3WO1A

Crystal structure of trp332ala mutant ywfe, an l-amino acid ligase, with bound adp-mg-ala
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
466
structure length
466
Chain Sequence
SKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGANMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine-anticapsin ligase BacD
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 134
structure length 466
sequence length 466
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wo1A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wo1A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wo1A01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wo1A04
4ME6A 2DIKA 5LXTF 4EABA 1PX2A 2R7MA 2W70A 4IIJF 1EZ1A 2R87A 5KX5F 2CZGA 5C1PA 5K2MA 2R7KA 2V58A 3U55A 3JRWA 4O7LA 1AUXA 3Q2OA 4IWXA 2R7NA 5EZYF 5CA0F 2YYAA 1GSAA 3RFCA 1UC9A 2GQRA 3ETJA 4O82A 1DIKA 4DLKA 4HNVA 4YAJB 3U9SA 2CNQA 1GSOA 4DIMA 3WNZA 3E5NA 1JLLB 4EA9A 1SCUB 4TV9F 3V4SA 1OBGA 4FGRA 1A9XA 4HR7A 4MV9A 2NU8B 3TINA 1GLVA 4MV3A 2CQYA 4ZHQF 2W6OA 4XZ3B 3BG5A 4HQ6A 4YB8B 2W6PA 2R6FA 3HB9A 2W6NA 3K3PA 4FE2A 1W93A 5I47A 1EUDB 1WR2A 4MV4A 4O83A 1W96A 2YZNA 3R5HA 1KC7A 5J2TF 1VBHA 3RV4A 2SCUB 1GGOA 3TIGA 2ZDGA 5JVLA 1GSHA 2DWCA 3AX6A 5CAEB 3ORRA 4HNUA 3VPDA 2FPIB 2FPGB 4XX0B 3TW6A 3UFXB 2GPSA 4IHJF 1KUTA 1EHIA 4ZI7F 2W71A 3G8DA 2HGSA 2FB9A 4EGJA 3GIDA 2Z04A 3JZFA 2YZLA 4O7WA 5HV6A 2NU9B 2XCLA 5HBRB 2R84A 4YAKB 2NU6B 4MV8A 2PN1A 2GLTA 2PBZA 5LP6F 3R5FA 2R86A 3OUUA 4O2AF 4YJ3F 1E4EA 4EAAA 1B6RA 4TV8F 1KJ8A 5GONF 4MV7A 1KBLA 3KAKA 2FP4B 4M99A 2Z02A 3HO8A 4EA7A 4J6EA 2X0SA 5JVDF 4NYEA 2XD4A 1Z2PX 1M6VA 3R23A 1AUVA 4TUYF 3AW8A 1A48A 4O86A 4FFNA 3K5HA 1I7NA 3SE7A 4O7TA 3VPBA 4GGMX 3VMMA 2HJWA 3VPCA 1Z2OX 4C5AA 3BSSA 2P0AA 2J9GA 4O4HF 4EGQA 4M9UA 5C8YF 4YJ2F 2I80A 4ZOLF 1OBDA 3WO1A 3N6RA 1KJJA 2NUAB 3ORQA 4Y8VB 2OLSA 2CNVA 3KALA 4HNTA 4RZQA 3I12A 2VHEA 4MV6A 2NU7B 2V5AA 1DV1A 2IP4A 3Q1KA 2V59A 2QK4A 5KKNB 4I4TF 5IYZF 1PK8A 4FU0A 3TQTA 1CQJB 5JQGF 2W6ZA 3MWEA 1T36A 3QFFA 1Z2NX 5JQWA 2YW2A 1E4EB 2I87A 5H80A 1ULZA 3R5XA 4FFOA 1DV2A 4QSHA 4E4TA 1EUCB 1JKJB 5LA6F 5LYJF 4I50F 2FPPB 3JZIA 2VPQA 5BPFA 4XYLB 2YS7A 1IOVA 4MAMA 2C00A 4FFLA 2CNUA 3BSYA 4MV1A 3U54A 4O7RA 2ZDHA 2YWVA 4O4LF 4C5CA 4O7SA 1JDEA 2VQDA 3VA7A 1JDBB 4M98A 2QF7A 1M0TA 5BPHA 5CB4F 2R7LA 3JRXA 3WO0A 4XYMB 3R9RA 1KEEA 3ETHA 2R85A 3RUPA 4O7VA 1CE8A 3LWBA 5BMVF 5J2UF 2W6QA 4FFRA 2DZDA 3V4ZA 4I55F 1IOWA 3U9TA 2YL2A 4O2BF 1CQIB 1UC8A 4IZOA 2VR1A 1BXRA 5FNVF 4O4JF 3K5IA 3BSWA 3N8DA 1KJ9A 4EG0A 4FFMA 3MJFA 4WD3A 1CS0A 2YS6A 3MWDA 4O81A 1B6SA 1BNCA 4EA8A 1EYZA 2DLNA 4O4IF 3RV3A 2NPOA 4MA0A 3KREA 4YBZB 3GLKA 1I7LA 3HBLA 3TIIA 2W6MA 1C30A 5JH7F 2PVPA 4C5BA 2GQSA 1VBGA 3DF7A 1VKZA 2I8CA 5DMXA 5D8DA 3OUZA 1KJIA 2GPWA 2WYOA 5CA1F 4O84A 1M0WA 3G8CA 2ZDQA 3VOTA 3LP8A 4L1KA 4M9CA 4IWYA 4O7NA 2R82A 2YRXA 3NUAA 5LOVF 4O7ZA 4O7YA 2YZGA 4ZQIA 1C3OA 4FFPA 2YRWA 1KJQA 2YZMA 3KAJA 4WBNF 4MA5A 3BFPA 5C1OA
chains in the Genus database with same CATH superfamily
2QYSA 1A88A 1EE2A 1OXXK 3OCYA 4XJSA 2XMCA 4HLCA 5K6AC 4MK4A 2SCUA 3ZXIA 3EOBI 1AUXA 5EZYF 3WYAA 2B4KA 4FR5A 2QXTA 1EGAA 2DM6A 1GSAA 1TE2A 2FPGA 4ZEMA 1OXMA 4I9HA 4NI5A 2D2VA 1ONPA 1WUKS 3TVTA 1IOZA 4KPGA 5AW5A 3WIEA 3IEUA 4TYNA 4C6TB 1XAHA 4Y2GA 4OQ4A 4ZYYA 4ALIA 2F9MA 3PITA 5K0JA 1HL7A 1IBCA 3JYPA 3ZE8A 1U3FA 5K0NA 1N56A 4OXXA 2VH2A 1N7IA 1S7GA 1RHRA 5HNKA 3IDAA 1EFHA 4UBMA 5ELMA 3F9RA 4PO1A 4FE4A 4KRYA 2YZNA 1Z0ZA 1XZIA 2BKVA 2G4VA 5KNBH 1WUYA 3UHOA 2VWHA 2EX4A 5MGBA 1FVHA 4HNGA 1H1DA 5KQSA 3OZEA 1T8SA 4JJIA 2IIVA 4U7HA 1WQ3A 4AN1A 2HDWA 1BOOA 2X8JB 3IVCA 2BGMA 1CERA 3AI3A 4TSRA 2XBMA 3ANTA 5TGZA 4HWPA 2BSXA 3GFTA 2XA1A 4H0FA 1CY4A 3TQRA 1S1MA 4P4GA 4DQ0A 3B9BA 3F6YA 3O7MA 1SZCA 3ZCTA 5HYVA 1NI3A 3QZ7A 3K1YA 5FOTA 4G0NA 4WUTA 3QY0A 1A5AB 5DN6A 2BUCA 2IQ5A 4IOAJ 1SGWA 4RS3A 2J7KA 4OLFA 4HNAB 4GEKA 3GJTA 2GLTA 1FYWA 4YR2A 4O2AF 2I3ZA 3R0IA 4MV7A 2NZ2A 2GZSA 4L5AA 1FFWA 2YJGA 1HSZA 3EIEA 2ILTA 1EK2A 2NTYC 5B3LA 1M6VA 2GN4A 2HN9A 1ZLXA 4Y2YA 2CZCA 3D5EA 1N48A 4S1PA 4ZOBA 3VUFA 2OUIA 3T35A 1YR8A 3Q3HA 3B3GA 3D7SA 1Q1NA 5JDCC 2H17A 3EVNA 2WE6A 2P67A 2QUKA 2QRKA 3K16A 3BCSA 1NPDA 1KARA 3F3MA 1XP8A 1R0LA 5D3MB 5T67A 2A5YB 4HDRA 4RGVA 3OE7A 5F78A 5CVJA 1I6WA 2FF7A 4XQ0A 4WLFA 1ULBA 4MVJF 1RLMA 4WF9J 4B09A 4HEHA 1Q0RA 3RF2A 3HZOA 2PYIA 4MYDA 3DUFA 2OL4A 2XT0A 1TK2A 3BIFA 4CQLB 4DV5H 4DB2A 1HYBA 4KQIA 3GFFA 3MIIA 4JI1H 5A4IS 2HMWA 4WEQA 3UJ9A 5J5VA 2XQIA 1IUNA 2ADMA 2VDNB 3QMVA 2ZJ6A 3VU9A 3K0CC 4V1CB 4NZYA 3RRJA 1ZSVA 1ZIXA 2B7BA 2EGGA 1HNNA 1WY7A 1SM4A 3PRHA 4KXNA 3ERCA 2Q5QA 4KNVA 4LBYA 1BMDA 4AJ1A 3KYDB 3U9TA 4J4BA 3FPCA 5DHSA 4YP0A 5E1OA 3ZTYA 2O54A 1KVQA 2JLZA 4LBWA 4R9NA 3H9UA 3N8DA 2QTTA 3QVMA 1M8KA 3H65A 3MJVA 3DOCA 4HG2A 2Q3MA 1P7ZA 4IH1A 4QM7A 3UQYS 4QTTB 3SC6A 2H3HA 4GX0A 3RU3A 3VV2A 5CYFA 3U7IA 4RJ2A 2AZTA 3PA8A 4MS3A 4QJ3A 5C8XA 2VTEA 1P45A 4TVSA 1YB7A 3KR0A 4NU0A 2HTEA 1XHLA 1YDWA 4EYGA 2QQGA 1TRKA 1X86B 3MD9A 2RDIA 4GC9A 2MINA 4GZLA 3AOEC 2VPXA 5CT9A 1LJLA 4RF2A 1EXDA 5CP8A 5AI6A 1SBCA 3GFSA 1OLSB 3FUUA 1QGUB 3WGIA 4ND7A 3LO8A 3C6YA 2OB1A 3BCHA 3S6JA 4QPPA 3C4JA 1Y81A 3TZLA 4CMFA 3OT1A 2CL0X 3G6KA 4R1TA 4PWQA 4C88A 2Q6LA 5ESRA 5KUTA 5KVAA 1DAPA 1GZSA 1IMOA 3CCMH 5AK0A 1WPRA 2OLEA 1BHQ1 4KC0A 1JQDA 2Q9CA 1XZNA 5BO5A 2HU5A 4NP6A 4IGAA 5EMKA 2WZDA 2VUMA 3CLUD 3BMCB 2UVVA 2NAFA 2O2IA 1AKWA 1HO3A 1SU4A 2BH2A 2QR3A 1BGWA 4N8DA 3TBFA 1TYEB 1QJCA 2AMJA 2WA1A 4HBGA 5KCZA 2WFZA 5DV9A 4XSHA 5AHOA 2RKBA 4OBEA 3FIUA 1DU4A 3KIPA 4BBPA 3ZHZA 3C8HA 4ZCTA 4KITB 5FWNA 2CDAA 1HT3A 1EFUA 4YPVA 4MQUA 3T34A 1NBOA 2H07A 3WBJA 4P34A 3HM9A 1KK1A 4UMFA 1E4YA 5CT5A 3NB0A 3BXZA 4DNQA 3E0QA 3LVQE 2G80A 3JQCA 2WMNB 5LQCA 2O57A 1VPEA 4CW7A 4ENTA 1FDIA 2R6AA 3A6JA 5EKUA 2ZM6B 3TLAA 3T3NA 1Z68A 1JROB 3VSBA 1HZJA 3DJYA 4PXAA 4U7TB 3RFUA 2HGWA 1VLHA 2I6TA 2YWEA 1MB2A 2QVLA 5ED4A 2CBZA 3M34A 3PQFA 3UG6A 2ZYDA 4B5LA 1BD3A 4LE2A 4JDUA 3T52A 1B6RA 1QR6A 4C0HA 4JC8A 3E9CA 1W1WA 4EDHA 1WVGA 2P9GA 1PWXA 3GEDA 4GLXA 2I5PO 3L7LA 2OGUA 3GLGB 1CHNA 1T2VA 3CWQA 4DR2B 3RKSA 1G5TA 2O0LA 1OLOA 1Z74A 3EZ6A 1K7FB 5D6NA 3ELDA 3TCNA 3MWKA 3P2YA 4DJDC 3CM0A 4FDVA 2QTLA 4RB2C 1IEQA 1D03A 2OCBA 3DPSA 1RYSA 5H7XA 1PKXA 3VAAA 2EFGA 4YHHB 3BQMB 4NENA 4MHOA 1FXWA 2QPAA 4HGZA 5IYZA 3A2MA 3U7HB 3VZDA 4BC1A 1FNDA 3UJAA 2WKWA 2BP7A 2XCOA 1E0KA 4JKIA 2V9CA 3PIDA 4B44A 4R1QA 2AD1A 1TF5A 4O3RA 4K9QA 3E3MA 2Y0CA 2GTHA 5KYWB 3VAYA 4OHFA 1X74A 2DLCX 3KRTA 2XB8A 2PXHA 4ES6A 3TMKA 2O8BA 1MA3A 4IMRA 2VPQA 1N9GB 2I4TA 2M6KA 4E33A 3IE0A 3V6KA 1V7PC 4QUEA 4LZLA 1FMJA 1P8AA 3KUKA 2DF8A 4CKBB 4QYSA 3CNEA 4XKJA 1S3FA 3R7NA 1R9MA 5I6DA 1FNMA 5E2IA 1IBLH 2W2OA 2H3EA 2F3RA 3AONB 3HFRA 4UCVA 5ALXA 1PFUA 4RCZA 1TJPB 1UBFA 4HN9A 3NYQA 4CDGA 3ZU4A 2FJPA 3EGDB 1JI3A 1SCKA 1H2HA 1WMFA 2XGQA 3VR3D 4X97A 3SZMA 1E5VA 4ZTZB 3FRIA 1UKCA 3P9NA 3E3NA 3OQBA 5FWXB 2VATA 1OV4A 2C5EA 4TMTA 4EHBA 3TIIA 1OA1A 1QONA 1WU8A 4E5SA 5JH7F 2Y1EA 3DFKA 4DV0B 1Q74A 3L6RA 4IG4A 1LCIA 3QJYA 3ESDA 4OD0A 3L0BA 3JARA 4L50A 3CKYA 2AI3A 4TKUB 4DW8A 4BWVA 4GRAA 2M05A 2HSGA 1I2AA 2CFRA 4ARZB 4WXYB 1HYHA 3QW2A 5K0LA 3U17A 3M5WA 3HY3A 1Z4IA 4BNUA 3Q8WA 2PUTA 1RC8A 1P77A 3PRJA 3H11B 5ELXA 1E7YA 3C15C 5DU2A 5KX5F 1F06A 3Q0TA 3ZDZB 3P9ZA 1WXFA 3FUXA 3LVFO 3FCEA 5DOZA 4YUZA 1P4SA 1RADA 1MCZA 5CH5A 4ZRMA 1JEDA 3UATA 4TS3A 2JEGA 1MJ5A 2BRUC 3WNZA 1S02A 1J9EA 4FKBA 2DHDA 1ZVJA 2X8LA 1K0FA 3IUPA 1QHFA 3O38A 2ZRIA 1HWYA 1KY2A 2YHIB 4LISA 3H8JA 5E3HA 3OCJA 1ZQ9A 3FE2A 4NZNA 2BQRA 1JMVA 3UT5A 3T1HB 4TQAA 4MV4A 4QDUA 2QW1A 3E1SA 3WGMA 1HLGA 4EFLA 3M2TA 1ZK3A 2DWCA 3BWDD 1JDJA 3WGJA 2HF7A 5KNBD 4KGZA 5DRYA 3E7XA 1PS9A 1WZUA 4Y1EA 1Q1QA 3T5MA 3G8DA 1M7HA 3VR5H 4W1QA 3F4KA 2ZT7A 5C4MA 3GFPA 1II9A 2P4SA 1CB7A 1GPUA 3X2FA 1EEHA 2B4TO 3QX8A 1RPZA 4J3NA 3BOSA 2QZJA 1EHCA 3C6XA 1IULA 5EIWA 4OTZA 1Y8AA 1MH1A 3DSRA 4FFSA 4PY2A 3NHUA 16PKA 1YKSA 4HWTA 3AZQA 1JQ5A 3TRIA 3EY4A 2GCIA 2PYZA 1X7XA 4L07A 1VDZA 4LIPD 2A1IA 1OOEA 3ZDXB 2H1IA 1KNQA 1QWSA 4DHWA 1D6SA 1XZFA 4RQUA 4MR7A 5LQNA 3TW7A 2HMVA 3OEWA 3MT8A 1ZN9A 1HOXA 2J3IA 1JHVA 3DEZA 4MUIA 3EGIA 1WCMA 3RNLA 3T0IA 1O57A 4GXRA 4PZYA 3SSNA 3D8TA 3H4VA 3LL4A 4LCJA 3PFHA 3PRKE 5LDDC 4M6WA 3VR3A 3WE7A 1FQJA 5ETJA 4QUDA 1W4CA 2R92A 1QAOA 3PR5B 3PZBA 5DK6A 2E48A 3PX3A 5JSZB 2K6GA 2JZOA 2V1XA 4ND1A 3F7MA 1RDFA 4M76B 3AKEA 3HHEA 2ZYAA 5M7EA 4QXMA 1W59A 3IOMA 1TQ6A 4PQEA 1HTBA 3DAOA 3QG5A 4BASA 4ER3A 3ODPA 3D4BA 3KL2A 3A1EA 1MENA 1U7DA 2X4LA 2V7QD 3PJEA 2VQDA 3FVTA 3UFBA 2VF4X 3ZK8A 3BGIA 5J2UA 1Y8QA 1CUFA 2PT5A 1JPNA 5KQGA 3BRQA 3CF2A 5IS2A 1PS8A 4UC0A 1XTJA 5BWBA 5EWEA 3F5FA 1YQGA 2PUHA 1L5FA 2WUDA 3ETRC 2QIPA 3QW4B 5UKDA 1IBMH 4WLEA 3G1UA 3PE3A 2PPLA 5I5XA 1JG3A 4UVIA 3BGVA 3LUGA 3HUTA 1EYZA 3QLVA 4GC5A 3BWCA 4E08A 4HVTA 1UXGA 2OD7A 4LRQA 1EK5A 4C5BA 4LGMA 2C54A 4TXLA 3FDZA 4HXGA 4X3OA 1M0EA 3EFBA 3ONEA 1ESNA 4CKEA 1YI8A 3D2BA 3QYJA 1U2GC 1DS6A 2AJTA 1NP6A 4L8LA 3P32A 3QBJA 5AW8A 4L1KA 4AUKA 3U56A 1MAUA 3NGLA 3UAOA 2W9AA 3R8XA 3VR0A 2ISQA 3TNFA 4RDHA 3GNLA 1UXJA 1WE2A 1N32H 5IASA 1OXSC 1ZL2A 2SECE 5JXGA 1F2UB 4XGQA 2D0IA 4R1PA 3PI6A 2ZUVA 1QHNA 4JQYA 5B6JA 2CZGA 4LOIA 3FHOA 2OYCA 3M8KA 4BO8A 4H4EA 3BE5A 3SICE 5KNBA 1AB5A 1MQ8B 4NCKA 2I22A 1OIVA 2O3QA 1S7CA 1ZO8A 1AKUA 5KOJB 3LUAA 3IG0A 3L6BA 1KS9A 1AF4A 2NWQA 1ZH0A 5JZ9A 2XCQA 1MKYA 1M67A 5LD2B 4RA9B 3SX4A 2ZS8A 1DXHA 1E4OA 4LF8B 3RSHA 3NRZC 3TK1A 3QSYA 4GKBA 1G9TA 1HGXA 5CVTA 4G23A 1JYEA 2W54B 1RAAA 1HNXB 2IYLD 2RGGA 1DRKA 1QPZA 3FYDA 3AIMA 3ZWXA 3MJHA 1VP9A 5SICE 2I2WA 2HU2A 3OF5A 1Y5NA 3KOXA 3SKYA 4OGKA 1QGZA 4HNSA 3TEJA 3AEQB 3NUQA 3ZQ6A 1YRBA 3KHUA 1N34H 2CD9A 3GLTA 2ECQA 3T5TA 1WXWA 5EKTA 3TLEA 3HA7A 2ERCA 2FJ0A 1OREA 1SUDA 2QN3A 3CCFA 3G0OA 1TEZA 5KDLA 4ECEA 4TZKA 2DMRA 4MR9A 2EGUA 4Z2AA 4O7WA 4OY3A 5KFWA 4KFUA 1X7YB 3H84A 4APMA 2HSWA 3ABIA 4MGYR 2QLJA 4RVCA 3EMDA 2B34A 4E5PA 3T5AA 1U7OA 1K3TA 4YS6A 2DB3A 4LRUA 2OBNA 2QMUA 5JVDF 5G4LA 3Q7IA 1XQVA 2GASA 3GILA 1LY1A 1ZITA 3NBXX 5GVSA 1JFFB 4H1HA 2V7QA 1QOZA 1ZJJA 3WKEA 2Y1FA 3BL5A 1FX0A 3MFIA 5CLFA 2GAJA 4M8KA 1ICEA 2IWRA 3G23A 1U3UA 4PSUA 3UC9A 3BQ9A 3PEUA 4C30A 4D9CA 1NQTA 4MV5A 1A8PA 1O08A 3F4BA 2OK7A 1YZKA 2PZBA 1JT9A 1G98A 5BQFA 1TPZA 3DOFA 2CUZA 5EG5A 4N41A 5KU1A 4BLRA 2WZBA 1IZ9A 1A1SA 1YFLA 5ARCA 2CV0A 3MWEA 3KK0A 3W3AH 5B1YA 5CLJA 3EG5A 3E8XA 1Y82A 3WGKA 2IYEA 3EIUA 1G42A 2AMVA 4G4GA 3AR7A 3QEBZ 4BNFA 4B4DA 2IYRA 1C1XB 1VBMA 3UV6A 1WOMA 4N40A 3ZGXA 3FNBA 2F8MA 5GIPE 3BIXA 2H31A 5IU6A 1YT5A 3F97A 2EV9A 3KQMA 4DDHA 1EFTA 2UUCH 2IGTA 4GSYA 3AG6A 4F97A 3TZBA 2CLMB 4ZZIA 1YIJH 3ND9A 4OQEA 2PUWA 1BXRA 2GNPA 2IWHA 4EG8A 3B82A 1Q1BA 1QX4A 1H6AA 1VGQA 1OX5A 1VECA 3ZLUA 2YU9A 4HOYA 2RDMA 3LD9A 2JANA 3HOVG 3GV7B 2JIZD 1MOPA 3IUQA 4Q1DA 5KHAA 1G6KA 1LS6A 2R1TB 3KSUA 1V5WA 4NMMA 2JFZA 3A26A 3PU6A 3AI1A 1WABA 1CE8B 1LSUA 4DEXA 3Q7EA 3H9EO 2XW6A 3A0RB 8ABPA 3JWJA 4N6NA 2WHRA 3QXCA 2Q5HA 5LFAA 4GFDA 3U7GA 5IYBG 4ALNA 2W7TA 2A1TS 2IOFK 4ZAVA 3C48A 4D0NA 2GZHA 5DISB 3M9LA 5JY1A 2JGMA 5BSUA 1PZNA 1E6WA 3DONA 1GA6A 2O6LA 3IB6A 3S68A 3IDSA 1J4AA 5FUXA 2PSHA 3QIAA 2HA0A 1PJ3A 3L84A 1EK6A 4Q4DA 2CFOA 4CMEA 3TUIC 2WOJA 3NASA 2J6CA 1K9SA 1P9LA 3AFOA 1UBSB 4MGZR 3WP1B 4MV3A 4ZHQA 4LDPA 1RRPA 2FG7C 4J6FA 2J46A 1A96A 2R5FA 3NGXA 4B3RH 4AZSA 3M89A 4O5OA 1ORWA 1XRPA 4WBNB 2POCA 4XTRA 4LYGA 1ZBDA 2ZSHA 1XU9A 5I7UA 3A1WA 3WWCA 2OYRA 1HR0H 3N59A 5ECDA 2FUKA 4ZJZA 2HNKA 1GT91 4AQ7A 3PHBE 1YVUA 3FFAA 1W4ZA 4CM5A 2C77A 4CC5A 4AQYB 5DSZA 2IHYA 5F35A 4BXOA 2ZE7A 1QHYA 5ALEA 4UQOA 5LQSA 1Q81J 1E5LA 3O94A 1GA4A 3T0FA 3FYUB 3BCRA 1T4CB 1JU3A 2FWBA 4JJ6A 4LOHA 3VR5D 1ESEA 2Q5JA 3Q0EA 4G5XA 2XWPA 1WCIB 3AZPA 1GKYA 3GEBA 3AI7A 4X9XA 1LF0A 3H4TA 3KUCA 1X15A 4IRDA 4DV1H 3T06B 3B8HA 4JOCA 4D46A 2XNHA 1U1EA 2ZRKA 1Z2PX 4MW2A 1DQNA 1ORIA 3TLZA 2C9YA 1BWPA 3IELA 1OWNA 4V3BA 3UWDA 3LIIA 1X0XA 2AOVA 2Q2UA 4R6WA 3WLHA 3JD0A 4EELA 1JEYA 4O4HF 1FBTA 3PWTA 1V3UA 4BFCA 1Y1PA 1JR4A 2CMFA 5KYXB 1L0BA 5B7NA 1RXYA 1RLIA 2P6PA 1QHGA 1TFRA 2XUDA 3NIFB 3I2KA 2CFTA 2QORA 3DDHA 1KO7A 3QVGA 3DOEA 1K6XA 1LDGA 4KYIB 2QM3A 2C3PA 3G2KA 2PHZA 2HHFA 3IVGA 4RTSA 4NZ9A 5CB4B 3EAGA 4IL5A 1KWKA 3L2OB 4UOQA 1ZD4A 2CMKA 4UU8A 4OSPA 3GA0A 2FVYA 1LA2A 2JIZA 1XJWA 4BAZA 2Q9UA 1T6BY 4YX9A 2ASDA 2EFHB 4XCXA 3ZHVA 2RBEA 2WJIA 3ZLTA 2RB4A 1KKUA 1Q14A 3GVHA 3Q8LA 1GKKA 1ZM7A 1YQWA 3K6KA 1SVIA 4LTDA 1V9CA 1N6LA 1K2VN 3NEYA 5CFLA 1IOWA 1YVEI 3MZ0A 2VBCA 3QENA 4MYTA 2P3OA 2L69A 5DYWA 4GKAA 3OU2A 1J8VA 3JXEA 5BSVA 1LDNA 4M53A 3LLUA 2IYYA 3QKSA 4O81A 4AD8A 4EATA 5DIZA 3B6IA 3K94A 3N86A 2Q1SA 3GBVA 4RVSA 1GUBA 2IU4A 2R97A 3SX2A 3I76A 4KHZA 4QDTA 3MLBA 5K3WA 2PVPA 3ZCPA 4A8JA 1CIJA 4FMCF 4BNVA 3JRNA 4D4HA 3KPYA 3ZK7A 3X2SA 4NU8X 4JV1A 1YCHA 2I8CA 1AJEA 3HCNA 1L7RA 5K51A 3GTLA 3SHVA 4LFAB 1BWRA 4RPGA 2HG8A 5FADA 3H9JA 1Y7HA 1LFDB 5DYYA 2GPJA 3TQSA 2ECKA 1N2CE 2QOEA 1YTLA 1M34A 5BWUA 3HB1A 4TVKA 2O20A 3K4QA 4KTTE 3SQLA 5TY0A 4H6VA 1WDTA 1MABA 2AG8A 1KP3A 2D5IA 4EGSA 3MOSA 1Z0JA 3U4IA 4YCCA 3G6WA 2XNSA 5A1JA 5TQJA 4YMVA 5FR2A 3AF0A 1JXMA 1B41A 3A6GA 3V5NA 3DFZA 1FO4A 2JEZA 1J39A 1YKGA 4K6MA 4Q48A 1RZVA 2XX3A 4W9MC 3HLKA 5DB4A 2ZJ4A 2PJUA 5AJWA 1P9RA 1FU7A 3VR5A 3T1TA 3SC2B 4DADA 1FP4B 2PKCA 2V7XA 3HCWA 2GKSA 5BR8H 4I5EA 3LP5A 5K3SA 1JIXA 3BULA 4MO2A 5HKAA 2ORED 4P6VF 2PM8A 2BJVA 5ITVA 1E3QA 3HB9A 2ZUSA 1Z2AA 3QG1A 3V42A 1N33B 1UBGA 2WAYA 5E6SB 4RANA 2Z0MA 3UXHA 1KWGA 4H7JA 1OGJA 1ZA1A 4Z3KA 1GT6A 4XSVA 1FFXA 4EPXA 1NX6A 3RWMB 1R37A 3RGGA 1KK2A 1SKAA 2DPLA 2JVJA 3KVOA 1SUFA 4R01A 1G3IA 1WVMA 3T7DA 1EDOA 3V4RA 2ZIXA 4YJGA 1B00A 2FZKA 4G8BA 1T0JB 3IUJA 3ZJTA 3DZCA 1FRNA 3AR6A 2AQIA 2HCBA 5CTJA 1A9XB 2VJCA 1UDAA 1F8YA 3RVNA 3TSYA 1ZG3A 4YRKA 4DMUB 2W4MA 2R8YA 1A9PA 3FDSA 3G9XA 2XWSA 3V1TC 3WZMA 4P98A 4G4IA 4WOKA 2IQIA 2FFRA 1WXHA 2QW0X 4BRZA 4IZHA 4ZKEA 1NG9A 3HWWA 3RJ9A 2X4IA 3ZJ4A 1R5OA 4GLLA 4WECA 2GN0A 2GEDA 1CR4A 3FLBA 3BSSA 4BMDA 1T9AA 3B1FA 4F45A 1Z5UA 2EZ4A 3I73A 1NQOA 3JQQA 2AG5A 1ZGBA 4L02A 2G70A 1JTEA 3KJXA 4M0JA 3SC3A 1UZNA 2FUG1 1KYXA 4CLDA 2LIVA 1KI6B 3CCQH 4JVNA 3AEUA 3FIJA 4PM4A 1P6QA 1GGEA 2CKZB 1L4MA 1KH1A 4YQZA 5IDWA 4ICIA 3CO5A 1QYRA 3HU2A 3C14C 2R8EA 2AUMA 4ZRDA 3H9QA 1WZ2A 1PZHA 1NUQA 4HGPA 3W3AD 1UWCA 5TE9A 1JKJB 1YKFA 3EDMA 5A9SA 2EZ9A 1QZXA 1HM5A 4RIGA 4Q1AA 2C00A 1NVMB 2JBWA 5C5DA 1XA0A 1RXEA 1N8NA 5FA6A 2H5JA 5DRTA 3JQ8A 2A9FA 1MH9A 5G40A 1VQ6H 1HZZC 2OHXA 1SUAA 4M37A 5T4EA 1EM8B 1UC8A 1G6Q1 4OFZA 4JYPA 4MR8A 4TTAA 3CZMA 4QQNA 4JL6A 1FRFS 4QAJA 1I2MA 4C3UA 2V1UA 4JEHA 1VBNA 5ENDA 3TO5A 1X8XA 4W5NA 2BEVA 5DDIP 3TGWA 1F2DA 4G85A 1RAGA 1N6NA 1DIBA 3VOBA 3OJLA 4J0GA 5HWSA 1U3CA 4XX1A 1FTYA 4PANA 3DOOA 1L4FA 4CZ2A 4DNFA 4DLBA 1WBDA 3EIHA 1XDZA 1PZMA 2O8FA 3N41B 3TRJA 5DTMA 4MARA 2CVQA 1K7SN 4NHEA 2YJ5A 4WZBA 2F8TA 4XVRA 5CDTA 4PCUA 2NVBA 4X7PA 4O84A 2FLLA 2P9TA 4M9CA 3D3KA 4PC6A 2VTDA 3TQHA 3CBQA 1ZHQA 3RIGA 2YX1A 1UKYA 2VJNA 3VKFA 4I55B 4U7PB 4YRFA 1D2EA 1QDUA 3CPEA 3I45A 1FQKA 2YZ7A 3CCUH 2BT4A 5KFVA 3VOAA 4MWEA 4IIJF 2C7PA 1MOQA 4FDLA 4NXNH 2VCEA 3H0EA 4QGHA 4LSAA 1CCWA 3A7EA 3C5CA 4QUJA 1E9BA 2VG8A 1YAHA 3H1AA 4TM5A 1N60B 2QAIA 3BD7A 4NZZA 3CEMA 3KXDA 2WIFA 2FSVC 1I1HA 2A4MA 3V6MA 4RKQA 4CE5A 1NN5A 1JB1A 1VBFA 3D6NB 2PGDA 3ONWA 1MDFA 2EAUA 2FWIA 3VRHA 4FMDB 4JT9A 5FUWA 4ZALA 3BA9A 1SWWA 2NW6A 1X3SA 5B64A 4XZ3B 4PQFA 4GI1A 2VP3A 3HJFA 2XTAA 3SR6C 3IAHA 5E4YA 4D9MA 3ZEAA 3HH8A 4Q0YA 1N7GA 4PRKA 4UUOA 3OT4A 5DM70 3CSSA 3UY4A 4Z51A 4J9SA 3PX2A 3MWLA 1M90J 1W88B 4C4YA 1ADCA 4PLGA 2B1JA 2RHDA 1EVLA 5GV8A 3W8FA 1VS0A 4G0ZA 4ZAFA 2BCGY 3E6AA 2WJVA 1TLTA 3SPXA 1EESA 1FFBA 3SS8A 4G5GA 3JZFA 3LPMA 3HRKA 4XFJA 1JL3A 5ALNA 3EXG1 1JH9A 3ER6A 1QIDA 4QREA 4MV8A 4V0KA 3I5UA 1F7UA 3VMFA 4GS5A 4BTLA 3W3AA 2FWMX 4M99A 1V1RA 2ZJQJ 5I5SA 2MYUA 2OBMA 2X9VA 1WETA 2X5JO 5JAQA 4LV8B 1SNYA 3VNUA 1ULTA 3R23A 1X8LA 1KI8A 2INGX 3F6SA 5AVXA 2CHEA 2C28A 2H16A 4H35A 1BD4A 3RGWS 1W75A 4UZEA 1N8SA 1PE0A 4M1QA 3MTBA 3DAYA 5ALWA 4IS2A 4BZZA 3DBLA 3HJNA 2Y66A 1PJQA 1F9EA 1U0GA 5TR9A 2BWJA 2QVCA 1UEJA 3ZHYA 5ILOA 2OP1A 2ECOA 1QE5A 2CUKA 3BWYA 1TADA 3SLRA 3HJHA 1NNI1 2I6FA 4JOBA 2UUBB 4ALLA 5CGQB 3N0XA 4OV6B 1OT5A 1MFPA 3I9FA 5F2EA 2HC9A 5GV7A 1YJCA 5JUMA 4D4IA 3KSZO 3U2QA 2I4LA 3WL5A 3GV0A 4Y9SA 1OH7A 3EEOA 5K7SA 3MF4A 5TT0A 3ACBA 3UW1A 4XYLB 1R0BA 4QZVA 3WNDA 2P75A 1Z7YA 5HIMA 1GTG1 4P54A 4O7SA 4MWZA 4FBTA 4ESVA 4DRFA 4WUVA 2RHTA 5HIJA 4RPHA 2QYTA 1ZXXA 1H05A 2GYYA 2VQ6A 5CRIA 3KYCA 1XV5A 3PR1A 3WSWA 2VZ0A 2EJCA 4Q4JB 3H1EA 3WFIA 2B7CA 2BZ0A 1U4NA 1DJMA 1GN9A 1T5TA 4DCUA 2FZEA 2QRZA 1SKYB 2BIFA 4RHUA 5JISA 4C3OB 5K4GA 1F7VA 3TSWA 3BXFA 1EGHA 3VU1A 1IYEA 1G8SA 5JARA 4PR0A 1GGKA 1GZ7A 1SVUA 1OFIA 1IMJA 4MVXA 4B3FX 4HDKA 5EIXA 3WLPA 4HT3B 1XTUA 1LRLA 3OWXA 3CGGA 5BNZA 3QQ5A 4B8WA 1VKZA 4PLVA 4DPKA 2O50A 4JENA 4R0MA 4JITA 4RAZA 1GZ6A 1ONBA 4RXUA 2I99A 3FZYA 1QU3A 4UJ5A 2GWRA 3P19A 3DHWC 2J5KA 1UK6A 2C9ZA 2GZMA 1NNUA 3CLRC 2ZUTA 3ZHSA 1Y37A 4V0QA 4FGJA 3IQWA 2R6HA 2Q7XA 3DH0A 1PJCA 4AU1A 4YI5A 1YF3A 4M21A 1AD2A 1YMQA 4CEIB 3L7JA 5I3ZA 4R2HA 3WK9A 4DR6H 3IR6A 3P1JA 2C57A 2GCEA 2N42A 2IPAB 3TSOA 1NYLA 1L7EA 1OHHD 3CUYA 4BBZA 4JYMA 1KRHA 3D0RA 2GSWA 3JATA 3LUHA 1H2ZA 3TFQA 2IBKA 3RPFA 4G1FA 2ZUUA 2JPDA 3PNLA 1GL6A 1LU9A 1XOIA 1WOYA 1XHEA 1N2CB 3GDHA 1I2KA 1V25A 4M8SA 3DNPA 1S3IA 1Y9ZA 1ISHA 3P97A 3BT7A 2H2IA 5IZCC 2FR8C 5KS8A 2J09A 3W04A 3MRTA 2ZJYA 4LRXA 3K05A 1HTTA 3R44A 3HDJA 5IX8A 4DF3A 3V8EA 3EPHA 1EUDB 4CCYB 3C3XA 1TIPA 4AP9A 1BFKA 1QPBA 5DYNA 3ZS9A 3FPSA 2P2ZA 1VIMA 1WHTB 4NJMA 1H85A 1YZHA 1XU7A 5AW2A 5BP7A 1PHRA 5F51A 1Q22A 3KZVA 1AK1A 1OH5A 1TYCA 4DIUA 4MP6A 3AL0C 1CJKC 5GAHN 2BHLA 1RJWA 3I6YA 1RJ9B 4P7JA 1TCAA 3KKLA 2FYTA 3SAJA 4OQYA 2A1UA 3JAWB 2HVRA 1D2MA 3RUFA 3CYFA 4Z9AA 1KBQA 2FSFA 4FVTA 4IOMA 1TJ4A 2FPPA 1QIKA 3T1VA 1MX3A 4K0RA 1WZEA 3J81A 4HDMB 2VSFA 1L3BA 4A3GG 3UB4A 5EJ8A 4PO3X 1AHNA 3EEFA 5GADl 5CR9A 2NZXA 3UAXA 1K7YA 3DB2A 2XYGA 1FVOA 3M0EA 4RXMA 3A6EA 2HQSA 4DUPA 3W4IA 4YRZA 4N76A 4R2KA 5C1BA 3W8NA 4GGOA 4M0MA 4DLSA 1NBWB 2YHSA 3L8HA 4YRTA 3LAWA 4D79A 4XCQA 4HYTA 5HGXA 4RB0A 4U3JB 4TTVA 4QNNA 5GP1A 2ZBQA 1QBKC 2O5CA 3KV3O 3PUWA 2FUEA 2XI4A 4K26A 3IC5A 3CPWH 1TTPB 2AW5A 1MB9A 4MITA 4LYAA 4FFOA 3DV9A 1T0UA 3LZ6A 1VL0A 2E4UA 4GI5A 4O3PA 1PNTA 3A9UA 4MAMA 4CG1A 4G01B 3ZGNA 4OQPA 4RD2A 4YIHA 2CLIB 3DAAA 2ZRPA 3LRPA 2IH2A 1R9NA 2J0UB 4XIIA 4DEVA 1JJBA 3PI7A 5EMJA 5BYBA 3WNVA 3K1TA 4WINA 4XB2A 1TNDA 1JIJA 1P7VA 4DV4H 1U02A 4LA4A 1KQGA 3EQ8A 5AVOA 5CTAA 3JTMA 2OHFA 2JBAB 3HVUA 2D00A 1USUA 5FNVA 4IP0A 4BUCA 1K0UA 3QFTA 2YXEA 2HSDA 3WK8A 1COZA 5KQLA 4TT3D 2V0CA 5H1SO 3QX3A 4R8KA 2FW7A 2PVSA 1BOFA 4RJIA 5F9MA 1OHHA 1NVIE 3LF1A 3FRJA 3EQ2A 4BN5A 1WQ4A 3N75A 1KDRA 4MIOA 2DWOA 4MX8A 4ZOHA 2AE1A 1P44A 2C99A 1IZYA 5D1OB 3WK7A 2YJNA 1PT9A 2WM3A 1KETA 2RHCA 1Z6PA 4FOTA 2EJ2A 4ON9A 5T3UA 3AP3A 3I34X 4UEKA 3OX2A 3ZCSA 4Q7MB 4I1YA 4HTAA 4H60A 5HCUA 2B61A 5C7YA 3RBDA 2C88A 1ADGA 3HKBB 3B5JA 4HF7A 1UCFA 3GF4A 3RR5A 4M0UA 3R9XB 2GMWA 1QPRA 3SYNA 3T7CA 2PUBA 5AM3A 2AMYA 3SJCA 1JG4A 3SEFA 4LF5H 4JP2A 3I62A 3I4CA 3KEFA 2EQBA 2BZGA 4K86A 1Q0UA 1QRDA 1C30B 3I9NA 4TTQA 4HRVA 2GVNA 1I80A 5D5PA 4CV1A 2AC2A 3V8MA 3GELA 3ZE1B 3NT2A 1P73A 3E84A 3E8SA 1JSZA 3UYLA 3GRYA 4P82A 5GPBA 4YAKA 5JATA 2F64A 1E79D 2J0VA 5FBVB 3DKPA 4S12A 4AQDA 5HPYB 1PW5A 5A0VA 3ESBA 5REQA 2I4OA 2C5BA 4ZCPA 1ILEA 2ZJ7A 3AGPA 3RVOA 3LMKA 2A35A 1U5BB 1I4OA 4FN4A 1E98A 4QOFA 4QQRA 3P7MA 1W5TA 4FUTA 4DJEC 3AX6A 4NJOA 5DBHX 1HE3A 2OTCA 3CEPB 4EB6B 4LHZA 3GT3A 5T6MA 2ZKIA 2WWRA 3W6PA 3O03A 4DQKA 4HYQA 1EHIA 1YS4A 1V9PA 3BL6A 3FI0A 3TAUA 4DG5A 3WMEA 4KI0A 1AGNA 2SHKA 4YT8A 1V35A 1K7XB 3RHTA 4MS4B 4IX1A 4KWIA 1POXA 5LVAA 2J08A 5ALPA 4HVCA 1EWYA 2YHUA 1GIAA 3OEHD 1KBLA 2X1VA 1I3LA 3WQRA 4CKZA 3MEQA 3A8TA 1QFYA 1AA6A 5B58T 4C08A 4ZQEA 3ZNOA 2VTBA 2MMGA 5JR3A 5KJCA 2PMCA 4RKRA 2OSBA 1OBFO 1F4PA 1AUPA 3ZI0A 4QYIA 2ID8A 1A71A 2PMKA 3BK2A 3DDZX 3QBDA 3OZRA 5SYAA 3QFSA 4ND2A 3ROPA 5FD8A 4MS1B 2NVUB 3COSA 4W8GA 4TT3A 4BKPA 4R54A 3O0TA 3QKRB 4L0CA 1T10A 2RH9B 1JDNA 3QFFA 2J3EA 5GY7A 4R81A 2I1QA 1VPVA 1M6YA 3LUBA 2H1OA 5IW8A 2PH7A 5L51A 3FR7A 1IY8A 4WASA 1V51A 1TTHA 4HYYA 4TTRA 2HPVA 3OT5A 3ZW9A 1XA3A 1SVWA 3JAMA 2QLFA 3RRYA 3L02A 2RAPA 3JVVA 3QXXA 2AEMA 4P7GA 3I5XA 2FW0A 3KTAA 1WM1A 4ID9A 4W9RA 4J75A 1U28C 3V3KA 2J5QA 2VYFA 3A1TA 4WOJA 1X1AA 2XBUA 5SZIA 3RB0A 3N2NA 1P2DA 1OH8A 4RAQA 3CH7A 1G17A 1R16A 1GWNA 1MXHA 5IKEA 2NUTB 4DARA 3ZLJA 1BMTA 5MHTA 2NXEA 2Z9CA 3SNOA 5LD2C 4IIBA 2NSHA 3MUEA 2II6A 5KSOA 4JHXA 2WNHA 4C4ZA 1H3NA 3MFYA 1E66A 3TI7A 3TB6A 3QLUC 3PFBA 3KREA 3JZAA 2I4IA 3SFZA 2XMGA 5HILA 5C51B 1N5OX 4OHMA 5DI3B 2VJOA 3N2LA 2HXYA 4G63A 1QQAA 3N2GA 1CC1S 3M4IA 2AW3A 2HT1A 3H99A 1E79A 1Z82A 3L1VA 4WJLA 1FP1D 1EVYA 1XDGA 4NEQA 4A15A 1AURA 2E4YA 1T8RA 4EX6A 1GEGA 2WJAA 1RPNA 5BMVB 5C80A 4D1YA 1EDEA 5CFQA 1LPSA 3CSWA 4RMNA 4COKA 4N6OA 4KE8A 1QYWA 1UC4B 2NVXA 3UV3A 3UK0A 3OTGA 4LF9B 5L3SA 3M4YA 3E03A 1N36H 2AGOA 1L5RA 2OM6A 4DUYH 1FIUA 4MXDA 4WNAB 3WIBA 2XMPA 4HFNA 3T1YH 4R41A 2EG5A 3EJ6A 2JA2A 4PGAA 4WV3A 3SSMA 4EHDA 3U26A 3N5KA 4AWXA 1JLSA 2ZJOA 3I52A 1KIFA 5KTPA 1EGVB 2WKQA 3GDFA 4BV9A 1IY2A 1FL9A 5DTQA 3KU4A 3IPCA 1HE1C 3CKLA 1EG7A 5HBRA 1V16A 2HXGA 1L5KA 3OEHA 4JBHA 1O89A 5A02A 5AH0A 3VPHA 3WNQA 1I5EA 5EDWA 1PLLA 1OW3B 3PGMA 1F9AA 1HETA 3HKZA 2IYPA 4LGCA 4CMDA 3V9AA 2VJMA 2VPPA 2FLNA 5DCYA 2VT2A 1ENYA 4YWHA 3KWJA 4HB3A 4YPFA 1DUVG 3RE1A 3ZDQA 1U7ZA 2V6FA 4QBKA 3IPAA 3RVMA 1XLTA 2ORIA 1J09A 3OA0A 3EGXB 2IEZA 1SC4A 1EP1B 4HLNA 4A5SA 3V1MA 5FR9A 1VKNA 2EATA 5JCOC 4TMZA 3A25A 3RLFA 4YT4A 3LK6A 5ESDA 4U0JA 4TQ9A 3F2VA 1SUEA 4DYVA 3E2IA 1I2LA 4F04A 1I24A 2C8LA 1RBQA 5LR6A 1HG1A 4WAUA 1FM0E 2P5TB 3OTOB 5JMOA 2HUNA 3GZ4A 2VO1A 3L6UA 3M6AA 5JNUA 3AR9A 2IBSA 4UVGA 3ITDA 5KAPA 2PGNA 3KQYA 2DBQA 2DAAA 3DEAA 5AICA 3S8EA 4TVIA 5G2OA 4ZAWA 1U0HC 4QLOA 1QRUA 1OYVA 2Z4SA 1Z5WA 3UUFA 4ZU3A 3NP7A 2ZRLA 3RAPR 4BKOA 1MAHA 3FPBA 3EGVA 1COWA 3RSOA 1ABFA 3AW9A 2JKVA 2WMOB 3GQCA 4EGQA 1SEIA 4HNRA 4CCSA 1DI0A 2A58A 4PYMA 1DEAA 2AOXA 4W9NC 2WT4A 4OU4A 3IAEA 3IEMA 1SYXB 1JZSA 1DBWA 1ZH4A 2QG6A 2OD9A 2COIA 2BE9A 3KYBA 1NHGA 1LWOA 1PT8A 2NVOA 2EJBA 1FF9A 2VYVD 2RGXA 4JXUA 1DJNA 4HLUA 3FVRA 2Y27A 1BCRA 1O0SA 1BMFD 3D0KA 3NHJA 1FYEA 3L8EA 3PGVA 3TJMA 2O2CA 1E89A 2WJGA 4O6VA 2V7PA 3SQXA 3HO6A 2XECA 3HJTA 5BPFA 2E55A 4RHYA 2ZSJA 3LW7A 4FFLA 4LKOA 2B7NA 4O7RA 4LOJA 2RARA 2JLWA 2GM4A 2BELA 1GDHA 3WYGA 5CVVA 2R7LA 1PV4A 2FWJA 1JS1X 3TUZC 2QYOA 5DISC 3OQJA 1KNXA 1RYBA 1F38A 3PF9A 4HCJA 1YZ3A 1Z8NA 1GCGA 3ITEA 1VYHA 3VJMA 3IKMB 4US8A 1QC5A 5EUMA 2CBXA 3ANLA 4X84A 2BTEA 3RAEC 2D1YA 5JUWA 1O3YA 2DXIA 2W2KB 4ENSA 4QOEA 4CTKA 4D9HA 4CIVA 1LB1B 3WYDA 5KYNA 3OM0A 4DR1B 4NS1A 3L0DA 4MUGA 3KQWA 3N0TA 3HBLA 2E49A 4KIGA 2JLBA 4BPRA 4XGRA 5CM0A 5LZ2A 1CRZA 4NESA 4GPD1 5ECGC 3UPUA 2DUWA 4PIPA 2R62A 3JQAD 4FOPA 1NVGA 1SCUA 4YY3B 1C4OA 4UAUA 1JJAA 3ASUA 5ICFA 3QKIA 3QITA 1AZLA 1G8GA 3TFOA 1QE3A 2H1SA 1BEEA 1K5DA 5HKBA 2FEAA 3NC1C 3HCOA 4P0PB 2FLWA 4DZRA 4KREA 4UHFA 3MGGA 1MQAA 4F3TA 1ZEMA 4JDPA 1Q1EA 2F1KA 5HQ3A 3RRFA 1DJQA 4XQEA 4OI0A 2VUUA 3MWDB 3JRWA 4OXNA 3ZUPA 1OSNA 3FYUC 4X1IB 5E8JA 1P5ZB 3PIPJ 2A9OA 4X66H 1L8LA 2HMTA 2D5BA 1KQFA 3V4FA 4EY4A 3SI8A 3FJOA 4K9RA 4F9EA 4M0EA 3GNSA 3SZRA 4TV9A 4I5GA 1IDOA 4P81A 2QP3A 2HV9A 4KUGA 1M2OB 1UWLA 1T34A 4JI4H 2FDCA 1KU6A 3SHOA 1ULHA 1GRQA 3BGDA 2XUKA 2B2NA 4LH6A 4YYEA 2IXBA 2W6PA 3FDJA 1RM6A 4Q12A 3W77A 4MWTA 1AKRA 2E4WA 3IKTA 1C1HA 3DD5A 4OJNA 4MUNA 1TC1A 5HZMA 4ZICA 1QV9A 5CLIA 1L7VC 2HW8A 2YQ4A 5FBRB 5CFOA 1WV0A 4B34A 4DR4B 1YDEA 3KVYA 5F3DA 5B4VA 3ZGVA 5B3JA 2QTWB 5E7MA 3EYYA 4KQMA 1K86A 1P33A 1SC6A 4GKKB 4IHJF 3OFND 4ABYA 4J9RA 2JLRA 5AM2A 4CTJA 1ZXBA 2LVBA 3AESA 3L49A 3JSAA 3KVRA 1US8A 4PLCA 4R8SA 4GRIA 4UCUA 4OQFA 2VYVA 2XCLA 1RYDA 5GAEN 2EWMA 1QGOA 3B1KA 1CZOA 1QKKA 2F4VH 1QIFA 2PBZA 1EA5A 1BMFA 2O14A 1XEWY 4LW8A 4RCYA 5AFSA 4D9NA 1IQPA 4X8OA 5IM4F 4B31A 1VMIA 3L8FA 5C31A 1NZJA 3S44A 1FJGH 3PDIB 4AY2A 4GWKA 2WP4A 4MKGA 2EGHA 2XUGA 3B36A 1RR6A 4Q1CA 4MTEA 3VSEA 1JX4A 1LLFA 1LQUA 3Q9SA 1I0LA 3AJRA 1G64A 1GTL1 3R0ZA 2FK1A 4YECA 1GZ5A 1YHYA 4MYSA 4P4SB 1E7MA 1R66A 2IMWP 3BSFA 3EDQA 4JBGA 2G82A 2LRHA 4YJ2F 2JD2A 1X14A 3DOJA 2GR9A 3GGGA 2EU8A 4FSHA 3NLLA 4N3GA 3L4KA 4MCJA 1WB4A 3HVRA 4L85A 4NCIA 1PGOA 2IIPA 4BUJA 1VJDA 5JZSA 1CP3A 3R77A 4AZ0A 2VTVA 3AEKA 1JIQA 3FPLA 5AK3A 1NRXA 3G49A 1U90A 2DHEA 4P84A 1BN7A 1XPJA 1KMQA 3M4NA 1HUQA 3R3HA 2OZLA 2R60A 4D9EA 3JQAA 1GZUA 3B60A 2CXTA 3QY9A 3EXHC 5DGTA 3SM9A 1BIFA 3LXUX 1N1EA 1JXAA 3IX7A 4NECA 3I37X 3T41A 3I3SR 2HTFA 1ZZGA 3SF0A 2JG3A 2BFAA 2BQUA 4I4LA 1DINA 1Q0HA 3DXXA 4H77A 4CT4B 4J16A 2AFIA 1ZN7A 4ZRNA 1DKQA 3WGUA 4G0MA 3B3AA 1JIHA 1K4KA 3CUWA 4XWYA 3TB4A 2B4QA 4YRRA 2QTMA 4GC6A 4LY0A 5TS2A 2AJCA 2WG1A 4RF4A 2HA7A 3IUBA 1PX0A 3NKFA 5H5JA 1GZ4A 4B2PA 2IITA 3KQPA 3OD1A 3WSTA 4B6EA 2FJZA 3TIVA 5I4CA 1PTJA 2QAGA 1KYVA 3STVA 2B99A 1M33A 3CQ9A 3R24A 1UKVY 1UBKS 3C1OA 4OHBA 3GTKA 3I58A 4NCNA 3C3EA 3BEOA 2BR5A 4UCWA 2E5LB 1FYXA 4N48A 3IBTA 2FQWA 1TVKB 4US0R 4ZEOA 2HO5A 1GADO 1P1HA 4FGWA 4OJTA 4W5TA 2WJYA 3HDGA 5HOEA 1IN6A 1UQUA 3EG9A 2PIDA 4JP5A 2V58A 2QVBA 1YU9A 1YB6A 1K6IA 2YYAA 3GAAA 1CV2A 1Z28A 5EUCA 3OIUA 4JEIA 1PKEA 3OFNA 4D4LA 1OC2A 1TLFA 5FI5A 3K96A 5HTKA 1R2QA 2ALJA 3OX3A 2BFCA 5HFJA 1P1KA 5DYIA 3UJNA 4BVLA 2CHGA 5DX1A 5HE9A 1OH6A 4PEVA 1E9CA 2OO7A 3II6X 5AHRA 2M2IA 2MSWA 1RWPA 1JKXA 4Y18A 4IAJA 5DNAA 3HOXG 2M98A 4YCJA 4QFDA 5E1DA 2JAWA 3I4MG 3DLIA 4B80A 3AV0B 2M6LA 3UQZA 3HPQA 4DJTA 5FBQB 4L2IB 1NAHA 3EHDA 3E8MA 1TVMA 1Y0BA 3D6TB 3QXJA 3NAMA 2VNHA 4DUGD 1AQJA 2BW0A 5CG2A 5L40A 4RZIA 5B36A 3QKWA 2A0WA 2YZLA 4FCTA 1NJ2A 3PHIA 4ZO7A 2NQ8A 5FI3A 1BZYA 5BWNA 1EX9A 1INLA 5HQJA 3PV0A 1SHLA 3E27A 4UNIA 1X7WA 2H5LA 2OHJA 4JI6H 4UDOA 1PNQA 2PZAA 1JKFA 4RUCA 1SUBA 1YASA 3F96A 4LGVA 4AT1A 3IAAA 2E4AA 1EKVA 5EESA 3S24A 2J9YB 3T7SA 1SHTX 1VIVA 1NXSA 2FSIA 3PTZA 2RSLA 4KKXB 3CUTA 3VYUB 4G0VA 4KH1A 5C44G 1GNQA 4E5DA 4YCMA 2FY8A 4O3MA 3JCZA 3TSZA 1MG5A 2VIIA 4A0HA 5ES4B 1SCNE 5AQ1A 3O74A 4PLPA 1UK9A 4GZ5A 4LBVA 5DSTA 3EK2A 3OZBA 4RK6A 1V39A 4KGVA 5ICGA 3LFUA 1XCBA 2QK4A 1HV8A 3KS9A 4K9MA 4N5MA 1JDZA 3N87A 4N18A 2KM1A 2PTGA 2PSJA 5EY5B 4Q02A 4HGRA 4KQEA 3FOZA 4KMOA 5TF4A 5AT1A 3W9SA 1YZGA 5JJCA 3ONFA 1ULZA 1UINA 3FJ1A 2B4YA 5F5XA 3A4IA 1G3RA 4ZCIA 3WIDA 4UM8B 3EXHB 3WAGA 4HSGA 3NATA 1W5BA 1OWTA 1FDWA 4E5MA 5JBIA 4ZC8A 2VLBA 4W8OA 5IJ0B 1IYDA 1M0TA 1SCQA 3HCEA 2PS0A 1NLFA 5CBKA 4BQPA 1VB3A 2NZJA 3DXZA 4R69A 5A4AA 4IR1A 3W79A 3ZDBA 4JH0A 2XWBF 5K2OA 1UJMA 1WMAA 3LQ4A 4O3NA 1MTOA 1Z5PA 1D04A 5ALVA 1OZHA 2COJA 3O4GA 4BECA 2I6GA 4RCNA 3D3EA 4X62H 4LXUA 1VJRA 3CN7A 3D6UA 4A3SA 2FRDA 1KYIA 2OV3A 2RC6A 2Q9AA 5KTTA 3G7UA 1L5GB 2B1QA 2HHAA 3FMAA 4GZ6A 4KFTA 4CYMA 1Z5GA 1SELA 3JSXA 5IARA 1XNQH 4QWBA 2UVPA 3H0GG 2GQSA 4GIBA 2R47A 5FI1B 3HSYA 2HK7A 4K9LA 1SD5A 1E2NA 4HSEA 1ATZA 3E15A 4EY6A 4PAGA 4F4WA 4ECAA 1KEEB 2IHZA 1C0IA 4GR5A 4F60A 1ND5A 3T5CA 3THRA 2A9KA 2YRXA 2JA5G 3OLCX 4C7BA 3OW2H 9LDBA 2BJWA 3CJRA 4J1TC 5FUQA 1BE0A 1KJQA 2B1GA 5HM8A 2VXCA 2Q3LA 4PG7A 2J45A 4P3YA 1JDTA 5IVPA 4PINA 3DMTC 4C4PA 2FZWA 2WV9A 3EARA 4CMHA 3L7NA 1SBHA 2WTMA 4LVUA 3CW8X 4TV8A 4DUGA 4F4XA 4J8PA 4S24A 2GWHA 4JQCA 3QPBA 5CDFE 4B5KA 2Q2NA 1JAXA 3CVUA 1REQA 4YV2A 5D5HA 3BC1A 1CZNA 4F4UA 5AK6A 3K6SB 4ND8A 2E4XA 2YFYA 1X87A 1YRYE 3L0GA 5KKAA 1N62B 5J2TA 3H2IA 3DPIA 1MC4A 2CHFA 2GARA 4QSMA 4MMYB 4I5FA 3RAXA 4KE6A 1V8ZA 5LP6B 3ORRA 2ZIWB 1WF3A 3S2IA 3KEGA 1U0RA 1W19A 1BE6A 4DZZA 2G71A 1PS0A 4MPDA 3S1SA 3GI1A 3ORFA 3NBQA 3P26A 1PR1A 3EVZA 3VO8A 4RZSA 4RTPA 3P9CA 1OIXA 2CZQA 2FPKA 1VXOA 3D3WA 3RS4A 1RC1A 3FG9A 5C4GB 1K06A 2EKLA 3AHHA 4UVEA 2OHGA 4POAA 4Z1OA 4O4LA 3QFHA 5T8KC 1Q3HA 4Y7CA 2OCAA 4LJ7A 2K87A 3G0GA 1YC5A 3KOMA 1M8PA 5FBZA 5ALJA 2AKAB 3O4RA 2HB6A 4ED0A 2BISA 1ZM9A 3C2QA 3N0WA 1NVXQ 3PUJA 4F4JA 2CSXA 2BM1A 4K8OA 5J5CA 2KSQA 5D01A 4FYHA 3FY4A 3G2PA 3DEKA 2W6CX 2BI8A 4FHFA 1EJ0A 5IBPA 1O94C 4QW8A 4G0XA 2XE8A 1WRVA 2BDUA 4M0PA 1AH2A 1R10A 4JA2A 2WK1A 1EG2A 3ZDEA 5AVTA 3NIWA 1FSGA 4PX3A 1PVOA 2ZXUA 3NTXA 1JPJA 4CVNA 2RC5A 1UFKA 1YA8A 3DW3X 3TDMA 3EVAA 1QH0A 2AFHE 4XTCS 3PO2G 4NBWA 3PCRB 5DH9A 1WF6A 5KYYA 5ALGA 2ID9A 5F33A 1SC3A 4TQSA 4WDRA 2FOIA 2XCPA 5DOVA 3UK2A 4KUEA 4NR0A 2WUFA 1U3GA 4ZT4A 2VDLB 4A10A 1WWKA 3LSTA 1FSSA 3NWJA 4IRMA 4K0KH 3B9RA 3F98A 2IUEA 4URUR 3KJEA 3AINA 4JOQA 3K09C 3U3MA 3GLHA 3EIOA 3ZV5A 2W9CB 2ICAA 1I1LA 3EH1A 1ISRA 4Q44A 4U4AA 5KMGA 2BM0A 2GCGA 3VR6H 3L6CA 3ZGLA 5A0TA 3K31A 3JU3A 4A2CA 2DCMA 4UFZA 1B6GA 4QG7A 1PP4A 3GJ6A 3HDVA 4YUXA 5T7BA 2O7QA 2WMDA 1LPAB 3ONDA 1XRJA 2NV2B 4EG0A 4AYXA 3CTPA 3OLWA 3ROZA 3WFJA 1QGAA 4X6LA 2X9NA 4WOCA 3ZVNA 1FFYA 4A93G 1TWCA 2DVMA 3BVPA 3KYIB 1IFXA 5EHQA 5DBEX 4RL6A 1D9ZA 1WP9A 1E9DA 2PJRA 2VXYA 2PUAA 4DVGA 5K8VA 3AVYA 1VBGA 4KSBA 1H2BA 5FCDA 1XWFA 2VLIA 1AKNA 4BATA 4EY8A 4GX2A 1P4RA 4RTJA 3T95A 3W2TA 1VCIA 2WIGA 5J40A 4GQAA 3OOJA 4UCSA 3ZWMA 4ED8A 1L1EA 1L9KA 4CV3A 1YBMA 3P8ZA 5COBA 3TLGA 4RE5A 2HNBA 4UUNA 4U1RA 3NVMB 2R6GA 3HEBA 3BF7A 2WM9B 1Z18A 5C1OA 2GXUA 5TQ0B 5LXTF 4EWLA 1KEZA 1XTVA 4AJKA 2REQB 3K9FC 4O7LA 3FOEC 3NHWA 4ZVOA 1OXTA 3QBVA 2P6UA 1IH8A 4A3DG 1P1RA 4UY8M 3N5CA 1T5DX 4IJQA 2ZWIA 4CETA 2EC5A 3E5HA 3GUVA 3QTTA 1SQGA 2NSDA 2REXB 1N0UA 4JHLA 2QL9A 2BLNA 3E18A 4BV2A 2FN8A 3RC9A 2QX4A 4NTZA 4UTOA 4DIBA 5AJVB 4RU1A 2JJQA 4BFXA 4FT2A 3L5KA 3LOUA 5K8TA 4A3CG 3WHIA 2CL5A 5HK9A 3ZCXA 1QS0A 4Z7OB 5HF5A 3OOHA 2BBOA 4H6PA 3TR5A 5JNVA 5ARDA 2C5SA 3NGMA 2FWPA 1MDBA 1CKMA 4FYKA 4ZJUA 1V1MB 2H0AA 1ZM3A 1I2CA 1VLMA 1Y3BE 4GSLA 1BWSA 4XWAA 3ZTWA 3TLKA 3RUDA 1N0WA 5FEUA 2Z95A 4EO4A 3BMXA 4CEJB 3O8DA 1E32A 3WYEA 5CA0B 4YROA 2VH1A 1W9HA 1O58A 4X1KB 1CUZA 2KBFA 1OTXA 3ICVA 4KUHA 1OZFA 2BMFA 3N2KB 5H9WA 2Q8PA 3M6VA 1WRBA 2AKEA 1V45E 3ELYA 2DPIA 1ACMA 3JVDA 3RTGA 3R6DA 3FNFA 2FCRA 4W5RA 3K0SA 3SYLA 4I1UA 2W2XA 5DWQA 5IAKA 1Z8DA 4BJHB 4EBCA 1Q6YA 4GYWA 3NFYA 5IH3A 1XKTA 3NAQA 3AP2A 3QP9A 3K1AA 2BOVA 4ZU1X 1T9BA 2WWWA 3LHSA 2G17A 3J81W 4EPTA 4R2LA 3U7EB 2XE6A 4FOSA 4XH9B 3JQPA 4EKGA 3GAZA 3KJNA 1LLUA 1FUEA 1ZK0A 4X00A 3BD8A 1XCGB 1WSDA 1JAYA 3C8MA 4G56A 2H51A 3AO0B 1IQUA 4ZI7B 1WB9A 4QTUB 2DPHA 5HZGA 5L9AA 5K1ZA 1D2AA 5KWSA 5AW7A 3KDSE 5B7GA 4JU8A 5BW4A 4EQ5A 4AZVA 3Q41A 3WK4A 2BGTA 3CNNA 4F3RA 3CB4A 4F3YA 1Z47A 2Y0SA 5B1SA 5JNTA 2GFQA 3TMYA 5DK4A 4BRWA 3I3OA 3ABSB 5FQNA 2HMYB 2CW8A 4WZAA 1Y33E 1DVRA 4EL0A 4JB2A 1QB8A 1VMKA 4Q9LA 4B3XA 5LOVA 3WL6A 1JGTA 2O3UA 3ZU6A 3ZWKA 3PX7A 1H6DA 4TMFA 2YS7A 2G25A 1VJCA 4G5OA 2HA6A 4MV1A 2V4ZA 1L6IA 4DN6A 1VQKH 1LGYA 3O3CA 2ZRJA 4KQ1A 5IPFA 3I9LA 2BMWA 5KFDA 5HA5A 4A2AA 1BQ3A 3UA3A 3I4FA 4RNDB 1O95C 4PTZA 3WHPA 2JAXA 2XUJA 1RWXA 2WYWA 5COQA 3G82C 4LGYA 3GCZA 5BWCA 2WWXA 4D6XA 2Q0HA 4QTYA 3OM1A 3AMZA 1GR0A 3R9WA 2J9FA 3DZBA 5EP2A 2WJZB 5KU7A 5BUCA 1I6LA 3GR6A 2LCFA 2Q45A 4GOJA 2EOAA 4TM8A 4WKOA 2QZ4A 5D7BA 2BJHA 2QQ0A 4CUJA 5CH3A 4XEUA 4RK0A 3N1UA 1I7LA 1U3VA 3WVNA 1ZPDA 5JPDA 4FDMA 2BGJA 1DQSA 2YCHA 1A0GA 1ZN2A 2O2DA 2VJKA 1XPUA 3UTCA 1QR2A 2WAXA 2PNJA 5IKMA 2AA3A 5DBOA 5DNYB 2OC4A 1H0RA 2Q5FA 2ON6A 3LPLA 2FETA 2ZIGA 3LP8A 4AZ3A 1ISJA 2WB1E 4LFBH 2W9BB 2C2WA 1LC3A 3D54D 1HEIA 4EJ2A 1VHDA 4O7YA 2A0FA 2BHRA 2AGVA 3F8WA 3WLNA 2WD7A 1ZGAA 3PNMA 1IHPA 2QTZA 4UEOA 4MIYA 3U61B 3R9IA 4JGIA 5JNSA 1EFVA 1FNNA 1WY5A 1N4DA 1DBQA 3MWGA 2WJ3A 4GEGA 4M1MA 1SBIA 2Q6TA 1TAUA 3AFNA 1U2EA 1PNOA 4M88A 4NG4A 4JXXA 2CJFA 3L5OA 3NT5A 5ADWA 4LHVA 5IULC 5IVKA 3ET4A 5A3QA 4FGZA 4CEHB 3LC7O 1Y80A 1VI2A 2G1KA 1JVNA 5A3JA 5FV4A 2IPMA 1GL9B 1WCYA 3TE7A 2QAJA 4MV9A 4XFDA 1LQ2A 2WE8A 2WF9A 4D9GA 1BH2A 5AKLA 2VYQA 1J1UA 5CYPA 1DXYA 1IEVA 3SVLA 3I64A 5BV8A 4F5WA 5FBLB 1L1FA 5IMBA 1W0JD 3NDJA 3RRNA 3EWSA 3NRJA 5I47A 3TRFA 4HXEB 3U3XA 1ZSNA 4BVHA 4EGFA 4JJ4A 2C3YA 1XQ1A 1XVTA 4KPEC 5MDHA 5JYDA 2BHSA 1VG9B 4KO1S 5CAEB 1I13A 2WE7A 2QTRA 4H1UA 1UDCA 4MPTA 4PBSA 1L9XA 3T7RA 1K68A 4RPLA 2F3PA 2FEKA 1ZUNB 2VT7A 4ECXA 4AF8A 5HUPA 2I71A 4JEUA 4ZO9A 3KSBC 1O5IA 3FPJA 2UVQA 2WD8A 5CCEA 1FOEB 1CR2A 3QNMA 3TSAA 2X2OA 3NZEA 5DHTA 2WAOA 3R8FA 4NBNA 1LI5A 4OGLA 4RTOA 2VF7A 1LXCA 4RMGA 1Y4ZA 2I7TA 2WWYA 1BW9A 5HCNA 4Z3DA 3NYIA 1SQ0A 2AHRA 3C2OA 2AEJA 4Y3UA 1U2QA 2G8LA 4TZTA 5SV2A 2P9BA 4LMPA 3HJUA 2Y1LA 3DDOA 4KYTA 4KR9A 5HW0A 1G3UA 3KKEA 2QEXH 3PHHA 5HRCA 4W63A 4D9KA 3MELA 5IZ4A 3O2QB 2OLSA 2ZZKA 2W8ZA 4AYTA 2H1HA 4LHSA 4ND3A 4GPZA 4IV8A 2C4KA 5LMZA 3KBBA 3Q1KA 1XNHA 2PKEA 1P72A 4C2UA 2FFHA 4D8YA 3FAKA 5ILGA 2EDCA 4Q4LA 5D1HA 5DQGA 4C0QC 1GUZA 3WJ1A 3JAMW 2R3SA 4L73A 2ZJFA 3O4VA 4KVFA 1E0AA 1E1CA 1ECLA 1HYQA 4YRMA 2R8OA 3L43A 1AN7A 1E8MA 3AFHA 2YVQA 5EP3A 3I42A 2JL1A 3GG2A 1HE4A 1AO0A 5BPHA 1VAJA 4CQJA 2BV3A 2EFDB 1JNYA 4NDZA 4EG1A 4S0ZA 1UJBA 2AFHB 1J22A 4H31A 5A7FA 4KIWA 1NQ5A 5JMPA 3VR6D 1GITA 2I2CA 1TD1A 4ZZ3A 5LDHA 4IZOA 4H6XA 1P5RA 1VLJA 4EGAA 3H9GA 1RYMA 2HZBA 1H22A 4KZPA 1T4DA 4LYEA 5JRJA 4LXYA 1L7PA 1FU8A 1XXHE 1YJQA 4Q3EA 5CEJA 4JYAB 3LWDA 4P0TA 3WZ2A 2BE7A 2JCVA 4LHYA 3NBMA 2YWFA 3N6VA 1TAHA 1RI4A 2W6JD 3NVWC 1DC6A 5FULA 5K0EA 3PB3A 4IDNA 4NXMH 1H4TA 4RKEA 1H42A 4LNHA 4A4DA 3EZXA 3HYCA 2I9KA 3HZRA 2DKFA 3OE5A 2HK9A 3P0HA 2ZITA 5TF0A 3OQVA 3AJ9A 1W0JA 1A9TA 4C87A 3NTRA 5H81A 1NYRA 5H3CA 2OXCA 4B2IA 1BE1A 1RC0A 2A9PA 5G3ZA 1GRVA 3P9XA 3HL0A 4BFLA 2VHJA 2PBLA 3CF6R 3P2OA 1PR3A 1GJRA 1JLMA 3LNTA 1MU0A 3UAVA 3U3DA 2X0FA 3A4NA 2YN0A 1QH1A 3EBPA 1G63A 2I66A 1HYGA 2GK3A 3HL4A 1V3VA 3ZK9A 2XWQA 1UPUA 1NVKA 5KREA 1XMOB 1YBVA 1SHUX 1CSEE 4FWTA 1BXZA 3AEXA 3BE6A 4GI3A 1J9GA 2ZRHA 1VI6A 1A2OA 1HYEA 4YRQA 4KG7A 3ESZA 2XF8A 3IUNA 1IVNA 5B37A 3O31A 1N5KA 2IGBA 3ACCA 2D8AA 3MBKA 4QNRA 4NAUA 4YHBA 5BYJA 1AV7A 5EJ9A 3F46A 1L5ZA 1ETHA 4IUYA 3ZZ0A 4FE2A 4R1MA 5JAOA 1Q3KA 2BAGA 1D1TA 1LDBA 3WICA 1CF2O 3ORHA 1ORHA 3HB7A 3AL3A 5F9FA 1WUHS 4TTIA 4IRKA 1S3GA 4DQXA 1EVQA 2AOWA 4BX3A 5JMWA 5BWVA 1MV8A 4FS8A 3MSXA 1Q91A 1J5PA 2NM0A 1QFZA 5DIFA 2AI1A 4M0CA 5LLSA 3QPCA 4AX4A 1IG0A 3GTQA 1ZD2P 2JFFA 5DM2A 4JROA 3ZG6A 1B33N 1H6BA 2EKQA 4H27A 3O8RA 1OLXA 1H0HA 821PA 2P11A 1N1MA 2QY9A 1T6XA 3L7BA 1T15A 1COWD 1EBUA 1CVRA 1RAIA 2ODNA 4EYSA 3PDWA 2E2HA 1RKVA 5CVEA 1X9GA 2XUHA 3LUCA 4BMYA 3FUCA 1CKNB 2XD4A 1R4MA 3K0AA 4CUKA 3EEQA 2FMAA 2NT3A 3NV9A 4TUYF 4FEGA 5E7IA 3UG7A 4KQ2A 4KXYA 3A70A 3K8YA 3NALA 1XCOA 2UYYA 5KG2A 3VPCA 4BFTA 3LDFA 4NBKA 1U0NA 2PY6A 2D1TA 4AC9A 2F2TA 1OA0A 3Q8MA 5AM1A 3GN2A 3N6RA 3VR6A 3JQDA 4J3FA 1TYDE 3GFRA 4RETA 2UVWA 2QM8A 1OX4A 2JJYA 4LK2A 3C24A 1UNNC 1KY4A 3HGQA 4LSZA 5LBUA 2WOOA 1HT2E 2D0OB 1VRWA 4XDGA 2DTXA 1I4TD 3W1WA 4EMTA 1ZNXA 1CNEA 2Q62A 1GGVA 4QSHA 1W30A 1II8B 5ALHA 4Q66C 2H06A 2YV2A 3ECAA 1V3QE 4RXTA 2W6JA 3E22A 4JLUA 1F51E 2B98A 1JF8A 1IJKA 4IDAA 1DKOA 4AUMA 3PEYA 4X7RA 1WL8A 4QW9A 5DCLA 1MBZA 4RKFA 1I5OA 4HS4A 5DGHA 5HUHA 2P7HA 3N8NA 2D62A 4L0DA 3G0DA 4YLGA 1F2TA 1C50A 2FN7A 3ZWWA 2GHQA 2UXCB 3WL4A 2YBEA 1N0HA 2EL7A 3QU7A 4LDAA 3OHPA 5FYDA 3LUKA 3UK7A 1RQ2A 3COYA 2CF6A 5FJJA 2JA6G 3W1VA 5C18A 4A5OA 3KXPA 1BJKA 3PPXA 1BU8A 3EY9A 3QPUA 4QBTA 2X14A 2W6ID 4YBZB 3A1VA 4ZWNA 5LQDA 1OAOA 3TQ1A 3JZ6A 1F17A 1SK9A 1R1DA 1U2TA 3QOXA 2WF6A 1SQSA 2Z58A 1K1EA 2D5LA 4AN4A 3F6CA 2WYOA 1WMSA 4BHTA 4UFOA 4GA4A 5B1IA 1T5BA 2V8OA 4YXFA 1CY7A 5HMMA 2QR2A 3R6GA 2YXLA 3V7NA 5CVUA 1SZJG 1ITZA 3ZOZA 2WJWA 4EHJA 3KR9A 1ARZA 3GEHA 3AI2A 3ZU5A 4C4XA 4F12A 5ALMA 3UJBA 4EF5A 4ASUD 1NLZA 4IH4A 2I54A 1X1QA 2AYXA 4GZMA 2VDPB 2IE0A 3KXLA 1JDSA 2CJWA 4KRXA 3AY6A 3ICWA 3HCBA 3TN7A 1JDUA 3GP5A 2Y6VA 1K3UB 2JAOA 4UD6A 3GGPA 1QX3A 4E09A 1Z25A 3X1JA 4HR7A 2GZ1A 1SXQA 4FI3C 4MUXA 5I3CA 1PEKE 1V7CA 1E5DA 4J0CA 1ODKA 4C7OB 4K46A 2PIAA 5DNWA 2W22A 4K9NA 5EIAA 2GZ2A 4JV5B 4IBOA 4A26A 4CIXA 1WH2A 4ADSG 1TAGA 4B7UA 2A0UA 1D4OA 1B93A 1Q1ZA 3USCS 4R51A 4DT1B 3R7DA 2G6TA 4ENPA 3KQQA 4JUAA 3PAJA 1TZKA 5DBFA 4XIFA 4B6PA 5L3QA 2XZDA 4DY6A 4HTFA 3CNHA 1F14A 2HPAA 2VQFB 1F8GA 4CMIA 3HOZG 4WACA 4HMQA 5ILQA 2AKYA 1Z45A 2WKRA 3FVQA 5A05A 2FQQA 2VT6A 4BY9E 1MN6A 3NP9A 2J3DA 2ZBUA 2IYNA 1Z5ZA 4V39A 3L1UA 4Z0NA 5JE8A 3RAQA 5GONF 5EWMB 4QJFA 3C3WA 4XYEA 3WBBA 1RYYA 1Z07A 2CDBA 1IQ0A 2DY1A 1QIEA 3HA3A 5FLEX 3H0GA 4C7KA 3RAFC 2LKCA 4OOEA 4D99A 2BFNA 4B3MB 3SBOA 1DCMA 3I23A 4F71A 2IZ7A 1B74A 3Q7SA 2IIQA 4J9KA 4UU0A 1F1BA 1YA4A 3DHYA 1EXNA 3SVZA 1M5UA 1YOVB 4AKHA 3ENNA 4ML3A 2D2XA 1U65A 5CDYA 4EY5A 5EIBD 5IANA 3FPAA 1SZDA 4I1RA 1H9AA 1YS1X 4U2CA 5C8YF 1ZK2A 3QHQA 2JA5A 3GUHA 3DAHA 3KC2A 1VMDA 3M9OB 2PTHA 3JALB 1X1DA 3NHZA 3FA2A 3AR5A 2NNLD 5E25A 2OWEA 1PZFA 4B84A 4FU0A 1ZS9A 3ECSA 4BQRA 1K6JA 4YJ3B 3UT0A 2JAQA 1M2GA 5LZ5A 4MJ7A 1N4AA 5I9MA 5AUOB 2W6IA 1N2JA 2DHQA 3WLAA 3JTEA 4KKVA 2DLDA 4QOSA 4K6KA 1M74A 5HKOA 1VI5A 4ZJYA 1NVUQ 3HOYG 3LQYA 3CVZA 4UM9B 5DM6J 3UHJA 1PL0A 4R16A 5IT9A 3DA8A 3MXOA 3ZVMA 1D4FA 3PEVA 4JI2B 3RHSA 1JDEA 4PNHA 2AK2A 5HL7J 3A10A 4ZARA 2X4DA 2UKDA 2I3BA 3VH3A 3FGPA 4B47A 4CLXA 4NMWA 3Q9LA 2QPOA 5KO2A 4F4DA 2OV6A 5L3VA 1FVXA 3INYA 3SCZA 1QGDA 1CT9A 2BKAA 4WCEJ 2IPXA 4K1LA 2UUPA 5HJ5A 4ASUA 5JCXA 5JSHA 4CRWB 2JEIA 2ZAMA 4EHAA 4C0LA 3OU6A 5KG6A 3M4JA 1XMPA 3HB4X 2QM7A 4R4JA 3RF6A 3ZDFA 4JUCA 1TT5B 4E6EA 4OCZA 3RANA 3D7RA 2LUOA 4L5BA 2PWZA 5FI0B 2G9ZA 2H2DA 2XUAA 1E6KA 2Q6OA 3HZHA 3FLMA 1IM2A 4LE0A 2R5WA 3SDZA 4F56A 1XROA 1NRWA 2LNDA 3QFRA 1SUWA 3JQFA 4ZZ0A 3JQ7B 4GPBA 2REBA 3DDWA 5TLSA 2R1ZA 5ADUS 2I2AA 4P31A 1F6DA 4AJOA 3IPXA 2ZOSA 3LO5A 4GWLA 2SICE 1SG6A 3HCFA 4US2R 5FWDA 1JA9A 1XIVA 1CU1A 1NYTA 3HCPA 1KF0A 3PDCA 2J48A 1AS0A 4RUAA 2KI5A 4R8UA 3PGA1 4NX2A 1FE8A 1BX3A 2HWUA 4FJ1A 1HOTA 5DTRA 2H7VA 3OJCA 1FFVB 2OORA 4NNPA 1L4HA 1X80B 1LK5A 4UHBA 3SZOA 2Q3FA 3L8YA 3TD9A 4QHYA 1I2BA 1V8PA 2BMEA 4MYUA 2ZTMA 2I03A 4ECQA 2JBMA 1HA3A 2O2XA 1NVWQ 4FFBA 3AUUA 2Y2UA 2JW5A 2I65A 4B7CA 3EC1A 1B3BA 3UWPA 3BEDA 4C43A 1F0PA 4J9PA 4BE4A 5JNLA 5I5WA 1GTZA 4QVGA 1HLFA 1WW8A 2ZWPA 3CCJH 1GN8A 5DPMA 4GF5A 4JEMA 1M1NB 2LDXA 2PGLA 3HCRA 4GOKA 4YMTA 4GL2A 2ZB2A 3N8GA 3PXDA 2D8MA 4XDZA 4O29A 1DEHA 4K81B 3V48A 2RDJA 2PT7A 2XDQB 1U1FA 3N05A 4KSYA 3RU9A 2EG9A 2Q46A 3OSNA 1H94A 1B8VA 4Y2SA 4NU6A 5B30A 3TIFA 2O7NA 4H17A 3CT6A 5AKIA 2C7QA 2AQKA 2A8YA 2OG2A 1PNVA 1NUHA 4LZAA 1LBQA 2XUFA 5GINE 2FSUA 2ODAA 4M86A 4DSTA 3W6NA 1PCXA 4IR7A 1UFQA 3SFVA 1PIWA 1RBMA 6Q21A 2PQ2A 1E59A 2NYRA 4R5MA 4NPCA 2UZ1B 3RBAA 5K8IA 5J4HA 4XJVA 1SQ6A 1THMA 2Z1MA 1OFUX 4PYQA 4BNNA 4Q7KA 4KV7A 4PE5B 4NHOA 2H7YA 4RM2A 2ZZNA 5DZSA 3HACA 2OBBA 5J63A 2R7ZG 4BQOA 1T3TA 4KQFA 4FFNA 2C35B 1VHQA 1RXWA 1RJPA 4QYXA 3WYNA 1CUCA 5EWGA 4QDOA 1FNCA 1GPWB 4C04A 2I80A 1DO8A 4DLPA 4MTCA 4LXXA 4D82A 4P7FA 4HX5A 5A5FA 4OBWA 3ZXXA 3HFGA 4L76A 3G2IA 3BDIA 2BTQA 2Q9BA 1GY8A 3IBCA 4PLHA 1MW8X 5BN4A 3DV0B 4U7WA 5BOVA 3UMCA 4KHPB 4EA6A 2WKSA 1J0AA 4J4TA 1JHDA 1F8FA 1P4HA 3AYXB 3IUMA 3OCUA 4L4XA 4TL9A 2WTAA 1RI2A 2JGLA 4JL8A 4MUKA 4RA6A 1KZ4A 3QA9A 3H5TA 1DAFA 4ZPJA 2CNDA 1P0IA 2VUHB 3C5HA 3AVVA 4ZT2A 3ANNA 9ATCA 1T3SA 2QZPA 4XWKA 4H0NA 1AQUA 5CLHA 3C5EA 3LT4A 1EEXB 4V24A 4F9FA 4Q39A 3NOXA 4F5YA 3PC6A 2NUPB 5CB4F 5K3FB 3U4MA 4NCXA 3WR5A 2D1FA 2NZUG 3GPDG 7REQB 1JMKC 1H23A 1UKEA 4AROA 3OC0A 4JCCA 3RB4A 3GAMA 4RGQA 4WADA 5BWRA 5F1YA 1KH2A 5FRDA 3P71T 1SC1A 2WIDA 3NEJA 8OHMA 2ZE8A 2EW1A 1V9LA 5KFMA 4YCBA 1SK8A 1CDDA 4KIJA 5M2QA 4DLUA 2I2DA 3GRZA 3U4QB 1KO8A 2R4QA 3GH1A 4IJUA 5CDHA 4O4IF 1Y8RB 1U0TA 3UMSA 2ZIFA 2NPOA 1KL7A 1USKA 3I8OA 1T4MA 7ABPA 4AURA 1M5RA 5K8JB 3RGZA 3NV7A 4PAWA 4B33A 4C21A 3ZGZA 2VCYA 3QUCA 4RH0A 4AYBE 3X1DA 1BFDA 1EWRA 1N1DA 3E9RA 1M73E 3GVCA 3IQIX 3ND6A 3UUEA 4IO1A 5KFCA 1NE2A 2Q8NA 2IOFA 4YCNA 2HRRA 1H6CA 3ZQJA 4D3DA 1ZMBA 5LP6C 2ANCA 3FFTA 1SKUA 4E2WA 4BX2A 3EPRA 4FNAA 4OEHA 5LP1A 4X3PA 2XE4A 4QQKA 2HJVA 2XKAA 5LQAA 1V41E 3U55A 3DTYA 2VP2A 5KIAA 1P0QA 4IVRA 2SNIE 4R31A 3P5SA 1MJNA 1Z26A 4RTMA 3HKDB 5FAKA 4WXRA 1TM3E 3FF4A 1Z73A 1H93A 1P6XA 1X9IA 4Q8FA 1CP2A 1FB5A 1DWUA 3E9QA 2D4AA 3VX3A 3JW8A 5EZ5A 2PVCA 4OB7A 3KKQA 3SWWA 2AJLI 4C0KA 2OBFA 1N3BA 2ZSKA 1N7JA 4P93A 1F48A 5LN1A 1QM5A 1DJLA 5I7EA 4UPDA 1NI4A 5FOXA 4QRHA 2X5NA 5D00A 2ZBFA 4Z8YA 5JBQA 1DSSG 4FONA 5FP0A 3QQPA 3AQIA 3AIIA 1YRWA 3KHHA 3L8DA 3S5UA 4P36A 3E35A 4BBRG 3JWHA 5JPIA 1MQ9A 3QEOA 3L46A 1U1GA 2DAPA 3PQ3A 5DG8A 3IIEA 1VCMA 4L5CA 1QKJA 2C2BA 1XTQA 5KQMA 3WYBA 2C2EA 2F9LA 3QNUA 3Q6IA 3VDNB 4M8NE 2EWWA 4CM4A 5C52B 2J4FA 1NBMD 2HGSA 2A7QA 1LS1A 4X92A 2PS9A 4I2VA 2C20A 4EPVA 3AB7A 5BV1A 1Q84A 3GCWA 2ATEA 3JWEA 3DLPX 4G24A 2CVOA 3BRSA 2R86A 1E4EA 3WDMA 1M83A 3WLIA 2ACWA 1NY5A 1MNAA 2QN1A 1EFPB 2UDPA 2VA3A 3HO8A 4KX3A 1CUJA 4MKZA 4RU9A 1IIBA 4N54A 2HY7A 1ZRMA 4Y2TA 3KZOA 4BNWA 1CJMA 1K1SA 3W8RA 5G3YA 4UCFA 2GPTA 4P4UA 2AV6A 2Z43A 2WJ6A 3UJ8A 1L7BA 4IKOA 2EX1A 4C9BA 3RIZA 5ITZA 3VHRA 1T3NA 4D9FA 3FI9A 2X0NA 1IJBA 4JI5B 5TV2A 1DTWA 3ZR4B 1FFGA 5CNKA 2IV2X 3CXRA 5LU8A 5I9NA 2P9QA 1XLUA 4DDKA 3QYFA 1CJCA 1RTKA 2QMOA 2AQ8A 2B2CA 2WF5A 1A9RA 3EFOA 4UU7A 4DM3A 2E2IA 1BVRA 1TT7A 3WNBA 3P2KA 2NXNA 4YLYA 4GU5A 1ODFA 1NOKA 4FHCA 3TLJA 5AHWA 4HVLA 3ZVLA 1ONOA 4E4TA 2CE2X 4A8PA 2F43A 5CT8A