3WO1A

Crystal structure of trp332ala mutant ywfe, an l-amino acid ligase, with bound adp-mg-ala
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
466
structure length
466
Chain Sequence
b'SKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGANMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 134
structure length 466
sequence length 466
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wo1A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wo1A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wo1A01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wo1A04
4O7VA 1WR2A 3KREA 4IHJF 3AX6A 3G8CA 5GONF 4TUYF 1KJJA 5LP6F 4O4JF 2WYOA 4MA5A 4M9UA 1OBGA 4I4TF 2PN1A 5HV6A 3V4ZA 3WNZA 4O4IF 3QFFA 1GSHA 3G8DA 4DLKA 2XD4A 4FU0A 5KX5F 2R82A 4MV1A 5EZYF 2W6QA 3JRXA 5H80A 4MAMA 5J2UF 3GIDA 3RUPA 4O84A 3R5HA 1GSAA 3N8DA 2ZDHA 4MV9A 3HO8A 5LYJF 4ZQIA 4YJ2F 5JQWA 3K5IA 3N6RA 2XCLA 2GQRA 2VHEA 4M99A 2YW2A 3R23A 4XYLB 2YS7A 1EUDB 1VKZA 3JZIA 5LXTF 1EYZA 3VPDA 4O7NA 2QK4A 4O7WA 1VBGA 1A9XA 2Z02A 1JDEA 3I12A 1IOVA 4NYEA 1M0WA 5CA0F 5JVLA 4E4TA 4O7SA 4TV8F 2R84A 4WD3A 4O7YA 4O2BF 5LOVF 2R7MA 2W6NA 5C8YF 1EZ1A 4FFRA 1SCUB 4O4LF 4M9CA 5JH7F 3Q2OA 3MWEA 3U9TA 4I55F 1ULZA 3BG5A 4ZOLF 4YAJB 3TIIA 2ZDQA 4Y8VB 4O7RA 4FFNA 4O7TA 2YZMA 4EGQA 5LA6F 4I50F 1I7LA 1A48A 2NU9B 2YWVA 3ETHA 4FFOA 5CA1F 1E4EA 3KAJA 1GGOA 3LP8A 5JQGF 2YRXA 5I47A 1Z2NX 1KC7A 3DF7A 3TIGA 2YS6A 1IOWA 1JDBB 2R7LA 1M0TA 1T36A 3E5NA 1CE8A 4ZHQF 5C1OA 4C5CA 2Z04A 5CAEB 3GLKA 1CS0A 4EAAA 3BSWA 4XX0B 1KJ9A 2V58A 1EHIA 4DIMA 3RV4A 1M6VA 2IP4A 4EG0A 3VPBA 3U9SA 2YYAA 3VMMA 1KEEA 4HNTA 3RFCA 1CQIB 2CNQA 3JRWA 1I7NA 2I87A 1KJQA 1W93A 4EABA 3LWBA 4M98A 4FFMA 5CB4F 4MV7A 4FFLA 4MV8A 2W70A 1AUVA 4J6EA 5JVDF 3TQTA 3ETJA 4YJ3F 1KJIA 1UC8A 3VPCA 3BSYA 1C3OA 2YZLA 5FNVF 2DLNA 3VA7A 3HBLA 2GPWA 5K2MA 4RZQA 4C5BA 2R85A 2CNVA 3VOTA 2C00A 4MV4A 4MV6A 4O7LA 1JKJB 3MJFA 1DV1A 2ZDGA 2GQSA 3BFPA 3BSSA 4O7ZA 1Z2OX 4XZ3B 5BPHA 1UC9A 1KJ8A 3NUAA 3OUZA 2NU8B 4HNVA 3WO1A 2P0AA 2FPGB 4O86A 2HJWA 4GGMX 3KALA 2VR1A 5C1PA 5HBRB 3AW8A 1BXRA 4HQ6A 3SE7A 1DV2A 1OBDA 2FB9A 2GPSA 4IWXA 3MWDA 4O81A 5BMVF 2CNUA 2QF7A 3ORQA 2GLTA 3TW6A 4FFPA 2NUAB 5KKNB 4EA7A 2R7NA 4XYMB 2R6FA 1B6SA 1PK8A 3JZFA 5BPFA 2V5AA 3R5FA 1E4EB 2X0SA 2VPQA 1GSOA 4MA0A 2W6PA 4EGJA 4HR7A 4IWYA 2HGSA 2NU6B 3ORRA 3HB9A 2NPOA 1AUXA 2YL2A 5IYZF 3U54A 3V4SA 3K3PA 1VBHA 4EA8A 4O82A 1PX2A 4YAKB 1KUTA 2YZNA 3UFXB 4ZI7F 2YRWA 4HNUA 4YBZB 2NU7B 1BNCA 1Z2PX 1W96A 2PVPA 1DIKA 2V59A 4FGRA 2R87A 4MV3A 5DMXA 2FPPB 2W71A 3U55A 3WO0A 3Q1KA 4FE2A 1B6RA 2FPIB 1KBLA 2W6MA 1JLLB 4ME6A 4YB8B 4O83A 4C5AA 2FP4B 4EA9A 2YZGA 3R9RA 4QSHA 5D8DA 1C30A 2J9GA 2R86A 2VQDA 2I80A 5J2TF 4L1KA 1EUCB 4O2AF 1CQJB 2PBZA 3KAKA 2CZGA 3RV3A 3TINA 4IZOA 2W6OA 4TV9F 2DIKA 2W6ZA 1GLVA 4IIJF 2DZDA 3R5XA 3OUUA 2I8CA 4WBNF 3K5HA 2SCUB 4O4HF 2CQYA 2OLSA 2DWCA 2R7KA
chains in the Genus database with same CATH superfamily
1II9A 3L0PA 5IJZA 2D1SA 1CFJA 1KF0A 1OVGA 3IEXA 4TMWA 1YQ9A 1ZLYA 3KLNA 3PYXA 3R5KA 4BIIA 3OZSA 1V9PA 2MCTA 4BZQA 4OI2A 4EM6A 4B81A 4KBGA 3CLUC 4C4TA 2O06A 4D8YA 1RAGA 1G60A 1X7ZB 1C7RA 2RGNA 1EIZA 1XL0A 1MOZA 4MWBA 2JLQA 3E6AA 2C95A 4WVFA 5IWAB 5DHUA 1P6XA 5G3ZA 2UXCH 3TKAA 2X5RA 2B4TO 4LBVA 1ZM3A 5M29A 1M1XB 4J1NA 3ZY5A 5CIQA 3L1KA 1DMSA 2WF5A 5CG1A 2R7AA 1U2DC 4PG4A 4U0KA 2QN1A 4A3SA 4A36A 1PLLA 1HX7A 4GBMA 5JARA 3VR5H 3AY0A 1F7UA 1GQSA 3DV2A 4U2CA 1HNZB 1ESEA 1XVUA 1NONA 3Q8QB 1PNOA 4KQ1A 1EFPB 4J0IA 2Y68A 3MF4A 1E69A 5JFTA 3OIFA 2BI4A 1ACJA 1O75A 2O59A 1C3LA 4H16A 1JG2A 3U40A 3M5DA 2J6IA 1IATA 2QRJA 4H15A 5ALFA 4X0EA 3ZJTA 2I54A 4BWFB 3OEHA 4FWBA 4LHZA 1L5KA 1Z0JA 5HZMA 3G89A 2J6SA 3DCNA 2X8JB 1ZA1A 4R0MA 1N5RA 1RWPA 5J2UB 5BORA 1SOMA 5HJ5A 1KOFA 1JTEA 1Z0FA 3HVJA 3WZLA 3A1TA 2VPZA 4NZMA 4LF6B 1SKQA 1N5LA 5BW4A 3UPDA 2IP4A 3GOQA 4YMUA 3OJFA 1P1CA 1MGOA 3WJAA 1X7ZA 1KORA 1H3FA 1M2JA 3ILXA 2ZVPX 4HNGA 1NNEA 4XWKA 1PHPA 3EHDA 1GQRA 3IAM6 4ZYWA 1FP4A 3VISA 4WOJA 4X91A 1YHZA 4RJ2A 1YRWA 3TZEA 3OQJA 4ZEVA 2H65A 1GTG1 2G06A 1GFZA 2CW7A 2PR2A 1X74A 3BFXA 4OCZA 4L4ZA 5I4IA 1W35A 1DKNA 3K73O 3ZU2A 2X0IA 1BGXT 2F4VB 4EHBA 1XEXB 3Q7IA 1N36H 2GJKA 2VNSA 2VHJA 3CPSA 3LKDA 3S2SA 4EKGA 1DAEA 2VS1A 3KSRA 3E7XA 3I3OA 5EE0A 4O81A 3V8BA 2H57A 4XIIA 4FFPA 1N8SA 3GMDA 4NJEB 1QK5A 2PJZA 1X3SA 3QQ5A 1GSOA 1W94A 3AWDA 4ZCLA 2PD4A 2EBHX 1HG1A 2BGLA 3G7NA 5EOVA 4PZCA 1Q12A 2XNJA 2P2YA 3ZQKA 2OFOA 2VUTA 4QQNA 3SYTA 5AW9A 2POQX 3ZS8A 1CG6A 4DV1B 2N75A 4ZI7F 1M5RA 4IR9A 3NJRA 3MFHA 3JWPA 4INJA 2RG1A 1RYSA 3I9OA 4RZIA 4JI5H 4C4AA 2OOSA 2W8LA 2C96A 4UUAA 1XMVA 1HFWA 1E9FA 4YP3A 4PRZA 4TLAA 5FP0A 2Q27A 1N7IA 5K20A 1JKIA 4BNYA 4I46A 1JV2B 1HYGA 5MLCO 3NH9A 5B53A 4HWRA 3DBOB 4QWAA 4ID3A 2HCJB 1TW3A 3U31A 5B7NA 1T34A 2AYXA 1UPAA 1N63B 1EUQA 3UKJA 5FPOA 3GJYA 3CCBA 4QUGA 1R1DA 2NU9A 1S02A 3M3DA 1QG6A 1AKUA 5H0IA 1D5CA 3L43A 1OC2A 1QMPA 3VPAA 4E70A 3T41A 2J4DA 3EC2A 4JI6H 4FFDA 4KQCA 3U7EB 1OFVA 2EIYA 5GONF 1SXIA 4ED0A 1BVYF 3FYCA 3P9YA 3HHEA 5F3RA 5CAEA 4GI3A 4M9UA 3B52X 4FGLA 1RJ9B 4I4TF 5MF6A 1OIXA 4P4SB 5KX5F 4NATA 1NVXQ 5A03A 4HOYA 2QS9A 2FWPA 2O0KA 2ATLA 1Y63A 1NL3A 2QM8A 1YRLA 2XA1A 1QANA 1LRKA 3GLGB 2ONKA 1AKEA 1XG5A 4I1SA 2Q45A 2QHXA 3QXJA 2IYNA 1QDUA 4L8VA 3VPDA 2YZ2A 1XNRB 3NBYB 4O4LA 2VEOA 1I3OA 3T9DA 5CFPA 3ZLVA 3EG9B 1QO7A 1ZD3A 1P2DA 2UVPA 1IOVA 1QAQA 4QXQA 3B13B 2QVXX 2AB0A 4MDYA 1V8PA 1DFIA 3ONEA 4XVRA 2MSWA 3JATA 2WWTA 3OZEA 5GZ6A 4C0XA 5LOVF 3R8FA 5BQ3A 1F48A 2W9BB 1J2JA 3VI3B 2IWRA 3AERB 4HN4B 2JIDA 1XZ8A 4LRXA 3G0DA 1CYDA 4ASUD 1VLVA 4Z99A 3HB7A 4BKPA 1J70A 3RHFA 1IEWA 3VHXB 1J8YF 3S27A 2IWHA 3TDNA 4RHEA 3PGMA 1T5HX 2VBFA 1CZLA 3FFAA 3DHEA 16PKA 2FSSA 1WS6A 1FKAH 3UBTA 5KFKA 4K1LA 3KVVA 4S35A 3V34A 4RKYA 1P8LA 2A9VA 5EWFA 4K26A 3VX3A 4DIFA 4ZANA 3G1TA 3LLUA 4GE0A 1JNYA 1O03A 3RVSA 1PR2A 3T1YH 4ZHQF 4TQSA 4B9EA 3D59A 2H3EA 3PQ4A 2GKSA 2DSNA 3UV6A 3ZOZA 3EMBA 2LDBA 3F49S 4UXIA 1BFUA 5BURA 2L2QA 5EPUA 4BL5A 3UO8B 1UIRA 3DJFA 2PMZA 4M54A 3PFNA 1V8OA 1PYOA 3L82B 4AZ3A 1JMKC 2ECOA 5JCXA 2RK3A 5CXUA 1Y5LA 3EFEA 2W2LA 4DBLC 3AEZA 1AUVA 2R92G 5D3MB 3ZVNA 1EI9A 4PSAA 2R93A 4QHTA 5KOHB 4D4IA 1GRVA 3R76A 2GI4A 4PHCA 3B12A 3E70C 2WE8A 2CNVA 4Q7LA 1TIBA 3MTAA 5KKAA 3TE7A 3SZRA 1PFQA 4JVNA 3KHRA 4J7UA 1V16A 4M89A 4BU1A 3CIOA 4BNNA 3K32A 4JENA 3GUCA 3GNSA 4KOAA 4BNDB 4G9GA 1NW5A 2DJIA 5J4KA 2EDAA 1BXGA 1TTTA 1C81A 1Y8RB 4XJTA 2OUKA 4F50A 3RREA 2I1WA 2HA2A 4EPVA 3H75A 3JZFA 3COWA 2MSDB 1R6DA 1UK9A 2YVQA 1AV6A 4K2HA 2GM4A 1A9PA 1JR4A 3KEQA 3RB0A 3H11B 5LL6b 4DB2A 4DV3B 3PHBE 2PA2A 1SC6A 4PGMA 2HWWA 2QUBA 4UM9D 3L7NA 1EWYA 2HEIA 4FHZA 2PWZA 3CX6A 1L5VA 1ACMA 3HBNA 2OFFA 3KS9A 2W6JD 4MW1A 5C0OE 3A4NA 4GSKA 5FNVB 5K0GA 3WGQA 1LTQA 4ECAA 1YFZA 5D3MA 5G0SA 4CM3A 4AY5A 1XX6A 2IDZA 3IR5A 1V6AA 3KPWA 2YWDA 5C5IA 3QVLA 4QU5A 2PS0A 1WVMA 3RR2A 4O8CA 5DX0A 4OBEA 2JAQA 1EQAA 4HDSB 3TQHA 5K6AA 4JEIA 2WTFA 1T25A 2W6ZA 3PFIA 4F96A 3W6UA 3DBVO 1QK4A 3M0EA 1KAOA 4OAOA 2DX7A 1CJMA 3EEQA 4M0LA 1AGYA 1PZHA 2LIVA 3IOCA 1YI0A 3NG1A 4DV0H 5HIJA 4ZEOA 3KJEA 3GD5A 2F1HA 4A8HA 2UYGA 1XP8A 4PR3A 4IRUB 2CD7A 1XZNA 2HF9A 1TUEA 3H0CA 1DAGA 3NHYA 2WF6A 1HRKA 1PJRA 4ZPJA 3I6IA 2XUPA 3GP5A 4G4SO 3BQ2A 4QNNA 1IEQA 1XQVA 3EIOA 2PGNA 5BUSA 1Z18A 5GP1A 3GRUA 1SZPA 1UKYA 3ASZA 3EF1A 3M7IA 1QH8B 4Y1EA 5K0LA 3H2SA 4BXOB 3JD4A 4YCNA 3KCNA 2RK6A 1UBHS 5CEEA 2R79A 4B84A 1V7CA 2M98A 5F3DA 2EZUA 4N6OA 1OU0A 2PT9A 1YU6A 1MAUA 4OU4A 3M3HA 4OBXA 3PFWO 1TLLA 3PTZA 1SVIA 2P6NA 1DUVG 2CL0X 5DT2A 2D1RA 4EJMA 4UATA 3GQVA 1BXKA 4KLRA 1PWHA 1ISHA 3LSTA 1EDDA 4BLQA 2CMDA 1WPRA 3U7FB 3ZCSA 4XDZA 4L5CA 5HBRA 3OP4A 2JCVA 4DRXB 4MGIR 2JB9A 2OZPA 2C07A 2VJMA 2A84A 3KQKA 4NDAA 3RODA 1FX0B 1TMYA 4PLPA 4LF7H 3O38A 3SS8A 4JBIA 2TMDA 4JJAA 4XVHA 3DMPA 2RD2A 1ISRA 1FNDA 2RE8A 3AFOA 2ZBGA 3QFRA 1PQUA 1MJGM 2AI2A 3LT2A 1ZW6A 5AM2A 4L4XA 2IEDA 3QE0A 1XU7A 4MVJF 2EF0A 3KVRA 3G88A 2Y6UA 3G6KA 5TMEA 1CR4A 1M76A 2WSIA 3OKCA 1YS9A 1KI9A 1ZN8A 1DEKA 1ZJWA 3SDSA 4LBZA 3L40A 2WAQE 4RGVA 1JA1A 2ZU0C 4IXTA 4Q7QA 3WDKA 4WXPA 1QHNA 1RJDA 3IQHX 4K28A 4R5HA 3IUJA 5J3JA 5BNTA 5HE9A 3FVVA 3AKZA 3GCXA 1Y89A 5I5XA 1MKYA 3HJRA 4TT3D 1RTKA 2DPJA 4BXOA 2PLRA 3THWB 3W5HA 1ILEA 3OOHA 5E7MA 2BGIA 3LU1A 2GZAA 2DQZA 2OUIA 5FUXA 3BAAA 2UZIR 2MINB 3V3TA 1YACA 5B2ZA 4NCHA 3MLAA 4RIEA 5KMGA 3NHBA 2HA7A 3RAFC 4E1VA 2ZB2A 3ZCQA 4CIVA 3O31A 1N7JA 5JS8A 3U5ZB 4ONEA 2Z83A 1N2XA 5TQJA 1JPNA 4Y1GA 5CD1A 4B6JA 1YCHA 3WYDA 2ZDGA 1WETA 2XUQA 4UE2A 3G7SA 4DRXA 4BO0A 1E2NA 1JLSA 2A0UA 3PO2G 4LF4H 3P9KA 2OO7A 1NQUA 2OB1A 1UBSB 1WSBA 1G19A 5DLDA 1DTEA 1GEEA 3E1GA 1Q77A 1RQ2A 3EW9A 4X1KB 3RIEA 1F5NA 1OWNA 4PTYA 5B3AA 3CINA 3S2YA 4GOKA 4L57A 2F1OA 2E7ZA 5BYBA 1Y7LA 4KO1S 3JWGA 9MHTA 3NBMA 2B6NA 1REQA 1Q7TA 4B3TH 2W54B 2RGXA 4FOSA 4HEA1 3U54A 1Y6JA 1DB3A 1U99A 1EQUA 3A31A 4EUNA 1NW8A 1C8KA 4RNMA 2FUKA 5CEJA 4LXIA 4XRRA 1M6EX 4BBAA 1SCBA 2GD2A 5IHXA 5M7EA 1YZNA 1I24A 1SAYA 4BFXA 4EG3A 2I7XA 3ZZUA 1CUGA 1H0RA 4L8GA 1QYRA 4IDQA 4LYJA 3ZGVA 4F56A 4NWIA 4P82A 3INNA 3HUUA 1TAGA 3GDEA 4TVBA 1T4BA 1M0EA 4WCFA 1FZQA 3FGOA 5JHGB 3DZHA 5DEOA 3LUGA 1X1BA 1U0SY 2GO7A 1E6EA 4M8SA 1USVA 3C8HA 4GNKA 1CUCA 5AOAA 1OXUA 3F9CA 1YKGA 2Q49A 3SG0A 1ECGA 3CUYA 3W6ZA 1S8NA 2QLMA 3CF6R 3D6UA 3R09A 3JWJA 1U2PA 3TNDA 1NXVA 4X1KA 2AVDA 2FFJA 4PTLA 3RSZA 1DEOA 1V3UA 3AESA 3SSMA 3ZJYA 1XWWA 5DLYA 5CX1A 5FYDA 4YHHH 4HX9A 5D3KA 3TZCA 4P53A 4EP1A 1GSHA 1A9QA 4DHEA 3FCUB 4H0CA 1I8TA 2FGKA 4EVIA 3KTAA 4KQFA 1YJ9H 2ZUTA 1R6VA 4IIYA 5CTAA 4FHGA 5ECGC 3DMHA 3ZWBA 4BO2A 2E4VA 3MRXA 1MXFA 3Q0EA 4WUVA 3ITNA 1JR6A 3ECAA 1YB1A 1GRCA 2XX3A 1L3CA 1Z5PA 3WHKA 5B1HA 2GQRA 2C58A 2ZJ0A 2QM7A 1RAHA 4UNNA 4BVEA 4LOKA 1AURA 2NP6A 4TLLB 5BVHB 4D8WA 4E07A 1XMQH 2CUZA 3PGXA 1LPBB 2FUNB 4H1TA 1LGYA 4HPJB 3VKHA 1GKIA 1P77A 5AJZA 4BUJA 4AYWA 3LUJA 3OZXA 3QUAA 1CULC 5H59A 4CUJA 1LD3A 2P41A 2XUKA 2Z6VA 4O4LF 3LVFO 1NR5A 3MWEA 2QD5A 4D97A 1DLJA 1VQLH 1E4YA 3HO1A 3OJEA 5EP1A 4BBPA 1MZBA 2PL3A 3OLZA 3K30A 1WBJB 4HVAA 3L04A 4KR7A 3PW5A 2FXVA 2EJ3A 4EMUA 2A1TR 1L6IA 4C6SA 1TU0A 2OC4A 3GEPA 2VRWA 3LHSA 4PXYA 3DGFC 4JBLA 4Y98A 4LN1A 4NYJR 2FEOA 2PMFA 3KJIA 3OE7D 3EAQA 1EX6A 5E7QA 2AHOA 3V6HA 1R0WA 5IWCA 3AU9A 2QX7A 4GI7A 1ENZA 4LWOA 1P0IA 1NUPA 4GKJH 5AM5A 1L8AA 1QRSA 5TMBA 2ZYVX 3VYTB 3KXYT 5A5VA 3GLUA 1SOVA 1S0NA 1W2GA 5TQ2A 2CZCA 4D3YA 4C2AA 3PDIB 4D0RA 5BVHA 3QKWA 3UJ6A 3Q12A 3S1LA 5FWYA 3E7DA 1ZOOA 3QX3A 3HR8A 5ETJA 3CISA 2AQKA 2CXUA 4GKBA 1TTHA 1BDMA 1U28C 1GGNA 2WAQA 2R6GA 4NG5A 2Z8YM 4L51A 5CM8B 2B6HA 1QNFA 2ZIGA 4DLXA 4D5EA 1WQ3A 3HI6A 5JLJA 3GG9A 3PNLA 3ZK9A 5KFPA 4EDFA 3UOAB 4TL9A 4DIBA 3ICEA 2H52A 3R3HA 1JP7A 1Q16A 4GA5A 5EJMA 2VF2A 4B3SB 4UBIA 1R00A 7MDHA 1YBVA 4I3FA 3H2JA 4R8SA 1M2VB 5EQDA 1GU0A 4N39A 5B3JC 1NLFA 4ALMA 3MB5A 2XE8A 4ZYVA 1MXHA 2NXNA 4N5HX 1HQKA 1JFLA 3DCJA 4G86A 4DMMA 3INTA 3PXUA 4CKWA 3NVYC 1CJTC 4B6RA 1NV9A 1RDFA 4LJRA 2PR7A 4HQ0A 4WKPA 1WKIA 2CCGA 1NM5C 5LL6P 1P1KA 4L4UA 5LLSA 4BQNA 1JHUA 4QOEA 5EGSA 3F7MA 3SJAA 2AD1A 4C9BA 1XRQA 2D5CA 3BHJA 1KJZA 1MAVA 4F2WA 4QGFA 4EFEA 4BHTA 3OURA 1KC3A 3D7MA 1E58A 2HIVA 3WGOA 1DE0A 4E5UA 4BUCA 2AUTA 3MS7A 2JFZA 2HLPA 3IBYA 3ZLTA 4UY8M 3U3ZA 1O58A 4JOCA 3PDIA 1VC2A 3D8HA 1VQ6H 5HIAA 1LA2A 2JDID 5KFRA 2IELA 3A26A 3BF7A 1DOAA 3RI3A 4N9QA 5IKMA 3ESRA 4A6PA 5EUQB 3KD3A 2PO7A 4D4JA 4X1IA 4HUJA 4XLZA 5I5VA 3CVYA 4NBLA 1WR8A 4EITA 3WQRA 4QG7A 3CZ9A 1EEHA 4GYKA 3C7TA 4RCZA 3OU6A 4XUGB 1OLSB 4A0RA 2JCBA 1QJCA 1CR2A 2Z2KA 1ECBA 3JV7A 2CLFB 2A0YA 1H05A 4KWEA 2BUCA 4RA6B 2QX9A 4QUKA 1PW5A 2J5BA 1H5QA 1EJ2A 3QYJA 2D7DA 1YB2A 3KB1A 2BTQB 1LBTA 3VTFA 1ENOA 1Z74A 1FSZA 2A67A 5A9SB 3Q9NA 2IHVA 1LI4A 1U2ZA 3REQB 3QNWA 3EQ9A 4UHKA 3AJRA 5HSGA 4A10A 2RJNA 1DIOB 4K7JA 4O5OA 1BRTA 4UBMA 1LLDA 2YZ7A 3FTNA 1POWA 3M4XA 4P4GA 3SX0A 1Y4AE 1M2FA 4ASUA 3FOEC 2VHZA 3PNYA 4B7XA 2DE0X 3KCQA 1OF1A 4CW7A 1F2UA 2GN4A 2ZYWX 2CLLB 4O7WA 1ZR2A 5BSVA 5AM4A 2YFQA 3PFCA 2KLBA 1MH1A 5LLDA 3JR7A 1L5GB 3GROA 4XVQA 4KHZA 4LKOA 3BIOA 1ODFA 3QM1A 2VQFB 3EYAA 5ITZB 4QLOA 3HA2A 2ZJYA 1GA4A 3UJ3X 2AMFA 3OE4A 3THXB 3ENZA 4ILKA 3PEUA 4UCRA 4IMJB 5EJ5A 2HTEA 4MIYA 3T5AA 1IBLB 2BBSA 3UXEA 3IE1A 4GXRA 1X14A 3WGUA 4QDJA 1X7DA 3WR5A 3ZNQA 3JYPA 2CNKA 3FUUA 2NUAA 3C6ZA 4I1OA 4J29A 1HZZA 3I39X 1K8RA 2C4VA 4GW3A 3KQWA 4PVCA 1XV5A 4WX2B 3ELUA 3HY3A 1ZBQA 2PK3A 4RZSA 4KQ6A 3WTCA 1NMQA 2FWMX 1U9JA 2JK1A 1ZD4A 4RJKA 4QA9A 1WAMA 5DNYB 4UVHA 2W8BB 3GEBA 4L72A 4XWOA 1DAPA 4DV4B 4K9RA 4X45A 1KYVA 4MROA 1T4DA 1S0OA 2O2SA 5HULA 3V8EA 3MTEA 4LTDA 3ZCVA 1FLNA 1A7KA 2AGVA 5ESXA 2P7IA 1P1RA 1P2GA 2ACEA 3VR0A 2RHHA 3WL5A 3A6KA 1QIEA 5LQAA 3N5KA 2IEYA 3WLHA 3F5DA 1ST3A 4JLKA 2FW9A 2PXCA 3HCWA 4YYZA 5AXBA 2E2WA 3H8JA 2I1QA 4GOLD 4FJ1A 3LX5A 2V5UA 4K6FA 2WQZA 3AVOA 3QMMA 4KXQA 5E8RA 4D0GA 2QPAA 3I6YA 4Q8FA 4MJXA 1G9SA 4M1QA 4QYIB 3Q8PB 1DHRA 1U9ZA 4F2DA 4DLRA 2YZKA 2W6JA 3FG9A 1L8XA 5T67A 4J03A 4JIMA 5CW1A 3KYCA 1RQRA 4WK4B 5IJWA 3LDUA 3C3MA 2V55B 3IOYA 4ZO7A 1QPQA 1YE5A 4AO7A 3M4YA 4HLDA 3CMAH 1G1AA 3F6SA 5ALNA 4AQ7A 2C4NA 1IXKA 1SCJA 3GV5B 1JQ3A 1O5OA 1YUBA 1E2HA 2OC9A 2ZRQA 1VMDA 1PJ8A 1Z7BA 3OM8A 2B34A 2AZ4A 2RF4A 2G5GX 3T3EA 1UT6A 1N6RA 2RDJA 3DZDA 4FFWA 1AA6A 3O8QA 5K3FB 1R5BA 3G1UA 1CV2A 5G41A 4QARA 1UXGA 4G6ZA 1RWOA 4L08A 2I2FA 4ND5A 4R6WA 4J90A 5LA6B 4U67J 1MJFA 1V0JA 5A62A 1JR3E 3LYHA 1JHMA 4R3NA 1NW4A 4Z0TA 4UOEA 4KVAA 3U16A 1BQ4A 4QYMA 3OTOH 4Q39A 1NUSA 5BYJA 2AXEA 2AYZA 3HEMA 5HM6A 2WMDA 1A8UA 1F20A 3EXIB 1PQWA 3W8RA 3EPPA 2XWJI 3UOGA 4U7WA 1JE1A 1UAGA 2HCFA 3IQGX 2EERA 2EKDA 3PEVA 2XB8A 3T12A 4J1QA 5ALZA 2WMYA 1E0DA 2UVRA 3QWBA 4RYLA 3K9BA 1DKUA 2XD4A 3AYHB 2VJYA 2FPOA 4D3XA 5H80A 3G0HA 3W2HA 3PA6A 3UT5A 1A8PA 1P75A 3X1XA 1OGYA 3ZJVA 3LCVB 1PS8A 5HFJA 4QT0A 3F47A 1QB8A 3UIEA 3A4LA 1VL6A 1ZA2A 2LBPA 4M99A 1L5ZA 3NGMA 4IWNA 2UVWA 2VDPB 1H3EA 2V7BA 5FPSA 2IHBA 4L9AA 1EDOA 2Y4NA 3PZRA 4M1EA 4W1QA 1VBGA 2IA5A 1KMQA 1ZN9A 1FFXB 4KQHA 1VAJA 5AUPB 3IVMA 4W5TA 2PEZA 1IM5A 4UTOA 1IK4A 2I8AA 2Q3EA 1EGQA 5I01A 5IANA 1V3TA 4YR3A 2VTVA 5MFZA 1NR1A 2VQEH 3D6JA 5KT5A 1PD0A 3UWSA 4N54A 2B8WA 1HDCA 5LMNB 3OTHA 1XA0A 4QTYA 1JWAB 4DV7B 2H0QA 2CXHA 1Q84A 2C04A 1ZJJA 1XNQH 4FFNA 3GIWA 3W9SA 5EXXA 3N3BC 3ZWKA 5JY6A 5DI3B 4TT3A 1H8ED 1D7AA 5BRAA 2RHBA 5KX5B 2P8JA 3HZOA 2WVGA 4NL4H 4OB8A 2V1XA 3TSCA 4H77A 3FCYA 3LC0A 3F46A 2NPFA 3W9BA 3B6EA 4BMPB 3TLEA 2LUOA 3OMXA 1I5OA 4PWYA 2R6R1 3LY7A 4Q1AA 4UD6A 5FB3A 4PAOA 4EFLA 2G36A 4P6VF 2DQYA 1Z4MA 3HXMA 4KGDA 5BN5B 3RVDA 5JXIA 4U8GA 4A3LG 4OGFA 1J0BA 1FFXA 4JLPA 1SQGA 4REMA 2I7CA 2X1HA 4PLFA 5DGAA 2GM3A 3TL3A 3EDYA 1YZQA 2V7EA 1CUAA 2VWHA 3OQ1A 3VPXA 3PFGA 5C3EG 3VTAA 3AETB 2IOHA 3Q5DA 4EY8A 1X2EA 3MJHA 1RC0A 3JQ8B 5DW0A 1JKJB 2F43B 2F00A 3HEBA 3OZRA 1NASA 5BWLA 4XZ3B 1JG3A 4DF3A 1PJAA 2PV7A 4GDMA 5LP6B 3TEJA 3DULA 1BGWA 1DV2A 1RJPA 3LQRA 4GKVA 1EFKA 3CPEA 2UYQA 4ZHQB 2VQSA 2ARKA 1T6BY 3KYBA 1RHMA 5F73A 4MUXA 4LQDA 1I14A 4BZZA 4KR6A 3UMFA 4JLAA 3P5BA 2O7NA 2GN0A 3CEAA 3D6NB 3K15A 3HBMA 2OVFA 3BMQA 3VUFA 2G04A 4PFSA 1GL6A 5MGBA 2XQJA 4ZEMA 2BGRA 3VKGA 5BUZA 4MS3A 3VDNB 2J1LA 1MQSA 2O8FA 4JCCA 3WMFA 3N2KB 1NQVA 4RAYA 3EVFA 4PHGA 1KNQA 4URVR 3OCUA 4KXMA 4JI0B 4FJ2A 3PQ5A 4YB8B 2IXEA 1QYXA 4L0MA 4E4YA 1YHNA 3BZUA 1NBAA 1W36D 2XCUA 1FVFA 2ZKLA 1RLIA 2W6CX 1FVIA 1HWYA 1YA8A 1CQPA 3AETA 4Y6LA 2EJCA 2JBWA 2DT8A 4ZMSA 2DQSA 1JKJA 1PKXA 2O8EB 3S4YA 3W0LB 2DABA 3M82A 3O4JA 3H13A 3DOHA 3SXPA 1G66A 2D4HA 4DGSA 3ZD9A 4ZYTA 2AC7A 1O95D 3GOHA 3GPCA 3EBLA 3DEAA 1OB2A 4LHSA 3A4TA 3ENQA 1UP6A 5BWVA 3D5QA 1NXSA 3K2IA 2OXTA 1GR1A 5TNXA 4LGYA 2CVOA 3ROMA 4CM9D 4UDNA 1DX6A 1G42A 3I8SA 4F2HA 1RHQA 1O4VA 3PLAE 2I4RA 1GV1A 3O9ZA 1JBQA 2GFHA 1I1LA 2ZR7A 3QFFA 1U02A 5HZKA 1VE1A 3M6FA 5IZ4A 4RQUA 1QVRA 3TCXB 5KFUA 2JBAA 3PIOJ 2WY2D 3W2IA 3OTWA 3LZCA 5K3DA 5AVQA 3N2KA 4DJAA 2XF2A 3CHYA 5DWQA 2HQOA 3I2JA 1MZVA 1CKEA 1KDVA 1A9XA 1Z2EA 5KQGA 3PKJA 4UTVA 1K0UA 1YDGA 4PX9A 2QR2A 4K1XA 1H65A 1SD1A 1VLHA 2IHTA 1FCJA 3RSQA 3TQOA 1OAOA 4LCJA 2CGEA 4HNHA 2P75A 2OB2A 2I6SA 3OE7A 2HMUA 4B4DA 2WJVA 1W85B 1N0UA 1OZHA 5T8KA 1MW9X 3IEUA 2Z2IA 2GOYA 3HYRA 1FDUA 1LPSA 1R8JA 3MJDA 4ARVA 1YQTA 4O7RA 4B34A 2X22A 3BB4A 2YNMA 1ZGHA 1LB1B 4I4LA 4Z9XA 3GCZA 2IPAB 4OHOA 4E5VA 3DE0X 3DEJA 1XZBA 1STOA 1Q0LA 5EYPB 3U0VA 5JWRA 2B1QA 3W3ZB 2ZAIA 3F3KA 3H04A 4MYUA 5CLLA 3OE1A 2Y2UA 1IFXA 1DCFA 5LBIA 3WWEA 1XCPA 3AOGA 3FF4A 1UT5A 4BNUA 4LK3A 1R50A 5GGYA 3CT6A 3ZDDA 3LY5A 4OUKX 1PZXA 1GY8A 2VYCA 3CONA 1TVCA 2V96A 3W9UA 1QIJA 3D0OA 3G5UA 5TEWA 3WWJA 1DX4A 1OIVA 5I4CA 1R9GA 1LUAA 4GMGA 2R8XA 1VSVA 3KXPA 1Z39A 5JYEA 3THRA 3QUSA 4EL0A 4ZVLA 5JPCA 4IZ6A 4JV5H 2CXPA 1CQWA 2ZYAA 3BVPA 5JAZA 2WQ6A 3JAMW 4LX0A 3KHUA 2Q6TA 2NYVA 1CT9A 3KQUA 4FE3A 1QDEA 3QEMA 3JPWA 5CK5A 4ZCIA 4ZRNA 4LGMA 4YJHA 3PDCA 3ZZ0A 3D02A 3OX4A 1BDIA 1LLCA 1DIRA 3B51X 5DGHA 5BOVA 1HQDA 5EQFA 2Z1DA 2FG5A 3A1NA 3LTNC 4ZRMA 1DBIA 5KUTA 4MUHA 2CLSA 2C4UA 5JWOA 2JD0A 2VAXA 1YUMA 2GD0A 1XRMA 4AMUA 4MLPA 2PA0A 2OHOA 1BWQA 1GRQA 5H9VA 2V5AA 4G8BA 3WV4A 1SVMA 1HTWA 3EXFA 2JDIA 2QMEA 4CPDA 3IQIX 1KI7A 1S7GA 4UHDA 1QKKA 2V4MA 1Y3CE 4A1FA 2H1IA 3QX8A 4RELA 4RSGA 3D81A 1QC5A 2EXXA 1BX1A 1Z6ZA 4BV3A 1X13A 1K92A 4L78A 1OX5A 4QG3A 3RKRA 3I4LA 1N2OA 1PJCA 2EG9A 4CDMA 4MLDA 4WT7A 3H9JA 1VM6A 1TYBE 4YRLA 4IMIB 4O2AA 4M7EA 1T0HB 5HA5A 4CCWA 2BHRA 5K0NA 1B6GA 4GPIB 1GTL1 1R9NA 5L40A 4ZAFA 3AEYA 3O4GA 5HIMA 3RRYA 3TTSA 2VA9A 1FP4B 2WMNB 1KHHA 3MS4A 4O4HA 3DL2A 2W93A 1E7MA 3F8TA 2UYCA 1JDJA 2VQ6A 3OESA 3L0YA 3IO5A 4FMPA 2QWXA 4YROA 2ODBA 4IZOA 4NESA 1TTQB 3MOSA 2E6KA 4BO8A 3QNUA 2BFCA 1AX9A 4QXMA 3N2GA 4J9LA 5ALTA 2FCRA 2IX3A 2A1UA 3ON5A 4C2TA 4H27A 1BWSA 1L2ZA 4AROA 1J2UA 3D64A 4PF1A 4LVNA 2Y0BA 1Y6ZA 4B8WA 1XWFA 2LD4A 3WV5A 5BT8A 4IDFA 1Q15A 2G8LA 2P35A 4U7HA 5EI5A 4WCEJ 3G8AA 1I1NA 3S2EA 4K6OA 3HN6A 3WYNA 2CVHA 1Y1SA 3QVGA 4A91A 1YT5A 1K98A 3E2MA 1Y34E 4R0VA 3WK8A 4AF8A 3EVBA 4ITUA 3BDIA 4PR0A 2D5LA 4J1TA 2Q4DA 2FXIA 5DU2A 3DFZA 4D79A 3A3OA 4YDQA 4JC0A 4BX9A 2IUUA 1G4UR 4R4JA 2HIXA 2C2DA 3U3OA 4Q1VA 2FUCA 6NULA 3K8QA 4FSXA 3S1AA 2HDNB 1COWD 2A9FA 3LBHA 4A15A 5LA6F 3DW3X 2NU9B 2JD1A 2FRDA 3KKPA 1E3QA 1FDIA 4GOMD 1H2RS 1MA3A 2C7BA 3U4MA 2R8HA 3LX4A 1SY7A 1R0BA 4MUAA 5FD6A 1VL8A 2YS6A 3DNPA 1P81A 4IDBA 2G9UA 5CAEB 4UPVA 3K0KA 1V8BA 4OI4A 1M2KA 3EARA 4I5GA 2WHXA 2DFLA 1LVUA 4M21A 5CA0A 4RD0A 2DB3A 2FZVA 3KNZA 4KH0A 3BERA 3PQCA 3ICCA 4DG9A 1I7NA 2A0FA 1JLHA 1EE9A 4L2IA 5I8WA 1KMHA 5ICEA 4ZALA 3NHJA 4P3YA 1MEEA 4FR5A 4BU0A 4YRIA 2V65A 4O1HA 4O4LB 3NBYC 2COKA 1IQRA 5BN3A 4ALJA 2UVPB 4LIPD 5J1TB 2M1ZA 3GJZA 4AURA 4Q6WA 3ELDA 3JWEA 1A4UA 5K2MA 4QJIA 1QZZA 2QG9A 3ESDA 4JWKA 3JATB 2C00A 4H0FA 1FMLA 4HX5A 2AS0A 3MW8A 1DKRA 1MRNA 2YWCA 1M8PA 1Q0UA 2NT4A 4BFUA 5J23A 4DLNA 2WPDD 4M37A 5EE5B 3GJ4A 3SE7A 2HFKA 1PIWA 1E2LA 3AH8A 1UPUA 2CUNA 1TJ3A 4ZCTA 3O2NA 3UT0A 2VDJA 2YMLA 3QVXA 5K3OA 3R3JA 3F3YA 1VIAA 2ZJ6A 1MIOB 3NHKA 1VDZA 1V5GA 4MI6A 4IH1A 2NPOA 1DAFA 3NWJA 4K0KH 1E2FA 4Z4IA 3MR5A 1NQWA 1JZQA 1VJ1A 3GD7A 1S0MA 4JXZA 4GO1A 1KK0A 2QX6A 4ECZA 1GVHA 1T2FA 3K96A 2BR3A 3E27A 5BWCA 4UTXA 3E05A 5EHNA 1KK3A 4AZ3B 5KSOA 1NVTA 2PFSA 4IJ5A 5DHQA 3ZKAA 2VP9A 3GZTB 3AJDA 3BA1A 4CTMA 3MQ2A 1KEZA 4BXXG 1C30A 4LXYA 2R6ZA 5LKRA 4NFSA 4PZ7A 2Z30A 4RULA 2WU4A 3IDOA 2ZJ2A 3G2MA 4PHTA 1T1RA 2G9NA 5H81A 4LZJA 2GN6A 1TZ2A 4YCLA 2X5XA 5F64A 1JVSA 1VBNA 1V16B 2IYTA 2JAOA 2DC1A 4WNCA 1TF2A 1F2TA 4UM5A 1BXGB 2AOTA 2FQXA 4DYDA 2J5XA 4D56A 4IJUA 4D6YA 1YJCA 3T5MA 3IEVA 5LP6F 2ORED 2F3UA 5D5HA 3ML1A 4US1R 1MIOA 2PN1A 4YN3A 6PFKA 1D2EA 4W6ZA 4D26A 4I1UA 3I1IA 5KCMA 1L0BA 1KWGA 3P2YA 3VU9A 1L1RA 4XW2A 3TZBA 1KL7A 5DCUA 5CNMA 2WABA 2WV7A 3IAEA 1UQRA 1F1BA 4UBNA 2DEUA 2NSJA 1OREA 4G84A 4FGKA 3V6LA 4FLMA 3W2GA 5FUYA 3QTTA 4A0SA 3UAXA 2BP7A 4Z9FA 2CJWA 4EZBA 3LKVA 3QPDA 1GZUA 1H8EA 4EI7A 2O57A 3G1WA 1E60A 1V4BA 4EUKA 2WYVA 2OESA 3OG9A 3EDQA 4PWZA 1N92A 4KGXA 3FDXA 2XKKA 3ZPXA 3ADBA 1RPTA 2ROQA 3K3VA 4MWOA 2QZZA 2B4RO 4NE7A 5CXQA 4TLBA 3TBKA 6YASA 4NXNH 1FPQA 1F51E 4D45A 1F7VA 3KPVA 4FWIB 3FPKA 5F5NA 1NJ6A 3LQFA 5BR8H 1F8XA 2FHSA 1PZFA 1GILA 3O1IC 4MS4A 1EP3B 2PWPA 1PUJA 4BB9A 4KVZA 3BIWA 4YGYA 1NTRA 3RAQA 2C5BA 5IAOA 2IYQA 2A8YA 2AC2A 1G7RA 2ZJ5A 1GPH1 4L16A 5I7UA 2J9XB 4RU9A 1I6MA 2VLIA 5EVJA 4JS0A 4MW2A 1CJCA 2LR0A 5J43A 3PA8A 4M0PA 4IOJA 5JDIA 1EUYA 4ZXFA 1PV2A 4V1CA 5IBPA 1FVHA 2O0JA 3I28A 4DR7B 2WJZB 4CNQA 1OTYA 3C5HA 5EC8A 5FBHA 2YZLA 1IZZA 5HCIA 4MW5A 3JSNA 3SLRA 1Z9BA 2PH3A 3D6AA 1AKMA 2VK8A 3TLBA 5FUBA 1XCJA 2FQYA 3FC4A 3RTGA 3N2EA 2GZ3A 2Y9MB 5HBRB 3HSKA 1DKMA 2VJMB 3KQQA 1YE8A 1NX6A 4KE6A 2RI0A 4ZOEA 5HL7J 3C2EA 3R5FA 1TKCA 3M9MB 5K4HA 4PFQA 2WYIA 4DQVA 5JXGA 4U7CA 2OENG 4TVKA 4BFWA 2VJAA 3QH4A 4R40A 4MTCA 5IT4A 2WJ3A 3PUVA 3EIUA 1U3FA 2IXDA 3SKYA 2OAQ1 3FTDA 4DSNA 4AYBE 5G2OA 1KIFA 3H4VA 2HLNA 1O95A 4FW9A 2B7NA 4AMZA 2OECA 2IKSA 1OLXA 4IIJA 4CM9A 3P9PA 5KMGB 3O4IA 3VC7A 2H1SA 1W9HA 4Z3DA 2BT4A 4WLEA 1T9ZA 3AJEA 4O2AF 2AJBA 2RGUA 3B3GA 1JTVA 1Z88A 5KWEA 2O05A 3FR8A 4KFUA 5G0WA 3UGQA 4H3KB 1H0KA 1SBHA 1JILA 1GCAA 3VVCA 5E1OA 4JXXA 2G7MC 1ZUNA 1UM8A 4O4HF 3GFFA 3DOFA 5JAHA 3GG2A 1FVOA 2ZE7A 5B55A 1P5RA 4F93B 5EHGA 1ONPA 4TS3A 3G6XA 4FMCF 2W7TA 4FXPA 2GJAA 5K0FA 1I0ZA 2AQIA 1FOEB 1NE7A 1M3SA 2H00A 3RS4A 3AI7A 1Z62A 1OGJA 4LYEA 3IULA 2ZCUA 2YWJA 1REQB 5LXTA 3WGTA 5HG0A 4QQ8A 1N8NA 4EGSA 4U8HA 4DQDA 2ZIEA 2NQ2C 4X7MA 1EFAA 2QTWB 1KVSA 2GQ0A 3PQ3A 2V9PA 1XL1A 2RAFA 4KB5A 5HXAA 1NQXA 3S99A 4F86A 5BMOA 4U9HS 3DE6X 1UH5A 1VA4A 1NP6A 2QK4A 3QP9A 2Q3BA 3GTPA 3FLAA 4M60A 4DA4A 4ZARA 3NJ4A 3I0ZA 1O6GA 2EX0A 4DKJA 1ULBA 5I5YA 1Z2DA 1U7OA 1H9CA 1Y1RA 4WCFB 4JQOA 1EXVA 1VQNH 4PPQA 4BDSA 4HG2A 4INPA 2LXNA 5AD1A 1NW9B 3TQFA 4DL2A 1YRHA 4FW8A 3FYUA 1M1ZA 4RK1A 1Q21A 2QGNA 2DPHA 1A48A 221PA 1EZZA 4YALA 3C87A 1XQXA 5AHKA 4BTVA 5HUJA 3UJ8A 3YASA 3QBDA 1XKQA 3H2ZA 4CZ2A 2QIEA 3R2JA 4RK6A 4L3WA 3SQLA 3AESB 2QVLA 3CNHA 3PI7A 3C2VA 5CX1B 4PG6A 3HXTA 4EW2A 1HT2E 4FGZA 1OWOA 2PKQO 3KTAB 4BIMA 1TQ8A 3VMMA 3SKVA 2E85A 1ZMBA 4GDFA 1SB3A 1TUBA 4XQCA 3UMMA 2RDIA 4X5OA 1YR2A 4ISCA 3FDIA 2YIDA 3PDUA 1USGA 3P45A 3COVA 5DV9A 4GA4A 3A6DA 3M9OB 3TIXB 5KYKA 8ABPA 3U3RA 4FYWA 3UJAA 5A9TA 1N62B 5KNCH 1A97A 1DBRA 2UVUA 3MFYA 4NXMB 4ZJPA 4OFBA 3NALA 3K94A 5FXMA 1G59A 4Q48A 1FLAA 3CMMA 1IJBA 1Y3BE 1WZ2A 4XQ0A 1IRXA 1T3NA 5IVKA 1X0VA 1R0LA 1X19A 1Y14B 3RYCA 5BV1A 3S8MA 3MWEB 3K5WA 2EJ0A 1DINA 3NEPX 1M72A 4HNVA 5C4MA 3SJUA 4X64H 3WLTA 1FLVA 5IM4A 4ZGBA 2HX1A 2GERA 4RCYA 3OHPA 4G1MB 3CGWA 3MJSA 1A8QA 4MH0R 4H9GA 4P7BA 1POXA 1RMQA 4FN4A 2WAYA 3PB3A 1RK5A 4ZYUA 4HS9A 1ZVMA 3I2YX 1N0WA 1KRWA 1N2IA 4K46A 1DAHA 4FONA 4A0QA 1CXZA 4EUHA 1DQRA 1ZONA 4WXHA 4EWLA 1DMRA 2O2EA 1MRSA 2Y05A 5FD8A 3ZD6A 1K7CA 3NS7A 4MVWA 3ITEA 1CY7A 4K88A 1CLEA 3N7AA 2WIJA 3REGA 1M2NA 2V59A 5CD9A 1UBUS 5LYYA 3N42B 1Z8HA 1J25A 1KJYA 3ZH9B 4ETIA 3WKCA 4KWCA 2ZYHA 5AW6A 5TQ2B 3ZNOA 4U4AA 3KBBA 4UQPA 2PAAA 2P2DA 5FWYB 3B9JC 3UK1A 3JQAD 3PNSA 4WZBE 4AULA 1JR3D 2VF7A 4OFWA 4PRLA 5IDQA 3G9QA 3PGLA 3KAKA 5CTJA 2VC2B 2JIBA 1E4OA 3LQ4A 3NAZA 5COAA 2PBFA 4MYHA 2Z57A 3ORSA 1AMUA 5A4MS 3VJRA 1W4AA 3DVQX 1HO3A 5C8DA 3FNBA 1SGWA 3NUZA 2RGRA 3DMYA 2HO5A 4YJKA 4JASB 2C7VA 4Q47A 1O6CA 5AVUA 1MN6A 4ID9A 3TVTA 5ILQA 1SIBE 3EDRA 4Y9DA 4CKWB 1QP8A 4FJ0A 3F5FA 1R5OA 5K3CA 2RC6A 3KZNA 2I67A 3AKDA 1CUDA 2SKDA 1PJ2A 5JCOA 2E3JA 4CL3A 5A2QW 4KU4A 3BX1A 1P1IA 5IYCG 4Z7JA 1T9CA 5E2BA 4XFDA 5EHXA 4KLAA 2A5LA 1K5DA 3VR4D 4AUEA 1ZN7A 2YXPX 2ZRPA 5KNBH 2BFNA 2QQEA 1COWA 3QWIA 5JS7A 1E7SA 2NO4A 4TYQA 5C8YA 1XDWA 1YONA 3I61A 1KQ3A 1JDEA 4II3A 4FCWA 5C80A 3C98A 5HOQA 4ZQHA 4FS2A 1CRLA 4KQKA 3DAYA 4UBLA 4AMVA 1Z33A 2BKXA 3HADA 3EGDA 2AJTA 3DBRA 1SHLA 1J1ZA 3PVSA 4YCAA 4DLSA 4GX5A 4KIUA 1WY5A 4QQFA 4JN6B 4X1IB 3I3SR 2H4XA 3NVKI 1R4MA 4O3OA 3CZRA 1VP3A 4JNKA 3EPJA 2YBDA 1XKXA 3I01A 5GAHN 2R48A 3H9UA 2ACVA 4WECA 4EEZA 5IYZB 1HNNA 3SKXA 4UHCA 3KAJA 4FBLA 2QXUA 4L5IA 4TWRA 4DRYA 4PGHA 2R7LA 1V2GA 1R0XA 1BE0A 3G8BA 1R0YA 4R01A 1L5LA 4YVFA 4G81A 3B2QA 4CU2A 2M1XA 4UM8B 4K87A 4PCLA 1UBNA 2UUAB 3CGGA 2VHTA 2FDRA 5JSQA 1H0SA 3IMCA 3SZUA 3C8ZA 1WNFA 1JLLA 1CJVC 2WPDA 3SCZA 2CLKB 3ZE8A 4K2AA 1RWNA 2WU3A 1SPBS 2DKOA 3PKZA 3PC3A 1F2UB 1RYEA 2WSBA 2ZRFA 4QODA 2JAXA 1N2BA 2NZUG 4NBRA 5M2QA 4MB2A 4QRDA 1NHWA 4RXMA 3T5DA 4UJ5A 5FQNA 1CQJA 3TUJC 5C5DA 3BWCA 2JEFA 1I51A 2ZVQX 4KHPB 2PNJA 1U7DA 4B3RB 1KYQA 2X2EA 1VGVA 1KSJA 1N6PA 1TZMA 2YXBA 2VF8A 5CIYA 4S1VA 4WZAE 2XXAB 5LQRA 121PA 4LDQA 2HIGA 5EP3A 5EGNA 4MJ7A 4OHUA 5IYZA 4RNNA 3AG6A 1GDTA 4DCMA 1TJNA 2NUAB 4AY2A 3CBQA 1KY2A 1TIPA 2V9CA 4MA0A 4HDMB 2RKOA 4OB7A 2PX0A 2LKCA 3L7OA 1VKOA 2PUBA 5HZHA 2AEFA 4FT4A 3LBFA 3RSCA 2RBEA 1G291 5AVSA 4M0UA 1SB8A 3AEUA 2X23A 4ALIA 1T5DX 2HQSA 3RC3A 1VLJA 4J4BA 2L82A 3BA9A 3ZBUA 3SE0A 4RV4A 1GNRA 5DMXA 2Z3WA 4FB5A 3AEKB 2ZPAA 1IIBA 5FV4A 4MYCA 1E64A 3T1NA 2ALZA 3R9KA 1KTIA 3LCRA 3C6KA 4OQPA 2JA2A 1RE1A 4R69A 4BX0A 1DIBA 5TGTA 3G2JA 3ENWA 4TMZA 2E2HA 2ZS8A 1TQ4A 3H7AA 1YVDA 2XYPA 2YYSA 4IIJF 4BKOA 3NM6B 4Y1FA 3JD0A 5KJ6A 3OBBA 3NDJA 4DSAA 3D7NA 4YREA 1G6HA 1U3DA 2XXAA 4RYDA 1NN5A 4DUGD 1I5EA 2YCHA 4IJVA 4DKXA 1NUTA 3KTMA 4UM9B 2PRIA 4MVYA 4EW3A 4HYYA 3IB6A 2P9GA 1KPIA 4HDMA 1EFHA 3BRQA 5EE9A 4NOMA 5L9XA 2HCTA 1GN9A 3RRMA 1G5IA 3KYCB 2XT0A 2PUFA 4UNIA 3OJCA 1LW7A 1MU0A 4DA7A 4WERA 3HXQA 1RYNA 2R44A 3BJMA 3SJCA 3Q3VA 4ZOAA 4XE5A 1DL5A 3MG9A 3ZGYA 3FF1A 3L7BA 1L4UA 4CMEA 3AEKA 5LXTF 4OPMA 4ZI3A 1VPEA 2MU1A 3T4UA 2H06A 1M6YA 1OAKA 4RIIA 3O8QB 4YCBA 4DIDA 1K7XB 2ZR9A 3DOIA 3UXMA 4ZAZA 4IUYA 2ZUUA 4DDVA 1S6YA 4MR9A 1DXOA 1I1QB 4I50A 5ALSA 1VPWA 3I0NA 1Z4NA 3ZWVA 3BEOA 3N44B 2R4TA 3N1UA 4XX1A 4RM2A 1ZNQO 4O3SA 2JFGA 2XMCA 2IXFA 1NNUA 2Y2VA 4CKYA 5EY3A 4NYMQ 4UHBA 1ZHSA 4Q0MA 4EI9A 3QEKA 1YKFA 1ULTA 2XCSB 4UCUA 2BHNA 5L1JA 4K8OA 3NHLA 2BW0A 3R9XB 4E1BA 1M7BA 2EKBA 3NRCA 2JFBA 4ER7A 3L6BA 1USKA 2ST1A 1XTSA 2HHJA 5CB6A 4PICA 2QLTA 4GX2A 3HH8A 1DAMA 3HXKA 3FHOA 1UJ5A 3FWKA 1KS9A 3G5LA 2EF1A 1RAAA 5B6IA 4LCEA 3PF8A 1P0FA 4EBFA 1BVUA 4QREA 4E2ZA 3WRWA 3ESQA 3UT5B 3LS2A 3ETGA 4A0HA 4GD3Q 1KR2A 4J8PA 2V7UA 4YUYA 3KYDB 5DCWA 2NO1A 2Q5QA 4FDTA 1E5TA 1JQAA 2ZRKA 2HHLA 1M7GA 2OO3A 2XV1A 1TLTA 2Q0HA 5M3BA 2WU1A 4H4DA 1ZDMA 2QROA 4NBVA 1A9SA 4JJGA 4CEJA 1V8DA 3QEAZ 4DL9A 5GWXA 1QGUA 2PKYX 4RNOA 1XEFA 3ZY4A 2QE7D 4JLUA 1DRWA 1W6RA 4ZGWA 5ILGA 3PUYA 4WL0A 4YV1A 2IEIA 3PWTA 4B33A 3R9XA 4IJKA 3TB4A 1E96A 1ZOPA 5HQJA 1KJWA 2FTKE 1E3DA 2NTNA 4BWGA 4Q34A 4KLZA 1QQTA 4KUHA 1Z0KA 4YRGA 1XI2A 3CW9A 4D81A 3N2YA 4EHNA 1U9CA 4HGNA 2J67A 5EXEA 2QAJA 3O2SB 5IM4F 3N3AC 2YL2A 4LMYA 2WZDA 4R7TA 1ZH0A 2A7QA 4XVCA 1FRNA 2ZPUA 1O0BA 5AJWA 1MO5A 1U2QA 3F6BX 3JYNA 4AMYA 4WZAA 1LNQA 1PL7A 1VPLA 1YIDA 4WA8A 4YK7A 1RBMA 2BL4A 3ORHA 4ZI5A 1RRKA 1P4RA 1N0IA 2FWRA 5REQA 3CIFA 2I6GA 2I71A 1XN4A 4LHEA 2Y0SE 4DJJA 2BN4A 2XNSA 3KYDA 2XEDA 4ME6A 4NENA 1RPJA 4H59A 4CKXA 1JFRA 2HSGA 5AVKA 1QP7A 1U0LA 3BTVA 1NYRA 2PX2A 3K0CA 4LX8A 1JQJC 3L1VA 4BEVA 3CH6A 2NTVA 1YCDA 2VYVD 4HBZA 4A92A 1BKDR 3IBCA 4E13A 4NABA 3TLCA 5K3EA 3OQNA 1K86A 2QMQA 3H19A 2AOUA 3NANA 4PFKA 1ORTA 3TPFA 3JWIA 3FMVA 2CCJA 4A3DG 1PNVA 3IMFA 3LMKA 5LP6C 1M6WA 5F4BA 3QFHA 1AN9A 4LJ6A 3PI6A 5DX1A 3RCBA 2YC4C 2B1RA 4EHKA 3QZ8A 4CV2A 2XMBA 1I2MA 4BVFA 4DG8A 1K08A 5LMUB 2Q29A 2CLIB 1TA9A 3SF0A 4JJ4A 4OAPA 1O4WA 2UUCB 3A6FA 4D92A 2O8DA 2O9JA 4FCVA 2X0RA 2O03A 3DTTA 3O21A 5FOQA 2GVZC 3EVCA 4EELA 3HY4A 2AE2A 3GRZA 4ESVA 1QPBA 3ME5A 3BMQB 3AFMA 2Q5WE 4JJ7A 4D41A 4RHTA 1VLLA 1XF9A 4JLDA 1AT1A 1E9VA 3UWMA 4KYUA 4MS3B 3B3QA 1RXUA 2O8FB 1NP3A 1ODIA 1SXJD 5CT5A 3USCS 2UVDA 3G7UA 3JR3A 4LFAB 3VYUB 1Y1TA 1JIVA 2VPSA 1C9MA 1AKTA 2HA6A 2DHCA 5BXYA 1R8YA 5C8YF 4AJPA 1YB5A 1ECCA 5DJ5A 2PUAA 3NBUA 3KQPA 3UAGA 3TRHA 1OAOC 2FPGA 3FX2A 1AOXA 3NKVA 1GRNA 5BWTA 3B8HA 1QPOA 3E2PA 3KD2A 4YRSA 4TYWA 2YHUA 2CW8A 2ZTSA 4O7TA 5CPFA 4A6EA 3T5TA 2CBZA 4UZFA 4OY3A 5U1PA 2YNMC 4B5KA 3SYMA 2N1MA 1ECJA 1N2JA 1PE0A 4B6FA 4I9HA 1IOLA 1Z3IX 1W5TA 2ZANA 4DV2B 1VHLA 2JF0A 4H6XA 4LF8H 2ZS7A 1HQCA 4XDHA 5SZHB 1I13A 3NO4A 4ARAA 1CFZA 1BYUA 3F98A 1Y5MA 5DNEA 1Q91A 2ZJ7A 2HPZA 1D3AA 2H51A 4C22A 1P61B 3ADOA 3GVPA 5L9AA 2B1JA 5ADHA 4AJEA 1M74A 4TLCA 2JBAB 4JJZA 2JA6G 4LQCA 4LZWA 3CF4G 3EYWA 4X7BA 3H0KA 4BAZA 4MWTA 2OG1A 3WKAA 3K53A 3V8PA 3W4JA 1KZ6A 2H29A 2NVUB 4G0VA 5FDFA 4ECVA 4HH4A 2P9BA 3W1WA 4WDRA 4ZJUA 1A9XB 3N74A 4JR2A 4ZZ3A 3N76A 3BDAA 2FPSA 1FQWA 3E18A 4LHWA 5LZ4A 2NUBA 3BIIE 1HG0A 4EW6A 3RYFA 3B1VA 3QVVA 3ZVLA 4NFHA 1VCNA 4C3ZA 4V3CA 1Q3KA 3VO1A 1BX3A 1QZTA 1UC9A 4ZVOA 1DQPA 2Q2OA 3V6JA 4YT4A 2I7VA 1ISIA 1C1DA 3GRVA 1OXMA 3F67A 4R2WA 3KT3A 3ASYA 3LW8A 4WFNJ 3M3PA 3HKEA 2BR0A 2O3JA 1GVNB 3LZDA 3DONA 4FX5A 1BMTA 4CWAA 3MCZA 3EGEA 4YTEA 2WHPA 3IR7A 3F6CA 1SRRA 1EUZA 5EWGA 5IYZF 1MO3A 4AU1A 4EMSA 3JQAA 3P9NA 1JR3A 4EA6A 3UK0A 5I7WA 1K8QA 2CCKA 4QQRA 5JSFA 2FK1A 2BDUA 4IY1A 3RYTC 4YIHA 1DIKA 2VWGA 4ZPXA 4D4HA 4IVPA 2HDHA 2FLLA 2NVUA 1WL8A 2YICA 1SOAA 1UAAA 1M75A 4CHIA 3UATA 2RGNC 2B25A 2QDXA 1U8YA 1EXWA 2O48X 4TTVA 2CVPA 3CY6A 2BGKA 1DWOA 1VG9B 3L2PA 1H2FA 3M6MD 4TKZA 4PLTA 2GBCA 5DP2A 1Z73A 3PGVA 4TM7A 4O4JA 1WWKA 3QEMB 5A4IS 2K4MA 5KFEA 1DBQA 4GF5A 4YJHB 2GS9A 3I23A 3HKBA 2Y0SA 2DR0A 3VR4A 2LCFA 2W98A 4QDKA 4EYKA 5KSPA 2AOVA 1CTQA 2Z2JA 4QBIA 2CKDA 4U7JA 3D31A 4YQEA 3SWWA 3BICA 5C34B 1TECE 2IS2A 3G2OA 2PJRA 3EXFB 4FM9A 3LI2A 4JVOA 3ICOA 3DMDA 2RJ3A 5JC8A 4N6NA 4GZ6A 5CLIA 1M1KJ 4FQ7A 4B1FA 5DG9A 3SX4A 1QC5B 4BEJA 2EV9A 5L53A 3FNEA 2ZJ8A 2FMFA 3KFLA 4FVTA 2YV4A 3PNPA 5C1IA 4XKJA 3A3KA 4H3VA 1VYHA 4RW0A 5CDFE 3IP8A 5F9HA 2FAXA 1J20A 2E89A 2IW3A 3T52A 4O2AB 1P9NA 1UDXA 4RK7A 2QUKA 1MTOA 5C5JA 4DUYB 4HDCA 5GV8A 3RVRA 3LPDA 4O4HB 4FUQA 4J07A 1KU6A 1MCZA 4XOUA 2OK8A 4OXRA 2BFPA 2BJWA 1IM8A 4FMCB 3PEFA 4FHFA 1WRVA 4EKNB 4I50F 3GFVA 2GXUA 4JLMA 3DPUA 1EHYA 3RWOA 3ADKA 2H9IA 2ID4A 1K1QA 2HSWA 5TJ9A 2BFCB 2IOFK 3N2GB 1O7JA 2VNJA 1EGMB 2HA4A 4R8KA 2C4KA 2A1UB 2CDCA 2CDBA 1SRQA 5KCZA 3UV7A 1BEEA 4HPWA 2J07A 3MELA 2PZBA 3MINB 4LTMA 3KB2A 3P2OA 3W5VA 1D7OA 1K4KA 1ZM9A 2CMFA 4G8DA 4W1RA 3DMGA 4DR6H 2Y67A 5LZ7A 3RU2A 4FZ3A 1S2MA 2PQ6A 3ZGXA 1UWKA 3ILHA 5JOQA 2Y1KA 2UU9H 2IPLA 5ALWA 5AM3A 4DVJA 2VDNB 3QVGB 3FIJA 1FE8A 4GS5A 2ERXA 5DN9A 4IR7A 1RHKA 4J0JA 3GV0A 1E6MA 3I05A 4XQ9A 4AJNA 1GKUB 4BN0A 3KUDA 3C7DB 2Z1MA 1A5BB 1QAMA 1ODTC 4OK3A 1QH0A 5ED4A 2VVTA 1A69A 2FMHA 3H1BA 1R6XA 4R7RA 3NVVC 3WISA 1WCXA 3R6DA 4DBVO 5EMJA 4YP7A 4ED8A 4JJ6A 5KB3A 3S1AB 2H54A 2XQIA 2R7ZA 3PX7A 2GZMA 2MHCA 3GAZA 4KLNA 1ND6A 1UL1X 4I4IA 2VTBA 3E0XA 2TPTA 4V3BA 1J06A 2C28A 4JDPA 4OQYA 2OCAA 3GB8B 4I08A 3MINA 3ZHTA 3EAFA 2PXAA 1WU7A 4LSXA 4CMDA 3FROA 5F12A 1Q20A 4J3JA 4RDCA 2EZ8A 1IQPA 2CXQA 5JATA 1C9EA 1Q5PA 4YQWA 2DPGA 2ZRJA 3ZR4B 3AN1A 3IHLA 4QDTA 5CA0B 4Y6GB 4EBEA 1OWTA 3G6VA 1VQKH 4AKSA 1NV8A 4JLBA 4QTTB 1SCAA 2JAHA 4L2IB 3ETNA 1KDTA 1CJSA 3Q1KA 1KMHB 4DUGA 4RX1A 4E6PA 1M1UA 5HX7A 3QPCA 4ENVA 1K97A 2HXSA 1UWVA 3IERA 4IS3A 4X8MA 3LF2A 1SXJE 4GP7A 5BN3B 5JCJD 2CB0A 3M4JA 2AOWA 2NTYC 4CC5A 4GHWA 3G23A 2UXDH 2Q9BA 4KCGA 4IHJA 3FA2A 2QP4A 4KR0A 2G28A 1U9IA 4GVXA 2Q4TA 1SVUA 2KW5A 1ACLA 3ZQUA 1Q3TA 4P22A 4UFOA 1DRKA 4HADA 1XTIA 1MORA 1BQEA 3ZQ6A 2BRUA 3BH0A 3NWPA 3C16C 2WK5A 1EVKA 1GQFA 2WG2A 4TTSA 1QAPA 4QU9A 1NJFA 2PGDA 3DB1A 3D43A 2WM2A 3RK1A 2IHZA 4UPEA 3T5BA 3GLHE 4BBJA 2VRNA 4OQNA 4FYVA 4NBNA 5IFLA 3T5LA 5F9MA 3EJWA 4TYMA 3IQWA 4ESOA 3WGLA 2C88A 1SU7A 1MB0A 1L4EA 1V3VA 2ZP1A 3P19A 1XAIA 4G65A 2VZ8A 3ROPA 3GT3A 3PNKA 4R9RA 4RB2C 1CY8A 4F8JA 3F5QA 2OILA 3IUPA 4LECA 3QHQA 5CVCA 4MDFA 3CSWA 5L1KA 4TTTS 2OZLA 2BQRA 1ADBA 1KFEB 2WG0A 4MINA 2XIGA 3FPAA 3C4VA 1UBOS 1C30B 5B57C 4FDUA 5T5QA 2XBMA 1EQ2A 621PA 1VTKA 3I9FA 4HYEA 2P5SA 1AN0A 3U9LA 2BFAA 1O9GA 3ZCXA 4RKFA 3GJTA 1T8SA 3Q9LA 1AKQA 1SCDA 4EHAA 3B78A 2JKVA 2DHQA 2D3TA 5THKA 3MJCA 2IC5A 3I6BA 4ARUA 3G0IA 1F2TB 4RTMA 3RSHA 2AOTB 1RM6A 1XMIA 4KSYA 2Q1SA 8ATCA 2CY0A 3A9VA 5IX8A 2X1MA 3V7WA 3KOMA 3RG8A 1W5BA 1NDHA 4DEYA 3Q87B 4YAOA 1VGQA 3B8EA 3K4QA 4WK6A 1AHIA 2RARA 4DA8A 2FMXA 3VU9B 4X00A 4JH0A 3N0VA 2QE7A 3CX4A 3L4BA 4BLWA 3PT5A 3ZCRA 5DNCA 3LWBA 2VO1A 1YJ8A 3M6LA 2FOIA 4C7XA 1K3TA 4PZEA 3AKCA 1UC8A 4U2DA 5JDIC 2Y27A 3ESAA 3HI4A 4MRPA 3TFOA 2J0UA 2CLMB 3I9NA 5G02A 1BDJA 2BP7B 3B53X 8ADHA 2CJWB 1CR6A 1VG8A 1PEKE 2XJ4A 1VQ7H 2TYSB 1ZIXA 2ZRHA 4NMWA 2V4ZA 5FULA 2IS6A 5K8IA 4K9NA 4BV8A 3RHZA 1GPNA 3PIIA 1RBZA 1RIFA 2R1VA 1LWNA 4ED3A 3PW4A 3KALA 5K6AC 3LLVA 2C82A 4IWXA 2NADA 2OEPA 2WC1A 2FFHA 4E5NA 4TMFA 4J9UE 4Y9UA 4MVXA 1P7WA 4J75A 5KKNB 4CQNA 3T9CA 3CLVA 4GPBA 2G25A 3G9UA 5IAAA 3RJMA 1EK0A 1R6AA 3ZW7A 4MLCA 2WNSA 3GT0A 4AY4A 5CDTA 1P2FA 3PXXA 5GJBA 4MS4B 1R9JA 4L8FA 6ABPA 1OW3B 4AYXA 1ZYUA 4DXAA 2DRIA 5EXSA 3DUFB 1JH9A 1C29B 2BEVA 5CDUA 4DJDC 2RFLA 2I2XB 4MV5A 1UQTA 3OTIA 5A4KA 4GM4A 4BMSA 4A2AA 1ZZEA 3S6JA 3GRKA 1ND5A 1U80A 3AXSA 4B3IA 1G4HA 3RVMA 4EEKA 1G21E 1ZD9A 1O95C 4HB3A 4V1CB 2X41A 4DE5A 3GUHA 4V1CI 3EEYA 1E9DA 1ODJA 2FR8A 1X86B 4G0XA 2X3YA 2G5PA 5FO0A 3UG6A 2QUZA 1Q0QA 1X80B 4RVCA 3UGKA 3BIFA 4QUDA 1XZIA 4RH3A 5KS2A 3DLTA 4LI3X 3TRFA 2X0NA 1E5VA 3OUUA 2NXCA 4ZVUA 1L5SA 2H5LA 2O6HA 4XEHA 2RHJA 4XM2A 3ZE9A 1ZIDA 2BDTA 2ESRA 2MSNA 3WRXA 3LCMA 4O4JF 1SXJA 2IEGA 4TX1A 1YZGA 3OE5A 4PANA 3F71A 1JDBC 4XX0A 2XDWA 1WDLA 3OD1A 4EPTA 1CUJA 5MGNA 5ALHA 3N8GA 3DUFA 1KAHA 1W36B 2RB4A 4QOIA 4YACA 2PUEA 2XADA 3ZEAA 4NZ9A 2W37A 2GYWA 4CMJA 1ICIA 3AB8A 1L7DA 4AJIA 3RANA 4A2QA 4AZTA 2BAGA 4IF4A 3ODGA 3F7NA 4O33A 1NXXA 4OX9B 2XD9A 1M83A 3PC4A 3QVJA 2P9CA 3ZHVA 5EE1A 4HL6A 4E4TA 1KRHA 5LR6A 1E61A 1OLXB 3LL4A 4IIJB 1KR5A 3P0EA 1TAEA 4GPTA 1WMEA 3L6UA 4FFRA 1X80A 3SSAA 1D4AA 3DHWC 1BROA 1NUHA 5EWJA 3ZG6A 5CA1A 5FORA 3U44A 1RQPA 4BTEA 2HDKA 4QUIA 2XMPA 2BGUA 1TKAA 3FYUC 3EFOA 4BNTA 2YWVA 2I4TA 4H1VA 1XDGA 1ZUNB 2XNCA 1FJGH 2GWHA 2C7GA 3GN1A 4DLUA 5DI9A 2RHRA 3ENKA 2BJVA 1ZVKA 3SN6A 3D5TA 3MRVA 4R9VA 2FSHA 4G5YA 2QZSA 1A8HA 1R4ZA 4JZKA 2JARA 1FK8A 3HN7A 1JDBB 3AHEA 1NE2A 1T36A 1X1QA 2B99A 4HP8A 3WK7A 2FMIA 4DC1A 1KD1J 4M7OA 3L6CA 1PYDA 1R74A 1UMDA 4IRKA 3GV7B 5AOCA 1TQHA 1PZNA 3AM4A 2MTBA 1SBIA 2VDMB 1HZJA 2BDEA 2ZE5A 3U9SA 5LXTB 1RWQA 1E6CA 1C8VB 1WO8A 1JLMA 1UT8A 5F98A 3DVRX 3BK1A 1L7EA 2H5IA 2OCIA 5JSHA 5BNWA 4ZKDA 3BAZA 3OUTA 3RFUA 1AK9A 4RMJA 1VFNA 4MV7A 5HKKD 4AN4A 4UQOA 2HDWA 3NJ8A 3JPYA 4MWZA 1JYSA 4GG1A 3PHHA 1KFKB 1X9IA 2O8BA 3R9WA 1IVYA 2ZSIA 3WWCA 3KEFA 3V4LA 4LHXA 5DWVA 3X0DA 1ISMA 4HWGA 4TL6A 3L9WA 4WCFC 1RJWA 2IHKA 2GJ4A 1LW6E 3LA8A 1FYXA 2OV8A 3KR2A 5C4XG 1NXWA 1KDYA 1ONSA 3FYUB 3BWXA 3RVKA 2FPWA 4LZZA 3OZVA 3R0VA 5E3HA 3EYYA 5KNLA 1CPYA 4HMOA 2VXBA 3I1YA 5FBWB 4B17A 2FVXA 5JFGA 5EMMA 5LLTA 2QF7A 1GFWA 1XGKA 2XYRA 3B38A 3EMVA 2O23A 2OLJA 5JD5A 3D3QA 3N5CA 5ITVA 4KUGA 1T24A 4G2TA 3OQBA 4X62H 2QGZA 2G7ZA 2W6PA 1F38A 3BZWA 2GBGA 3FNGA 5I7RA 4J4HA 1ISSA 1QTQA 1P7VA 2HPAA 2RH8A 4HN9A 4EA8A 5K0JA 4CLEA 3HCFA 4XB2A 5LDGA 1ITZA 3UFXB 4UQLA 1ZK3A 1KZ4A 3WGKA 4M38A 3ZLUA 4ZGGA 2J3HA 4ZK2A 2X42A 1TUBB 3ANSA 4R6XA 1ZCAA 4EYEA 2H5JA 3QSGA 1DC6A 3PX2A 4YBRA 3DCYA 1XTJA 5BSTA 1RI2A 4KWWA 4F0JA 4MUIA 3S2FA 1PUXA 2NTEA 3CX7A 5CT9A 3UW3A 4RQAA 2AR7A 5IT5A 2ISQA 1XA3A 4Z54A 1WU8A 4IAJA 5T4BA 4BY1G 4EG1A 1LKZA 2CZGA 2A5DA 3N8IA 4P3NA 2H1OA 4RTNA 1O5IA 1EPUA 2POCA 2FEPA 4G0QA 3KHTA 1N5OX 4LOAA 3RYCB 3DAFA 3LHFA 1K8ZB 1T9DA 1ZI9A 3QKUA 3ID6C 4MEAA 1GUZA 3C6XA 5H1YA 1ZRMA 1G21A 4S1TA 1YL7A 2X2PA 2FX5A 4IHJF 3ICVA 1MFZA 1RM0A 2F3SA 4TRNA 1GAXA 4A4DA 4ARCA 3FZQA 4KQEA 1PJZA 2PUDA 1A8SA 1E66A 5A4JA 2N47A 1PRYA 3AT1A 3IP6A 4M0CA 5GINE 2A4MA 3EASA 2VXYA 3MPOA 2Q1UA 3UFXA 4IDNA 2RKWA 4JOSA 1EINA 1UPXA 4UOZA 4DDWA 5JCOC 2H16A 1IM2A 3E3LA 1P74A 1XJCA 5JNTA 2GT1A 5KFNA 1HLPA 3FB1A 3ILSA 5JNUA 4RVNA 2YW2A 3TUIC 5G4LA 5D87A 3N8KA 1JDZA 4TRRA 2VNKA 1G3RA 1DIHA 3KHSA 2DH6A 3PE3A 5CA0F 1CIVA 1QZXA 1Z0SA 1E3TA 5ISMA 2XWBF 1PL8A 4BKQA 2P2CA 4E4RA 4L02A 3ZCTA 4UVDA 2MWMA 4DRZA 1Z29A 2W2TA 1VECA 2QNIA 2BR5A 4Q4CA 4RK0A 1ZNZA 5H1SO 2QN3A 1MEJA 3TAUA 3TTTA 5EZSA 3B70A 5KREA 3U4QA 4Q12A 4OJMX 5BNZA 3GEIA 4PGAA 3DE7X 5FBLB 2VCEA 1XEAA 3GZJA 5HR5A 1VKNA 5CT8A 3NONA 4EG5A 3BKWA 2XMRA 1WHSA 1ZD1A 1RWKA 3CQ9A 4UKDA 3WP1B 4C7ZA 3TIGA 2H8KA 3C3CA 2VUMG 4D46A 2BM9A 4RGBA 2UDPA 1FFCA 4FKMA 3BMOB 5DGTA 2JFOA 1V4NA 4RZRA 5ADWA 5FPRA 4KP7A 4F60A 2Q5HA 4G37A 1RADA 2PL5A 4G63A 2YYAA 3U3KA 4OKNA 3PR2B 4WZ6A 5H7XA 1DAKA 1RP1A 4CCAA 1U04A 3IALA 5JG7A 1MJGA 1CU1A 2UYOA 2ZT6A 4J2HA 4BMNA 5C8YB 4XDGA 1TMKA 2PRJA 4E31A 5CNJA 2ZRGA 1PDOA 2FN9A 5JZOA 4JOBA 5IN4A 2BFBA 4RACA 5K03A 4B44A 1OFUA 3H9BA 2CFRA 4LHMA 5T14A 2A1HA 3AL2A 1JEDA 3GDHA 3HDGA 3OEYA 3ZXUB 4KE9A 4MTEA 4D6PA 5EMKA 5CYGA 3OCCA 3QG5A 3UMJA 1JFTA 2ZJPJ 3EGDB 2V98A 4C07A 3DBRB 4GXNA 5F7JA 3BIXA 4HFNA 4BFTA 3KETA 4UVIA 4XYGA 3W6PA 521PA 2JI9A 5FLMG 1HLGA 1R4MB 5DP1A 4AYBA 1OBDA 7GPBA 4ZCSA 2YHSA 1ZITA 2O3QA 5C5CA 5LB4A 4BASA 2FPLA 3IDZA 4DCSA 2A3NA 3BMOA 3N7TA 4KRGA 3GWGA 3HFSA 4QTZA 1K9SA 4A6DA 3HB5X 3THOA 4F2GA 5JCJA 4DJEC 1JJVA 3UCXA 3ABQB 2NVOA 4NSNA 1B1CA 4KIGA 5JD6A 1SU6A 5CYOA 2WHQA 1BNCA 3OZAA 2WIAA 4OJYA 4ZT3A 2VH1A 3LIIA 2OD2A 3WB0A 4B9AA 1G55A 2K7ZA 3O4VA 2WMOB 4KN6A 3THSA 3Q7PA 4MITA 1BHO1 2WI8A 4AP8A 3ORYA 1VXOA 1JLLB 2GK3A 3P9RA 2R5NA 2FK7A 4EMTA 3FNHA 3H1GA 1EGHA 2A9KA 3E5RA 4KO2S 2YZGA 1C0KA 3E9DA 2FF7A 2YINC 1XRJA 3FR7A 2J32A 2WKPA 4LVOA 4ZYXA 1FNBA 2PZKA 3NKLA 1GL9B 5IC5A 5B37A 3CWZA 1CQJB 3K0AA 3LVQE 2G9VA 2B8JA 1E18A 1RE0A 2G0NA 3ABIA 4MV0A 4PSCA 3KC2A 3VOSA 4AY3A 3OX3A 3G5AA 4QDXA 4F91B 1QFXA 3DEIA 2BKLA 1IDN1 2DU8A 3NOXA 5K8UA 2Y0EA 3NBFA 3OQPA 3DZKA 1FMTA 3PKIA 4UCSA 4OHBA 1JU4A 4X65B 3T7RA 2Z9DA 1T9GR 1O5TA 4L0QA 3PWZA 4JJEA 1HZZC 1CLUA 4G1CA 5FBKA 2L19A 2IHNA 1I2KA 3IG0A 1P3Y1 1YVRA 3PWSA 1CUZA 1N5DA 4UHHA 1AO0A 3ZIDA 2IGTA 1U8XX 3ILYA 4PZAA 4C06A 2VATA 4J0MA 1BMDA 1XZHA 3B2NA 3KJHA 1JDUA 2YX1A 1CR0A 1LNZA 1FSGA 1QWSA 5BYAA 3AEUB 4HAOA 4GGOA 2XITA 2OWOA 1MAWA 5BW8A 1TK3A 4JROA 4P0QB 1Y7IA 4EF6A 4O7NA 1Q0SA 2AFVA 3ZIUA 5GM1A 3BREA 5ALJA 1L5YA 1WBBA 4CMEC 4JL8A 4R71A 4JJ8A 4QUJA 4YR0A 2JGMA 3BGIA 2AK2A 4QRHA 3D7LA 2IYVA 1PR5A 3D1VA 3FUXA 2Q6LA 3AVTA 3CUWA 2BELA 4Q7JB 2PMCA 4OLHA 2ZM6H 4PRYA 1RRVA 3OIDA 4PHHA 1PT6A 3IC5A 3VR6H 4DCNA 4P08A 2XCIA 1QVFH 3GUUA 1B74A 3IAHA 3DD1A 5KJFA 2X14A 5CA1F 1U8EA 2H0RA 2YRXA 3C97A 4B71A 3SNOA 1NNSA 1HM5A 1JG4A 2VHQA 5FPHA 1TZBA 3GR6A 3L8HA 3CJQA 3RJ5A 1D5WA 3EIQA 3QBVA 2HU5A 1ZAYA 3VNSA 5EA2A 4ER5A 2QPTA 2D1FA 2Q0XA 1PSDA 2CMHA 2IU0A 1SCQA 4E51A 4B3MB 3LMLA 4EKEA 3E9ZA 3FOZA 1R4NA 3IQDB 4P35A 4L6IA 3IV6A 4BBSG 4F6RA 4N03A 3B9QA 1KKMA 1YO6A 3G82C 1X7GA 2Y1WA 4LSAA 2WT4A 2B0JA 4J2OA 1ZHFA 3KSZO 4BC0A 5LM3A 4XQEA 4R1SA 1KI4A 8LDHA 3OFJA 2FP4A 2VH2A 1K68A 4KPGA 3TQVA 3DEYX 3EMKA 3KPUA 3ZJ5A 4PNEA 3H9QA 3ZY3A 4YUWA 5FI0B 1EIWA 3EQ8A 3OICA 3V8NA 2ETXA 3GK3A 4AWXA 4D3SA 4CBVA 2HI0A 4Z3KA 3BQ0A 3FLEA 4JVMA 2JEJA 4MR9B 2H1RA 2XQGA 1YXMA 4JLNA 4I50B 3MJFA 4P86A 4MWGA 3H2IA 3BJEA 4OSPA 5BMVA 4CMIA 5FLXW 3H5LA 1X1AA 4UUGA 3FUCA 3K0SA 3WXMA 1RK6A 5CH8A 5AHRA 1GPUA 1P5FA 2H85A 4UEWA 3HXOA 4IR1A 4HAYA 2AYYA 4GZ5A 4NMLA 4BNXA 5GAJA 3DWIA 1XYVA 3I6QA 2F8TA 2Z8YA 2HXGA 1U8ZA 4P0PB 1V1RA 3OQMA 4MIOA 2I6TA 4BRZA 4WZBA 1SUIA 4BVLA 3MTIA 5TX7A 1TWHA 3FSRA 2D8AA 4AS3A 3O8RA 3MWGA 1UPTA 4PS1A 2PSDA 3DM5A 4PYIA 5AW3A 2R3SA 2QM0A 3LC7O 1PW7A 2FZGA 2GM5A 2OPHA 3ZQ4A 2JC3A 3OSNA 5J2TA 2WKQA 5GAGN 3DL7A 2X1VA 2DFDA 5IDWA 3TPCA 2IPMA 1A2BA 1ZU5A 3A28A 1USUA 3EEOA 2VHCA 3GY0A 4CMBA 2B82A 3JQFA 4CI9A 2AW3A 1SG6A 2C7PA 4BVAA 1XDNA 2O1WA 3BWMA 4FYMA 1YR1A 3M5PA 2C1XA 3NFRA 3O47A 3DLPX 3ICPA 1E32A 1XTPA 1U6KA 3K0CC 1HT0A 1D1SA 1K9VF 5DN6D 4K9SA 3NGXA 1NN0A 4CEJB 1TUIA 1QGUB 2CC2A 1YMVA 4ZOQI 2FSVA 4YT8A 1FDSA 1AQUA 4NU0A 2VP3A 4AX8A 5GPBA 1UZAA 1SHZA 1SFRA 1H8HD 3N40P 4BMCA 1NNI1 2BY4A 1GJRA 1NJ2A 1HUQA 2VOBA 2C9ZA 5FI5A 4PLHA 3JQ6A 1C7EA 4P84A 5BSUA 4HRYA 4KQIA 1F4PA 4PRKA 3EIHA 5DT9A 2G5TA 4A0GA 3WIVA 3K8ZA 4X6UA 3SFVA 2QW0X 3CZPA 2VOJA 4Q1EA 3LDGA 4GR9A 4YT5A 1UFRA 4PV7A 3T1OA 3E8SA 3FWYA 4NOJA 2JAUA 1C9NA 4RTPA 4MS1A 4WW0A 2X19A 4WZAB 2FDCA 3W3AH 3ZU4A 1YR8A 5REQB 1SIWA 3C6MA 2G0AA 1WULS 4X1OA 1SKUA 2GPYA 3KQHA 3HWSA 5LQSA 4KIWA 4NKRA 2GNPA 3OZ7A 5E9JA 1NFFA 2A5YB 2I34A 4NENB 1U2RA 5KG4A 1VJTA 4M6WA 5AHWA 2JHFA 3WFJA 3LQSA 4KEAA 2QYSA 3FD8A 4DIKA 5DLPA 4MUFA 1HEIA 3QJYA 2SECE 4IXDA 2WLSA 4EY3A 4JOQA 1XYYA 2B9VA 1VYVA 3E0QA 4UNRA 2JLXA 5DCLA 4B09A 2AOUB 2VJNA 1N32B 1QF9A 1D9XA 2EBFX 2BCEA 2I4MA 3K9QO 3BXHA 4P92A 2YJTD 1V4YA 4TYYA 2OD9A 1GYFA 3NFYA 1O9HA 1Z6AA 3WS7A 3GTKA 2VNHA 4EHHA 2E4WA 2AEEA 3DF7A 2AMVA 3KQOA 4MCIA 4XGQA 5HKKA 3E9EA 2RHTA 2GXAA 3QENA 4F97A 1KXJA 5HIIA 3GDFA 3DKVA 5JVHJ 1HF3A 5K8LA 1E5XA 4TXNA 4TM5A 3EIWA 1CZHA 2O8DB 4EO4A 4CIYA 5KOYA 4EFKA 5LU9A 2MSKA 2B36A 4BFSA 5L4LA 3F6EX 3H8SA 3HRHA 3OPNA 4KBYA 2GKGA 5GV7A 3UMRA 4RJLA 1URPA 2ODPA 1ZESA 3KZKA 2J6CA 2B1IA 4GP6A 2FQWA 3B2EA 1I2ZA 2HV8A 4CCSA 1WZIA 2AUMA 4NH0A 2JEGA 3K1JA 2XVZA 3GGJA 4G9BA 1FNMA 3CPJB 3A7EA 2AHRA 3R7LA 2B98A 4RCNA 4R8VA 3DEHA