FO0A 2XGJA 3N07A 4YLYA 1BW9A 2C59A 4J1NA 2VTBA 3U4QA 4FSHA 4Q4LA 4EL0A 2Z09A 4I14A 1L5QA 1ZM4A 3RSQA 4XJXA 2WYVA 1OI7A 1WPGA 2WE7A 3C6YA 5AKHA 4GYWA 2C7RA 1KHTA 3QNUA 3ZWOA 5IFKA 2IU6A 1DGQA 3FSGD 3HXOA 2PUGA 2BR5A 1MA0A 4ZRNA 2C20A 3HXLA 4CKWA 1HNZH 2Q4DA 3PKIA 1KH3A 4KXWA 5K6RA 1L5KA 5IHPA 3V9AA 2WZQA 4A2BA 4EFNA 3ESAA 1R6XA 1XCOA 1QFJA 2P1DA 1KE1A 1ISGA 4NR0A 1DINA 2UUAH 1NJ6A 4ZQEA 1G2OA 4D3YA 4JI8H 2VT3A 3AYZB 3TOZA 3RUAA 2PA3A 3WNQA 3LUKA 3WGOA 4Q0MA 4BP8A 3DZCA 1V11A 4IVRA 1YHNA 2I66A 4LOAA 4B87A 4CE5A 4PQRA 3GV7B 5TX7A 1AHNA 3P2OA 3GRYA 1Y6QA 5D6NA 5F9LA 2M6SA 1YTEA 2BEUB 1RP7A 4FMBB 5ANRB 4ZOBA 3BRWD 1SBTA 5IM4F 3GYBA 5KC8A 1NNSA 1GL3A 5LBIA 3IPYA 4KTVE 3KLBA 1GKLA 2JFZA 3JYOA 5BQXA 4QNRA 2J31A 1O0BA 4F6LA 4R0VA 3QE9Y 5KU1A 2BSQA 4WACA 2GS9A 4OQLA 5EIEA 2B8EA 4Z8YA 3R75A 2N3ZA 2V6JA 4N3CA 2VAXA 4HRVA 3PSAA 1EHYA 2B4TO 3FPBA 4PV7A 2OPBA 1J8DA 4X44A 1O87A 3FMOB 4PXYA 4YMTA 2WTUA 3U3KA 1F8YA 4GP9A 3BX1A 3RNOA 3WNZA 1E2JA 2LD4A 4DLSA 3IC5A 3AJAA 2YJ5A 1Z8FA 4GM4A 3STYA 3EPIA 1DSSG 1RZVA 4C1NA 4KMOA 2BFPA 3L8MA 1AGRA 2KWIA 3RFUA 2R8KA 2QVZX 4D6XA 3FWNA 1NT4A 2CLHB 2NOAA 1YMQA 4GU5A 5JJKA 3QGMA 3M83A 4XUEA 4RGBA 1DIBA 3CSSA 4UULA 2CVZA 3W79A 3EB9A 3CD6H 3C8MA 3BFVA 2R7ZA 2ZJ0A 1T8RA 2FQQA 4YCBA 1VCIA 4ZI7A 4CETA 2IYOA 1EFUA 5E3HA 3R7SA 1YB6A 4YJHB 4GPAA 3IL2A 3FF4A 2XTNA 5M29A 2B4AA 2KHZA 3BWVA 2B3DA 2R8GA 2B69A 5CA1A 4HH4A 1NUAA 4M7EA 3FFWA 1N36H 4V0KA 3KZKA 1I7SB 1W19A 5BWMA 4YUZA 4G1VA 3H0GA 2X5NA 4YAFA 1YULA 2FMAA 3VVBA 5IASA 2AXQA 4D9BA 4K6FA 4IOMA 1NJ8A 1LY1A 1SCBA 3LULA 4XWGA 1V8DA 1XALA 2V7BA 3M70A 1IWPB 4MR7B 5DF1A 4RVSA 3NTQA 1P1IA 1NYLA 1Z4QA 4CMEC 2QJTA 2IYXA 4N6NA 1K7SN 5BSGA 3UYLA 5JOQA 4AP6A 2R6DA 2HSJA 2X8LA 3R6WA 4HNAB 3GLKA 3QFSA 2YXLA 3KHKA 3KSUA 4JC0A 1YITH 3VVMA 2RJNA 2QBYB 3W5UA 1T24A 5JXHA 4ZAFA 1X92A 2OCDA 2ZIEA 5K3FB 4AYBE 4GXNA 4LVCA 1RWKA 3F73A 4JZYA 1SM4A 4W5WA 4V1CB 3CB4A 4O08A 3RCBA 3JALA 1DTWB 1GZ5A 2XAAA 4F60A 4L9WA 3PDHA 1VMEA 2GGSA 2QXTA 3D3KA 2E5LB 3I72A 3S44A 4DUZB 3BMCA 3AFIA 3T7SA 1RJEA 4FOPA 2C22A 1DKOA 1KMCA 1CR2A 5I5TA 5IHXA 5FUWA 5KFXA 4G5SA 1E2GA 3T1NA 2MHCA 3AERB 4LXYA 1KQGA 1DWUA 1XG5A 3HY3A 3NASA 4B3HA 4P2BA 1TD9A 4KBGA 1L9KA 1ECLA 3QFRA 1Y3CE 1XLTA 4TLCA 1DX9A 1RI2A 5IYDG 4DR5B 1R6TA 2WF6A 3N3BC 3U9LA 5DQGA 2EDCA 5LBTA 4KTTE 2C88A 3JQGA 4RWEA 2F1JA 3SDBA 2AX3A 4ZZIA 4AQYB 5ECWA 3KL2A 1W49A 2P9FA 5J4KA 4QODA 4KHZA 4CQNA 2EZ4A 2QZJA 2ODEA 1P4HA 3WKBA 1WR2A 4B6GA 3A6GA 1S97A 2BE7A 4BWSC 2MYTA 3MT0A 1Y89A 4YO7A 3G8AA 1XDUA 4QGSA 3ND8A 2WINI 4MVJG 4Q02A 5JDCA 2F00A 1U99A 1KI9A 2TECE 3WKAA 1E1QA 3SHOA 4DR7H 1RAAA 3N43B 2BBTA 3K32A 4E32A 4QM7A 2O0JA 4CLOB 1V2HE 2P5YA 2QD1A 3BIXA 4NL4H 2YXEA 1PNQA 3NALA 2COGA 4OH1A 4C01A 2I3ZA 4TSFA 4R1SA 1NM5A 3FDZA 2IXDA 1SCKA 1OZFA 5KT3A 1NZDA 2D4HA 4JUZA 4L27A 4GP7A 3TLKA 4IDEA 2XZLA 3TAUA 4DV6H 2Q3HA 2A9RA 3CLRD 5FUVA 5J2TF 1I1KA 5CFPA 1U5CA 1D6JA 1R9NA 2CNQA 1D3AA 1T9CA 5ALJA 1Z5NA 1EVEA 3U3XA 2HVQA 3A1FA 2H9IA 4E5UA 1YCHA 2ZTMA 1Z2PX 2P0EA 3HKCA 4BCDA 1CHNA 2R65A 2NXJA 5FTJA 4N5NA 4IOAJ 4M1ZA 4DM3A 2ISQA 2P9CA 4C4OA 1V4VA 4IFEA 5HCNA 4K9NA 4R0NA 4NESA 3UT5B 3HR7A 4MIEA 3CCVH 1Y80A 5IDWA 2FQ1A 4B73A 3GLSA 2X9VA 3O82A 3GZJA 3TSCA 3H9GA 3V8RA 3WXMA 4XD2A 3FNHA 3HLYA 4RK1A 1Y48E 2IY9A 1OPXA 5ALSA 5CFMA 1Q83A 5DYYA 1O7JA 1H69A 2ZTUA 3HJHA 2QR5A 3KAPA 4GMXA 5F5XA 3KR0A 1UJ5A 5CG1A 1DQPA 4GUAA 4XX0B 1XP5A 3ZY3A 3PFKA 1EYZA 1WV0A 3SYMA 2A5DA 5KCZA 4IZIA 2WE8A 1ZJYA 2W57A 1WAMA 3E2IA 3CSDA 1SCNE 1TQ4A 3HNOA 4KN5A 2WF8A 2ID7A 3CF0A 3LV8A 1UFVA 1UOEA 4MAAA 2H48A 5MDHA 5E9AA 3IPCA 3MWEB 5KFYA 3DBVO 4G2NA 4PBRA 2IIPA 4EKDA 1QHXA 4AP5A 1M90J 3LT0A 3DZKA 3I04M 3N0XA 2P9BA 2H7VA 3PD7A 4BNLA 3G7NA 2C1XA 2PZLA 3D7RA 2WD9A 1W30A 2QTVB 4X93A 3T52A 1U2ZA 4JV2A 3U1BA 4YV7A 2B5WA 2B94A 1XTKA 1CP2A 4WESB 1U4NA 3A25A 4Q5IA 3AVOA 4YRJA 5LL6P 1RS0A 2V1XA 3FUWA 3BDIA 1I14A 3TKLA 1LLUA 3AR5A 2PUFA 1RI1A 4U9UA 5KBYA 3KKMA 5LMUH 3WA7A 4RXTA 1WCIA 3G3EA 1N7IA 1SZPA 1UJ4A 2MSKA 4B35A 4ZXPA 1H3EA 2FH5B 3HVKA 3RHZA 2Z2XA 2IF2A 3Q3HA 1IVYA 1N2CA 2FRVA 1E60A 3AINA 4KHPH 2BIFA 4GA5A 2W43A 5LCXA 2Y1GA 4HXEB 3GX1A 2O5CA 3VHQA 3QX8A 4ZEXA 5KNDH 2OHHA 6REQB 5EXPA 4UU0A 2DWUA 4B7AA 3DAFA 2ZIWB 3AI7A 3U3OA 2X8JB 1W2BH 5A04A 2XOKD 1QM5A 3BEDA 4O2BF 1ZSNA 2PU5A 3C43A 2R97A 3GT4A 1KEZA 1UF9A 3KLNA 1WSAA 2D3WA 3ROKA 5IP9G 1MR3F 1AZWA 5C18A 5AVTA 5CYGA 4CMIB 2JD0A 4NV3A 1R66A 2A88A 4Q0YA 4CR8A 5CAEB 2C1ZA 2EWVA 1HEIA 1CDDA 1XTVA 3TZCA 5L8VA 2EERA 2W54B 3UOAB 2O8DA 4G4SP 1BH2A 2FLPA 2D0PB 2PVCA 3EQ8A 4P93A 5KEIA 3H5WA 4DWOA 4Z1MD 1HETA 4TTRA 1NWHA 3NT2A 1MV8A 1O5TA 5ECGC 4R6XA 3O8QA 4J1QA 5FEMA 4B3TB 4C1BA 1YI2H 1O1YA 3OE7A 5CT5A 1P18A 3PWKA 4CUKA 3WB0A 4ENWA 1A0IA 1OAAA 2IZ5A 2R47A 1N5OX 5EMKA 2IU4A 4H7HA 3PA6A 3CMAH 2BCEA 5G3YA 1JLLB 1UZLA 4NABA 3F5SA 2RGBA 5A7FA 4LRSB 2GOYA 1QIGA 3K6RA 1V3VA 3GLHB 3IR5A 1OA0A 2AKAB 2C3YA 4QBHA 1UWVA 1NBME 3QVGA 1ZD9A 1IEXA 2UVQA 1VRWA 5I7RA 3UFXB 1OC4A 3TBHA 1E2NA 3EMVA 1I5OA 2C97A 2HU5A 2RGNC 2YV4A 2CBXA 3GIKA 4ZO9A 1ZSVA 3N0WA 1I2BA 1EXWA 1LDMA 2B63A 1SUWA 4LJ5A 1IUKA 3L0BA 2E2WA 2PQMA 4Z3KA 2WT9A 3NRBA 3GGDA 5JXIA 3T8YA 3QVTA 3RJ5A 4QXAA 5DTEA 2WAOA 3DPIA 1Q7BA 1WXQA 2NZ8A 2XT6A 2BBSA 1AY0A 3QI2A 3F67A 1RXYA 5IAAA 1Y7LA 1NVAA 3SFVA 3WX0A 2VKTA 1YKGA 2DSJA 2H4WA 2WIFA 1IN4A 2XT9A 1UBTS 1SBNE 1U9ZA 1XTZA 3BGIA 2E21A 4KOEC 3FRJA 3D6NB 1M7HA 2WU3A 1JKJB 1XEXA 1QANA 1TWFA 4IOLA 4JC4A 3ETJA 2EBHX 3EIWA 1PFVA 1K8RA 5I9MA 4FR0A 3JQAA 2DBVO 1QGZA 1P3DA 2JAHA 4XWWA 3PEWA 3W4IA 4RHFA 3BRQA 1TO6A 4Z9FA 3SF8B 2ZJ7A 3KOWA 3VJKA 5IZCA 4QLOA 5SY6A 1NUQA 3UFBA 4TVSA 1GILA 1DO0A 4XDZA 3ZI4A 2DWQA 2JW5A 3NWJA 4U3JB 2YZ2A 4LSAA 1XAIA 5CNKA 3SYLA 3AHIA 2VQEH 1E0JA 3KD2A 1KI6B 5IAEA 3E15A 4H59A 4W5QA 4HPWA 1NJ1A 4JH0A 4XKJA 5JFGA 5NULA 3RSSA 1PR6A 3I52A 1GZHB 1H5NA 1KDOA 2YINC 2HJGA 4DANA 2QQ0A 2WILA 2HDNB 5TV2A 3NMUF 2VUMA 4BMNA 5E0KB 1WPQA 4RF3A 2F9FA 5JW6A 2G63A 2ZJ6A 2CVQA 1EFRA 2HWUA 3BFJA 4PO1A 2IU3A 1ZU4A 2FR0A 1BYUA 1V9PA 3A32A 4LSXA 5TIIA 4D6YA 1T0IA 3MMSA 3DDOA 3DTYA 4LMPA 4PWYA 4FU0A 4JBLA 1EFPB 3EZFA 4MWZA 1SZDA 4J90A 4DYVA 1N8TA 1SG6A 4RHXA 2YYZA 2O3RA 4LN1A 4KSBA 3RAGA 5F7XA 3QELA 1C9MA 4RK0A 2YV2A 1YZUA 1KMIY 3PC7A 4GBED 3KJHA 2NXEA 1X8KA 1BQEA 4J3JA 2AGOA 2XNDD 3GEDA 1Q17A 1VIVA 3OFSA 4BVGA 3N8KA 4QRDA 3RFFA 2WHEA 3C3BA 4BKQA 1I80A 4TMZA 3Q9UA 3NGMA 1IN1A 3K1JA 4FINA 4UCUA 1AK2A 4MPDA 2FX2A 1RXSA 4HAZA 3GLGA 1T8YA 4QM6A 2QN2A 3VV2A 1ZWLA 1X80A 3B6KA 3M6LA 4BO8A 1MQ8B 1HMPA 1DHTA 1C1XB 5JYCA 5K01A 4EG7A 4BO1A 3WGNA 3A3PA 3UUWA 4CPDA 3CKYA 5H68A 5KT6A 1PL8A 3WGHA 3RNLA 1T5DX 1QGOA 3WSTA 3TAHA 5IBPA 3M4YA 1WE2A 5I9TA 2A2ZA 4MV1A 1ZNQO 4R8LA 1F4PA 4L8WB 1ECGA 2RGRA 1IYEA 4RIIA 1SOWA 3AETA 2AZDA 3MZ0A 4DJFC 3KUXA 1IY8A 1I2DA 1IOLA 2C8JA 1CY1A 1F9EA 4LOLA 4PGFA 1Z7WA 4UFOA 3ZDYB 4O7WA 3H5QA 3FX2A 2PVPA 4XGKA 5B2EA 1XQVA 2ZI5A 4ITRC 1JFFB 4HLQB 1Y5RA 1JJAA 5FOQA 2Q2WA 2DPLA 4UFPA 5F2NA 1TAUA 4YAKA 1XDNA 3PR3A 2VF7A 3UWDA 3M6WA 3MQ2A 5COBA 4QQFA 1B8OA 2ECFA 2K2WA 4WFAJ 4NCHA 2FEAA 3F46A 4C2AA 5CFRA 5CDFA 1BA3A 1YD7A 1TJPB 2X3YA 1CUIA 4QUAA 2JJ1D 1YRLA 3UMFA 4CKEB 3WOHA 4AT1A 3U44A 4M89A 2VNKA 2OMDA 3DQPA 1QPRA 3I01M 2AFVA 3AF2A 1GZVA 1P44A 5BN3B 5FBRB 3IKTA 1DMRA 4EO4A 3BSFA 2J46A 3KHHA 5F78A 3AI3A 1T5LA 4FJ1A 1VS0A 1QRTA 5H5JA 5BR8H 4FHEA 4MWDA 3P0JA 4IH9A 4ZI5A 1A9RA 4XLLA 3HVJA 5AOVA 3ASUA 4Z0PA 3BORA 4UREA 5A03A 3W4JA 3G6WA 5DHTA 4FFNA 4PZYA 2YBDA 4HTFA 4BLTA 3RF7A 2I6TA 2W2NA 2XXBA 4MUNA 1XMXA 3AW9A 2XGQA 1WXIA 4NU5A 1PL6A 3G2NA 4MS4B 2QTBA 1V5EA 1QDEA 1HQDA 4CKBB 3L06A 1N5RA 4X64B 5FCDA 1VB3A 1KO4A 1ZITA 4KR9A 3OUZA 1M1NB 2B9VA 1ZDMA 1RQXA 1D4OA 3RKUA 5CYFA 1HOTA 3HWRA 4ZZ2A 5HE8A 3VHXB 4OJYA 1JE0A 3KQPA 4MW0A 1W94A 3NBKA 1BMQA 3KR2A 3OP4A 4JNCA 2EGHA 4MUIA 2VBCA 4B4UA 2C4UA 3GEEA 3KOUA 2H8GA 4RF4A 4BVBA 3HU1A 3A9SA 4X94A 4BV2A 2HIAA 3TB4A 3EJWA 3DHWC 3EN0A 4PTLA 2H16A 3RS4A 1SPBS 3QLUC 3FKIG 5EMLA 4G6ZA 1EFVA 1KIAA 2QAGC 2FW7A 4DNOA 1HZJA 2I2FA 2XCSB 3RVOA 4LVOA 3VI3B 4DLXA 3NDIA 3SIXA 5EQDA 2EEZA 1DMSA 1D1PA 2QVLA 3AIMA 4RY0A 2OKCA 5IK2A 3W5IA 5I01A 1E2EA 5I7SA 2IHUA 1RAFA 1W96A 3F1LA 1PG5A 1LRKA 4DW8A 3BXXA 3MN1A 1Y6GA 1K1SA 1UDXA 4DL2A 5ALKA 1H4QA 5JT1A 2H65A 1XZ8A 3NHUA 3QTLA 3FOAA 4QUGA 5JAUA 2WSMA 4G26A 5DN6A 1IUOA 3IAEA 3NANA 4XDGA 2HEIA 3E03A 4CI9A 1BSVA 1I0IA 3W1WA 3AQ4A 3UZBA 4EAFA 4EF5A 4ODIA 3GBPA 2DF8A 1A9PA 3WZMA 1XZEA 4A4DA 5C35A 3EMBA 5HXAA 3KVNA 3QKSA 4P92A 2AJCA 3DE2X 3HJAA 2XUOA 1UMDB 4GYYA 2VF5X 2XNHA 4FBLA 4J9OA 2FSSA 4LOHA 1TVKA 1KYVA 1NU8A 2WKRA 4QSHA 5E1OA 3UHJA 4E5VA 3W6NA 3PR5B 5DHRA 3U4HA 3W2HA 1RRKA 1NOKA 2JS7A 4NOLA 3V4VB 2AFHE 4HJXA 3H9BA 1XZCA 3LBYA 5ITZA 1QF7A 4Q18A 5F3DA 5A7GA 3O6VA 2GB4A 3WO1A 5ETJA 3H2ZA 2YCHA 2JFXA 4QLAA 1AHIA 1UINA 4O4LB 2QRQA 2GT1A 1RWOA 1TJ5A 1CS0B 4JP5A 1FFAA 2D1RA 5JZBA 4Q4DA 3A4NA 3V7YA 3RTDA 1BHJA 2EZ9A 1RYMA 2ASVA 3OY2A 4Q05A 4PZUA 3QVJA 2I7TA 4KAJA 2C4NA 1USWA 1UT6A 3WIBA 2OECA 5EJ9A 5AFSA 1Q57A 4KIWA 3A4TA 5EP8A 2CHUA 2R5NA 4NJEB 1O58A 5DISB 2G1JA 3PHGA 4JXUA 1K06A 3DH0A 3GIWA 2DHQA 4LPKA 5I7VA 2XWQA 1E63A 3IUSA 4G3IA 3MGBA 3RHSA 1FMFA 2W6JA 3MELA 2O20A 3CSWA 5L1JA 3EG9B 1VLLA 1SBZA 1NOIA 4W9NA 3RLFA 1WABA 2CVHA 2O3UA 1QGDA 3MUNA 4JIGA 1JWLA 2HXGA 1JWBB 4QIHA 5E8JA 1HMYA 1OXXK 1K5PA 5IWAB 4M9QA 4WINA 5EYPA 3SVLA 3D1JA 2AA3A 1T94A 1GPYA 1FTYA 1K92A 5GOZA 2I54A 3V8PA 2YOGA 1O9HA 2J4CA 1BMFD 4LPSA 2V9WA 2ZCJA 1C3VA 3PUYA 4P35A 3FBGA 3RT1A 5L4SA 4Z9XA 3HKEB 2ADMA 5KU7A 2W55B 3CNHA 1H2ZA 3SN6A 1FVFA 3I0ZA 2Y0SE 5DRYA 1XRPA 4EBEA 3VDRA 4BLSA 3QEKA 1N9GA 5A3VA 3AF5A 1Q77A 1QMGA 3UKOA 4EVQA 3VU3A 4E11A 2P5UA 1Q0HA 4Q3KA 3J81k 4R16A 3L0DA 4CMGA 1QK5A 5CVTA 1DL5A 2C5EA 1IJBA 1T8UA 3RU2A 1DRUA 4YR7A 3HRIA 3CR8A 2OLJA 3AHDA 1XN4A 1KYXA 5DKFA 2GTHA 2GJAA 5FLXA 1JIIA 2Q3EA 4WBNA 2B5OA 1G3RA 2FEOA 2Q45A 1I1OA 2GH1A 1QYXA 1CCWA 3CRMA 3FRHA 2E4XA 5KOHA 1JE1A 4BUJA 1T6XA 4TRMA 3HDGA 1Z28A 2OB1A 3PZBA 1T6YA 5FPYA 2VPTA 2XJ9A 2EP8A 2JDID 4R8SA 2NIPA 3UENA 1KEEA 4HNQA 4TL6A 3V00A 2P78A 3DKRA 1LK5A 5IT9A 3NRJA 1E6EA 2YJTD 2O9JA 3AR8A 4GKBA 2JGAA 4CKXA 1DZIA 4MLZA 4PEVA 1QTIA 5BSFA 2WWHA 3NHSA 1E59A 3ZCXA 1RYDA 1P4AA 3L7NA 4EPYA 1NW7A 3WLLA 3CO0S 5G0TA 5A3JA 2QVXX 3U56A 3QLJA 4DC0A 4F3NA 2QL7A 4YT4A 4D5EA 3C14C 3LSYA 3DCJA 2HHHB 1TI7A 1ATIA 4LH7A 4DJTA 4MV3A 2WA2A 3NTLA 4QDOA 3MMZA 3IQFA 3GXOA 4DNFA 1TU3A 3DT8A 1H2FA 1C30B 4NZZA 1TYEB 5DBGA 2HLDA 4BVEA 2ZREA 1QHHB 1XZMA 3MBIA 1MQAA 5M5BA 3RTBA 5J2TB 1A8IA 2DLDA 2WDZA 4HH3C 2DXIA 4HL6A 4AJIA 3T5BA 1JAZA 4DCVA 3MR3A 4ENSA 3A2LA 4FUTA 4I50F 1FRNA 3I9JA 5JY6A 4R81A 1J0CA 3ZN2A 1A5BB 3C3AA 3WL6A 4PBSA 7AT1A 4P82A 3GAAA 1MT3A 2B1JA 5G4KB 3P4YA 3SDZA 1ST2A 1YFJA 5CFNA 1E9AA 4NOKA 1RXVA 3S5UA 1XQXA 3DD1A 2VZ9A 2J0QA 2HRQA 2V3WA 1LTHR 4NYJQ 4DWJA 5CX1B 4CF3A 2W8BB 3HVHA 1GKUB 4NY1A 2JIQA 3NM4A 2HAEA 2GFHA 3BD6A 1EVLA 4Q37A 4MS1A 1KJZA 4GOXA 4JL6A 1RM4A 1RWMA 3P9ZA 3V8MA 4Y0NA 1DAMA 1FSSA 3H1EA 2QRGA 4BLOA 5F9HA 3VNVA 3VRHA 1AGXA 2UKDA 2PEYA 1AUPA 5CEFA 5GADl 4D4MA 4HGOA 3FMFA 1V25A 3VA7A 4X66B 1NMQA 3G1WA 2HRDA 5ADWA 1M8KA 1T4GA 4QWMA 1J99A 1A8HA 1CB7A 3HOVG 2AD1A 1I3NA 5G0SA 2PKWA 1NBWB 1LQTA 4X97A 5J5VA 4QPZA 3HUDA 3CUWA 4GVLA 2RG1A 3FNQA 2NU7B 3F74A 1NVUQ 4FNGA 4V0SA 3CHYA 4G4GA 1QF6A 3CF4G 4DV3H 2H11A 4IIDA 3A31A 3LY7A 4XFKA 4Q4AA 4EMSA 1OOEA 3QSYA 1SKUA 2QTHA 3UUEA 1N9ZA 3UT5A 2GN4A 1A77A 1AN0A 1IZ9A 1L0BA 5ALYA 3TEFA 4FFLA 4GVXA 1E5TA 1S6YA 4K9LA 4F71A 1Q1NA 3ROPA 3PU6A 3GAFA 4LAFA 1NN5A 3K5HA 4N3AA 4UOZA 1C81A 2Q46A 2Q41A 4QGAA 2NSDA 1PDOA 3TMAA 5C3UA 1RIFA 4FYVA 3DAAA 1DAPA 2XDWA 5IAOA 3PFHA 1X87A 3GDHA 4CEIA 3K70C 3CMMA 1ZJJA 5DIZA 2C58A 3LM8A 1JFVA 4CCYB 4C4RA 1VQKH 4NI5A 4O7VA 4EX6A 5DNEA 4EA7A 1R9TA 4J9VA 1RHMA 3WGIA 4PW0A 4G36A 3MD0A 4GWKA 4HTAA 4ZKEA 2DSTA 3IEIA 1XZKA 5P21A 3FNEA 1G20A 1VCNA 4BFVA 1OWOA 1IZ8A 4LC0A 5JJ5A 3TRHA 1XEWX 4P38A 1F9AA 1FUUA 3TQHA 1X7HA 1TF2A 2OWDA 3DOJA 4JUIA 1JHXA 1NXPA 2X9QA 2ZB8A 2KX7A 3O1JC 4YHBA 3SYNA 1AQNA 1QIDA 5HGJA 3GG2A 3ZEAA 1I24A 6AT1A 3H17A 4NDAA 4OQMA 2VNJA 1T0HB 3ACBA 1QB8A 2HMWA 3ANTA 2EDAA 1IBSA 3MIIA 4EJ2A 2ZXEA 2H9AA 3KYIB 3LK6A 3B78A 1KWGA 1RKUA 2UZ1A 1D1TA 4TVKA 2DABA 2WAQE 2O8VA 1V7PC 1C8BA 4WVFA 1A8SA 3U40A 3DLPX 2QY9A 2OXCA 1U7PA 2FP4A 1CETA 5ARBA 5LJIA 4X3CA 5DMXA 3D5QA 4IDPA 5A1TA 3U4AA 2QTWB 4ZT2A 3TQIA 3MHTA 2ZBFA 2N46A 3RYCB 2VP5A 1TU0A 5EWMB 3CE9A 4EA6A 2BFBB 4P3NA 3UXYA 4XWTA 3QKRB 2OK7A 2GYVA 1T1JA 1NVEA 1WX1A 4LF7B 1T9KA 3BBPA 3IE0A 1G8YA 2PBRA 3UJDA 5AW0A 4D9NA 1NF3A 1HZZA 2H08A 2HHCA 4OLJA 2Q0XA 4M2LA 5P8WA 4M1OA 2GSDA 3DZDA 4G0WA 3B3JA 1NURA 3OQJA 5BN4B 3U3RA 2PO5A 2VDNB 2FU5C 5ALWA 4EEKA 5FLMG 1GPAA 5HEKA 1TA0A 1P3Y1 1W4BA 3R5KA 1JYSA 4RD6A 1QIFA 3E05A 1OASA 1G1AA 4HDMB 4F1JA 1Q14A 4HMOA 2OR3A 1GPH1 1UPTA 1W44A 1YGPA 3IQIX 4EKNB 3GTPA 1LRJA 2G9NA 3T7IA 1L2TA 2YBEA 1K3TA 1U4SA 4BJ3A 3NVZC 3PRHA 2XKAA 1FXUA 4WKPA 3HB9A 3P0HA 3GEPA 1XNRH 1OLSA 4E6PA 5EMNA 4KFCA 1VL6A 4DRXA 3IBYA 3D8TA 4YPVA 2W37A 4PFJA 1FW6A 1RMQA 2PO7A 3GDEA 3PNBA 2VJMB 1RZ3A 4OFZA 3MJDA 5DM0A 1QQ6A 2QT0A 3BGOS 4J4BA 3REGA 4RJ2A 4B2IA 3TZKA 5AOAA 4JXZA 1UL1X 4C2TA 4C0XA 3GGGA 4MH0R 4EY6A 2B7LA 4MRMA 3UB4A 2I7VA 3ZV7A 4QOEA 3WWJA 4DBLC 3PIPJ 5I8WA 5GONB 4WZBA 4OAOA 4J1TC 4PC1A 4F4HA 3N8HA 4P33A 1KK3A 1P7VA 4RULA 1FFDA 2AZ4A 4HNSA 4PZLA 1LSJA 3NRCA 2ASJA 4DA6A 1W4ZA 2RMKA 1ADBA 3T54A 2HQSA 4O7NA 3V7WA 5HIIA 1WDLA 4HATA 4J0MA 1TUEA 3D31A 3W3AD 5EJ2A 1G6Q1 1Q0PA 4NFSA 1SKYE 1FBNA 2G7ZA 2ZRFA 6PFKA 4ABYA 4GR5A 1U0BB 4C6TA 3NM5A 1EP2B 3LCMA 3ER8A 1PJ8A 2QLBA 3DB2A 1BHSA 3KYCB 4TM7A 1I1HA 4DM7A 1JQBA 2NG1A 2XTJA 5C8YA 2OZLB 2DFTA 4WLNA 4YT8A 1PJAA 1Z2OX 1SHZA 3RFXA 3K09A 1M33A 1P5FA 3R0VA 3QY9A 4D8UA 4TS4A 1GG9A 4US0R 5B1IA 3KXPA 1ZWKA 3W8RA 2AZXA 4MR8B 3U48A 1X94A 5KREA 1ZUNB 1WY5A 2BCJQ 2WNSA 4KFTA 4QZVA 1V3QE 1U98A 4YRLA 2X19A 3TQSA 1XPJA 1XZGA 2CNBA 3X1ZA 2A9PA 5FRDA 4JS0A 1JXMA 1N3BA 2R4UA 1PFUA 4URVR 3O2SB 3ZX4A 4IX1A 5H83A 4I66A 1J23A 4MRRA 1MO6A 2ZQ5A 1KL7A 3BMQB 3WXBA 1UP4A 4B84A 2I1WA 2AD5A 1O0CA 5EHXA 1P7ZA 2EBUA 1NLZA 2YR0A 4MW9A 2Z2JA 3C98A 1QS0B 3UWKA 1U8CB 2YRFA 4KGXA 1XMPA 4TOIA 2B0CA 2G1UA 3O8CA 5SZIA 3GZNB 3ILHA 4PPQA 1MZVA 4TLBA 3HCWA 3S6JA 1RAEA 1CY2A 1P2DA 2Y6UA 1EZ4A 1UBKS 3GRRA 1PJSA 1JXOA 5JYEA 1VECA 5E7JA 1GGFA 1Z12A 5BSUA 1EFPA 2NXNA 4MQBA 4B2PA 4CMKA 2BZSA 4WOBA 1O3YA 4R1UA 4D46A 3TWOA 4F93B 3F1KA 2ZYHA 2HJVA 2WFLA 4YECA 1W85A 3C8UA 3I5MA 1SBQA 4F06A 4D4LA 4MA5A 3AZOA 2VPWA 2XA1A 1M6NA 1GCIA 5SZHB 2FPPB 4BX8A 3C6BA 3G1UA 3JZDA 1P6UA 1PHRA 2Q07A 2ZVJA 1NJSA 1A9SA 4QYWA 4NV1A 5EKTA 1T0BA 1YBFA 5CLIA 4LFCH 4K86A 1N7HA 1HE2A 4EYKA 4TS3A 3DLAA 1G60A 2FZLA 1ANKA 1ZIXA 2Z08A 3UMSA 5CG2A 2ZJTA 3D7MA 3HOZG 4C5CA 3QY0A 1W1WA 2QM7A 2OZKA 3VKWA 1C1XA 2XQVA 1NUSA 4QNNA 3QKTA 3HYRA 1I9GA 3NEJA 1JJVA 2O06A 2RHHA 4WLUA 5DP2A 3WFZA 2FPKA 4FWTA 1QPGA 3W9YA 1Q0RA 3UJ3X 4EGAA 1U9IC 3FTQA 5G53C 4LECA 2IS6A 3QEBZ 4A3BG 2VBFA 1I1LA 1G7CA 2Q2VA 4UDXX 1DQYA 5CA0B 1MBZA 4NYMQ 3K53A 5AI8A 1TF5A 2G72A 2P2NA 1C7EA 4M6WB 1ESEA 4QHTA 5SYAA 3R4VA 3O31A 1OWNA 2HTFA 3OHBA 4YRZA 1IM2A 1KNXA 2Q3BA 3V4SA 1CUHA 5IYBG 2EC5A 5B6JA 2FE4A 1I4LD 4G81A 3Q8SB 5DGDA 3ORQA 4I55A 4TUYF 1R10A 3INGA 1U0HC 3DBHB 1MTOA 3SQLA 4NK5A 3OSZA 3SCZA 2VPYA 5TVGA 4OXQA 1Q3TA 2EKLA 4QEKA 1W4CA 2UV8A 4R69A 1EE2A 3JWHA 3ONNA 3KOZA 4A8PA 3MF4A 4O86A 5HBRB 2OBFA 1RXWA 4XQEA 1LV8A 3U13A 3V2GA 1MC5A 1WCWA 4E2FA 1DDGA 1NNEA 3IB3A 2HXSA 2EKQA 1ZHFA 4RVFA 3RUFA 5LDGA 4O8ZA 2DOKA 5KAMA 3EEFA 3GRZA 4Q7MB 3IULA 4FYXA 5DX1A 2PH5A 5BUSA 3ELBA 3LXUX 2JFHA 1QO0D 3OUUA 5JAQA 3ZDQA 1BXGA 5LVAA 4IIYA 2HW8A 3FCYA 2J4DA 2DWPA 4NH0A 3EK2A 3TL6A 1RW4A 3PWSA 3LWBA 1P72A 1DV1A 2YHIA 3HSSA 2C5LA 2HT1A 3EWAA 3U7JA 5TMDA 4I5EA 3PD1A 5A3RA 2C83A 2ZJZA 1Z17A 3ONEA 1QDUA 5FJ8G 2IK8A 2JLCA 1CF2O 3S55A 5EWJA 3BICA 3I39X 3SJBA 4MS4A 4B6SA 2VOBA 2IGBA 1UP7A 3WYBA 3A6JA 3PG5A 1S3SA 1OFIA 4GKAA 4CIAA 1XHLA 1IHUA 3FNGA 1M2EA 3NWBA 1BU5A 1ZR2A 3NDBB 1KIFA 3CLHA 3TL3A 3VQTA 1YR2A 1X8JA 1YI8A 4X6LA 2YJ3A 4LZWA 2Q1XA 2B4KA 1M6EX 1ZIPA 1QAMA 2YWCA 5FI1B 2JEOA 3ZLBA 1CUFA 3FDIA 3RRZA 3QFCA 4NX2A 4KQHA 3UATA 3H84A 4O4HF 3U49A 821PA 2CFSA 2PD4A 2F8MA 3LOUA 1VGRA 1JMVA 3O4VA 5EWEA 1FVHA 1DKUA 2JIDA 1T2AA 4HAVA 3ZJ5A 1DJNA 4OXNA 1OBDA 2HX1A 5KG4A 4LBYA 1SVSA 4HDSA 4LF5H 2FMXA 5HZGA 4OHBA 5IZ4A 5KYGA 2O3JA 1DCKA 2X5OA 3C7TA 3RAFC 1UBUS 3NPAA 3OSPA 2AR7A 4CV2A 3WB2A 4WXMA 2OC9A 3MCWA 3ZGZA 1Q3KA 1A98A 3OLQA 2YY5A 1GFZA 1NKTA 4Z1OA 1EM8B 3D3WB 1WUTA 1NRIA 1TE2A 2HDWA 4MVJF 5A0FA 3QVVA 3ZE6A 5IANA 2P79A 3V42A 5I9SA 3QQPA 3LPNA 3T3PB 1D8TA 2PJZA 2NUBA 2ZZMA 2JKYA 1U1FA 1C0PA 1KERA 4PR3A 5JNWA 4RH3A 2UUCH 1W9HA 1SCIA 4M3NA 3INTA 1XZBA 1P4SA 3CR3C 1V39A 3SC4A 3M9OB 3W1EA 3B2EA 4FMCB 1LU9A 1UMDA 3X1MA 3GLIE 3I4NG 3OKCA 3QLVC 2M9MA 1MF7A 2Y67A 4B4OA 4BPBA 4PLGA 1TA9A 3D2BA 2J08A 1JNYA 1VSVA 1T9HA 2CDBA 4A3SA 3OIFA 5BQPA 2PGOA 4HYQA 1VBKA 1QH8A 2JA1A 2YQ4A 1GA4A 5JZVA 3ICWA 1QR2A 1KSHA 1UBNA 2EFYA 1RYBA 5F7ZA 2P4QA 5H3CA 3LO5A 4EY5A 1ABBA 1GTZA 1VQNH 4QELA 2IE0A 1MNQA 2I9PA 1FJ2A 1GQYA 2NO9A 5I4CA 3VTAA 3GRKA 1K4KA 2Q1TA 3CNQS 4Z9YA 2WVHA 1N33H 1TD1A 2JF0A 1EE1A 2ZTVA 1GPBA 5KFPA 1IM5A 5AKLA 4IDGA 1RC1A 1XT6A 3PYLA 3CUKA 4HDAA 3Q41A 3SM3A 2FE1A 3T5KA 2FWMX 1ZA1A 3KTAB 3OIGA 4Q1AA 1Z5PA 4L5CA 1U0FA 2GLUA 3E7DA 2UVUA 2A14A 3TCKA 4QWAA 3NIWA 1T5OA 2CFCA 3AOGA 1Y9ZA 5AXCA 4TROA 4DMRA 2VVTA 3QIAA 3LD9A 1JQDA 2V7XA 1E1RD 1R64A 1UMCB 1LDEA 3TZBA 2VF4X 4HLUA 3RC2A 3FAKA 3ZLVA 4PS1A 4D8VA 2BKLA 4IIGA 4ROSA 2ZI9A 4YP3A 4E6EA 2JCYA 1CZOA 4N0QA 1IFXA 4F21A 4ESEA 1C4KA 1GP2A 5ALTA 1BRTA 3BB4A 1F0KA 4AJEA 2ATEA 3FWPA 2W0SA 3O9ZA 1B73A 3DXXA 1GIAA 2PCLA 4D96A 3H0EA 1XD9A 4JYAH 2I7CA 3RC1A 3NHLA 2RCNA 1N0UA 1JT2A 1ORRA 4RMIA 2DUMA 3TIGA 1FJHA 5K20A 4MITA 1L9XA 3QG1A 4ZO8A 2QRLA 1SXJD 4RV5A 5J1SB 5KFOA 4FWIB 4D3SA 4R2MA 2NVBA 4Z3DA 4OK6A 3RBZA 4DLNA 3TH5A 3W3AH 2CCJA 5TT0A 1KEKA 4PGGA 1L7OA 2C5FA 1Z8HA 1GNRA 3EWSA 5JCJA 4I50B 3SNKA 2G5TA 5JLJA 4M1YA 4NDNE 1EFRD 1Y9EA 2XMDA 5BV0A 3NP7A 4EW1A 3W5JA 1N2GA 2FETA 1JU4A 3IBFA 3D3NA 1NG1A 2A67A 3ONFA 4E5MA 1EPUA 4GSYA 2HZBA 2XDQA 4PC7A 2FFHA 2EZUA 1BCSB 3R3VA 2WZBA 2QPLA 2BMDA 3GLFE 4BX9A 4NCAA 3KWMA 2CDAA 1VQ6H 3L93A 2W4MA 4HR7A 3KKQA 5FULA 2YV1A 1QGUA 2BQRA 1CY6A 3JQBC 4F04A 1DUSA 2GEUA 1AZTA 3N6XA 4IBOA 2GF2A 4ZOHA 1JG1A 3ES9A 2FFAA 4MP8A 3P97A 2FRDA 2QX6A 2JI4A 2R8RA 2JEIA 4UASA 3Q3IA 4BN4A 4BEJA 2VYND 2ZJ5A 3GEGA 1C30A 4KIFA 3RYHA 2LPMA 4FIZA 2VOEA 3M3HA 5BWWA 3DEFA 2FDCA 2WY2D 5IP5A 2OOKA 2YUIA 1Y3HA 3KB6A 3B2NA 4ND3A 4HDKB 4CT5A 2AWOA 3O8OA 4KZKA 1PYDA 4K3VA 1XZLA 4BNUA 4B3MB 4YO8A 1UIRA 2WABA 2ZE5A 2X0IA 3HKZE 1ID8A 4PAOA 1SWWA 3EIHA 3HY6A 5TY0A 4URZR 3C74A 1Y42X 2EARA 2DUWA 2X22A 2PTHA 1GVNB 4RIGA 1PZFA 1UKEA 1OC2A 3ZV5A 4O83A 4NPAA 2Y68A 3SOPA 3QX9A 3T1OA 4G0NA 2PWZA 1FNDA 1DAHA 3D8SA 5G4KA 3TW8A 5K6AA 5T14A 1KBZA 3KV1A 1IIBA 3D6MA 4PPGA 3EA4A 4EYSA 4B7CA 1P77A 3DE7X 2OHJA 2BLNA 2F3UA 4KIGA 2F1RA 3C5EA 3IUEA 4U2FA 3L7KA 3KZCA 3A04A 3HR8A 3AKEA 1FDVA 1XF1A 4QU5A 1KDVA 1QGYA 2RBGA 3D0KA 3LI2A 1COZA 3C41J 4H3VA 5IUNC 4LFAH 1IMJA 1WKBA 4HMPA 4Q1BA 3EZYA 4YROA 1XD2B 3NJRA 3I09A 3FAHA 5CNIA 3ZGNA 3OIVA 3VPSA 1Y1VG 4D9HA 1AVTA 3TMKA 2PUDA 3LMLA 1ULBA 3TOCA 5HS4A 1LLDA 1TW2A 2GPTA 4UCXA 1P7WA 3PN1A 4HADA 5KIAA 4P80A 4ZU6X 5GJWC 3BXOA 3KDAA 1KC3A 1DARA 1C80A 1X86B 1PJTA 2ODBA 4LJLA 1ODKA 2IF0A 1RYEA 2XCRB 1QX4A 2NU7A 4KE7A 3LLSA 3GFOA 3VVCA 1C2YA 2PX5A 1G4HA 5JHHB 4D8YA 1NR7A 5LWQA 2FMHA 2R6JA 4KLZA 4N54A 2EKBA 1B76A 2PG3A 4NJMA 4LVNA 3OTOB 4BNDA 1W0JA 2OXFA 4FGKA 3CLUC 4O3NA 2ZRKA 3NTXA 1ZHOA 3MBOA 3R8CA 1RM6A 4MUYA 1UNNC 3AUXA 4JBYA 2CFOA 3PICA 1YH3A 1VL1A 1AZLA 2M6KA 2Q9BA 1T26A 5BUCA 1U0LA 3KBBA 1PBTA 2CJWA 3S2IA 2ZWOA 1DJLA 1OB2A 1JEYB 3BAFA 3GV5B 1HDGO 1KVRA 3LFUA 5HF9A 2RGXA 1JIUA 4BNKA 1J8MF 4LJ8A 3GDOA 5IXSA 2XA9A 4DL3A 4ZAGA 4PCUA 3KZ1E 1CVRA 1TT5A 3RV3A 5KQGA 3Q7SA 1NI4B 1DFHA 1GJRA 5GADN 4S1VA 4DLAA 4UTPA 5K0CA 2VSYA 1SXIA 1RYZA 5JMWA 2I2DA 1LDNA 1E1NA 3BBLA 2ZFUA 1ACMA 2W8KA 1PKXA 2PD3A 4OEHA 1X7GA 3ODPA 3BH0A 4AO7A 1C7ZA 1DXQA 1GQOA 2C9DA 4CDRA 3TW6A 3WO0A 1WUJS 3HK2A 3AHGA 4BRSA 4RPLA 2H1WA 2YC4C 2IOFK 5U4QA 1XRQA 3FYUC 4BQFA 4C0BA 1PKEA 1VDMA 1SCAA 2I3AA 1QOZA 5BR4A 4OQ4A 3U19A 4M0JA 1YQ9A 3UAXA 1I4WA 2PM8A 2H3HA 1OTHA 5B5SA 3KYHC 1G2IA 1ARZA 1NBEA 4AS1A 3NDJA 4JASB 4NH4A 4YGYA 4NBLA 4KNYA 3QHAA 1UXHA 3D6FA 3ZIDA 5E7MA 4XDHA 3RBEA 3NAMA 3S2SA 1NQ5A 3SBXA 3VPHA 1XDWA 3ICOA 3ZHCA 4ARUA 1MH1A 3Q7IA 1J56A 2VDRB 5DCUA 5EGNA 2WIBA 1CQZA 1YKSA 4B5LA 2KYRA 1J20A 1K9SA 3K0FB 3IEUA 3B85A 1YZFA 3CVJA 5KX5F 2Z6QA 3T15A 1JIVA 4WVLA 4MI3A 1OKKA 2IXBA 5EWMA 2BFBA 1ZM2A 5JCPA 1PT9A 1PGPA 1ZGCA 3Q7TA 4X1KB 1RWNA 2AN5A 3IUJA 3TJZA 5KKNB 5E6UA 3EUB4 1L3CA 3K0CA 4I1YA 2ZJ2A 1KYQA 4JJGA 4GGOA 5LP6F 4HQFA 1EB9A 4RVGA 3MWDB 3ZUGA 5FPTA 4OA5A 2GQSA 4HZIA 1HDCA 4QBKA 1YFKA 3ZK8A 4AUMA 3OQMA 3RPFA 2EJ2A 3FDSA 2HBRA 2D2EA 4W82A 2PGAA 1EBUA 2IZ7A 1I1MA 3UMYA 4JV0A 4WCFC 2W6JD 4ON9A 3K8YA 2O2CA 3CM0A 1L7VC 1W73A 1KVQA 4X7RA 3I32A 3RF2A 1FQJA 5K0ZA 5JY1A 5JD6A 1MOSA 1P9NA 3F0TA 3K4PA 3FYSA 2IELA 3SKYA 2EV9A 3GEHA 1ESCA 1ZCBA 4PCVA 1I6LA 5KI6A 1GM5A 2HLNA 3C48A 5DTRA 2SNIE 2PSEA 4NLGA 1I7PA 4HY3A 4WGFA 4L5BA 3NTUA 5JSKA 3UK6A 2IV7A 1XJWA 3QWIA 1NLFA 3H1PA 1AV6A 3L6RA 3VR5A 2XD9A 2O05A 1KPIA 2KJQA 3LFTA 4HX9A 1UKYA 3OPYB 5ELLA 3SNOA 2CLIB 3IUYA 2CFIA 5BURA 3EGVA 4R41A 4UCQA 5DK6A 3O8RA 3EQ9A 4AMBA 2MCFA 3R20A 5CR9A 1V8FA 1E1KA 4NNJA 3K5WA 3HJUA 3AV0B 1M73E 3EXIA 2PGIA 5MGBA 5LD2C 2OTJH 3DOUA 1XCPA 2PPLA 3VO8A 1SU6A 4EA9A 2OWEA 2MR6A 4MROA 4CWAA 1G7SA 1A82A 4FZJA 2WZCA 4BWGA 1XNQH 5BMOA 3LW8A 4EADA 1I6MA 3OE1A 3CPSA 3AVUA 2GQ0A 2QTCA 4MJLA 1ZL2A 2Z0MA 4PBCA 1AOXA 3L41A 5DBHX 2JI9A 1D2RA 1M8PA 3AT1A 3D3JA 3HRKA 4HNVA 5U9CA 1KQ3A 2IMWP 4GQAA 2RJ3A 1VYVA 4HAIA 3UB2A 3TIIA 4XSGA 3NOXA 1KSJA 3AZQA 4ECAA 3RUIA 3D0RA 1Q16A 1CZKA 4LSWA 2A0YA 3AVPA 2I2WA 1R6AA 1C9EA 4L4XA 1YONA 2ZSEA 1JFRA 3V4FA 3IPRA 2RHRA 2XTMA 1OGIA 5EP2A 1GAJA 5HTOA 4J9QA 1N5DA 3OCCA 1CRWG 1A4RA 1E98A 2IIVA 3B9RA 5FLEX 2PX0A 1QH9A 3PXGA 3EXHC 2RHCA 4LHEA 4QSMA 4BAUA 2XMQA 5DNDA 2BEUA 3EH2A 5C80A 1W36D 4QW8A 1OIWA 5JYDA 2BMJA 4KR7A 2PD6A 3WMEA 3MAJA 2BHTA 1TTQB 2AUMA 4M9RA 1AQUA 3I5YA 2V9ZA 2PXCA 1U3GA 2FX3A 1I3LA 2CNOA 1N4DA 2ACEA 1RM0A 4DLLA 1U0SY 1I0LA 3LSTA 2PL3A 2HLDD 1S89A 2TMGA 1UBHS 4U7GA 4GE3A 1P1RA 2PZJA 2ISSD 1JEAA 2QYTA 5LIPA 3IHTA 4K05A 4I1OA 4NBSA 3GAMA 1MEJA 1NUPA 3FTDA 3BHMA 1TMKA 2HT6A 4BTEA 3TR5A 4ARSA 4I6JA 2H52A 4QKQA 1DO8A 4F2WA 3WQSB 3GZNA 2IYFA 1N60B 5AMXA 4ZAZA 2WMDA 5BSRA 4FDTA 1BN6A 1JX6A 1AGYA 2W6CX 5ED4A 3DLIA 4TWBA 4CQJA 3A3NA 3EF0A 4Q3OA 1AC5A 1VKNA 2CV1A 2Y8EA 5T67A 1EIWA 3ZVNA 3SEAA 4H6PA 2HHJA 2Y93A 3I1JA 4EY4A 1HI9A 4QE3A 2ONCA 5D8DA 1VE1A 4UNPA 3V6KA 4BUZA 2JJYA 1U6JA 2I2BA 3E84A 3IP5A 5DASA 3TM5A 1S2NA 1TZ2A 2QVCA 2EKZA 2HMYB 2WTNA 1U8AA 4A91A 2VDKB 2GRAA 3G2HA 1EDOA 4OIFA 3UAZA 5GV7A 1EFLA 5FOTA 2QL6A 4YJHA 1BKSB 5L45A 2GRUA 1K83A 1O89A 3FVRA 1AH2A 5BWNA 4OUDB 3DDHA 3CKKA 2QVYX 4TMYA 4JQOA 3DEJA 2QZ9A 2AW3A 2E82A 1KFEB 1XRMA 3KQOA 2X8BA 2V7PA 3IXQA 5CRIA 1E9SA 3CRRA 4BLRA 3KOYA 4S2UA 5EXDA 4MR7A 4NNOA 5CGQB 2EZTA 3DDZX 1DAOA 3EVEA 1TADA 4IHJF 1NVIE 3EGWA 2VP3A 1YB5A 2XB4A 1W47A 2WKSA 2GPBA 4A6EA 1Y4AE 1IUNA 4Z3OA 3VDMA 4GKVA 1JG2A 4X7MA 3KSDO 5SZKB 2PEZA 2PGDA 3LWZA 4FVTA 4HNAA 3QVOA 2VI5A 4WW0A 4M8IA 3WA6A 2LE0A 3QYFA 2CMHA 2WIKA 1Y7PA 5TF0A 2QBYA 4LJSA 2CMDA 1RKBA 4FHFA 3BVPA 2QAGB 5K3FA 4IGAA 4E30A 5JNUA 1BKYA 1OBOA 2DH5A 3ITKA 4V1CA 2D5IA 3ZWXA 2HA7A 2YFYA 4D3FA 1DTWA 4J0FA 5ADUS 3FNRA 5AK4A 4IPTA 2QL9A 2RC5A 3IXMA 4TXMA 4D9JA 4ARIA 1A0GA 1P16A 2R68A 4QG7A 1F38A 5C1OA 3M1LA 3PL1A 4CT4B 2IYQA 2PSSA 5L3QB 4M8NE 5KNBD 3BFXA 1X7YB 4OAPA 3QA3E 1QJCA 1EESA 3IIJA 3AERA 4R2XA 3QHQA 5EIOA 4DCUA 4EBBA 4PIMA 2ZTLA 1G5FA 4YAEA 5IW8A 3VSBA 1ZH4A 3OD5A 3GFSA 1M2NA 5GAHN 1MX1A 3BXZA 2PUHA 2PRIA 4PX5A 2WWYA 5KG7A 4LI3X 1WP9A 1ZD5A 1TUGA 2HWKA 2CLMB 3HUUA 3V80A 1PAUA 3C5HA 3K9FC 4JKIA 4QICA 5AW4A 1NMYA 5IF3A 1ZGJA 1C1DB 4LHZA 5DBIA 3AOEC 3ZDRA 2ZGVA 4KIJA 2W9AA 1K8XB 2ZUSA 3WQQA 5F1KA 3QEJA 1VPVA 4R9NA 4MWEA 1ORHA 2JFPA 4UEQA 2BRUA 5K05A 1LNZA 3W7BA 2D8AA 5DNVA 4Z4CA 5AYYA 1B23P 4M0LA 4CLOA 1ZRMA 3S1AB 2G9VA 3PENA 2QUKA 4HWTA 1IQUA 3HCDA 4KAXA 4L5AA 5F21A 2UXDH 3VX3A 4KMMA 2JFNA 4D9KA 1KBLA 4G0VA 1NMZA 5CLJA 1JYEA 3UQ8A 3E9MA 5DN9A 5FI5A 1DQNA 1W2HA 1IZ0A 1TUBB 2H7YA 8GPBA 4C88A 1YL6A 2TMYA 3H5AA 1EM8A 2OBNA 3CUSA 5E9QA 4A5OA 3UKJA 1WVMA 3KYJB 2ZAYA 4DCPA 4HPJB 1OBHA 4JXKA 3GJ5A 3BC1A 1WUYA 5A4FS 2ZRDA 3RYIB 10MHA 3HJTA 2Z56A 3OY7A 4ECSA 1F5SA 2PZMA 2ZKIA 1FA9A 2PK3A 1Y1PA 4GRIA 3HZZA 3AVYA 2CE7A 2UDPA 3TN7A 4ZA2A 3RASA 3PQ8A 3NBYC 2Q2UA 3TUZC 2ZJFA 5T4BA 1H65A 2G28A 4YRFA 3PXBA 2H54A 1I8TA 1UUFA 2WMYA 1N0VC 2ET6A 3WHIA 4FFDA 1PO7A 3SFZA 4EEZA 2FPRA 5DQIA 4RVHA 1E2KA 3TEMA 1L4KA 1OB5A 1FVIA 2COIA 2ZYWX 5HUHA 4EQ5A 1NG9A 1ZUHA 3JYHA 1Z8DA 2I2AA 2B21A 1OR8A 2C2HA 2C2MA 4XX0A 2BZ1A 4R2LA 3K1TA 4JLBA 1BX3A 1NSYA 2J5XA 4L0DA 5B3JC 3ZE2B 4D25A 2I8CA 3M5PA 3GJ3A 4ZQFA 5AJUA 1RHJA 2OEPA 3BSYA 2QD2A 1G8FA 1VIAA 3JD1A 3MWEA 4GFDA 2W8LA 4C7YA 4QJ3A 4POAA 4O2BB 3KT8A 5C7YA 2PS1A 3L7OA 3D02A 4PFQA 5DGHA 3D7SA 2YWFA 4L5JA 1G16A 1GGEA 1RT9A 5LMNH 5LQMA 4C08A 3CUUA 4JIMA 1VKRA 2CUNA 3PFCA 2QTVA 2NGRA 2BZGA 2D13A 2VF8A 4Q9IA 1IBMB 2WJ6A 2GN2A 4JJEA 3QG5A 4MQEB 4WESA 3F96A 3OX4A 3D7LA 3CPWH 1DX4A 9LDTA 4ER3A 3G5AA 4R1TA 5DE3A 2Q0HA 4TQ9A 3WWEA 3KEOA 2I7XA 2OYCA 2VJCA 4OG2A 4ND2A 4D7AA 4AY2A 1ID1A 2JD1A 4Y1EA 5ADVA 1HRDA 2DBYA 5M34A 2PQ2A 4YMLA 5JAMA 4YBZB 3A05A 1K5HA 2XVZA 4RENA 4DR6B 2CJPA 2C3UA 1FLNA 2IYNA 3E3MA 1XRRA 1VG0B 4OQQA 2I67A 4TL8A 4F9FA 1K2VN 5JNVA 4JV5B 2VJBA 4PNEA 2I4NA 1DJMA 1UOPA 6REQA 3ORHA 5B7PA 3MJCA 4RB2C 1AQJA 3D2LA 3JD4A 1DCFA 2X8JA 3UHAA 5FR9A 1JXAA 4BVAA 4MTLA 3E9NA 4C7JA 2B61A 2H5EA 5AQEA 3HOUG 1WDWB 4CMIA 4H15A 5FB3A 3HCAA 4NXMH 3PYXA 4FR5A 5CAEA 5KFHA 1X2EA 1VLJA 1AKNA 5JROA 1JV2B 1AU9A 2IZOA 4WMLA 4LDNA 2JARA 5LP6C 3RS3A 4RY8A 3K6SB 2JHFA 3ETGA 3NAGA 1Q2UA 1H2XA 1PR9A 1GSHA 5AXAA 3OTIA 4ZQHA 2FN9A 2GJ9A 1DJQA 4XR9A 4C0LA 3T1HB 2FSGA 5DO9A 2NTEA 3ZGVA 4GMDA 2XGMA 1OZ0A 5HQ3B 5MPOC 2BI7A 3JQ9C 4MRSA 1E9EA 3GMTA 4OCZA 3WLTA 3GD7A 4JLAA 5BWCA 1F0NA 1G41A 1STOA 3PTLA 5I48A 3JARB 4LC1A 1RWXA 1G291 1EBFA 3RUDA 1V16B 3G8CA 1DE0A 4GBMA 1JLLA 3PVZA 4YCDA 3SJ7A 2BFAA 3II6X 1TK2A 5HF8A 3JQEA 3MG9A 1ENPA 2XUDA 4J16C 3N28A 3GLHA 1XQ1A 3UAVA 5I5VA 3ZZNA 3D6TB 1OGYA 3U80A 5ALUA 2WM8A 1Q6ZA 3ZKAA 4JBGA 4RV4A 4PRLA 5JR3A 1JDPA 1TQHA 2J33A 5ISMA 2QS9A 2QJFA 1YZ3A 4YMVA 2CHQA 3AEUB 3K9CA 4GLJA 4HEA1 4TLEA 3EIEA 5DHPA 3UFXA 1GLGA 4DCGA 3WIVA 4MIYA 3ILVA 3PQ4A 4I3GA 5J4HA 3CMEH 1NYRA 5LXTF 4AULA 4BZQA 4ACAA 3KM0A 2ZJYA 4M0MA 3PX7A 4TVOA 2Q8QA 3ZD6A 4FGWA 2MCTA 5J59A 4QQ8A 4V0RA 2VPQA 4PX3A 3PW0A 4RTOA 4QQKA 4Q45A 1Y37A 1N2JA 4YFYA 2YYAA 1D8AA 2CNKA 1QLWA 2Q5OA 2NM0A 5JH7F 5EIBD 5FOVA 2XW6A 3WJ2A 1BE8A 2FLWA 5K0BA 1JKJA 1V8OA 5AKJA 4MO2A 4R3UC 4CT0A 1RQ7A 2D0OB 3OZFA 3HI4A 4JB8A 4C03A 1KU6A 1C1HA 5K5EA 2E37A 4V3BA 5UKDA 1E6MA 1QSGA 4UTXA 2FWPA 5TVKA 1U28A 3KOXA 3QIVA 3DMHA 4GDFA 5FL7A 1XWIA 3RREA 3ZVLA 4LCEA 3OZVA 3BH7A 4UTNA 3SF8A 5JVLA 4QARA 1X9HA 5KFQA 4TTIA 2VDJA 3V8NA 3K70B 1JI3A 1Z7YA 1M0WA 4K6CA 5K45A 5KWIA 2PUJA 4U3JA 1U9CA 3ZE8A 4KX3A 4YJ2F 3DVLA 3HDHA 3IEXA 1EUCB 4LRUA 1WXFA 4M60A 1TZKA 2VXCA 4NTZA 1ZGZA 2JEYA 3O4FA 2LCQA 4JX8A 1PWXA 3I6YA 3BXHA 1N57A 5LQRA 1KI6A 2JI6A 2CMFA 4MWOA 2ACWA 1KI8A 5FUQA 4OPMA 3MSXA 1Z6GA 4N49A 2I87A 3SQWA 3T9AA 5CM0A 3ND9A 1RPZA 3P9QA 5KFZA 4NCBA 2WSIA 4XOUA 3RRFA 3NCHA 2E2HA 2FPMA 2V55B 3F5FA 2WK5A 3AX6A 4UHHA 3T4UA 1NF2A 4S0ZA 2B8WA 2HY7A 4X60A 2Z95A 2G80A 3ZVRA 4PLYA 1E3EA 5IKOA 1MB9A 1TZBA 2MJLA 2OQ2A 1OTYA 3KEQA 4CG3A 3ZDAA 1TYCA 4B3SB 5JRDS 4PC3A 4IH1A 5GQSA 3FDXA 5G3ZA 5DM2A 1VG8A 1FF9A 4CG1A 3DG9A 4R4JA 2QN8A 2WSSA 1Z75A 2W9BB 3T7AA 2VP0A 3P19A 3T35A 3WK4A 3EZ2A 1J7KA 4DUYH 3W2FA 4M55A 4M83A 1E2LA 3ENVA 5CEEA 4J43A 1QAOA 4RDIA 5DQHA 4EKEA 3NI2A 1R15A 1B1CA 4QU9A 4C7XA 2RSLA 5F51A 3F7TA 1E2PA 1JVBA 1MGOA 2VUSA 4M9CA 1JI0A 1CZHA 4ME6A 2ZYGA 4CLEA 3BB3A 1E1QD 3JSAA 3IALA 1JLSA 1TFUA 4P08A 2JGFA 3MTBA 2X7JA 4MYRA 4CDGA 2AYXA 5KNBH 2K2QB 1MJGM 5IAJA 1JBKA 3DFUA 5AW5A 4TSFD 2AEMA 1ISRA 1NI4A 4MDYA 3H4MA 4BQQA 2GXSA 5TXGA 2BISA 3N7AA 3V4ZA 1FNNA 4LYGA 5K3AA 1KDTA 1AG9A 4X0EA 1WDTA 5EVJA 4QECA 4F4UA 4GICA 2A7QA 4KVZA 3LK7A 3OICA 3VO2A 3WNVA 4ND1A 4B9AA 5AJXA 2ZUWA 4EFEA 3MLAA 1L5WA 2MDTA 4FYKA 4PG5A 4ACBA 4A10A 3GFVA 1JFFA 3GYGA 3B7PA 1YJAA 4F72A 2PIAA 4CKYA 4PAWA 2B2XA 1MO5A 4K8OA 3A6PC 4GPEA 1XZQA 4KPFC 3ZGXA 2F67A 2RI6A 3L8FA 3EOZA 4EJ6A 2J3MA 4D0NA 5J63A 1UXKA 1G8MA 1V6AA 1RXEA 4KO2S 4CKEA 1Z47A 1ZETA 1OREA 1E1LA 4RQAA 4JUBA 3IUBA 5G41A 3WGUA 3L9XA 3ZBUA 2JLWA 2MINB 1A2KC 5BN3A 2GEDA 5CT8A 1XKTA 3OM8A 4L57A 3JX9A 4QXPA 2YVUA 4XX1A 2WOOA 4BYGA 2V6BA 1VLBA 4KCGA 3QQMA 2RGNA 1DDIA 2H8KA 3K16A 4ZC1A 1RHQA 4C4ZA 1EVKA 4X1KA 3ZDEA 1F8UA 2DY0A 3ZHVA 5KQLA 2FK8A 4FQ8A 1QVAA 1KAEA 3M4JA 2JGKA 2VHXA 2YMLA 4JI2H 4CKBA 4IIVA 2QU7A 1Z38A 4FYMA 1WB9A 4KPUB 3O1LA 3EZ9A 1VAJA 2QE6A 3I34X 4HH0A 5KQRA 1M1NA 2XLBA 1JVNA 1C3EA 1OYVA 4KO4S 5BT9A 3N41B 3CW2A 3GR6A 4RLHA 3VHXA 2IQ5A 1AUOA 1R0SA 3MSCA 1J9GA 2CXTA 1WSBA 5GPBA 5CIQA 1N34H 4U7CA 2DTEA 1OYOA 1H8EA 3KAQA 8ABPA 3WYFA 1SVKA 1PE0A 2POCA 3CWCA 4N9QA 2OQRA 4B6PA 1MO3A 4ZDJA 3G85A 3DBRB 5KUTA 5DTMA 1OVMA 5MN6A 1QZUA 1OQAA 1UIMA 3VTZA 5WRFA 1V6CA 1R9MA 4KB5A 1T3HA 2NTNA 3DHVA 1RVDA 3Q4GA 2HF9A 3PFIA 4E3WA 4D57A 2VAMA 2GJ8A 3QFHA 1QXSA 3I76A 2LKCA 4Y1RB 2VQSA 4YN3A 4C21A 2JCBA 4AJNA 3TLZA 3INNA 5EL0A 2PJUA 3G2KA 1T5TA 2DFPA 4GI1A 4CCWA 5K9ZA 1SVWA 2H0QA 5EZSA 1T5BA 3G7SA 1SHTX 4TLLB 5AJZA 4CM9A 3NOVA 1RRGA 1V6SA 1Q81J 3GPLA 3UJ8A 1NQWA 2Q28A 1KQOA 1YL7A 1HDZA 4FHGA 4TN5A 2QMOA 5HTKA 4LWOA 4JBNA 1LPAB 2F17A 3B8EA 3GCZA 1JEQB 5FV7A 2IC5A 5FBHA 1QPZA 4M7OA 5KTSA 2GD1O 3PHCA 5JNTA 4JA2A 5BWTA 1A9TA 1AKQA 4PVDA 3F6EX 3TI7A 2WWIA 3WIOA 3ZYZA 2IITA 1NVBA 4AIIA 3N0TA 3DFFA 1F7VA 1EKPA 2VDOB 5IJXA 1WDMA 2BE9A 4DQXA 4C04A 3DNMA 4BGDA 1OH6A 3NVKI 5KVVA 2UUBB 2IS2A 2G9QA 2X5XA 3OE7D 3OZEA 5EIHA 1R88A 3RWOA 2H00A 3TUIC 4O2AF 3AU8A 1P1KA 4KWWA 2BFOA 3FPAA 5LQJA 1SU8A 1YMVA 3SDSA 3T3HA 3VZRA 1TJ4A 1DKNA 3ISJA 4GR4A 4XWYA 3T3GA 3L6DA 2Y4OA 4O4LA 4U6QA 2ZT8A 1GT6A 1QOPB 1Z07A 1CS0A 4P4SB 4P5EA 4W5RA 3E0XA 1DQSA 2PPVA 2XPCA 1M7JA 3WL3A 3P2EA 4I4IA 4K6MA 4L5YA 1GQRA 2JB9A 4KQIA 5E9JA 1UXJA 1K6XA 4KQGA 1C7JA 4PLPA 2FW8A 5LQCA 3CZ9A 5I5GA 4PYRA 3WJ1A 3LPCA 3GO4A 3H04A 4NJEA 3Q8RB 3N05A 5THXA 4U6PA 1E62A 1DBSA 3S4YA 2C3MA 4YYEA 1HNWH 4A0SA 4K87A 1JILA 1F4VA 5C1IA 5LP1A 4HN4B 5JXWA 2IE8A 3EG9A 3EULA 4N3NA 3U37A 3S2EA 5AHWA 4YV0A 1YZLA 2OP0A 3CC4H 2ON6A 3ZWAA 3P9IA 4GOOD 4C7BA 2E3JA 1TCUA 4NCXA 4HYYA 2WJHA 4NXNB 2FSIA 3LHDA 2X2PA 4M9UA 5EWFA 3HXPA 3MTIA 2IZ1A 1W2GA 2Z2ZA 3R3XA 4AYXA 4EG8A 2VRCA 3ODGA 3OQPA 3TUJC 1ORWA 1DAFA 3HKEA 4DQNA 3OE5A 4XASA 5IPFA 1JJIA 3J7AK 3EUAA 1XR3A 3NC4A 3JQAD 1BG6A 4X41A 3R9IA 5BSKA 5BY2A 3AEYA 7GPBA 3TPZA 1TQ8A 5FPOA 3PW2A 2Y1XA 4JT8A 4ER7A 3USZA 2YMPA 4CFYA 1SUFA 2CCKA 1YTDA 3BGWA 4INJA 4WL0A 4BEWA 1PHPA 3QFFA 2PLNA 3WIEA 3EOAI 3KCNA 3FOZA 1W4RA 3D4OA 4JDPA 3V6MA 2R25B 4OK5A 5BWBA 1T9BA 3NBXX 4RHEA 5A4AA 1ZHQA 3E6AA 2I2CA 4KFUA 1RFGE 1ZXLA 4HQKA 4O7YA 1QKJA 5T8KA 3F3YA 4GBGA 5EXEA 3WAGA 3W90A 2PT9A 5KSWB 3NJ4A 3MPOA 1J70A 4PG7A 4LV6A 5HNKA 2X1LA 4DZRA 2P4SA 3H1FA 1QNLA 1NATA 5A4DA 2JKZA 1DIAA 1IEWA 1E3DA 5HS6A 3DTVB 4UMFA 3TGPA 2WTBA 2BTQB 3ITEA 3QLUA 2IEGA 3D5EA 1DX6A 4R2JA 4X46A 1ZONA 2YFHA 3SJCA 1L5ZA 4LMYA 4DV1B 2AC7A 3DC7A 3FGZA 2XAUA 2QB5A 2ZIAA 3HU2A 4O84A 3K2IA 4V39A 1EXVA 4BLVA 2UXBB 2XZPA 4AS2A 3ELYA 2ODPA 2OXRA 4H4CA 5FJJA 1EGHA 3OX2A 5JG7A 3DWIA 1JLRA 1QHHA 4K40A 1T1IA 5T3UA 4ZZ3A 2BW0A 2HC9A 4B75A 4LTDA 3LT5A 1HLPA 3CCSH 4R2IA 1C0EA 1KVUA 5JO9A 5J2TA 1X7YA 4IDCA 4EHLA 1K6EA 1C9YA 1OBGA 5DWQA 3FOWA 2YMQA 3W6PA 2FY8A 1Z0DA 1TEXA 1W46A 2BBWA 4KPEC 2WAAA 1BNCA 5FAKA 4LK2A 2AJDA 1QK4A 5BORA 4LY3A 1M74A 3BEOA 1HE4A 4YONB 1XGKA 5HR5A 4N65A 4OHUA 5KG1A 1USVA 5GIOE 1CR0A 2CXPA 2ZT6A 4M22A 2Z2KA 2P5TB 1DXHA 1XVVA 1XJ0A 1N3LA 1C8KA 4C3ZA 2ZSJA 3RSFA 2VZ8A 2YU9A 5K8CA 5CX1A 2W8BA 1C1DA 2IDJA 3N2KB 3EIOA 3UMBA 2GXUA 3D0QA 5LDHA 2W42A 3K0HA 2O3TA 2FPXA 2WB4A 1EI9A 3EIFA