3WO0A

Crystal structure of bacillus subtilis ywfe, an l-amino acid ligase, with bound adp-mg-ala
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
465
structure length
465
Chain Sequence
KTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 140
structure length 465
sequence length 465
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wo0A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wo0A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wo0A01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wo0A04
5IYZF 2CNQA 2YRWA 1UC8A 2VQDA 1EHIA 4YBZB 1EUCB 3HO8A 1SCUB 1DIKA 2DZDA 4MA0A 4O4JF 2VR1A 4ZQIA 3RFCA 4IWYA 4MAMA 3BSYA 5H80A 1M6VA 3TW6A 3RUPA 1JDBB 3ORQA 4NYEA 3VOTA 1KJQA 1ULZA 4YAJB 4FFPA 4IIJF 5HV6A 2VPQA 1I7NA 3MWDA 2WYOA 4EA7A 4O86A 5KX5F 5LYJF 2DWCA 4ZOLF 2IP4A 2V58A 4I4TF 4HNTA 2W6NA 5DMXA 2W6PA 1IOWA 4FE2A 3K5IA 5D8DA 4XZ3B 4YAKB 2V5AA 4O7LA 2FP4B 2VHEA 2HJWA 3V4ZA 2ZDQA 4MV8A 4EA9A 5LP6F 2QK4A 3BSWA 1BXRA 3U54A 3ORRA 2J9GA 5LA6F 3HBLA 4O2AF 2GQRA 3Q1KA 4Y8VB 3VPBA 3VPCA 1OBGA 4O7SA 3JRXA 3AW8A 4TUYF 4O4HF 1KJJA 2PN1A 1AUVA 2R82A 4MV7A 4I55F 1OBDA 3KAJA 1GSAA 2CNUA 3ETHA 1JKJB 1KBLA 3BSSA 3N6RA 5I47A 4EA8A 2V59A 1VBGA 2NU6B 4O82A 3HB9A 3JZIA 5C1OA 3SE7A 3I12A 2GPSA 1PK8A 4IHJF 3TIIA 2R86A 2OLSA 2C00A 2CQYA 1EYZA 4GGMX 4EAAA 2W70A 1KEEA 4M99A 1DV1A 3R5XA 1B6RA 2R7NA 2XCLA 1VKZA 4HQ6A 1WR2A 2CZGA 3GLKA 5LXTF 3RV3A 2GPWA 4YB8B 5JQWA 3R5HA 4O7RA 4WBNF 4O7TA 4ME6A 4I50F 1CE8A 2NUAB 1W96A 3U9SA 3K5HA 4MV1A 4YJ3F 4DLKA 4QSHA 4RZQA 1Z2PX 4O7VA 3R9RA 2Z04A 4FGRA 4J6EA 3UFXB 4C5BA 2NPOA 2R6FA 1GLVA 2ZDGA 1E4EB 1PX2A 3Q2OA 4EGQA 2ZDHA 5CAEB 3R23A 3GIDA 5FNVF 3JRWA 4MV6A 2YZGA 1IOVA 3KREA 4FFLA 2CNVA 5KKNB 2R7MA 4C5CA 1JLLB 5EZYF 2FPPB 1JDEA 3MJFA 2PBZA 3VA7A 1VBHA 1E4EA 4O4IF 1A48A 4M9UA 1CS0A 5BMVF 2DLNA 4L1KA 4FFOA 4O2BF 1KJIA 2R7KA 5CA0F 2R7LA 2NU7B 1GGOA 1KC7A 5JVLA 3WO0A 3VPDA 4FFRA 2YZMA 2W6QA 3MWEA 3N8DA 3R5FA 2GQSA 1DV2A 3NUAA 2YRXA 2R84A 3OUUA 3WO1A 4FU0A 4HNVA 5C8YF 1EUDB 3TQTA 4M9CA 3WNZA 1EZ1A 4O7WA 2R87A 3LWBA 3VMMA 4FFMA 1Z2NX 3KALA 5J2TF 2Z02A 2I8CA 2W71A 5BPFA 2YZLA 2XD4A 3LP8A 3K3PA 1UC9A 3TIGA 4XX0B 4WD3A 3DF7A 4IWXA 4O83A 2R85A 3JZFA 5GONF 4YJ2F 4O7ZA 4C5AA 2W6MA 3G8DA 2I87A 4XYLB 4MV4A 2FPIB 5LOVF 1C30A 2GLTA 4MV9A 4HR7A 3G8CA 3V4SA 1B6SA 4FFNA 2YYAA 4TV9F 2YW2A 1GSOA 5HBRB 3E5NA 1A9XA 2YZNA 2FPGB 3ETJA 2NU8B 2I80A 5CA1F 5CB4F 4O84A 1C3OA 2YWVA 1I7LA 1AUXA 2QF7A 3U9TA 1CQIB 5JVDF 2W6ZA 1GSHA 3KAKA 4O81A 1M0WA 2W6OA 2NU9B 5JH7F 1Z2OX 3QFFA 4EG0A 4EABA 3OUZA 4O7NA 1KUTA 4ZI7F 4O4LF 2YS6A 3TINA 2P0AA 2YS7A 2YL2A 1KJ8A 1BNCA 3BG5A 1W93A 2FB9A 2HGSA 4EGJA 3U55A 4TV8F 2DIKA 1CQJB 4XYMB 1KJ9A 5K2MA 5C1PA 2PVPA 4DIMA 4MA5A 5JQGF 4HNUA 5BPHA 4MV3A 1M0TA 4ZHQF 2SCUB 3AX6A 2X0SA 3BFPA 4E4TA 5J2UF 3RV4A 4O7YA 1T36A 4IZOA 4M98A
chains in the Genus database with same CATH superfamily
2IYYA 1GA1A 2GCOA 4FZRA 4AULA 4QBIA 4IH9A 5F5NA 1DAEA 1QGOA 1YBMA 1Z18A 1A9RA 2VR1A 1DCKA 3EGOA 1LDMA 1L8XA 4HO1X 1V8BA 2W2QA 4UDYX 4Q1FA 3H13A 3G2KA 3DMHA 2GAOA 2BSQA 2P1RA 4IOLA 4KO2S 2B61A 2WT4A 4CGYA 4C30A 3A9TA 1Q12A 3WL3A 3R76A 4P81A 2FTKE 1VBFA 3DKPA 2FK3A 4NEGA 2GPBA 4AMBA 4I4TF 1SQ0A 2GRJA 2I2AA 1SHZA 3CTMA 2C2OA 5IC4A 4JMLA 4QGHA 3HKZE 5BMOA 4GM0A 1Q1QA 3HNRA 4MULA 5H1SO 2Q50A 2HJWA 2J0FA 3RSQA 4XR5A 3OM8A 2G1KA 1H8HD 2I6QA 1CUUA 3WSTA 5MHTA 3ZH2A 5SZKB 1SKQA 3BRSA 3M6LA 2ZJ1A 4Y6QA 1IXYA 4F0JA 4C7XA 1W581 3RJMA 5CM0A 4RTLA 2OB2A 1R0XA 3O2JA 4U4AA 1FS4A 1PKXA 5CA0B 5KWJA 2EFHB 2CDCA 5C1BA 4KGXA 1RJDA 4K6NA 1B76A 3W2IA 4QXRA 4XM0A 4BB9A 4R8MA 1FJGB 1EP9A 2P9TA 4UBJA 1G42A 4UD2A 1FBNA 5GV7A 1E0DA 3N0RA 3PYLA 1HETA 4M4SA 4NVRA 3UPDA 3BXXA 2Y05A 2I33A 1JB1A 1CUGA 3JX9A 1QKKA 1ZAYA 1B43A 3TZKA 4RLQA 1DL5A 1NBHA 1WB5A 3HRIA 5BV7A 3N1UA 1W4ZA 1V9CA 1Z7GA 2NPOA 3PTZA 4LHMA 3PE6A 3NT5A 3L0DA 4JJZA 2BGMA 1P60A 3FKJA 3BCRA 2QT0A 3VVMA 5H68A 3T5GA 2HVSA 4EUFA 3ZWQA 1PJ4A 2V3VA 4X6YA 4QT4A 3ZWCA 4A8JA 4TZKA 2GF0A 1R3UA 4ZEXA 2Q5QA 1RHQA 3H5VA 1LB1B 3QGMA 3EPIA 4ZYVA 4MVXA 2GKSA 1ONSA 5DQGA 1WABA 4EJFA 2QP9X 1R6VA 3C4QA 4DMUB 2IEZA 4NZYA 5TX7A 3SWWA 3F6PA 1O6ZA 1Z5ZA 4JBYA 2J32A 3L4JA 4TT3D 4WCFB 3WBJA 3L4BA 4ENRA 1ZJZA 4ND2A 2OHGA 4M60A 3K9NA 3NB0A 1EWKA 3AU9A 5DNWA 2V0CA 4LDPA 1ADGA 3VMMA 3OZCA 1FMAE 3BWCA 1M2FA 1I3LA 2AOTA 1P1KA 1MG0A 3DULA 3M49A 4WD3A 2XXAA 3INTA 4X46A 3IQWA 1ULUA 1T9ZA 3HPRA 4G1VA 4DNXA 4ND6A 3HSSA 1Q6ZA 2P4UA 5KFJA 4ZFNA 4PYRA 1YDEA 3KHGA 2NADA 4MPRA 2C5AA 4TV9F 5HCIA 1G63A 1GR0A 4UAJA 1E2MA 3G8AA 5BXQC 3F5FA 2ZJPJ 2HK8A 1GYRA 3UV7A 2BEJA 3MWKA 5EWLB 5D01A 2XZTA 2OYCA 3M89A 4QUBA 4OF4A 3VYVA 4Z9BA 4B0PA 1EK1A 4QLAA 3GLSA 1JEYB 2XQKA 4NFSA 2HG8A 1XDSA 1LPNA 4RZIA 2JPDA 3DL2A 5JJKA 1T0JB 5EE1A 2ATIA 1XKQA 3UK2A 1FXUA 3QFSA 3KEQA 2NPFA 4OHFA 1SC3A 4C0SA 4PO8A 5IHXA 2WHPA 4XR4A 1CQWA 2JBAB 1MQ9A 4LHWA 1WP9A 1P18A 2JCBA 3K92A 1DTWA 2FJ0A 3O03A 3WP1B 5JCOC 4MITA 3CBGA 3IOCA 5E7QA 1D2EA 4QJBA 3H0KA 1F4LA 4BNVA 6PFKA 4WK4B 2YH2A 2WIKA 3JR3A 1XLWA 1XZAA 3H0GA 3GQVA 5K0ZA 2IHKA 1E9EA 1HMPA 4XQCA 4NJEB 4YAFA 2H52A 4DLWA 5BR7A 3U3XA 2WPDA 1EDBA 1SO8A 2WP0A 3R4CA 3MGAA 2R6HA 2ASDA 4E5UA 1PQPA 1KEKA 2GPAA 1ZIDA 5A4FS 2DRIA 3V4ZA 3NQ41 3HACA 1KU0A 3JQ7A 3BA8A 3GJRA 3L7MA 4JXJA 2O1XA 4OSPA 3U4QB 1H4SA 2PX4A 1E9DA 2BM0A 5DNEA 3FYSA 3M9NB 2WI8A 2ZJBA 1QIMA 3T5KA 1JDBC 5CNIA 2A14A 2UXBH 4BQQA 4QUAA 1Q7RA 2V1UA 5K20A 5FOWA 2XUFA 1O94A 1VB5A 2WQZA 1XXHB 3I09A 1T2EA 2X9QA 5JC8A 1PNQA 1JWAB 2Q3HA 1OI4A 3HOVG 2PTHA 3T54A 4AY4A 5JCJA 1BWRA 5KHLB 4FLFA 3LW7A 3IHWA 2F3TA 4LTDA 1ZVQA 1JJ2H 2PIAA 3KFVA 1H6AA 3GL9A 5DTMA 9ATCA 5ESXA 1PSWA 3O4IA 3G6VA 4I1OA 3GEPA 2EJ0A 2ONKA 2UXDB 5CJ2A 3PVZA 2H1OA 3G4SH 4FGRA 1U0GA 1UBLS 1TEHA 2IDJA 4D4JA 2NQ2C 4QDKA 4DA4A 4U7TB 3FPHA 5LQCA 1VQ8H 1L5RA 3I9LA 1IWOA 3QVMA 2PY6A 4DIEA 5KVCA 2CXSA 3F8WA 2BI8A 3OA2A 3TIFA 3ZW9A 4F4CA 3F7TA 1VPWA 4J9RA 3ETDA 3E5RA 2P2GA 1RQGA 3ZYZA 5KAMA 5DZSA 2WWVD 4NFHA 3ZWNA 1F2DA 4MKHA 3MOIA 3KZXA 3B3GA 2Z9CA 1JHPA 1A2BA 5F9MA 3UQZA 2V5UA 2W22A 4EB6A 3M9MB 5TEVA 3JQAD 4PYQA 5FJIA 5JZSA 3D2BA 3K71B 4ENWA 2NP6A 2BGNA 3TEFA 5FWDA 3DMNA 1E69A 3SHVA 2Z2YA 3LYHA 5AWFC 3ZY2A 3Q0IA 2CHFA 2IOFK 1U6JA 1Z7BA 3HXKA 4H4DA 2AVNA 3S2UA 4AZ3A 4P58A 5JO9A 2GPJA 4PNPA 4C3VA 1C3VA 2IF2A 3FDZA 1Z07A 1QGUB 2C4NA 1ZONA 1ZHOA 3CT4A 1T35A 4HH1A 1TU4A 3VR3D 1IYEA 1I2MA 2V7UA 1ZD9A 4KOEC 4FHGA 5AJZA 4LHSA 1RZRD 3B1ZA 5ALOA 1NV9A 3ZX5A 1DX4A 4Y98A 3FJ1A 3P9IA 3W34A 1IVSA 1V16B 2X23A 3ZBUA 3VTKA 4LFAH 2WAOA 1LSSA 2WJAA 5LLSA 4ZARA 2Q2UA 5AW8A 3CQZA 4C43A 4X65B 5CCEA 1XMOH 2Q2WA 3P32A 2G63A 4ESEA 3DZFA 1FL9A 4EYSA 3EW9A 5BR1A 2WDZA 4D26A 1GO3E 3BKWA 1SKUA 3NVVC 4RD0A 2ZGIA 1LEHA 1W93A 3Q7RA 4BRZA 3A31A 1VJDA 2C5HA 3DGEC 4FBGA 4WOPA 4RB1A 4ZANA 4GO1A 1IOZA 4TV8B 3DE2X 4JLNA 3W7VA 1Z06A 4PYLA 2CSUA 3I9OA 3TY5A 3PCXA 2IFTA 3T61A 4V38A 1C4WA 3OCZA 1RZ3A 3ZKWA 3ETLA 2C5LA 1QO0D 1RRCA 3IE0A 4IQFA 3W78A 3C2FA 2Z3VA 4LHYA 5HYVA 4B3MB 4B80A 3UC5A 1ZGBA 2I03A 2NT4A 1UBKS 2XNKA 2YQZA 2VA8A 3FE2A 3OQVA 2XJ4A 2IIPA 3JQGA 1EX6A 1C0KA 3TQSA 4X62H 1GRVA 1EWRA 1ULSA 2C4KA 5CRIA 1X14A 3IMEA 4ZYTA 3VR4H 2WUDA 3AUUA 1A3GA 2VYVA 1QQ6A 5HXAA 5JIBA 3WIVA 3D0QA 3V55A 2X9VA 1TF5A 2NSLA 5A2QW 2F3RA 1OZFA 2BGTA 5J3JA 4CNBA 5FD5A 1GGHA 1A0OA 2HVRA 4YYZA 3CT6A 4Q4HA 1KWGA 3NJRA 2EFJA 2I9KA 2PQMA 3GVHA 3TY8A 2E89A 5BW6B 1VQ7H 1IMOA 5AM4A 1SKYE 1UJBA 2E5LB 5EHQA 3OICA 1ZZEA 1JZTA 3OLVA 1R37A 3ZDDA 1KERA 5C8XA 3LNTA 5LJLA 2XNHA 2IXTA 3EZ9A 5EG5A 1NIJA 4XUCA 4H1UA 4MRMA 3ZVKA 2NNWB 3G9TA 4L07A 4UE2A 1NY5A 1T8TA 2NU6A 1L7AA 1E3JA 4WXHA 4CM3A 2ADOA 1RAHA 4EA6A 1N6IA 4Q6BA 5FL3A 2J59A 3DDSA 1M2OB 4JJ4A 4QDUA 2ACKA 3A10A 4ZWNA 1GUAA 4RTSA 3VPSA 2W3RB 3IUBA 1PSDA 1C7FA 3TK1A 2IV3A 1W1WA 2YXEA 4JI3B 3CCCA 2YUTA 1JXLA 4R84A 4C7YA 2B5WA 2VUUA 4DYHA 2C54A 5BSTA 1VSTA 2QTMA 2ZVQX 2JG3A 2EXXA 2R92A 3S8EA 5EIBD 4GIBA 1D6NA 3NT2A 2X8JB 3W1BA 1IBLH 2I9PA 3D3NA 3PC7A 1XDWA 1HDEA 3OX1A 3G9QA 4FWIB 5AVYA 3ZE2B 3CSWA 1AO3A 2F6RA 1OLUA 5K0BA 2AJTA 2YXDA 2JAWA 1KPHA 1SUDA 3CZRA 2IHNA 3JD0A 1J8MF 4RQTA 2DM6A 1RYHA 4ECTA 2REXB 3C16C 3NBZC 4HB2A 1D1PA 1KKUA 1Z7WA 4A1OA 4TRRA 4O63O 1L5GB 1ENOA 4A82A 5B3AA 1JTFA 4MZXA 4IAOA 4RY9A 4V0RA 4KPUA 4HTAA 2VF8A 4M22A 1CEYA 1XEFA 2RGVA 4MI6A 1DGJA 3MHPA 3Q98A 4J0FA 1T6YA 1OH8A 1Q1NA 1U6IA 1IY8A 4H60A 2P2NA 1YRQA 1ZOOA 2I6GA 3OT1B 3HABA 2RCNA 1NAHA 2XEDA 3CW9A 3WLNA 3BAZA 1N0UA 3AR8A 2RHJA 4BQSA 2FSPA 1DUVG 2Q6LA 2FGKA 1ZNQO 5TV2A 4GPBA 1XZQA 4HWGA 5EPUA 4RPJA 1ORVA 5GJVC 1L7PA 2H4WA 3BZWA 1QMGA 3LX5A 3K6KA 4BNGA 4C29A 4D6YA 5A04A 2XBUA 3RSGA 2H06A 3OX2A 1QZXA 2WB2A 5ALHA 2GKOA 1H5UA 1XU4A 3U0BA 1ACJA 5D7BA 1K83A 4OL0A 4BNTA 1SD5A 2Q3DA 1LLQA 2WJJA 2OQIA 1K5GA 2CXHA 1X7ZB 1KDOA 2DBYA 1C4OA 1RWQA 2NU9B 1UK9A 2BFMA 4C2AA 1YQGA 1B41A 4KXYA 1CW2B 3WLSA 1TQ8A 3BQ0A 2NV6A 1WW2A 4NBKA 2OLEA 3O5AA 1HORA 4A15A 3VAYA 1KJ9A 4BAGA 5KT3A 1MRNA 4TKLA 1XVIA 2FMFA 1SZPA 2HQ1A 2SBTA 2F4VB 4HUTA 2P2LA 4TUYB 3ZQJA 1J8YF 1AA9A 2FNAA 5KEIA 4LQ4A 4RWZA 2W83A 5ALEA 4QXAA 5K3WA 3WDKA 5TJHA 3CH4B 4BGIA 4P33A 2QUZA 4E0BA 1MW9X 4RVGA 1Q0SA 2JBWA 1SBZA 4TWJA 4G85A 5A62A 3JU3A 3OLYA 4YP7A 4KG7A 4G26A 1GNSA 2UU9B 1DQNA 1GGNA 2QD4A 4ZAVA 1FNBA 2CYCA 1UOEA 1VE6A 5H3CA 2P65A 2RHHA 4LRTB 4LTNA 1EAYA 2A67A 1IBCA 1V8ZA 3CMMA 2V7WA 2X77A 1A4XA 5FPSA 1PQWA 2O3QA 3DCNA 1P7PA 2GH1A 3PC4A 4YCAA 3CUYA 2XVZA 3IP1A 3OZXA 2WKSA 3NIBA 1CX9B 5G53C 5F35A 2AOUA 2XLBA 2CLSA 2PMZE 4WDQA 3I05A 2QW1A 2Y71A 4NFLA 1JPVA 3BXZA 4F3RA 1ND5A 4HGNA 2X9GA 5F51A 3C4JA 1OBGA 1EUQA 1UT6A 3EVTA 1QORA 4ARUA 4PGMA 3N40P 2FX2A 5KYXA 2ZRIA 4MRNA 1YKSA 4EO4A 2ZBQA 5JFGA 1X77A 2HRZA 4ZAGA 3AERB 4J9KA 1TAGA 3WIUA 3CXRA 1YA6A 4RV4A 2XCLA 2NUTB 4R31A 1XJ5A 3FFTA 1I50A 2ZRCA 1TZ2A 4TRMA 4D9MA 2VIIA 1HL7A 5DCUA 1SXPA 2BKAA 2YJ6A 2RHWA 2J6TA 3CH5A 4JBWA 3NLLA 2CLDX 2YYSA 3NC4A 3F78A 1BXGB 5H9WA 1I80A 3WWZA 3CZAA 3H4VA 1LRJA 4JP1A 3CX7A 3TPFA 1LDEA 1PHRA 2ZJAA 2NW6A 3AUFA 2ST1A 2NTJA 3ZZMA 3DTGA 2IGTA 5J2TA 4K9NA 1DC6A 3CV3A 1DKRA 2MCFA 5ICEA 1XD8A 3O6VA 2RH4A 5JZOA 3O21A 3CFYA 4GL4A 2ZBGA 1RQRA 3MT7A 2R1VB 3BE6A 4Y2TA 3H2SA 3IUNA 3AP1A 5I4KA 4IRDA 4QGSA 1M1YE 1TA0A 5BV2P 3MWGA 1OT3A 4RLSA 3GAAA 4TMKA 4DCSA 1U8FO 2HXGA 4JCCA 1JN0A 4B71A 5EZSA 3VDQA 2EERA 2WW8A 5HILA 4NE2A 4UM9B 1O6FA 3B9PA 4URXR 4AG6A 3S44A 1YCDA 2FZLA 2WAQA 3LKBA 1XP5A 2IDMA 3JWGA 3GBPA 1GAEO 4AZWA 1BA2A 1T9GS 3LUGA 1QF9A 3KU1A 1PLJA 2EBHX 1XA3A 1OTXA 2QTCA 1M67A 2ZI9A 2YMQA 7YASA 2H54A 1WBJB 121PA 1NV8A 4NZMA 3P97A 8ABPA 3GRAA 1YQUA 1BH2A 2HDKA 1PDOA 4X61A 3KQUA 4K26A 4BNUA 2IA6A 1G9TA 3H04A 1YD7A 3IX7A 3VVCA 2MMGA 2FEKA 2I3GA 2CC2A 3R3WA 2POCA 2FPGB 1ZCFA 4EPWA 5JS6A 4DQUA 1QIFA 2KB0A 3OEWA 3SS8A 1UMDB 3AYHB 3UW1A 3M9OB 5CHYA 3GLGA 2ZPUA 1EBUA 2WC1A 4RD6A 4EVSA 3QSYA 1ZH2A 1BCRA 4I5IA 4R6WA 3SJUA 1PWXA 2GZ3A 1CWUA 2BGIA 1AUPA 4CM4B 1PN3A 2WHYA 1Z17A 3BG5A 2OORC 1ZFNA 4FYYA 3IB6A 4ZOLA 1KYIA 3IAS1 4ZDKA 5F3RA 4F3NA 1QXSA 2MINA 5KG5A 3QU4A 1V0JA 1KDYA 2QW8A 4XOIA 4GICA 2Z6UA 2YIDA 2KSWA 3M0EA 3MT9A 4WF9J 3CCMH 3IMKA 4O7YA 2RHMA 4QOSA 3KPUA 2ID7A 1G59A 4YQZA 2SECE 2R2AA 1SBCA 4DJEC 3Q2IA 3QPAA 4B74A 1O96B 3HO8A 4D9HA 1V26A 2XT9A 3RFCA 3UXYA 3KVOA 3W7AA 4PX5A 2HDOA 3CRQA 1FFXA 4G5RA 2J6IA 3UAVA 3JTMA 4NK4A 3OZBA 2JJ8A 2QPTA 2JLBA 1B0AA 1LQUA 1KL7A 1O8CA 5B6JA 3OZFA 3V1MA 1IXKA 4EOGA 4BLPA 4HD8A 2XCUA 3DYVA 1GU0A 1RLUA 3L7AA 1XUOA 5AVZA 4X92A 3PUZA 5JEDA 1NN1A 4IDGA 2AKYA 1V11A 3WAGA 3LHKA 4MNTA 2BCEA 2RI1A 1N6RA 1N4AA 3AR5A 3LZDA 5EJ4A 1IY0A 3WRYA 4ARAA 3K70B 5EOVA 3N42B 1LZKA 4PSCA 4IXDA 2X4LA 3KE8A 5D3QA 1K73J 5BQFA 3U6KA 3K0KA 2ZUTA 5CITA 4QPCA 4RDXA 4GOMD 1OIVA 4GEKA 2AHRA 1HL3A 3GT0A 1DEKA 1X0VA 1XJWA 3LG2A 2ZSDA 3D0OA 4EUSA 2JFOA 3SF0A 3PW5A 1PK8A 3TAUA 4ZPJA 3QELA 1GXSB 2H3EA 4KXNA 5FJJA 3VYWA 1IM2A 3LQ4A 1E2JA 4DF3A 3GZJA 1UKAA 3DMRA 2PWBA 1SXIA 4F11A 4OHVA 2Q27A 5JSZB 4RB0A 5ALGA 1I36A 1N6OA 2Q0SA 3M4IA 4IPTA 1HEYA 2A57A 1G9SA 1SNYA 3OIDA 3VKFA 3QEMA 4M8KA 4DLKA 3K8YA 2ZUDA 1GR1A 2NZYA 2LUOA 4ZGWA 2RJOA 2NTEA 2QVZX 3T4EA 4FFDA 4NYMR 4F3YA 1HLGA 3M4ZA 2LR0A 2M6SA 4YT8A 4WLEA 2OFPA 2QU8A 3HO6A 4XTCS 4CMDA 5AESA 5DSTA 3UKDA 2CNNA 4UCWA 2VDUE 2DHDA 1L4GA 2VWQA 2Z1MA 3V2HA 2GA8A 1PJRA 2AN3A 4GAEA 1Y7IA 3VM6A 4LXTA 5CYPA 4RTMA 3GTLA 1NVVR 2ZFUA 3SLKA 4DBLC 2M32A 3ON5A 3PXXA 4LSAA 4CQJA 5TEWA 1QHHA 3K2EA 3BE5A 2VXCA 2R7LA 4TKUA 3LCUA 5FD6A 1NUPA 2W2KB 1R0CA 4MW2A 1AVTA 1FU8A 2R2GA 3RYIB 3ETNA 1RKXA 1JIKA 4B5KA 1TB4A 1PDWA 3OUUA 2ZWIA 5B6PA 4C0XA 1P75A 2QTHA 4BVLA 2IC5A 5J2TF 1D4AA 3DZGA 3LRXA 1AH2A 4BQNA 4N7BA 2C9ZA 3F6BX 2QGFA 4B3TB 4O7ZA 2OBYA 1E4VA 2OXIA 2C82A 4XGQA 2PZEA 3TE7A 1U3VA 1RHRA 4U5QA 4IZIA 5EJ8A 2ASJA 4UTOA 3KYBA 1JJBA 4IM7A 4PPGA 3SXUA 1AKRA 5JSYA 1AS2A 2NWQA 1ZA1A 2IH4A 3GNTA 4ND5A 2DQZA 3AEKB 3GVPA 2FPIA 3QW4B 2AI1A 2C22A 1VHQA 2Z56A 4AQDA 4IQ0A 3LYAA 5KWSA 1PD1A 3HBFA 1H1TA 4DL9A 3ZHTA 4LBYA 2OV8A 2PUVA 2YL2A 4C06A 2R5NA 1JIVA 1Q77A 4PTYA 3EZFA 3UGQA 5C1DA 4Y2RA 5JWHA 2A5DA 3FPBA 2WJ6A 2UYOA 3H1EA 4HQRA 1UBUS 4OLHA 2C5GA 2JC3A 5BNIA 4AWAA 1G8HA 1IZZA 1CUZA 5HKKA 1YB4A 4MO9A 1TWFA 1ISMA 1X8JA 2QM8A 5JDIA 3COWA 7MHTA 1UKYA 1VE7A 4YALA 2ZR8A 2M9MA 4XCXA 2QA4H 2PJRA 1MX9A 3UUWA 3SJAA 2P27A 1ZK2A 4C22A 4O4HA 3UYYA 3HYNA 4MW4A 3TW6A 1OX5A 3H2JA 5M29A 5FF9A 1JG7A 3OCVA 1WWKA 2PGJA 3QK7A 2YVKA 5CEFA 3UH1A 3D4IA 4Q03A 2BFCA 3NRZC 2GXUA 3RT9A 3F2VA 5IF9A 3JSLA 3A1WA 5CLQA 2OPHA 2Q3MA 4ZOLF 2IP4A 2YZ2A 4LVUA 1B1AA 1UAYA 3HVKA 1KU6A 2JGMA 3HP4A 4PFKA 1XI2A 3S24A 1T5SA 1DIAA 1HQYE 4PNEA 4XYGA 1FYDA 1CJCA 4KXXA 1EVZA 2E7ZA 2ZVJA 3CH7A 4ZN6A 2Y2VA 1LPAB 3TW4A 4BQOA 2PUHA 4LBVA 2D2VA 1W19A 2HBYA 1IXSB 5AVJA 3TZBA 3LZCA 1QFXA 5I7VA 1JYFA 3F0TA 4I1UA 3F4BA 2R8JA 4IEIA 4K81B 5F73A 3CMCO 2N47A 4B47A 4UXHA 4JLDA 4RD4A 2HPHA 2W6IA 1S0UA 3KWLA 4UBIA 4AIIA 4A93G 3TD6A 1A9PA 1TUGA 2GXQA 3RRZA 1YOVA 2YJGA 3TTSA 4C6SA 1TEVA 4C4TA 3H5OA 2D2FA 1LS1A 1KQPA 3LDUA 3Q8MA 2B63A 2OXRA 1TZCA 4MUKA 1N2OA 4CTMA 3K32A 4KX5A 3COPA 4EYEA 1DBQA 1NX9A 2J3IA 4BOYA 5FEMA 1HPLA 4Y2QA 5G0VA 3D2AA 2AMVA 2Q8QA 3SZGA 2NVXA 4DCMA 1GG2A 3U44B 3MGBA 1X8XA 2HO5A 2CVZA 4Q4CA 1B16A 3JYHA 4EGQA 3GP3A 2Y4RA 4HK4A 3JQAA 3IAM1 3GN1A 4F4ZA 4RJ2A 4S12A 1ZOLA 1BO6A 2NT3A 5LZ7A 4QT0A 2BFBA 1NKVA 5DW3A 3KSAC 4E2YA 3NIFB 2DTDA 2KW5A 1CS0A 4I4IA 3C2EA 5CD9A 3R7BA 2BMAA 3BDIA 4L95C 3TFWA 4CLOB 3AHCA 4AURA 4F92B 2WEKA 1GEGA 2J5XA 4FXOA 2AFIB 4ZAYA 2HJGA 1W35A 5TIIA 3AY0A 1JALA 3AJAA 2P35A 3VR3A 4DBZA 4G37A 3CPHA 4AYXA 5AM1A 1X3SA 3TQHA 3H9QA 4YC7A 3GBSA 4XGKA 5JECA 5C3EG 1SXHA 2QLFA 3DCIA 3WGGA 1SB3A 1NWCA 4RNDB 3UK7A 2Z83A 3WGLA 3FPJA 4C80A 1K8XB 1TYAE 3UMRA 1U2EA 3ED5A 1RKBA 1U3UA 1XAIA 5AK5A 5D3ZA 4Q12A 1NVWQ 1CIPA 3DBRA 4DA8A 3CO5A 4XW2A 3KKLA 5DLYA 4JVLA 2BP7B 2PKWA 3A1EA 3WDSA 3QV2A 1ENZA 5FWXB 1RE1A 4CTNA 4B6OA 2HKIA 1OWOA 2ZYSA 3FWNA 3EBOA 1KSFX 3VSAA 1TJ5A 3C87A 4PQEA 3FVRA 2XCIA 4YCNA 4B34A 3WA6A 3UMYA 5CPBA 3W5HA 2XCTB 2B0JA 5H3LA 4RB3C 2XMBA 1Q7EA 4GBJA 3OD1A 1PS0A 5ERGB 1F8GA 1G6Q1 4PLGA 3OW2H 4YXFA 4CIBA 1YQXA 3L01A 1F1BA 2FWJA 4NE9A 3BEDA 4G1MB 4YDRA 3KT8A 1QDLB 1MT0A 3C3WA 5H1YA 3GGDA 4DAAA 2HPVA 4N0MA 3K7EA 2PSSA 4BLQA 4UUPA 1C3XA 2G9VA 2PT5A 2V7EA 3BRQA 1D0VA 5CK4A 2QAIA 4GI5A 2Q9CA 4YRIA 2JHFA 1KDTA 4MDFA 1RJPA 4M21A 3NOOA 1WXHA 2OC4A 4RAQA 1JR4A 3OIFA 2EJVA 5KCZA 3ICWA 4WFQA 2XI4A 3LVBA 1HSOA 2CFIA 3MUEA 4CTKA 1V4YA 5IANA 1JLRA 2H2FA 5K2OA 3R75A 4GPAA 4WACA 3D3WA 4X54A 1DX9A 2P2SA 3THRA 3WGNA 4J3FA 3GV5B 5M5BA 2JAPA 4FQ8A 1Z63A 1YL7A 3D7SA 4B6JA 5B3KA 3KXKA 3P5SA 4O4HF 1QK3A 5ALJA 5IFKA 1V1JA 1H8ED 5DI3B 3UB3A 3O3MB 4LH6A 1WRVA 5KB3A 3BJZA 1F2VA 1SIUA 1M6HA 2UZIR 1MABB 1TM2A 1BDJA 2XH8A 1JFTA 5JXHA 4FYKA 2WDPA 1V4BA 3CRNA 3FPEA 4MX8A 3Q3JB 2FEAA 2J9RA 4LOIA 3IEPA 4LQDA 3D2LA 2WPNA 4J16A 3IAHA 1ODCA 4Q9JA 3DP7A 2VDOB 3MCZA 1SEPA 4KQ6A 2Y6VA 1Z45A 3F6EX 5HRCA 4H0FA 4R1NA 2VA9A 5B2ZA 5C7OO 3LKVA 4V2IA 4B87A 4YMIA 3WJ7A 2CJYA 1JIIA 1R8QA 3IQFA 5AKYA 2OG2A 4YR9A 3LRTA 2J07A 3QSGA 3UHPA 5BN4B 1E1DA 7REQB 4DV2H 3W5SA 1JVSA 2A35A 3DTVB 2EEZA 4JLBA 1R6BX 5ALRA 3GJZA 5KMGB 2ALJA 1HQCA 2NUAA 2X2PA 4HPXB 1YZFA 3HDHA 1E18A 2FUNB 1U3GA 2WP8J 4WBNA 2FK2A 4ZAWA 1Q0QA 3JRWA 4BO3A 3KREA 2VTBB 2VZ9A 2CNVA 4S2UA 4AX8A 3Q1LA 4EY4A 5IAJA 1JGTA 2B8EA 2GZSA 3W06A 4FMBB 4QUHA 1JT2A 1Y3CE 2ZPAA 4B35A 4E70A 3SOPA 1UWKA 2FMXA 3N39C 1S8OA 1MTZA 1T2FA 3AFHA 3GQBB 5CDFA 2RE8A 3A2LA 1MVOA 1BCSB 4JROA 4JGBA 4MUHA 1INLA 3SQWA 1NW6A 4JR0A 4J76A 3G49A 3AEXA 4LNUB 1P72A 4JLSA 1GCUA 3H4DA 2I8CA 2ZAOA 4URFA 5REQA 2TRSB 4ED1A 5GIOE 2Q2VA 4PRYA 2DB3A 3CCSH 2Q8PA 3UB2A 4K6KA 2BEVB 4H08A 1VYHA 3GLIE 4DR1H 1QH1A 1L6IA 4NJOA 4OSEA 5KFYA 5KAPA 3S27A 1VQKH 1E1RA 4Q4AB 3ZCXA 4YFVA 2R6CA 4L8YA 2CLCX 1L1RA 4S2EA 3X44A 4BCCA 3GUCA 5FOTA 3WDLA 3U3DA 3W4IA 5E4FA 2C03A 4YJ2A 2PG3A 4CF7A 1FTWA 3A11A 4FFBA 3C5VA 1E2NA 4A3KG 4OJNA 5KWVA 1V95A 4UPEA 3HA3A 3FFAA 3DOEA 1Z2DA 3O1LA 3TKAA 5D2CA 4TYMA 3ANTA 4AP6A 4Z3KA 2COKA 3KKZA 3L49A 1NNI1 3SG0A 3R7WA 1GPH1 3MERA 4NBSA 4XDZA 1FIUA 3NKVA 4PYKA 4G4IA 3PPWA 2W8ZA 3QVJA 2Z3ZA 3NI2A 4TL6A 4F2HA 3EISA 3GGOA 2OP0A 5AOCA 1MNAA 4ZEVA 3T9FA 2EBFX 4YV2A 1SA0B 3H5WA 1Y0BA 3VPGA 1C8KA 2C96A 4HAYA 2E2IA 2W7TA 3OLZA 1GAXA 1ZKDA 2VP2A 1RTKA 2DPMA 4KXWA 1SOVA 2P30A 2UZAA 5IP7G 4KAXA 1EHIA 4FGZA 1T3ZA 2Q2OA 5HZMA 3M6VA 4IIEA 4RX1A 4R7TA 4ZQIA 1JKJA 4DQXA 3DHYA 2KMLA 4HAOA 2VPWA 3EX7C 1DPGA 3EVGA 1G60A 3HV0A 3OG9A 3EXEA 3HZRA 4L74A 1TZKA 3NHSA 2RB5A 1KSGA 1G0NA 5C18A 4W5JA 1T4DA 4EPTA 1JFFB 3ZWOA 1UWCA 4MR8B 1O0CA 4IIJB 3MRSA 3A1TA 2B8JA 3IKVA 3VDRA 2C3MA 4B32A 1XTJA 1IOLA 1LI4A 3ZC3A 2W54B 4KR6A 1KXJA 1HQDA 3SOZA 2ILTA 4BXOA 1VMIA 4CEJB 3KWFA 1WHSB 4Q5IA 2ZWAA 2WAAA 1P7CA 3HR4A 3EPLA 1XZGA 4XM2A 5A5DA 4CCSA 2CUTA 3H87A 5D6OA 1X13A 4PG7A 3DXZA 2G36A 1SXJC 4H4CA 3LYUA 3Q8KA 3IVGA 1EKXA 1XB2A 1X42A 3AUKA 2R82A 3KXIA 4MR7A 3WGKA 1L8QA 3NU1A 2A84A 3O4HA 2DPXA 4ASUD 1KOJA 3AUTA 4I66A 4WX2B 4MWTA 4CKCA 4YP0A 2MR6A 2L2QA 1CKNB 3HXPA 1I3MA 3HC7A 4DADA 1Q2XA 4GM4A 1H66A 2JCVA 3ER8A 2JH8A 3HU1A 3V7WA 4E2XA 2QRGA 3L02A 1Y1RA 1J70A 5JSKA 2H57A 3D43A 3EG9B 5BN5B 4AF7A 4Z7OB 5JAUA 2OM6A 4DAOA 1YQDA 3DZBA 3SI8A 3IQDB 2BPOA 4BY7G 3WSVA 5CT5A 4EVQA 1TGVA 4UCTA 1R16A 5LVAA 1R8XA 2IYWA 3EWSA 2LCFA 1DI0A 4RSMA 1U1IA 5KOYA 4B17A 4QQNA 4RXTA 3ASZA 4PZZA 1UC5B 4DKJA 4TGLA 5KFDA 2CUNA 4E22A 1CUFA 1KJZA 4ZAZA 4EHFA 1CJMA 1EWQA 4BU0A 5F2NA 1D6SA 3ND8A 4JYMA 1IB0A 1R4NB 5JWOA 2OUIA 1FFBA 5BV8A 2RGGA 3JXEA 2PJZA 3RBDA 8ATCA 4M9UA 3HVUA 3MWJA 4QOJA 1Z0DA 5TXGA 4C9BA 3D8TA 4YP6A 2BEKA 1QPRA 1J8DA 3UZUA 1WLYA 1LFDB 3MS7A 1Z4KA 3V34A 1GLGA 3SICE 4KQCA 4EMBA 3WAKA 5I48A 3DCJA 1DPFA 2V6MA 2VBGA 4JEMA 1SPBS 3L8MA 2DF8A 3WTBA 1JHMA 4A10A 1YJ8A 2QIOA 5M34A 3LWBA 4TTPA 3V2GA 4X1YA 1HLPA 4L4ZA 1NASA 2H18A 5CEJA 2PGLA 4DGSA 5AI8A 2ZYGA 1P3Y1 4J9LA 4BVKA 4WRRA 3W7BA 3UT5A 1E7SA 5F12A 3AVYA 1A7UA 5C52B 2NYRA 1CUHA 2KBFA 3ZE0B 3AXTA 5TB5A 4W5HA 3HB4X 4E32A 2QP3A 4JWKA 3TMAA 4EJ0A 3SE0A 1K8RA 2JJ1D 5HKKD 4MRSA 3EPPA 2OZEA 4KR0A 2WB1A 5A4JA 2NMVA 1K2VN 4KRXA 2PSFA 5TGZA 3QKRB 2C2RA 5AVOA 3WLQA 5KYTA 3BHIA 3NEYA 4P82A 2C2WA 4RVNA 1O2DA 3B5JA 2RKOA 1KMHA 1TA9A 5BT8A 4Y6LA 5BWTA 5CCBA 2W6JA 4A16A 4AVYA 5JDCA 5DO9A 1N25A 3PFKA 3LFHA 3ETRC 2C2BA 3EDQA 1MR3F 1SD2A 4EGJA 3HR8A 3ONNA 1K0UA 2RARA 1E6LA 2J0EA 1USWA 4RFSB 3BK2A 1EJ0A 3F9CA 4Z1OA 1U99A 2BOVA 4IUDS 4BLSA 5EY5B 1HK7A 1KVSA 5CVJA 4RDIA 2IZ0A 1TE2A 3TF5A 5LLTA 4OGGA 4DL6A 3GIWA 3USZA 5G1OA 3CC8A 5J4LA 1D2HA 3MTJA 1KY5A 4AKTA 2SCUA 4GP9A 4P4LA 8GPBA 1V7ZA 2IEYA 4ZGBA 5HQJA 3MWLA 5H80A 5KTOA 4WFAJ 1C3OB 1X7WA 4R5MA 2EX4A 3LPMA 4N9QA 4U2CA 2BE7A 3SF8B 2ZWVA 2ZYHA 4NYEA 3VOTA 1CUYA 2X15A 3S6JA 1N5LA 4QTXA 4PE5B 3LYLA 4PZ7A 3BM5A 4AUNA 1OHHA 4PCAA 3SC4A 4YMGA 1MOQA 2REQA 3VAZA 2W6ID 1JDVA 2CXTA 4PLWA 2X4GA 821PA 1J6UA 3K5IA 1N5OX 2IYRA 3TZQA 2V4ZA 4IJVA 3N41B 2EVWX 1I3OA 3HT5A 3AXSA 5G41A 4AJLA 1EKFA 4X1KA 2A3RA 1R0BA 3GELA 1CQXA 1J0EA 3ZIDA 1UFVA 4B7ZA 3TL2A 1EVEA 3PEUA 5DTIA 1E6MA 3Q9NA 3J7TA 4TWAA 3KVVA 2QUKA 2HREA 4LRSB 3MYYA 4JUZA 1Y6FA 1Z2CA 4FGSA 4HRVA 2H1VA 1VJRA 1VQ1A 4PZLA 2HF8A 5GJCA 3AR2A 5KNCH 3KXPA 2L0XA 1N2BA 3MPOA 1HYQA 2VSQA 1GQFA 1Y1PA 4ZCRA 4O6VA 3ZGZA 3GRVA 4HNAB 3D54D 3LQFA 3EQ2A 1IN7A 2VAVA 3ILVA 4FM9A 1N2SA 1VI6A 1TU0A 3PIOJ 3SJZA 2IWRA 3B8HA 1N2CB 4AJ4A 3CUUA 3SSMA 2CLOB 9MHTA 3VHQA 1I6WA 1HDZA 1HA3A 4GKJH 3UXMA 3IN5A 1OZGA 3UWDA 2WAMA 2HTEA 2AG6A 3NBUA 3EODA 4JI7B 1T0BA 1A72A 2ZBDA 1BWPA 3KOUA 5LQJA 3RBXA 2DSTA 1H6DA 1HBJA 4KDFA 4DL3A 4PU0A 1PTKA 3WHKA 3BXFA 4ETWA 1FP6A 2OCGA 3RKSA 4IFBA 1YB7A 1YZVA 4NK5A 2HWKA 1CY0A 4L02A 1GPDG 4JAVC 3VU9A 3EZYA 1FNNA 1QFMA 3UQ8A 2UYYA 3GCDA 1C9KA 1KKLA 4HEA6 3LOQA 3DEHA 3F4KA 1T6BY 1DEAA 1SCIA 5M3BA 4D02A 3U48A 2JW5A 5BR4A 2MSNA 4JEUA 3KT0A 1L5YA 1W94A 4DV0H 4Z86A 2ZITA 1R10A 1S3IA 1H5QA 2AN1A 2OTJH 5AHXA 4H6XA 4UJ3A 2E3TA 4GC5A 1E0JA 1QKIA 1CUDA 1MRSA 4OYHA 3L4EA 1X7YB 1J8VA 4KE9A 1L7QA 4IKEA 1IN4A 1NOIA 2QV7A 2HV8A 1JG3A 3DT6A 3ZY6A 4EENA 1NG9A 1HYHA 2QHXA 3FSRA 3RC3A 4F7DA 5AHRA 1R64A 2J6SA 3E23A 1NNUA 3CCLH 5KFKA 4D3FA 1UMCB 2NXWA 2JA2A 4PG5A 1RJFA 3CEPB 1OVMA 5CH5A 2HMAA 2H1RA 1Z2OX 1W4AA 1OFGA 2XE4A 5ALIA 3DWFA 4O3SA 3AQ4A 4TPKA 5C9ZA 1U8UA 2Q2QA 4KVGA 1WUHS 3RUHA 2XQVA 1SMKA 3W2EA 4Y2SA 1SWVA 2PNJA 2JJYA 2O7QA 3BREA 3E3OA 2Y77A 3OFSA 3E3LA 1KTAA 3RGXA 4FEEA 4TMYA 2PD4A 4GMFA 5DP1A 3JZAA 1EWVA 4H7JA 3C7KA 3FGPA 5FPOA 4O2AA 1WSDA 3I6MA 4UOEA 2BTQB 1AA6A 4RKWA 1MXFA 3ND9A 1HE1C 3KIPA 2A1TR 2CMGA 3L7JA 4Q1BA 1KI2A 3EZ6A 4HQNA 3H4MA 4C2UA 3ZZ1A 2RKBA 4C87A 3O38A 5DNDA 4HQFA 1AB5A 1FSGA 4QOIA 3NV7A 3D4LA 5ELMA 5K8TA 2C92A 3UAYA 4TROA 2BSXA 1GQSA 2ZG6A 4YV1A 2F43A 1P0PA 2QLJA 1VECA 4GGPA 3CGGA 4HV4A 4UUGA 4KP7A 4NOMA 3KUDA 3IOEA 1I9CA 1DXQA 3M4NA 3PP8A 1C9JA 5C7IO 3GT7A 1IVNA 2WYUA 4FE7A 4IIHA 3LPNA 3L5KA 2B83A 3IKLA 4LZAA 1C2TA 5M04A 1RXVA 2IX3A 2XKAA 3G2QA 3RYCB 1QZUA 1JFVA 1YJXA 5ALNA 3QBTA 3JWJA 4HYYA 1SZDA 1NYRA 5AKLA 1VJ5A 2FKNA 1Z6TA 5ALYA 4CDMA 1BDHA 2I2BA 5B7GA 2PT9A 1YVRA 1DUIA 1I5EA 1S7CA 5KFUA 4Z54A 1N7IA 1QHFA 2CHUA 3T5AA 1HRKA 3C6KA 1YFZA 2QJOA 3GN2A 3RVJA 5LKAA 1VMDA 2R1ZA 1DWOA 3WB1A 1YGYA 3LUAA 3C24A 4E07A 4ECVA 1J0DA 4GNRA 2GXSA 2VK8A 2JLQA 2ERCA 1VJTA 3PNPA 3VKVA 3OQMA 4RK1A 2IXEA 5JATA 4H1VA 1K4YA 4ZC1A 2IS1A 4FZVA 4PG8A 3AZPA 4TLLB 3OSUA 3ORFA 1R6XA 4N3GA 3T9EA 5BSKA 1WKIA 4OA5A 4Q15A 1Z2PX 2B1RA 1W6RA 2I4TA 3BC1A 4MKZA 2WAQE 1K9SA 2A9PA 4BIMA 2Y1LA 5E3HA 3TB4A 1E3IA 2VRBA 3FGNA 3NETA 3U3RA 4NOLA 4F2GA 4YAEA 1M83A 4H1TA 1T9BA 4WOBA 1OLSB 4F8YA 3RRFA 3BMNA 1WCIA 2VLIA 4INAA 3X1XA 5KT5A 2JHGA 4HS9A 4OFBA 4YCLA 4RACA 2IOYA 5A9SB 4EG7A 5E9JA 1QVFH 1E1RD 3B1YA 2WD9A 2CEAA 3HFSA 4XRRA 4Q9IA 2QXYA 5JVLA 1A4IA 3U37A 3QOFA 4L3OA 2FPPA 3IULA 1W5SA 4BWVA 3FHTA 2Q1YA 4G8CA 1MGOA 1ZWLA 3VV3A 3GLGE 3WNZA 2A5JA 1JHXA 3F49S 2B4TO 5C8YB 2BHSA 2PUEA 1R5BA 3W6PA 4O1IA 3IAFA 5HGJA 1EI9A 3FTQA 3YASA 1XEXB 3T95A 5IDXA 2A1TS 1TWHA 2J4DA 1JROB 4KEAA 4PY2A 4QIWE 1PLLA 4KQXA 3DUWA 5HBGA 4WVFA 2H3HA 1X1EA 4Z1MA 4QL3A 4FOSA 4BGVA 2B6NA 2H17A 1P29A 4M0KA 4M0FA 2O2DA 4DZZA 5THXA 4L9AA 4O84A 1Q7TA 1QVZA 3KHKA 4LISA 5KX5B 3STHA 5KT7A 1Y1WG 3QUQA 4IY1A 4KYUA 4HH3C 3Q0TA 4CMGA 4LOHA 5JNWA 1PS8A 2Y8EA 2FMHA 3K2QA 3LK7A 1YSCA 2YS7A 4K8RB 3T1HH 2PUBA 3KQMA 2JLVA 3BEOA 1GL6A 4Q3EA 2ZI7A 1S0OA 5AVVA 2NO7A 3GIMA 4OH7A 4ZI5A 4DFDA 4GSKA 2OO3A 2C2DA 1LDNA 3CZQA 5K4GA 1N6PA 4MR9B 3S3TA 2PYZA 3GTGA 1U11A 2J9YB 4DC1A 5I60A 1AUOA 2IA5A 4GSYA 4IV8A 2JI8A 4X1OA 2ZJ3A 3TNYA 2OKGA 3EFHA 2AS0A 3IVMA 2P9ZA 4PS0A 3KQQA 5EGSA 1FYEA 1JHYA 3NALA 1K27A 1XEWY 2CW7A 1AN7A 2ZSAA 1U8XX 2O2EA 2CFSA 4C2TA 2VP5A 5IVHA 2EV9A 1T1JA 2Y67A 2JGNA 4HGOA 2PKXA 3LOUA 3PNMA 2Z6VA 2G9QA 5TMPA 1Z68A 4GC6A 2R3SA 4Q82A 2BEWB 1IUNA 1H8EA 4CKBB 3B3QA 4DV7H 2GYVA 3TVTA 4KX3A 4ZKDA 1S97A 4ND4A 5BQOA 1DO2A 2FXIA 2CVHA 1U9CA 2CN1A 5F1YA 3X2EA 1D2CA 5G2OA 2QAJA 1CUEA 4O2AF 3HVJA 3DXYA 4UW9A 4NAUA 2CFMA 1FOEB 3EC2A 2FW6A 4Y7CA 1QBKC 1XAHA 1LS6A 3DMFA 1H0SA 2BV3A 1KEEB 1OFUX 3PE3A 1NURA 4MKGA 4YDHB 2B98A 5JARA 3Q5GA 4ZMSA 3RVBA 3ZCQA 1EKPA 2J3DA 3H5QA 3KEFA 4HADA 1KDPA 3PUWA 3A2MA 4PSDA 3IIKA 3ZLVA 4MB2A 3ML1A 1KK0A 1RAGA 6GPBA 2WWWA 5FEUA 1C9NA 1ZSYA 4P7JA 2JIRA 4R7ZA 5L3ZA 1Z8DA 2G5CA 2JD1A 2Z4SA 3IKJA 4MYUA 3CF5J 2X6RA 1R9GA 2R6JA 5CCXA 4J6EA 2ORIA 1A2QA 5HOEA 4WZBA 1I1MA 4A3IG 1HNZB 1YMUA 2AXEA 3EEIA 1A5AB 3HKCA 5CAEB 1XZCA 4ZO4A 2EZUA 4XWWA 1UZAA 2PRJA 3H3XA 3ZXSA 1E3TA 2RAVA 2ID4A 4Q3LA 4DMLA 4E31A 4JK3A 1JUDA 5LMUB 3SBOA 4HAIA 1QH9A 1P7ZA 5C5CA 1S5PA 2EJUA 2NGRA 4TMZA 4J0HA 4B4KA 3K53A 2WJIA 2XNJA 1Q50A 1LY1A 4M8IA 1RYFA 3CPJB 3SIWA 1ONBA 4A91A 1UKZA 2NYVA 1OXVA 1YVPA 3MR5A 4HGYA 4LMYA 2W6JD 1CRLA 3PENA 2NU7A 1AKTA 3DTYA 3IIJA 1T3NA 3DBLA 3LKZA 5CXQA 4IFIA 1UBSB 4LBWA 1IZ7A 3K6SB 5AUQA 4WK0B 3I64A 4MVJA 3OF3A 1L5WA 3MJHA 1ZGZA 1BQ3A 2Z5FA 2G40A 2Q4OA 3RTEA 1M7BA 1L5VA 1XE3A 5FUVA 3JZMA 1J20A 4MQEA 5GM1A 1VKJA 3KX2A 1PGJA 3JW8A 3DVLA 5K05A 3OJ0A 1JVNA 1NPDA 2O7RA 4ARZB 2PZAA 3DT9A 1RWWA 2B1QA 2N1BA 4EFNA 2Y92A 5TS3A 4P0PB 3QFCA 5K3EA 3FXAA 4JIGA 4GOOD 3CPWH 3B1XA 1NVFA 1RPTA 3IG0A 3H65A 3T3MB 1DKQA 1C14A 4HDNA 4ZVOA 3I56H 2GYYA 3FWKA 1IH8A 2WAXA 1Q21A 1G2OA 2A30A 4CQMD 4GOXA 4KUHA 3NTRA 3RVKA 2IPAB 2YKGA 3V7FA 4KN5A 3TE6A 3QOWA 5H16A 5D1OB 3ZI7A 4L0CA 1OHHD 1SVKA 4QO7A 2QB5A 2B1JA 3L8FA 3PB3A 1USGA 1HT1E 4OBXA 4R1PA 3ZWXA 2ROQA 5KDDA 2JA5A 1W1UA 1N34H 4LJ4A 4GR4A 3V9AA 5JNUA 2PH3A 3TTTA 3CIOA 4YTEA 1DT3A 4GWLA 4BMNA 5FO0A 4JBLA 2ZYUX 1JAYA 4YECA 3ZHXA 1Y14B 3OLXA 2OR3A 2IEBA 3QW2A 3TRDA 3JQFC 4LXIA 2K2QB 4L4SA 4CM8A 5IPFA 5AXDA 4XVRA 5FWNA 2NVBA 2QL7A 2QTTA 2OTLH 1N0WA 1WUIS 3GLUA 3RUPA 1G8MA 4LDRA 1WCXA 2HLPA 2YV4A 1XAGA 2H4HA 4BKMA 3PQ7A 1N77A 5I5XA 4MCHA 1YBAA 5IJZA 4QFBA 4EZEA 3A9RA 3H11A 2H2HA 3NO4A 4G8DA 3PF9A 5FUMA 4P6VF 4H7KA 2VYNA 5TVGA 3NAGA 3ND5A 4ASUA 3COJA 5DULA 4L75A 3ABSB 1KBQA 1Y3DE 5I9NA 1V3QE 3FAKA 5CR5A 4DRZA 3CC4H 1HFWA 1IY1A 2XLCA 1QQAA 3GFBA 1VLJA 3PPIA 5AW6A 1BMTA 1RYEA 3DR5A 4DDHA 5IAKA 1NF2A 4G56A 2O1EA 3RIYA 5LA6B 3ESDA 4GX1A 4C78A 3VBEA 3GJXB 3KSRA 2JAXA 3RUEA 4LVOA 2GNOA 2GN2A 2JEGA 1G5RA 5IABA 1DFGA 3BSSA 2Z4TA 1KZ7B 5DW0A 4RB2C 4M6WB 3K0BA 3OLQA 4U7HA 4EX7A 1TM7E 1N78A 5JJ5A 3UWPA 4LDAA 2W70A 4E94A 1E4GT 2R7NA 1J1IA 4E5DA 3WISA 3W5BA 3ELBA 4G41A 3BQ1A 2F1IA 3T38A 4HQ0A 4JU9A 4EUNA 3O4GA 3SDBA 2VQEH 3C7DB 2AEFA 2Q3CA 4UCQA 4I14A 2ZK7A 1P2GA 2XMQA 4US8A 1Z6PA 5ALQA 4I36A 5SYMA 4HSEA 4EHNA 4D79A 2GLUA 3MT0A 1DVRA 3LWNA 3C2VA 2VUHB 3HBNA 4PAOA 3VR6H 1E9RA 5KQSA 2BZSA 4Y6PA 4CM5A 5A9TA 1UXHA 3KE9A 2WMDA 2XUGA 4BNIA 3HDQA 2AC4A 1I94H 5DNYB 5GOTA 3MR6A 1U31A 1B15A 1KJYA 4YN3A 3MBIA 1RYBA 3K15A 2VNHA 4YLYA 1J56A 1XSEA 3EY9A 2QZ4A 3QBJA 3QQPA 5JSUA 3TQIA 4M0LA 1N1DA 1PYOA 2H92A 5L9XA 1E3MA 1M34A 3NWBA 4HN2A 3II6X 3HOYG 3Q2KA 2JJ1A 1VG8A 3JASA 4GS5A 1OH5A 2R1TA 3DC2A 3TZHA 2E2HA 2R8PA 1EZ4A 1XRJA 2W0MA 4O4LA 3WI7A 1VPTA 1CQJA 1VJCA 3T7EA 2GMWA 5EMLA 2BFDA 3E0XA 3PHLA 1GPLA 4O33A 1G17A 1VFNA 4HAWA 1W88A 2Z43A 4NCXA 2IIQA 1UNNC 1P8LA 3L8YA 2ECQA 1NHGA 2WHRA 1N7HA 2KLHA 4QICA 1KQGA 1GSOA 3F7MA 3PGKA 3RWBA 1OLXB 4GUDA 3MLAA 4MRAA 2UZ1A 1HDRA 2VAXA 2R8EA 2NVOA 4UBKA 4QDXA 4K2HA 3L43A 4JH0A 3OT5A 3NHFA 3LT4A 1Z08A 1G4AE 4OG2A 3P2JA 4GLWA 4XFDA 3RIMA 3DBIA 2RHGB 3GIKA 2NU8A 1E5LA 2FUG1 4US1R 2G82A 3EH1A 1OF1A 3UCEA 2OT3B 5DGTA 4AJ9A 4I1IA 4MVJF 4QU8A 4DR2B 1E1LA 1G5HA 5EUCA 2JANA 2G5PA 4BNHA 2RIRA 4FQ7A 4RTKA 2V7BA 4NPHA 3N70A 3JYOA 4V0NA 5FWYB 1UBGA 2JRLA 5EPOA 3I42A 4PEVA 3FZGA 1MOPA 4DR3B 2X6QA 2VRCA 4R2IA 3DE6X 1JAZA 1N8RJ 2GYUA 3D6FA 3RFXA 4QECA 1SVMA 3OKPA 4JHXA 4UBNA 3U13A 2DFKB 4JJ6A 5EQFA 1EG2A 1E1CB 3AEQA 2JIZA 4WESB 5EHXA 4OJQA 4KGVA 4DL2A 1WU8A 3DMGA 3QVUA 2GBGA 1EFVB 1BKSB 1TF7A 1D4FA 2WYOA 5DGIA 3QYPA 5DYIA 1A7JA 1XRQA 4FMDB 4P4UA 5EAIA 3KZNA 3R5JA 4BFUA 1Q81J 1T8RA 3PCTA 4KZKA 4EJ6A 1V1RA 2FZEA 3VPAA 2O2CA 2PFSA 3OZWA 3TTYA 4O7LA 4HFMA 2FWPA 1WCV1 2FPRA 4N82A 2QK4A 2C2MA 2UVVA 4RV5A 1BXRA 2JFVA 3WV5A 2X1HA 3JQBC 1E3WA 2AA3A 4MHSA 2E4ZA 2CKZB 1YNSA 5LM3A 4BMPB 1LD3A 5EXTA 1XPOA 3G68A 3G71H 4QWDA 1M76A 4HDSA 5H82A 4BYGA 4F06A 3RFTA 2XHZA 2JLWA 3WZ2A 4L0MA 3AM1A 4XFJA 5B2EA 4BO1A 3CSUA 3HOZG 3BAFA 5ENDA 5HFAA 1AOXA 1FYXA 2VJKA 3UJ3X 1GGEA 1SCQA 3CNNA 2P41A 4Y18A 3WP0A 4BNXA 4Q93A 1HZZA 2CK3A 4N40A 3U4AA 3PXEA 4XIFA 4PQGA 2I2WA 3Q3IA 4Z4GA 3K73O 2B7PA 5CFRA 3UM9A 4KRFA 4UCUA 5HHTA 1B8VA 1JU3A 5CDFE 4WY5A 2VOBA 1Q86J 3R9RA 3FF4A 3TLJA 3EXHC 2ISSD 3U6BA 1AF4A 2AR7A 1GZVA 1E4EB 1OSNA 3E8XA 2G72A 3RRXA 1IOVA 4XLTA 4ND8B 5JYEA 1MO4A 3TM4A 4PCLA 3VYSB 2JA8G 2FF5A 3M83A 1ECCA 3G82C 4LF9B 2EHDA 4Z1MD 3OFVA 4FHEA 4WNAB 2KWIA 1PV2A 2FW8A 4N7MA 1QP8A 3UAZA 3SC2A 3GFPA 4MGHA 2HK9A 3V8EA 4NPAA 1JLLA 4OLFA 1MW8X 1ZD1A 5IZCC 3DBOB 4U2BA 3ACBA 1QH8A 1EGAA 4REMA 3R9XB 4FLMA 2IZ1A 3LT5A 1ZCJA 3NOVA 3X43A 1KYWA 4DDUA 1CDEA 4EG4A 2IZ5A 4LE0A 4Y0VA 1A9ZA 2IUUA 2ZXUA 5FBZA 3HB5X 4Y9SA 4PHHA 3D8BA 1XMPA 5A7FA 4XX0B 2UYCA 5K6AC 4GYJA 4K87A 1EDDA 2P90A 3IOYA 4KI0A 1YJBA 4DM7A 5F98A 3L0CA 1YO6A 3TIXB 4MJ3A 5HS6A 1QHIA 1NFRA 1ABEA 3NC0C 3GJ0A 1G0OA 4ZVUA 4XUDA 2A0FA 1Z6QA 4M0DA 5AI5A 1FCJA 1JMYA 4PLCA 3LQRA 1T15A 3I55H 1PEAA 3F5DA 2AE1A 3OZSA 2FR0A 5DSXA 4A3FG 3SBEA 3I34X 3I37X 4O4LF 5HVNA 1ESEA 1RJ9B 1WTCA 4GPIB 5H8WA 3WHLA 3QVXA 4BVJA 2HGSA 2YHIA 3ZLJA 2Y1WA 1JW9B 2OBLA 1KGDA 4EUHA 3NHBA 1DC3A 3RPFA 2HF2A 1VI2A 2YVQA 2B3DA 4UZEA 4LK2A 1WB4A 3AX6A 3D5QA 4M53A 4NI5A 3CLRD 1BYIA 1H2XA 4CG0A 2EJ2A 4QLOA 3EZNA 1ZHSA 2OGZA 3MXOA 3VHXB 4Z49A 1Y9JA 1M1YB 1RM4A 3JPYA 1HE3A 4B3DA 4CKEA 2Q7DA 3GIPA 4D7AA 4R9SA 3ORSA 3FHJA 2GBCA 2IQ5A 4A5OA 1J1ZA 3RT1A 5M2QA 5FB3A 5EP2A 1RNLA 3I01A 4Y2HA 1EG7A 1JA1A 1BQEA 1ZXXA 5ALZA 1SCUA 1R0KA 2RGBA 4Q0YA 3PR4A 1WMAA 2D13A 1AGNA 3GILA 4FE3A 5IVPA 4XFKA 3W05A 1RVDA 2C4MA 3IUJA 4YA6A 3P96A 3V8RA 2VHCA 2CE2X 4U7DA 3LU1A 2BHNA 2CVOA 1L2TA 2NIPA 2QPAA 4KB5A 1QOZA 1D4OA 3L8HA 3KJFA 4JJKA 4MZDA 3B2EA 4CI9A 1F8FA 3VZDA 1MA3A 3CJTA 4ED0A 2AJ8A 4Q9HA 1KFBB 1JMKC 1K9MJ 2EAUA 3Q8QB 4YP1A 3QLEA 4RYDA 1UDCA 5CLJA 3JQ9A 2RH8A 1F6BA 3CH6A 5KNDH 2JZCA 1I13A 3UZBA 4J0QA 4YREA 4V03A 4IMRA 4YUYA 4PAWA 3U5ZB 1E2PA 5BOSA 2RB4A 1J21A 4EJSC 2H8KA 1M1NA 1RADA 5KKCA 4YBRA 2Y1CA 3OZIA 3WLJA 1JZQA 1O1YA 1QYRA 5DE3A 1U7PA 4N5MA 1T25A 2GCNA 1IHOA 3IH5A 1N8KA 3BACA 2AJDA 3CCBA 2YX1A 1C5KA 4RZRA 1OFIA 2VQ6A 1P0CA 1FP4B 1DFHA 1SC4A 4BFYA 2ZBRA 3R7FA 1PT5A 2DX7A 2ZJ6A 3PC2A 5AKKA 4QC2A 3M6AA 5IJ0B 3T5MA 2A9FA 1VM6A 2P6UA 4MVJD 2ABWA 1YAJA 4BO9A 3A3OA 4FSXA 1QCDA 5FAKA 4XVCA 5K1ZA 3AUXA 1X7XA 4MUIA 5ADVA 5CT9A 2X13A 2IBMA 4Q05A 1XHFA 3FUTA 5HUHA 4RF2A 4OQYA 4DR7B 4RGVA 4IIDA 2EKDA 4GSLA 2O9JA 2FPWA 5AVWA 1Q92A 3H7AA 1W0JA 2GK7A 3AHEA 3JWPA 5KDLA 3VVBA 1R5OA 5J5AA 5IN4A 1C0EA 2Z6QA 2GD1O 2QSUA 4H7HA 3IV9A 4R8LA 2FE1A 1ZESA 3TLZA 2Q3LA 4A3SA 2GK3A 4LI3X 4TXJA 1P0MA 1EAMA 4RETA 2ZIGA 3G5TA 1ZKMA 4D4IA 5CH8A 1J07A 2OWDA 521PA 3OMWA 4TQUS 3AESB 4A3GG 4C6TB 4L9RA 2H2GA 2ZXFA 5BWNA 4LFCB 1DWPA 1B0UA 4G3XA 1NM5A 2ZYVX 5B1EA 4XYLB 3NEPX 4FFSA 5FLMG 1IEXA 4ZDWA 3CM0A 3RTGA 1Y80A 2WF9A 3L4PA 4JLUA 3J80A 2ZB7A 1E60A 1UZNA 5EEGA 2CMKA 2JD2A 3BL5A 2CHQA 4RHCA 1E7QA 3SFTA 2H1FA 1TTHA 4XGRA 5IBRA 4TKVB 4JI6H 2Q7OE 2FSHA 4UPDA 3NHMA 2P9YA 3O0TA 3KZOA 4LGVA 5ARBA 2AG8A 4D9JA 2ACEA 1FFSA 4HDQB 1U3DA 4OGFA 2QMHA 1NP3A 1MD9A 1OXMA 2A0WA 3N7AA 2Z2ZA 1AKYA 4X3CA 1EB9A 4YCBA 1KY3A 3HLYA 1ZUNA 4C0LA 5CTAA 2OAGA 4TTSA 2AEMA 2XX3A 3ZHOA 2XZPA 3U7IA 1G5QA 5BN3A 1WV1A 2VYND 2VEDA 3FYUA 1NI5A 2YWHA 5IYCG 1NUUA 2VPXA 2DBRA 4QOFA 1S0MA 1WF3A 3AN1A 1LI7A 1W2BH 2HXYA 1QV6A 1ZIXA 3OPYI 3KUUA 4FFWA 3EZ7A 1EMDA 5CFNA 2C5BA 5AXBA 4G5FA 3PLAE 2CXQA 2I2DA 3R5KA 4IXNA 3RBZA 4O5AA 3DOUA 3T1YB 1Q7BA 4XD7A 3P9RA 3VFDA 1PO7A 3O4VA 3P8ZA 4FT4A 3I0NA 4M8NE 2CCKA 4OGWA 3K9WA 4FN5A 4EHAA 2WJHA 3O2SB 4QEDA 1ZM9A 1O6GA 4I4TB 2XA1A 2VEOA 4ZRNA 1GNLA 2QN8A 3NWOA 2XDWA 3LQ1A 5EYPA 4CVNA 4QOGA 1RWPA 2OV2A 5D6NA 4C4YA 4UTRA 5IKEA 3OHBA 2UUCH 4RF4A 1H9AA 4C04A 1ZI9A 1C7ZA 1OY1A 4IV5A 3FUVA 3LKDA 1ZNXA 4MS4A 3E8SA 1KJJA 3WRXA 3VR5A 4HLNA 1N48A 2FI1A 2GEVA 5FFMA 1LK5A 2P9JA 3ZTTA 2JH9A 3OETA 3N6XA 2G76A 2ETXA 1S96A 1QQ5A 1E9BA 4XJTA 2ATVA 3OCWA 3W0LB 2WYWA 1O9HA 1O95A 3FA2A 4KWCA 1P16A 4YB8B 4X7PA 2GX6A 1SCNE 4WBNF 4ZVNA 1N2GA 3MR3A 3AR9A 1WVIA 1DE0A 5A5GA 3TCNA 5HF9A 4EFDA 3C3CA 5G1PA 2PXCA 5AM0A 4B3FX 2ZM6B 1SCKA 3L0YA 2E21A 4B4WA 2I4MA 3OAAA 1Q3HA 2HLHA 1H65A 2GZDA 1GIAA 4FDLA 3CVUA 1EFRA 1I51A 3OCYA 1HGXA 3I8XA 3S1AB 2GF2A 4NTZA 4O8ZA 3G79A 1ODJA 1JHQA 5DBIA 2GLXA 4CWAA 3KM0A 2NVYA 3GIDA 4FVTA 4DL5A 4BLRA 1TVMA 2C3UA 1V41E 4N48A 4ZO9A 3M81A 2XKKA 2PBZA 2QX7A 2JASA 2RHCA 4BV8A 2COGA 1IY2A 2W90A 4JKOA 4YMTA 1U0FA 3IHLA 2QEXH 3L2PA 3GFGA 3OJEA 4NBRA 4FFOA 1PUXA 1SXQA 3OEEA 2JFBA 1VQMH 3OTOB 3DLHA 4M1KA 1BQ4A 4WN9A 4PNHA 1NKSA 5DF1A 1XTBA 2H59A 4JJAA 3CLSC 4LZZA 3A14A 1V5EA 4RMJA 4OCZA 2GDZA 3TQFA 4DREA 2QL6A 4OY3A 3VZCA 5DXJA 4UTXA 1XQXA 3VJKA 4FOOA 2VKTA 4ND1A 2AFHB 4O83A 1RYRA 3EA5A 4YJ2F 2D0PB 1SOMA 1E5XA 3UUGA 5BWXA 1Y6JA 4CQMA 4AJIA 4UBMA 1CYEA 3SVTA 3ICVA 5LKRA 4Q7MB 1WPQA 2VRCD 2PO7A 4EY8A 2YZNA 5GQSA 2ZUFA 5CW1A 4DCOA 4IDPA 4TV9B 5KWEA 8AT1A 6LDHA 1VI5A 1GL3A 4M1WA 4JYAB 1XL1A 4EHIA 3SFZA 1X2BA 2JIZD 2B25A 4KXLA 1SHLA 4B81A 3PE4A 3KRTA 3QXGA 1X80B 3ZLUA 1OFUA 1BNCA 1ETUA 3H1TA 3KEGA 5JZBA 4V2UA 2R4TA 5ALTA 1NN0A 2AC7A 2PA2A 2J41A 2F3QA 4DWJA 5CT6A 3O92A 4M7OA 4TTJA 1WHTA 3EGXA 1T9HA 5AFSA 1PTJA 4IGFA 3DAHA 4RADA 1S02A 4HH4A 4EKYA 1NMXA 5DSZA 2GAJA 3HPQA 1JEEA 3K0CC 2PR7A 2GZHA 5BSUA 2WDTA 2WINI 4ZC8A 4CMCA 1VLZA 4F5DA 4CL2A 3D1LA 4QASA 2HRRA 3G6EH 4UZFA 3LLMA 2IXBA 2O7NA 2F1JA 3UJAA 5HUOA 4A4DA 2OFOA 5BYJA 2X42A 4RCYA 2OVBA 5B12A 1EUCA 1MC8A 1WCYA 1ORHA 4JXZA 1SQGA 1DG1G 4W5QA 2WFLB 2P3OA 1T6XA 2YASA 3OIVA 1TVEA 3QJYA 2ORVA 5D8DA 1KXZA 1ZH0A 3OLWA 4PYIA 2XQJA 4OQQA 4B73A 2CK3D 4JLWA 3LQKA 1SG0A 2DYKA 3EWIA 4QTTB 1CR0A 2J45A 4BBSG 5DN6A 3IVAA 3ADPA 4EKEA 1DLIA 4GC9A 2ZATA 2O3UA 4DT1A 1GN9A 4BJ6A 3FAZA 2A92A 3UHFA 2ZAMA 1OWPA 1I1HA 3M6IA 3I4FA 2DSJA 4ITRC 4MW9A 2WT8A 1NVTA 2VNJA 3B70A 3VNNA 1Z5WA 2LIPA 3KD3A 5KFTA 3NBYC 2BCJQ 4XR9A 1VAJA 1BRTA 2LDBA 3D8UA 1NVBA 1QDEA 3G0GA 3CONA 3R1IA 2AMFA 3VNRA 3ROKA 3K9QO 2GYWA 3TLGB 1TKRA 1MAVA 3VC3A 4R8UA 3IVRA 1QONA 2AL7A 2IU6A 3PS9A 4RS3A 4I9NA 1GTSA 1SB9A 5I6DA 3PT5A 1N7JA 4P83A 4WCEJ 3GFRA 2XTJA 3TUJC 5TGTA 3N74A 3GJQA 3BL6A 1YE5A 4QHSA 4K6HA 5JJBA 3M82A 4LTMA 3KKQA 2A7XA 3N28A 1WUTA 2VDQB 1BTOA 1QPZA 3RFVA 5FUQA 2DR2A 3GDWA 4HVCA 1C4KA 5JS8A 4MIYA 4QULA 3UHJA 3W90A 2VUMA 4HLUC 1ZHFA 3PDUA 5ER6A 2F00A 2OK8A 4RA6A 2I78A 1DIHA 5KYNA 2JATA 4CF5A 1C1DA 5GONA 1A1SA 1H22A 3ZHQA 5LOVA 1QIDA 5JZ9A 1H4QA 5KNBH 4Q1CA 4KQMA 1KMIY 3E8MA 2G1AA 2RDIA 3HKBA 2OMEA 2ZT7A 4WKOA 3RVRA 1WZIA 4W9NA 5IWCA 5CA1A 1ARZA 1L9KA 3G9XA 2XMGA 3ONEA 3L8ZA 4E2WA 1ZRSA 3PNLA 4M1YA 5TPWA 3RK4A 4KDRA 4NYIR 3WNDA 1RZVA 2QMEA 1J4AA 4RH1A 2B8TA 1RM5A 1QGZA 3TN7A 3T3HA 1CYDA 2VOJA 4XYMA 3AF3A 1EE2A 1N2IA 3KR1A 3ZQUA 1TK2A 4AK9A 4GMXA 3W1EA 5K3CA 3IQIX 2V9WA 2CF5A 2VBIA 4BO0A 4ZI2A 1T34A 4WOKA 4NV3A 4MPJA 1YHNA 4ID9A 1XMSA 4N3CA 3JR7A 2N9UA 5F4ZA 5KTSA 4AS2A 4DLYA 2HZ7A 1QV9A 2WUWE 1AN0A 2HFKA 2GRUA 4G9EA 4YONB 4EARA 1XLUA 2EL9A 3OC6A 5C81A 3C43A 2DTEA 1HF3A 3QTBA 1VLBA 2V7VA 3LVQE 2GFHA 1YONA 3C3AA 4RJIA 4UEWA 4G5QA 4UZSA 4FS8A 3DZDA 2QM7A 1D03A 3MMNA 1FZQA 3KEOA 4ML3A 4P54A 2J87A 4IDQA 2EWMA 1HNWB 2FWMX 4C7BA 1NYTA 3G13A 3EVZA 2IDKA 1EVKA 5SYNA 1K6EA 1XQ1A 1ZXIB 2VCHA 4D8XA 1VHDA 3ZLBA 4TMXA 2IZZA 1QB8A 3IUYA 1XTZA 2XXAB 5DHSA 4YRBA 3STWA 4CEHB 2JEIA 4FJ0A 3NTUA 5LUBA 2DBZA 4DIDA 1D6MA 3QLTA 1CJKC 4ETSA 4WHMA 4DV3H 2A5YB 4EI9A 1Y9AA 4Q1AA 4GQAA 1SCAA 1XDNA 4KR9A 1E2DA 3G0DA 3QXJA 2VDKB 1D4ZA 3AKYA 1T3SA 5FLXW 3CZ5A 5LIPA 1P2BA 1VDZA 4XA8A 3GEGA 2BTEA 5IM5A 3ELUA 3OFJA 1CR6A 1KNQA 1I2LA 2WKWA 2FU5C 3JAMW 1F12A 3GLIB 2HJSA 1ESZA 1TLLA 3EIFA 3M3HA 2IBTA 1E3DA 5CVDA 3H9JA 3M3DA 3FNEA 1TTQB 3KQNA 1DRJA 1KYVA 3UJDA 1MP0A 4CDGA 2BE9A 3UFXA 1V2GA 3U17A 2V7XA 3AW8A 1VLLA 1XA4A 4OA8A 3GG9A 3PXCX 2Y0PA 4J0CA 5CLHA 4WZBE 4O2BB 2V59A 2IBKA 1FPQA 1P7VA 1YHYA 1RQPA 4F4FA 4EY6A 3N2IA 3RSFA 4P7FA 3T7DA 2O0HA 2P62A 3G1WA 3VOAA 5AXAA 2UUAH 1P2DA 2Y0SA 1U9ZA 2C42A 5E6RB 5LB4A 5JZMA 1W0JD 4C03A 3OF2A 3K5HA 3QY0A 4KITB 2DWOA 1RI2A 1FLAA 4Z2AA 4ZD6A 3MINA 2PL3A 3VZBA 2B2NA 1JP7A 4C7KA 3H18A 1LDBA 5K0CA 3GVCA 4ALKA 2QG9A 2PGXA 2D5LA 2OQVA 1HH4A 4IJMA 4MVJE 2YZGA 3ANMA 4OU4A 1WQ1R 1FW6A 1DSSG 5J1SB 4IJWA 1ZI8A 2I3ZA 2FFHA 1U28A 2OCBA 3SN6A 5DG7A 3FVTA 1GKUB 4OB6A 3KOZA 1M6NA 2J4FA 4EW6A 2BQ3A 3LSTA 3BXEA 3EQ8A 1T3HA 4OHBA 1ECPA 4D4MA 2NZXA 4GR9A 3E9YA 4HUQB 2IYXA 4AROA 1CFZA 4A3JG 4X90A 4MWZA 2YZ7A 3AIMA 5HSGA 2CL6X 3PU6A 4DSZA 4CV3A 1PR6A 1P2FA 3GIIA 4KRGA 2OOSA 1A9XB 2CLMB 2WK5A 3OPVA 5GONF 1KY2A 3X1MA 1EFHA 5EJ9A 2GF9A 5IEJA 1G8KA 4ZICA 5LOVF 4MH0R 4CW7A 2R79A 1ZOPA 3B9QA 2YVAA 5DG8A 3S99A 4TKMA 1T8PA 5L3QB 7MDHA 1T9AA 1S2DA 1OXSC 5CA1F 2BBSA 3SEFA 3MC1A 5EJ7A 3SM9A 1B3BA 5KFFA 3HSKA 2E9SA 4EB6B 4DVJA 4EO9A 4UM7A 4BBAA 4DV1H 3KL2A 2WIJA 3NASA 1SULA 5L8VA 4JIMA 4XD7D 3AKEA 1MA0A 4V0LA 1J0XO 2P79A 3ROEA 2B2XA 4O3QA 4WNCA 3W2GA 2HR1A 1M7GA 2VNKA 2IBSA 3L6EA 4P36A 4E08A 3H42B 2ZRNA 3HVHA 3NVDA 4PWYA 1J8QA 1WEHA 2PLNA 3T52A 3A1FA 3KJNA 1KWKA 3WMWA 4YAIA 2I34A 1DB3A 1U7DA 3RKUA 2R6ZA 3RYHB 1KIAA 1JX6A 3VR5D 2BFAA 1B6GA 1UPFA 3F4LA 5ALSA 2OC9A 3LPAA 2HBZA 3VI3B 3R9IA 5FI1B 3G7NA 4PZ9A 1SPXA 3KPJA 4D41A 2VHTA 4NOJA 1FVIA 3LFUA 4DR4H 3JZDA 2IHJA 4RJLA 3PJRA 1DAPA 1J7KA 1HQKA 5BRJA 4IMPA 1LJLA 4IR7A 3BTUA 1X15A 5KOIA 5KDOA 3URKA 2IYLD 1RZUA 2AK3A 2QAGA 3HUFA 3O8QB 2ATLA 4J4TA 1O95D 4KXVA 5LUAA 2VSNA 2FV8A 4P2GA 1G3IA 5BUQA 4OQFA 3OQHA 1N5JA 4QM6A 3DDZX 3BIOA 3FBWA 4MWCA 3FHLA 4RNMA 1KOFA 2AIRA 4X66H 3C8ZA 4B33A 5CE8A 2O2IA 4Y1GA 1P5ZB 3OAAD 1IJEA 1A69A 3K72B 1TOAA 2OLKA 1EFRD 2LDXA 5JD6A 1ACMA 2C9BA 4I4LA 1DXOA 2FG6C 4NJMB 3ETHA 3DVRX 1K3TA 4AZTA 4AN0A 4LJKA 2B99A 3U4GA 3HWX1 2XDQA 4HAVA 4KXQA 3TAHA 2O1SA 5F9NA 3FOZA 2CL5A 3UA3A 4MRVA 4D3XA 2DLCX 5EZYA 1Q14A 2LCQA 1S3GA 3I1FA 2IU3A 3JQGB 4BQPA 4IG4A 2QVXX 3HKEA 1F9AA 1RT9A 4BN0A 5I5TA 3OEED 4INPA 2FUKA 2NAPA 5HIAA 5EIOA 3M6UA 3C3JA 2FRVA 1KR5A 1M1ZA 3DD5A 4M54A 4PBCA 1EVJA 3FLBA 1LBTA 1QHSA 1H6BA 4XUGB 3ZR4B 1N3YA 4DRYA 3W5CA 3EARA 4HLCA 4EPXA 2R8KA 3E7PA 1DKMA 3Q12A 4FR2A 1WA5A 3BWEA 4GQIA 1RWNA 1SKMA 1V7PC 4U2KA 3RB8A 2XD9A 1HR0B 2P9FA 2OZKA 4AM8A 3EMVA 5FTNA 4RDHA 3ZE9A 5C35A 1ST2A 2WSSA 2XCPA 4BEWA 4EMTA 2EDAA 2PRYA 4JGIA 1JBKA 4DRFA 5TMDA 4W63A 4FEAA 1M0EA 4AP8A 5ES4B 2FZCA 2LKDA 1EE1A 1ZSVA 4TVSA 4KJZA 2VZLA 1UAAA 1VHLA 1Y4AE 3WMFA 4RPIA 3KSUA 4AMGA 3CLUD 1OBHA 3QF4B 1VZ3A 4JJ8A 3WL8A 3A4VA 2PZMA 3LCRA 2XY4A 1X70A 2ADMA 2JA6A 1GTZA 1ZM2A 4MKIA 1U2GC 3QKSA 2R8RA 1WBBA 3VBCA 3ADOA 4LJ7A 4A3DG 2YWDA 2IPNA 4KIGA 5DM60 3B13B 1LSJA 3P52A 4WWHA 5DX8A 3I83A 4JBXA 1MVNA 2JL1A 1Y6ZA 3UIEA 1C80A 2I71A 1U2DC 2ET6A 3OPYB 4J43A 4JI1H 4KRYA 2JLCA 1E64A 3O90A 4LVCA 3IO5A 5LMCA 1OLUB 4FD2A 1SC9A 1QGAA 1GL7A 2D5CA 2IH2A 4J7UA 4MAFA 2AKEA 4UHEA 4E46A 1G5FA 2GBPA 4GH5A 1Z6XA 1XRSB 4WA7A 5JAIA 4EG0A 2QTRA 3MTAA 1U1FA 3WBFA 3ZIAA 3HJBA 2P0AA 4XE5A 1I24A 1A5ZA 2C0PA 1XQWA 1TRHA 1UIRA 5D1PA 1GT91 4I8XA 3KETA 1XVAA 1NSYA 2IHZA 2YFQA 5IYBG 5BPHA 2ECPA 2FQ1A 1Y4DE 4X1IA 1GG5A 3KWJA 2GBLA 3IMCA 5LP6A 2SKDA 5BW5A 1GZDA 4M7RA 5KU1A 4BWSC 1WDMA 4BFXA 5ABPA 5DN6D 1R0WA 1HKHA 2Q5OA 4FOTA 3HWWA 1G3UA 1UOUA 1W44A 2UXCH 3R7NA 4WW0A 2QOEA 1VMEA 4ZHQA 3FDJA 2P9BA 3HCFA 3IKTA 3U40A 4BAUA 4IJ6A 1I7PA 2C8JA 2Y68A 3WHIA 5MDHA 5M7EA 1ULZA 1IFXA 3QYFA 4BP8A 1ZM4A 3G6KA 1U8ZA 3CZMA 1C9MA 1KVUA 3W8EA 4JI0H 1MO5A 3CLTD 4Y2VA 1U02A 3BWVA 4MYTA 1M8PA 2DHEA 1GKYA 5DMXA 2VHUA 2C7QA 4JZYA 4P35A 5IUJC 3C1TA 1M5TA 2H4FA 5LXTA 3C6XA 2CJWA 2YNMC 3OMXA 3NVWC 3NVYC 2Z0MA 1Y7PA 3ZWKA 3E3AA 4HXFB 4PX3A 3IEIA 3ILHA 4NULA 1Z29A 4QWWA 2TPTA 1OZAA 3QEBZ 4XZ3A 1N6LA 4CQLA 1A4RA 1UIMA 1JSRA 4G09A 3OWXA 2OZLA 3EXIA 5BWWA 4F46A 3GMIA 4N0DA 1DAKA 2Z95A 3AG5A 3BZUA 3H1AA 1A5SB 1GZHB 5CJPA 5IX8A 4R1LA 2UUBH 2XGOA 6ADHA 2A33A 3EMDA 4J0JA 4W7HA 5A0FA 1SKYB 4C4OA 2XB9A 5TRTA 2FG7C 2HFJA 2FQXA 1ICEA 2O48X 1ORDA 5A4KA 3HRHA 1R7RA 5I4BA 2AMJA 1GARA 4A2AA 2OO5C 3O7WA 2CJXA 1CZKA 4KNVA 3PUXA 5KCMA 3JD1A 2W8BA 1KDZA 2ODQA 2ENWA 3NHJA 3D4PA 1GGJA 3D8HA 1Q95A 2PMDA 2VQFH 1JI3A 3HN6A 1A04A 1DIGA 1BC5A 4RJTA 4UJ5A 4LC0A 1DTEA 3CX8A 4J94A 4HAXA 5HF6A 2ACWA 4EZIA 1YTDA 3DLCA 4HF7A 3UG6A 3E2IA 1RWOA 2WLSA 5EZYF 2F62A 4D9GA 1IN8A 2F3SA 2YYYA 3IT2A 3WOHA 1L8AA 2VO1A 5KG4A 3SZMA 5T3YA 2OENG 1G8PA 3PHGA 3JQ6A 1N4DA 2ZBVA 2QRNA 5EXPA 2AW5A 1UZLA 3CN9A 3V8MA 3MWEA 4NF2A 4MOWA 1Y3HA 3PQ6A 1AMOA 2AJLI 3ZBQA 3GCXA 2ZIUB 1Z7EA 1TKCA 1ANKA 3B89A 4LF6H 3KHHA 1ONPA 1EBBA 4ALJA 5EE5B 4GBMA 5FPQA 1QIIA 5KQPA 2J48A 3SP1A 2PZLA 1MX3A 3SXPA 5JW6A 5FPKA 4CLRB 3OP1A 4TTRA 2DQKA 1T2CA 2DWPA 1FNDA 3A6HA 2ZAIA 2PYDA 2XTZA 3P19A 3PD0A 2IIBA 3N86A 4XWKA 4BV3A 4XH9B 1KAHA 2J3EA 2O0LA 4IGEA 4Y6GB 3G8CA 4Q4JA