3WO1A

Crystal structure of trp332ala mutant ywfe, an l-amino acid ligase, with bound adp-mg-ala
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
466
structure length
466
Chain Sequence
SKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKDYFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACERLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPTYLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTEGYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEGLGLQNCATHTEIKLMKNREPGLIESAARFAGANMIPNIKKVFGLDMAQLLLDVLCFGKDADLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSAAAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single Mutation Alters the Substrate Specificity of l-Amino Acid Ligase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords Alanine-anticapsin ligase BacD
total genus 134
structure length 466
sequence length 466
ec nomenclature ec 6.3.2.49: L-alanine--L-anticapsin ligase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13535 ATP-grasp_4 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3wo1A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3wo1A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wo1A01
3.90.1170.60 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Aldehyde Oxidoreductase; domain 3 3wo1A04
2GPWA 3RV3A 5JQWA 5LYJF 1DIKA 1I7NA 2GPSA 3I12A 4I50F 3WO0A 3N8DA 2R86A 3G8CA 2ZDQA 4MA5A 3U54A 2ZDHA 3ETJA 4FGRA 4FFRA 4HNUA 1VBGA 2R7KA 4MA0A 3JRWA 4HNTA 3R5FA 2YZNA 1VKZA 2I87A 4O4HF 4EGJA 5JVLA 1GSHA 4TV8F 4M98A 3JZFA 4O4IF 3KAJA 2CNVA 3E5NA 4O2AF 2CNUA 2VR1A 4MAMA 5J2UF 1Z2PX 1I7LA 1BNCA 4ZOLF 5JVDF 2PBZA 4YAKB 2X0SA 1CQJB 2W6NA 2FPIB 2FP4B 1GSAA 4TV9F 4IIJF 2PVPA 2YZGA 4I4TF 3TQTA 2GQRA 4I55F 4ZQIA 2P0AA 5C1OA 4MV6A 1E4EB 2PN1A 1IOVA 1JDEA 2YWVA 4Y8VB 4EA8A 3K3PA 2YYAA 3R5HA 5BPFA 3RFCA 5BPHA 3K5IA 3AW8A 3AX6A 4WBNF 2QK4A 5JQGF 2Z04A 4MV3A 3MWDA 3BSYA 4M9UA 1B6SA 2HJWA 4O7NA 4O7TA 3GIDA 2XD4A 4EG0A 3MJFA 1EZ1A 2VQDA 4E4TA 2YZMA 1Z2OX 4XYLB 3R23A 4QSHA 2YRWA 4DIMA 1KBLA 2V59A 5HV6A 5LXTF 5CB4F 4O84A 3QFFA 3U9TA 3OUZA 5CA1F 2DLNA 4O81A 4FFLA 4M9CA 1JLLB 2DZDA 2R7NA 3BG5A 4HR7A 4O86A 5KX5F 1OBDA 1GSOA 1W96A 2WYOA 2YS6A 2R87A 1KJ8A 4FFNA 4O7VA 4O82A 3TW6A 3TINA 1CS0A 2DWCA 1JDBB 1OBGA 3R9RA 2VPQA 3BSSA 1DV1A 5LOVF 3KREA 3JZIA 3NUAA 4ZI7F 4FFPA 2C00A 4YJ2F 1W93A 4FU0A 3VPDA 3N6RA 4FFMA 3BFPA 3DF7A 4ZHQF 3Q1KA 1CE8A 1KEEA 4O7YA 4RZQA 2CZGA 1Z2NX 4FFOA 4M99A 3HB9A 1KC7A 2CNQA 2W70A 3LP8A 4XZ3B 1A48A 2R7MA 2V5AA 4O7ZA 5J2TF 4XX0B 3WNZA 3HBLA 4C5BA 1EUDB 1EYZA 2I8CA 3LWBA 3BSWA 3WO1A 1CQIB 2R7LA 4MV7A 3G8DA 4O7WA 5C1PA 2YZLA 1C3OA 2R84A 1DV2A 5DMXA 2ZDGA 4IHJF 2W71A 1BXRA 3K5HA 2YL2A 5HBRB 2NPOA 2NU8B 3ORRA 1E4EA 3KALA 4FE2A 2DIKA 1M0TA 1UC9A 4EA7A 4YB8B 4TUYF 4O4LF 4O7SA 5LA6F 4HQ6A 4YJ3F 4EGQA 4J6EA 5D8DA 4MV1A 1UC8A 2NU6B 3UFXB 3HO8A 2FPPB 3U55A 2YW2A 4IZOA 2HGSA 4MV8A 1EHIA 1B6RA 2GQSA 4O7RA 1JKJB 4YAJB 1IOWA 3VA7A 2W6ZA 1M6VA 3ORQA 4NYEA 3VOTA 1KUTA 4IWXA 5CAEB 2W6OA 1KJIA 2I80A 1A9XA 1EUCB 2FPGB 3KAKA 1ULZA 4MV9A 3Q2OA 5FNVF 4XYMB 5H80A 4DLKA 5I47A 5JH7F 3SE7A 2YS7A 1KJQA 2FB9A 1M0WA 3VMMA 1KJ9A 3TIIA 3VPBA 1GGOA 2Z02A 1VBHA 2NU7B 5K2MA 3VPCA 2VHEA 2YRXA 3U9SA 1AUVA 3R5XA 2W6QA 3OUUA 2XCLA 4GGMX 4C5AA 5KKNB 3GLKA 4WD3A 4IWYA 2W6MA 3RUPA 3JRXA 2NUAB 4O7LA 2IP4A 2V58A 2NU9B 3RV4A 5IYZF 4YBZB 4HNVA 4O4JF 4EABA 2SCUB 4C5CA 1KJJA 4MV4A 3MWEA 1T36A 5GONF 5LP6F 2CQYA 2QF7A 2R82A 1GLVA 3V4SA 1SCUB 2W6PA 1PX2A 3ETHA 3V4ZA 2GLTA 5BMVF 5C8YF 1PK8A 5CA0F 4O83A 4EA9A 4O2BF 2R6FA 1C30A 1WR2A 5EZYF 2R85A 3TIGA 2OLSA 2J9GA 1AUXA 4ME6A 4EAAA 4L1KA
chains in the Genus database with same CATH superfamily
2GPWA 2OCKA 2NQ8A 5E0OA 3AQIA 1LLCA 1VJRA 4BP3A 1EKPA 4Z51A 2JG3A 3V34A 2LDBA 4IOKA 5C1IA 1H2EA 1R66A 1AGYA 2IP2A 3MB5A 1VDVA 2Q1WA 3LUPA 4NCKA 2AGQA 1Z0FA 3N8DA 1YB4A 1PJTA 4Q9NA 4Q01A 4ACBA 5HKAA 2PEYA 3TX6A 3C3KA 2HDOA 3QOXA 4JJKA 1QK4A 3LLCA 1M5TA 3M4JA 2CLIB 5EWFA 4JHLA 3CEHA 3FAZA 2C82A 1IVNA 1N7GA 2ZAGA 3D7NA 3JD2A 4ETIA 1IN4A 1JMYA 1VBKA 2OO5C 5EY5B 1ZGAA 2A58A 2P9TA 1J8VA 1YZQA 3D43A 3LH5A 4RL4A 3W1EA 5E6UA 3B8HA 2CB0A 4WK4B 1R27A 2FK3A 1VKZA 3VDMA 3HA2A 1JLKA 3A4IA 3CV3A 1NM5A 1A4UA 3E5RA 1X19A 5EJ2A 1F8FA 3OC0A 3WLNA 3ANLA 1V6SA 4HNQA 5IN5A 1E2QA 4K0KH 4CM7A 1JFLA 1PBTA 5JI2E 3E7PA 3OSUA 4RJKA 1TGYA 1UKAA 4CMCA 2OESA 3GNNA 4A0HA 4CLOA 1P6QA 4UHFA 3SZLA 4LJ7A 5CIYA 3QA9A 2IRWA 5HF9A 2QRKA 2H2DA 1P19A 1N8KA 4WJLA 4N54A 1MFPA 4QBHA 8ADHA 1C7FA 1P9RA 2NVBA 3NOOA 3VJKA 2H6EA 5CHYA 3WRVA 1JPUA 3UWMA 5KVVA 1LFAA 2GAAA 3BSFA 4JHXA 3GIWA 2W6NA 2CFMA 5FLYA 4KPFC 1YRQA 2ZSJA 4RVFA 3LP6A 1Y6ZA 2CDNA 4LZPA 4DJJA 2ASJA 3TECE 4I4TF 2XQVA 4MUIA 2XDQB 1FMAE 3ZR4B 4Y6LA 4BB9A 3QNWA 1NF9A 2QPOA 1L3BA 3VZBA 1SUBA 5D6OA 4D9KA 4P0PB 2RBGA 3E03A 4DRFA 1Y1TA 1Z7YA 3P9YA 2HUNA 4DBLC 1NUUA 2XHEA 2Y71A 3U13A 3ZS8A 3HU1A 1C7JA 1NLYA 5ARDA 1AGXA 2HJGA 3GU3A 1FVOA 4JVSB 1ECJA 2IYWA 4GP6A 2BSQA 4C08A 3MN1A 4HPXB 2WB1A 1IQUA 1LX7A 5JSZA 1QRSA 2Z5GA 4KIUA 3KTMA 1L1EA 1Z4IA 4CEIB 3AVWA 3PDIB 4DUYH 1BROA 3SICE 3R5HA 1JJVA 3Q11A 1AKVA 2M6KA 2J3MA 1NU6A 2ZWAA 1XNQH 4BLRA 2L2QA 3C8UA 2Z9DA 1LFDB 1Y7IA 2BDUA 4OV6B 1SHKA 2RGNC 4CEJA 2PR2A 1JH9A 3R7BA 4WBNF 3AVYA 2OCYC 1T3ZA 2DY0A 2QY6A 4PYKA 5GM2A 1EDZA 3OE5A 1C3JA 1ORRA 3PVSA 3PC8A 4BCBA 1Z12A 4R2LA 5F1YA 5HMLA 3GEMA 2V6IA 1P8AA 1XRPA 5CNIA 1K9VF 1ZKDA 4HG2A 4NARA 2JDIA 1JEJA 4OIFA 4XM1A 2FSUA 5ALOA 1ABEA 3ZBTA 4Q12A 1PEDA 1Z5GA 3OOYA 4C7XA 4GNRA 3AY3A 2QUKA 3RB4A 1D2HA 1MORA 2HQ1A 2YZ2A 2IU0A 1KVSA 4BV3A 3F67A 5LXTA 5G3ZA 1QHHA 4WK2B 1IY9A 2P6NA 2WJ4A 2XZDA 1TKRA 5AJVB 1C81A 1KI6A 4B1FA 4D9CA 3K70B 3VH3A 2GOYA 3CU5A 3AM9A 4KXUA 1KORA 2GJ9A 2YWGA 1QF6A 1U0GA 1XQYA 2E6KA 1BJKA 3OE1A 4LPSA 4F6CA 5K8CA 1ZMTA 2GK3A 1GM5A 3EEQA 4WN3A 3AYHB 3ITKA 4IRDA 3SJUA 2AEEA 4OXIA 3QEAZ 1Q0QA 5ENZA 4WL0A 3RTXA 3A1UA 4IMPA 1T94A 1TIKA 4BXXG 3DJFA 1JDTA 3O82A 4NU5A 2MMGA 4PXAA 4PWZA 4RSRA 4YO8A 3ZU4A 4DB4A 3SNKA 2WP0A 3A32A 5BN4A 1OI7A 5GMOA 1MQ9A 1QG6A 2EJBA 4PM4A 1FX0A 2Q2UA 3E1KA 2GZRA 3ZQJA 4DABA 3PR1A 3FYCA 1M34B 3G68A 1S03G 2XUQA 4QG7A 3SYTA 1M8FA 2E5LB 3H2SA 3J80A 1WW3A 5HR5A 4TTSA 3BL5A 5AHRA 1T3GA 4TQUS 3Q2IA 1JAZA 2MR6A 5EKUA 4IV5A 1UXGA 1UOPA 4Q8EA 2E4WA 2C2YA 1T15A 3OFSA 4K6KA 4AYWA 3PHGA 4URXR 2QTCA 1DQYA 1CF9A 3N41B 2HGWA 3BFXA 4IVQA 2PZKA 3QF7A 2I3GA 2HMWA 3PDHA 2Q3JA 1NYRA 1R5NA 3OZIA 2FHSA 1E3JA 1UKZA 2P41A 4WTOA 1OV6A 2G71A 1Y3CE 3QYFA 4K3UA 1W4RA 4ZC8A 4F2PA 1QFXA 4HDMA 4UPEA 4J9QA 3ELBA 4PV7A 4S3MA 5TNXA 4JUIA 4U2CA 3EUB4 2QOEA 5FB3A 4EHIA 3PFBA 1BKYA 2JBAA 4Y2RA 4UZFA 4B3MB 1U7HA 1TE2A 1Q12A 4YBRA 1KXZA 4O82A 2GILA 3KFVA 5AT1A 4E94A 5BQFA 4MUEA 2EJVA 5T8KC 5JQGA 3W77A 2XUPA 1BQEA 1TVMA 2GKGA 2R2AA 1IHYA 3D5TA 1KOFA 1UF9A 2JJMA 3DL7A 1NKVA 1GUFA 1YC5A 2ZK7A 3EF1A 2AN4A 2NUAA 3JSAA 4P4SA 4D02A 4LF5B 3JYNA 3CN7A 3STXA 2VDMB 2FWNA 4REMA 5KREA 1U90A 4LXUA 3CMAH 1F2UA 1Y7PA 3S27A 4GIBA 3T5AA 2GN0A 5LQNA 1CUWA 3ZUPA 4KO3S 5ILQA 2F1JA 5H1YA 3IH5A 2YN4A 1JB1A 4QX6A 4R6XA 3V55A 3DEHA 3KQHA 3BMOB 4CMDA 4XDGA 4Y6RA 1Z38A 3AVXA 3I73A 1UMDB 1EVJA 4FJ2A 4PYOA 4J9OA 4I3FA 3EG9B 4NTZA 1FNNA 1FFEA 4AKGA 3GQCA 4DV2H 1L0BA 1QGOA 2WJYA 1Q0SA 2VDNB 4G2NA 1V7PC 3EH2A 4QULA 4TRRA 4C6TB 3P9ZA 3VQTA 1YL6A 2RB5A 2F1RA 3NEJA 4QDXA 1EWYA 4O29A 3K9HA 2FPMA 2HJHA 1YGPA 2J5QA 2VKQA 3P9IA 4MUYA 4XX1A 4C2TA 2VDKB 1RK5A 4DUZH 4AD8A 4WKOA 5KFVA 3LBHA 1YJAA 4DLLA 4AZ3B 1NBIA 3BIOA 3HBMA 1U7TA 2QL5A 3V6LA 4C80A 3JCZA 2GJKA 3E7DA 2YTZA 3IRUA 2QHXA 3NHPA 1V48A 3V2UA 3EMDA 3FRHA 3ORHA 1GL6A 4P7FA 1ZRNA 1GXSB 5HFNA 2WSSD 3FWZA 2ATEA 4GG1A 3WBJA 4A8JA 2VUTA 4MGIR 3WRYA 1FJGH 2PA0A 5EE5B 1RACA 1GXSA 3LZ6A 3QA3E 4M87A 4CIWA 3PO3G 5IBRA 2CNQA 1T0BA 2PXXA 2W70A 4PO1A 4F4ZA 1OBFO 4TLLB 2QW8A 4FBTA 1SWVA 3DVAA 4G5YA 521PA 3HP4A 4D9JA 3P20A 4IOAJ 4MTDA 4EYQA 2Q3FA 2EJCA 2GNAA 2A4KA 2Q5HA 4A3KG 1UJCA 4N82A 1VQPH 3O75A 2QX7A 3HBLA 5L3VA 4OGFA 4WN9B 2XZPA 5JNLA 2RJNA 2IHJA 2W11A 3KPWA 1I3QA 3DQPA 1Y37A 3UXHA 3F7NA 3PT5A 4Z4HA 1CQIB 2XNSA 4E2ZA 1CUJA 1G20A 4LHYA 1MEEA 1U9IA 2RDIA 4M1YA 4YGXB 5ERYA 5DM6J 4D0GA 1CQIA 4BXOB 5AN9F 1M2HA 4MB0A 1WE2A 4KODA 1VHLA 2WYUA 2RC6A 3QEOA 4MITA 2AT1A 1C3EA 5LLDA 2Q0QA 3E9NA 2P4EA 3HJAA 5K6TA 1W2WB 1X8KA 1L5KA 3FF1A 2X8LA 4JL5A 5J43A 1X1CA 1ZHSA 1Y42X 2YL2A 2AW3A 2VHQA 1CRPA 1LW7A 1PJRA 3TOCA 4B3IA 3IAS6 2BMDA 2GSWA 2AXQA 4YRIA 1YA8A 2H2IA 3KZMA 9LDTA 5FV4A 1NURA 3C4JA 4R68A 2K7ZA 3IEXA 3IUJA 1GO3E 5I51A 1ZUWA 3EXG2 2D5CA 5D01A 2LBPA 5FP0A 5TEWA 1GAQA 1JGTA 1M0SA 2O3QA 5CFZA 3DKVA 1W581 3VR0A 3BK1A 5FKJA 1ADFA 1HYQA 4G1BA 4X54A 4GWKA 5DGXA 4RTLA 4ZOAA 3TK1A 1P2UA 3WGUA 4HRXA 4O4LF 2GR9A 1ETHA 5LP1A 3M3PA 3DVSX 4IOMA 3VU8A 4XQCA 3C16C 3MGKA 3QK7A 1DQSA 3UXMA 1QTQA 4J1SA 5A6SB 1PDVA 1D0SA 1PLKA 5KAMA 5DI9A 3LOUA 5CX1A 4K5QA 4UEKA 3THXB 1A3GA 1AHNA 3NV7A 1N48A 3IFSA 4GLJA 3EJWA 3O2QB 2ZUVA 2Z1MA 1GA6A 3KKLA 4CCYA 2O8DA 4I66A 2V7VA 1SZCA 3E18A 2FZGA 3RRNA 4WOCA 3HB5X 3HCPA 4P58A 4BO0A 4XPIB 2PL1A 1AO3A 3OCXA 4ZVTA 3H2KA 3S81A 4TL7A 5I7AA 4D8UA 5CB8A 1JXAA 3FJ1A 4MR7B 1O0CA 5IWAH 5KG6A 2WKQA 2XY4A 5HS4A 1OZHA 4V0QA 3KAPA 3ZX5A 4B33A 1KQPA 2ZIZA 5HF6A 1YULA 1EA7A 2NO4A 2RHLA 3NIGB 1E18A 4L51A 1KE2A 2Q1YA 2WJ6A 1YK1A 3FJYA 3H97A 2WWVD 3RREA 5D1NA 4Z4EA 5AM4A 3BGWA 3FB1A 3LXXA 1O0SA 2C5FA 1DIBA 3KJEA 4BVJA 1OIXA 1SM4A 4YDHB 5B58T 4O0LA 1NN1A 2R47A 3IAAA 5KNBD 3Q7IA 2GN9A 5EIHA 1RFLA 1B1CA 4N6NA 4MYRA 3W8EA 1KL7A 1FSFA 4JP2A 3TSOA 2YWHA 2ZJ7A 3BRCA 1ISHA 3RYIA 3E2MA 3TLJA 1CQZA 1PJBA 3HNOA 2VA2A 1AS3A 2ZS7A 5KTMA 3KETA 1ZNXA 4D8VA 3WYGA 1P3DA 4F4FA 3I9V6 3M4XA 1JTFA 4FZRA 2E89A 3ZI7A 1DKNA 1FUIA 1IBCA 1G9SA 1MNQA 3JQ9C 5DBHX 3Q2OA 4MQUA 4LGYA 1H6CA 1EB9A 1LPOA 2YJGA 4P0TA 3CRQA 1S1CA 1IM5A 3D7SA 3VH1A 3H9UA 4UJ3A 3FTFA 2V98A 2VZ8A 5LYYA 3PITA 4GVLA 1SVIA 4BNZA 1JYSA 5F64A 2AEFA 4Q6BA 1U0NA 2X9LA 3MS4A 4JZKA 4EG3A 3MQ4A 2IYSA 3RC9A 2OGTA 1HE3A 4NIMA 2CMKA 4DA0A 4Q7MB 4PYRA 1GFSA 3IDAA 5DK6A 3TRFA 1E6CA 1GV0A 1KK0A 2EL7A 1PL7A 4BECA 3GEDA 3SG0A 1KYQA 4EMTA 1T4MA 2BCEA 3P0FA 1PZMA 4LDPA 4GPIB 4OATA 1KZ6A 2PRZA 5GGXA 5EUQB 3LY5A 3S2UA 3WJAA 4DRYA 2ZJ3A 3E27A 3JU3A 2PEZA 3ZU5A 1G5RA 3N39C 4U2EA 2A9OA 3BWCA 5ITWA 1W4ZA 5C8ZA 1MT3A 4BQPA 5CBKA 3SQWA 3W2HA 1FO4A 4DV7H 1VKJA 2UVPA 1XZPA 1DO2A 4YRZA 2JA8G 1IL0A 2G80A 2X9VA 3NJRA 3PNMA 2NVXA 4GGMX 2C5BA 1R15A 1OAKA 2WHPB 4OHKA 4JY7A 2ZG6A 4GBED 2XNHA 5K0JA 4B6SA 3H40A 1UPBA 3ICWA 1CUHA 4FTWA 4L0DA 4B74A 4CMEA 5JS8A 3L7YA 1UP7A 4LFBB 4LTMA 2DWOA 2IYTA 1BYUA 1E1QD 1XRNA 2WAYA 3OF2A 2G04A 3GK3A 4N3GA 4QPJC 5A1JA 4N0PA 2QIOA 3DNFA 2P35A 1U0JA 3TVTA 3VDQA 1JR3A 2K7FA 2G6TA 3CUUA 1ONBA 4JXKA 4HLCA 5KFWA 2LCIA 1H2WA 5ALYA 4ZVVA 1HRKA 1ODFA 5GZ1A 3ILYA 5JRJA 5K0ZA 1BHJA 1Q5PA 4NLLA 4ENRA 4OL0A 1CY7A 3WWDA 5A7GA 4R1QA 1L8QA 1VLMA 2EC5A 2FWMX 4LI3X 4MQEB 5EXXA 4LF7B 1YTLA 1JPJA 2ZQZA 3BE6A 2ZTVA 1LBEA 4K6CA 3SM3A 2OOKA 3ABQB 1NI4B 2JASA 3PG5A 3UAWA 4EG6A 3DGEC 1Y0BA 1P2GA 2P2NA 5A5DA 1H05A 1F0KA 1D3AA 1R5BA 3FDIA 1FEZA 1KHHA 3Q5DA 2PT7A 3FETA 4UUBA 3R8CA 3WHLA 1EE2A 3PQ8A 2GTIA 1OWNA 1T2DA 1CSEE 1O58A 3L6RA 3OQOA 3LS2A 4XJSA 3GFVA 3L0GA 1ISJA 1YR8A 3CCSH 1SQGA 3Q6NA 4ZZ3A 3DZ8A 4GKJB 2MYNA 4ZYUA 4TMFA 2GESA 1MU0A 3MS2A 2QLFA 3M4NA 5FUVA 3CF5J 4ME6A 4TTQA 1FTGA 1R7RA 4WFNJ 3O7MA 4PG6A 5IT5A 2FW1A 4D9HA 3OX3A 2ORVA 4OHCA 5TY0A 5KG2A 1SHUX 1WH2A 2C42A 2C94A 2HK9A 2Y1XA 3RC7A 3BEDA 5JQWA 1OMOA 1ORTA 3PR4A 2L17A 2VPSA 4OQEA 4RHFA 1VRCA 3VC7A 5JR3A 5JZOA 3G8BA 4KMMA 2Q4BA 3AWDA 4DR1B 3OPNA 1M6EX 1BU8A 1RRKA 1R64A 1A1SA 4DLXA 3A70A 3OUTA 3WLMA 2QUZA 1U8CB 4FBGA 3TQIA 4AJIA 4C06A 3T61A 4Y2SA 5T14A 5I7RA 1YKFA 4EAQA 1OB5A 1P2BA 2HMUA 4EG7A 3N2EA 3R40A 5TQ2B 3O73A 2NSYA 3QU7A 2IKSA 3BFKA 1WX1A 4IIEA 4W5WA 4EZBA 1IHOA 2RKBA 4OI1A 2R25B 1CC1S 4TYYA 1UBNA 4DCPA 3T4EA 2XZLA 4J9VA 1W85B 3S1LA 1M2WA 5LNK6 2Z6VA 3JQFC 4RKYA 4BX3A 5B2FA 3MT7A 2R0QC 3DLCA 2ISQA 2QRVA 2JEJA 2EARA 3D9QX 4B2YA 2YZNA 2FR8A 1EK6A 1VPDA 4I50B 2C7RA 1BDHA 2E0IA 4KAFA 4N7JA 1P7PA 3TNDA 4MI1A 5U9CA 3EEBA 1GSHA 1LLFA 1MABB 3CT4A 4UUPA 2OQ2A 4RVOA 3WY9A 4DUGA 4EYEA 1X7WA 1LDYA 3BXPA 1NWCA 5DQHA 3OIDA 3T5MA 4PSAA 3QLUC 4TYQA 3P2EA 4MS1B 2QI9C 1T8RA 3H4TA 3PW7A 3LDUA 5IVKA 1Q77A 4DA8A 1KRXA 4OU5A 4KXQA 2IHTA 1Y8AA 3FPAA 4QM6A 2V7PA 3PYMA 3CLHA 4MB6A 3FTCA 4QXRA 4Z1MA 5JHGB 2NN3C 4C4XA 1Q2UA 4BO2A 1SVSA 4BGIA 4TLMB 3HXOA 4KO1S 2BD0A 4DLVA 1WXFA 3E7XA 1F6DA 4O2AB 4B6GA 3CLVA 2W3RB 3QXHA 5F5NA 1VJTA 2C0PA 1BDBA 1VDZA 2QTTA 4H2DA 2YZGA 1KKLA 4NSNA 3DBRA 3WDSA 3L7MA 4O2AA 1NMZA 3MR5A 2YMPA 1QGED 3KHGA 2I6FA 1RXWA 3SR6C 3OT5A 3OE7A 4IDBA 2QDKA 4ZARA 3TW0A 3NT2A 5E2AA 1JP7A 5F1PA 2JIMA 4MUAA 3QGMA 4I1UA 3GMIA 5C1OA 1HURA 1EB8A 1RAHA 1DMSA 2DBYA 3C8HA 4R83A 3N0RA 4YRBA 1VIYA 3DE0X 2HSJA 5FBVB 1ZI9A 1M6NA 2R7ZG 2HQRA 2CXQA 1ISPA 1OA1A 1FSPA 2HRDA 2FZVA 4FGSA 4PG7A 3RIGA 2XNCA 3H19A 1AXRA 2E21A 2WJIA 3L7CA 1ZM4A 1YNOA 3DT8A 3SSOA 2FZEA 3C3JA 4PPNA 1S8AA 1H1LB 2DH6A 3ZY6A 2WHYA 5B1HA 4BFSA 3OLYA 4I2VA 1SXIA 2P2DA 1G38A 3HLTA 4WLVA 5AM5A 3AX6A 1ZSNA 2R1VB 3EB9A 1ZZGA 1C3OB 2Y0PA 1T8UA 5AUQA 4AJKA 1QVVA 1SKQA 1WG8A 3F8NA 4MWOA 5HUHA 4KHPB 3V6MA 3LYUA 4YAOA 1JHZA 3PXCX 4OI4A 5C46F 2OORC 2HBZA 1NBMA 4F9EA 4TGLA 3WWIA 2JIPA 5K0GA 3ESBA 4BNTA 2ZB2A 2W2KA 4HQOA 4BJ6A 2OTJH 2UZ4A 4RVCA 1YS4A 3LPDA 4BMPB 2Z57A 4NECA 2QN7A 3QQMA 2JEFA 4HWGA 1P7YA 4N0MA 1OCEA 5FTKA 3IQGX 3KUDA 5SY4A 4UM8B 2RK3A 3KEFA 1W88B 3KC2A 1NPYA 3IT2A 2G28A 4FDLA 4G4GA 4JA0A 1R9JA 4KNVA 3LFTA 4UHHA 2I1VB 3C3YA 4I6JA 5DOVA 3GDWA 4FFBA 5F33A 4ZJYA 3NYRA 2VPYA 4H0CA 4B5KA 4YMUA 2QPAA 1X14A 5KDDA 3ZDFA 2FW0A 1FNMA 4HXGA 3ANYB 4D4GA 4XWTA 2ASVA 4DMKA 4GM1A 2PZ8A 5JJKA 2ZAYA 3RHZA 3CF4G 4JWTA 4EEKA 2ZSAA 5IC4A 2RHGB 5K0FA 2QSZA 4TTTS 2V59A 2YZKA 1OJ7A 3JW8A 1AZSC 2VA9A 4G5QA 1XQWA 2Q5JA 3QEMB 3TLGA 2BOVA 1YE3A 1AC5A 2AQIA 2XDQA 3HEBA 3MOSA 1ZL2A 1NPTO 5REQB 1NW6A 1PLLA 5ALDA 4O84A 2IYEA 1UBMS 5AJZA 2O52A 3ELYA 4OHRA 5CH8A 2Z8XA 4EHKA 3QHAA 4WKBA 1DUVG 4EENA 4R1NA 3IOCA 4WK6A 1SEIA 3F5MA 2DLNA 5GM1A 3SI8A 4RE5A 3E5HA 2NO1A 4IDCA 3P27A 1TOAA 5FLMG 4X85A 1XDSA 3GRAA 2XBMA 2ID7A 4CDMA 2OD9A 4ARVA 2R7NA 1HH4A 1WR8A 2I33A 3TLAA 3B6JA 3WGGA 1JSLA 3QSYA 2VWHA 3M6IA 5TPZA 1JA9A 2XODA 2OV1A 2C20A 3AEKA 3DXYA 2HWYA 3SDZA 3ZI4A 1KNXA 3ZWPA 4AIIA 1YTUA 3W6UA 1YJ9H 4EFKA 2H2HA 5IUKC 2X77A 3DWIA 4FIDA 4EGAA 3MGCA 4RMHA 4Z0NA 2Z58A 1FM0E 4Y3UA 2R87A 3A05A 1NSFA 3F6EX 4LQLA 3QVGA 3C8ZA 4DT1B 1KO5A 2QLJA 2QTAA 3DBHB 3FFAA 4WBSA 3SM9A 5C1BA 1JHPA 2X2OA 3ZHYA 5G4KB 4JT4A 5KFPA 5KYYA 3MERA 3FTQA 1W36B 1NXQA 4YJ3A 5BMVB 2GTHA 4B7ZA 1H2ZA 2H06A 2E87A 2VPQA 2JARA 4RWZA 2VJCA 5AOBA 5HS6A 5IDYA 4CKCB 4II7A 1W35A 2OG2A 4MW2A 1RYRA 2OV2A 3ASUA 3KK0A 3OO0A 4ND8A 4J9SA 3CLRD 2FK7A 3QOFA 1I5EA 4KP7A 4JLWA 3FYTA 3MF4A 4NULA 4ECWA 4KIWA 3RYHA 4GC9A 1RNLA 4LZNA 4JODA 2W57A 2G82A 3AJRA 3L1KA 1ZC3A 4GI2A 4UPVA 5EGSA 3ZY4A 4LJYA 3FBTA 1IYDA 1NC3A 1SN7A 2CD9A 1MGPA 2FHPA 2GEDA 2ZSHA 3NDRA 1GKYA 3IA2A 1TT5A 4FFPA 4Q4JB 4P33A 4N12A 1A9TA 3MHPA 1JJ2H 3QBJA 2JLSA 5BMVA 1DJLA 4PWQA 3H04A 2R68A 4WOJA 5A05A 5ALGA 1TYZA 4LG1A 5IT0A 4NCIA 3ZWWA 2EQBA 3C6ZA 4GQBA 5TMEA 3UQZA 5I48A 2X8AA 3U4DA 2HA6A 4WXPA 1XALA 4XWYA 5KFUA 4F91B 4ECQA 1N92A 1CY2A 1XP8A 4Q4AA 1L4FA 1SOWA 4V39A 4H31A 1PK9A 5EWLB 1FP6A 2VOJA 4X8MA 3TKAA 4B35A 3WKEA 5CLQA 3Q1KA 5DTRA 3HY6A 3AIMA 5EL0A 4ODIA 3H5RA 1ZCZA 2OHJA 1IXRC 1DOHA 1VHWA 2TECE 2PRSA 3H17A 5CFNA 4LYEA 4DR2B 4W5TA 1OILA 2H2AA 3DE1X 1C9DB 5ENVA 3RSZA 4GOLD 5AKIA 4P0QB 1UBGA 5LMCA 3DJYA 1DWUA 3W1WA 1UOEA 1YZTA 2IHYA 4WHXA 1BXZA 3MCAA 4L72A 4UTOA 1MFZA 4X3OA 3WHIA 1D1SA 5J2TF 2O6LA 2O5VA 3FOBA 3ZCXA 1J2YA 4DIUA 5AK0A 1QIEA 3RU2A 3W05A 4EGSA 2F9FA 1K9MJ 1OGIA 3QEJA 4X1KA 1YDWA 2NZUG 4B31A 3GLIE 3W5AA 3CH4B 1WEKA 5A4AA 4CUJA 3MTQA 2W22A 3VC3A 3GJXB 1TZBA 4MV7A 2X3UA 5BV1A 1OXBB 4O7WA 1JIUA 1K68A 1FYFA 1VYTA 3CRRA 2PJUA 4J1TC 5CGQB 3WZLA 1QVFH 4D3FA 2B2CA 1X1TA 4G37A 4HVAA 4J0JA 3TAUA 1U1IA 2ZSKA 5FI3A 3USES 2BDEA 4JOCA 4PC2A 2O7SA 4R1MA 5TGDA 5EKDA 2WY2D 3SEAA 2DPGA 5J4YA 2GI4A 1NOJA 2FOXA 3NBMA 1RQ7A 2G36A 2ZPAA 3EF3A 3UYKA 2G76A 5HZKA 4IHJF 3C6MA 4XRRA 2OMDA 4S12A 1ZUNB 4UHEA 4PSVA 3LC2O 1FZQA 1QKJA 3BMOA 1LI4A 4YJGB 2B7QA 4LDQA 1N5LA 1FMFA 4MIKA 3G0HA 3GP5A 2A9QA 1MP0A 2NPOA 1VE3A 2E4YA 4BY9E 3TQCA 1DHTA 4ZVUA 1TTTA 3EAQA 4KR7A 3AKDA 1TW2A 4KL8S 2YY7A 1E60A 1OJLA 1RVV1 2ACKA 2DIKA 2BKXA 2N42A 2F64A 3F3KA 3HL0A 4LQ4A 4OGLA 2PRJA 2NTNA 4PBSA 1WHTA 4TWJA 3U48A 4TXJA 3A11A 3ZHZA 3ADOA 2OHFA 2EBUA 3HOWG 3JQBC 3T3PB 4ZK2A 2F9MA 1YTKA 1MJHA 4ECEA 3KQYA 1A5ZA 2W8KA 4AQDA 4P34A 4ZT6A 3NTXA 3VBCA 3LPLA 3ETDA 4O3FA 4EY5A 5B3LA 5C18A 3M0EA 4E3WA 5AXCA 3W6ZA 1CHDA 1WCYA 4XH9B 5C8VA 4V1CA 2WAXA 1PJQA 2XYVA 4CM8A 3RTEA 1RYMA 4HQNA 4TUYA 4XCXA 4CKBB 1K3TA 4LEIA 4CM8B 3BXXA 3IIMA 3WAJA 1EH5A 1GILA 3BMXA 3FZEA 4ZEVA 2WWGA 1BFDA 1VHDA 2JD1A 5C51B 1KWGA 2C8JA 5ERGB 1LUAA 3A3KA 2WE8A 5KOHA 1ODIA 3HO8A 2COEA 2CHGA 2VVTA 1NMEA 3C7AA 3WR5A 3A4MA 4IXTA 2IXGA 2W5UA 1N8TA 3LCRA 5B1DA 5IWAB 1MX1A 3O8QB 3JASA 5BSHA 1K3UB 2A1HA 5IFKA 2FWRA 2QLNA 4D8YA 1XRLA 2GQSA 4E32A 4DA7A 3EA4A 3WG9A 3A6KA 2X19A 3SLGA 3CRVA 4YLEA 4YY3H 1BCRB 2EVWX 2W9BA 2E1RA 1D0IA 2Z5FA 3EW7A 2W6ZA 4FYHA 1PHRA 2M1ZA 1M6VA 4XVQA 1DLJA 1JNXX 4IIHA 1LDMA 1K75A 3B2QA 1RM0A 1VQKH 3HKDA 2WTUA 1L5YA 2PGJA 2WKRA 3IHTA 1F4PA 3EVEA 4LFCB 2PH5A 2XC9A 5DAAA 3HKDB 4E14A 2R62A 2XYGA 3BRSA 5A7HA 2X7HA 1OW3B 2AQ8A 4J0GA 1HLFA 4RELA 3RWMB 1KS2A 2DRIA 1YJWH 3IT3A 2B9EA 4CM6A 2AKYA 3GLGE 4RPJA 3CTMA 3O7WA 4P4UA 3BGOS 3Q41A 4ZALA 1G8YA 3E0QA 4OGGA 3RVQA 4JI0H 2G67A 1DJQA 2P5TB 4A93G 3DM9B 2GBLC 4ZVPA 1YJBA 3PI6A 4B75A 3T5DA 2ZR7A 1OR8A 1MNAA 5TPWA 1QCCA 1QHSA 3LC0A 3QVJA 3B3GA 1C8LA 1EAMA 1I5RA 4F92B 3CH5A 3LGAA 4AZ3A 1OXVA 3CPWH 1HFEL 2GARA 1LPBB 2O1WA 2ZEJA 4NBSA 4R0VA 3SMVA 3C6QA 3N58A 4AS3A 3TKYA 2FWPA 1VGQA 2HLHA 4OSOA 3WB0A 3L5KA 2NVUA 1KTAA 2C3UA 3JZMA 1Z29A 2BGNA 3HOXG 5I47A 1V47A 2FEKA 1JDJA 2KBEA 1FFXB 2L19A 4GDMA 4IEIA 4JEUA 5FD6A 4L6IA 4B0PA 5JIBA 1ZGZA 1KJQA 3DFZA 4TWBA 4B3RH 4X5OA 2O8NA 3Q7SA 4QTTB 5EQJB 5EWJB 3OOSA 5T6MA 1AF7A 4P86A 2AWNA 3VMMA 3DVRX 4ZEWA 5FUXA 1VAJA 1SBHA 2Y77A 1ODJA 3L40A 3PGMA 1XA3A 4WY8A 2Q9BA 1RC0A 3GLVA 1DAFA 4AX8A 5KFMA 3Q85A 1R6UA 5JADA 4HT3B 2IEIA 4G4JA 2C4VA 2VJMA 3P0EA 2JA5A 1SU4A 2GJ8A 2OE2A 4X91A 3K9QO 3W4IA 4E07A 1U2GA 1QO7A 3TZEA 4JT8A 1ZXXA 3GD7A 3KB6A 2Q3HA 4KSBA 2CLFB 1G5IA 4UMDA 3KLBA 1Z7GA 2FRXA 1CUAA 4IEEA 4WZ6A 5MFPA 3NS1C 3D81A 4RKFA 3KHRA 1QH1A 2GAIA 1D7AA 1UDCA 2Q1XA 4MJ7A 5D3ZA 1RWQA 1U1FA 2FG5A 4RY9A 4LFAB 2BEWA 5CK5A 1NI5A 3GARA 2OWEA 3JRXA 3IYLW 4MS4A 2CXHA 4F85A 3NEYA 4E5MA 4MRNA 6AT1A 3VSBA 3VDXA 2PKYX 2FMHA 5AJUA 3LWDA 2JGJA 3UHOA 2XIGA 1GZHB 2PXHA 1VMIA 1TCCA 1FTNA 3G13A 4JLPA 1EQAA 5FA5A 1Q86J 2OK7A 2WM2A 1WLSA 4I2NA 3RS2A 1XZIA 1Z39A 4Y2VA 2PHZA 4QT0A 3C97A 2D06A 1I9GA 5CH3A 4CODB 5J3JA 5LP6F 1CLUA 1KVQA 4NC9A 4B8ZA 5K0SA 2R82A 4G3IA 1FXWF 1I80A 4GAEA 1HZZA 4P82A 3IV9A 1NY5A 1SBTA 3FHOA 3LUHA 1Z16A 2QSJA 1RMQA 2KE5A 2AN5A 2O3JA 5F9MA 1BX1A 1XVLA 3K0AA 3G1TA 1MHPA 3UK1A 2NYRA 4UNPA 4TLDA 4XA8A 3U3ZA 3CPEA 2UYCA 4FLMA 3ZWCA 3KKPA 5JH7B 1SXGA 4YECA 3NFRA 4UOZA 2J9ZB 2VOBA 2ZAOA 3NUZA 3PX3A 3HYNA 4LBVA 3QWBA 1WCXA 4BLWA 2NU8A 1AKYA 4ECAA 1KY3A 1X1DA 4PN3A 2C5LA 2PV7A 2WSSA 2WA1A 4AKEA 1ONNA 2CHQA 1B6GA 3MLEA 2ZBQA 4G8DA 4JELA 4FEGA 4LCBA 1Z6XA 4ZOLB 5JVDB 1EFRD 4BBAA 3UEOA 2PGOA 3NGXA 2OTLH 2XECA 2A6PA 3I9KA 5AQEA 4G36A 3WJ7A 3IBFA 4TMYA 5C3EG 5FLEX 5JW6A 4XWAA 2QZZA 1VSVA 1QANA 2VPZA 2ODPA 3DDHA 2E82A 2GHTA 4FMDF 4OMFG 2GBCA 1Z47A 1VLVA 2AE1A 3KOWA 4K6OA 4M46A 4URYR 5P8WA 3RU3A 4OHVA 4YCNA 4BU1A 1YIDA 4RM2A 1E66A 1DKOA 1JI3A 1FL9A 1PUJA 1ULUA 4HUQB 3ULKA 4G24A 4I50F 2AVDA 5F2OA 3IAS1 1AS0A 2H4FA 1USUA 2CXRA 3FFWA 4X84A 4DB2A 2GA9A 2PT6A 2VFAA 3K72B 3COVA 2AS0A 3AF1A 3AY7A 2J3QA 3UHJA 2ZDHA 5JMPA 1HM5A 1QHGA 3SXJA 2HH9A 5KI6A 4CL0A 2YBEA 5F7OA 2E9SA 4KPGA 3RPFA 1V1RA 1VLLA 2REOA 3A31A 3RRZA 1MX3A 1XTSA 3HB1A 5E1DA 2EFYA 5A9RA 3E3AA 3GV5B 4MA0A 5IYBG 4X20A 1OBCA 3QPWA 4DMMA 5LDDC 2WKPA 4G0UA 1V25A 1V4BA 4RS4A 3TRJA 3LOPA 4J94A 4BVEA 3VZCA 5LQKA 1VSUA 1CUBA 5H1SO 1Z34A 2I0FA 5KAPA 3OKAA 4Y7CA 2J33A 1VECA 2V8OA 3KG2A 2Q29A 3LPCA 1QF7A 4C0JA 1HTWA 3PUIA 3L0OA 1CKNA 1F51E 1NU8A 1X2EA 1QOQB 2W42A 1QZTA 3NKLA 2XB2A 1IK4A 2RGDA 2MSDB 5LNK1 3ZHTA 1S9FA 3GN1A 1NE7A 4RWEA 1OLUB 2QQGA 2EKDA 4J9KA 2AX4A 4INOA 1Q92A 2NOAA 3H8SA 3UWSA 1KSFX 2AF3C 2WWWA 3ZVLA 2H7XA 2C9CA 3H5IA 1OLUA 1C0LA 5C2JB 1Z2PX 2WM3A 5KNDD 4LSMA 2PLFA 4D46A 1R0RE 4LYAA 4GA6A 4WV3A 1DJPA 3OTIA 5FLKA 3COJA 1AB5A 2I2XB 4UAUA 1I6WA 1I3NA 4B3MH 1ZD1A 3AUUA 1JKIA 2WWHA 3LOQA 4QUIA 1RRPA 5IDXA 2AI2A 1XYGA 3TUZC 3K1ZA 1E9VA 1TXGA 1V43A 3NNNA 3P4XA 4KGXA 3ZXXA 4GA4A 2HJRA 1GCIA 2YFQA 1E2PA 3I1JA 4RKQA 4RJJA 5F9FA 3ICOA 4B2PA 3JQ8A 1DXQA 2V4ZA 2RAUA 4IHKA 4WNYA 3HUUA 3G0OA 2V54A 2FPWA 4FNMA 4RABA 1PU2A 3H3FA 3C6KA 4J0KA 4D9MA 1YL7A 3HPRA 2JVIA 3GT7A 3L0CA 3UWPA 1YCDA 4BPRA 1IOVA 4BQEA 4XTRA 2H16A 1NY6A 3GVCA 1PV1A 1RWVA 5E95A 2VP2A 3DTYA 1TRKA 4OBEA 2YMLA 5FV7A 1CBUA 4G8CA 2DY1A 3RRBA 3RB3A 4IR9A 4O3MA 1QRRA 4UVIA 2LNDA 2P6MA 1R88A 2VQ6A 3FD8A 4JLVA 1HE1C 4D9FA 4BPBA 4DCVA 1UWKA 2H48A 5IXJA 5JCOC 1Q0LA 4QD3A 4MHTA 2Q4TA 3GRKA 1S97A 3K8YA 5B3JA 1GITA 4U9UA 1M2JA 3B20A 2B7BA 1WO8A 4M1TA 3R7DA 4Y18A 1L2TA 1YU9A 5IVDA 2AG8A 4RNMA 1CJCA 4YJHB 3GAFA 4CF5A 3ZHUA 3AM1A 1FF9A 1T2VA 3TZHA 2VATA 2OFOA 3H6HA 4JCOA 2HI0A 3N0VA 4FBLA 2VSNA 4BU0A 4DQ0A 4DV2B 3E9CA 2DPXA 4X60A 2ZSEA 5EMKA 1WTAA 3INNA 1MC4A 4MTEA 3M5WA 1KR2A 1QS0B 3NGLA 3R6GA 4FYMA 4NAVA 4RVHA 4WKPA 2BW0A 2JAQA 3GC6A 1PAUA 4F8EA 3LUJA 4MAAA 4C0BA 3ENVA 4H15A 1MD9A 3LBAA 4LGCA 4OXKA 5B6PA 3GIDA 2OENG 2OKGA 2OAQ1 1V2HE 4D56A 4R2MA 2PFSA 3BN3A 5FLXW 3KKOA 2WWIA 3O21A 2XKJE 4RYDA 5JAQA 4UTPA 3PQ2A 3DEAA 5BSRA 2FRDC 3DLLJ 4LDAA 5TPZD 5HOEA 1P0IA 4RZ3A 2JH9A 3ETLA 4L07A 4BMDA 2IZZA 3V1MA 4QSHA 1DAMA 5BWLA 1NQXA 1UJ2A 2JJ1A 2PX5A 4OBXA 4FDTA 3SBOA 2HRQA 4CHGA 5C5IA 1FP1D 5DGBA 1G20E 3Q98A 8AT1A 4NBUA 3D4BA 2ZJRJ 5TQ0A 4QUJA 1SG0A 1J0BA 3RGXA 2VP0A 1QYWA 2IZ0A 2R8BA 3DBRB 4Q4HB 1YAJA 4RENA 4LMPA 1HF3A 3MA0A 4Q9HA 1LX6A 4CT0A 4E2FA 3RGZA 3VO2A 3U4CA 2GGSA 5K0NA 1PR0A 1JDUA 1MB2A 2EWMA 4GF5A 2RH5A 5K03A 1C9MA 4D25A 2O8BA 2F55A 2DCMA 1UBEA 1PR4A 1XEWX 2IWHA 2Z1DA 4QGAA 5JISA 5FPQA 4K0KB 1W85A 2F8LA 4LRYA 1T3HA 2D7CA 4BLUA 1T4CA 3FRIA 4MKFA 4O33A 2OXTA 1KQNA 3JQGA 4N7MA 4MYUA 4Y0VA 4HR7A 3ZEAA 3ZHVA 1T4CB 1T3NA 1A4XA 3GLRA 4OLHA 4ZQCB 2AR0A 2X58A 5JWHA 5DX0A 4EY3A 2XTAA 4KN9S 1QZXA 3SEQA 4AY5A 2OD2A 3KSDO 2OM6A 3EPJA 1EWTA 3PF9A 2ZB3A 4UAVA 1IDOA 2HNKA 5K3EA 1VQ5H 1SZPA 3IAEA 3L7BA 4M7RA 1H6BA 1AZTA 3NYIA 4UNQA 4ZYVA 1EGVB 1UANA 4KVAA 1ORVA 5CDGA 2Z5VA 3U3KA 4BMOB 1BWRA 5AKKA 2B8JA 4BEBA 1GFWA 4FWBA 3EIFA 3N0WA 2IX9A 2C5AA 1P5RA 2LVBA 3ACDA 3AK4A 1Z5PA 4HTAA 3UICA 4CKWB 3R3XA 4NL4H 2FJUA 4JYPA 1DV1A 1VB3A 2CLMB 4NBVA 1FFAA 3UKOA 3BB3A 1ULSA 1PHPA 1VI6A 1BC5A 1E89A 2AN3A 2Q3MA 2TMYA 1RI3A 2UZAA 3AW9A 2I4IA 2Q41A 3DT9A 1ZESA 4KZPA 1AN9A 4KK4A 4B4OA 4TKUA 4ZYTA 3G6YA 1QG2A 1QRDA 3OVMA 2B98A 4PZDA 1ZX1A 2ZM6H 2PLWA 1ESCA 2WUWE 1WVIA 3LNCA 3A4TA 3WGJA 5ADUS 2RHRA 3WNQA 1JFFA 1I6MA 1JIIA 2PX2A 3TQ1A 3IC5A 4MV5A 2D8MA 2OHGA 2CXTA 4FU0A 4RY0A 3G6XA 3AEQB 2XMBA 4CR8A 4PC6A 1EU1A 4JXXA 4Q4CA 3RS9A 4DRXB 1J8YF 3S2EA 4URFA 2BISA 2I8LA 1VG0B 3DLIA 3IP9A 3MQ2A 3OLXA 4GX5A 4MVJH 3WWPA 1DBIA 1LC0A 1MVLA 2VK4A 2VSQA 3V6KA 2WD9A 3IB3A 4ER6A 3P1JA 1EDOA 3W78A 3EIHA 1RABA 3UB2A 3ZE2B 5DBIA 1TF2A 5BN3A 3R41A 4GEGA 3H2GA 4IUYA 4F71A 5IDWA 2AQHA 5K8UA 3GJSA 2C7PA 1Z7WA 2VK2A 2EF1A 4QIWE 2O3UA 4OM8A 5EFOA 1K63A 3TNLA 2AI3A 1WDWB 2HIMA 3UHPA 1Y48E 5KJCA 2AMLA 2CZGA 5HHTA 3ICEA 1BXGB 3AJEA 4YRMA 1JR3D 1Y1SA 4E03A 5E6RA 2BJVA 5DHQA 4EX6A 1U7ZA 3G2QA 4PZ9A 1LPAB 2WUDA 1NJ6A 1EKFA 2JJ1D 3UH1A 2OAEA 3PPXA 4Q47A 3CVUA 4TVSA 1YZFA 3TNJA 2IYNA 3EASA 4FQ7A 1XJ5A 2GUGA 3M81A 2C35B 4XJTA 1Y9EA 1KVTA 3VH4A 2IODA 1PSDA 3FGOA 2O4CA 4NJMB 1E9CA 1SFRA 3EFOB 1DELA 3PDCA 3ZV7A 4RK1A 4X62B 3WGIA 3DE7X 5CJPA 1RP1A 3A1CA 4J7UA 1N2EA 1RJGA 1L4EA 5LC1A 1NMXA 1V2GA 1L5SA 2RHBA 2Q62A 2GYYA 2HSGA 3FPEA 2A5DA 5DF1A 3W9BA 2XXAB 4IRMA 3ROFA 4C7OA 3GY0A 4XWWA 1AZYA 1VSBA 4PVCA 4IILA 4JJ6A 2AR7A 2FEMA 3I1IA 3GFPA 4NJEA 1CU1A 2ZQYA 4FOPA 3ZXYA 4RD3A 5DRTA 4AF7A 4UTZA 3PHCA 3BF8A 5L9XA 1FDRA 2AMFA 5K4AA 5IAAA 1UAAA 3VSDA 3UJ9A 5JUWA 2FSVC 5FPPA 3DE6X 2BR0A 4BDSA 3GDEA 5JV5A 4BEJA 4HTFA 3PNLA 4MYDA 3WI7A 3G8YA 3WA6A 4YHHH 1A8UA 1L7MA 4MICA 1NQUA 3QX9A 3CZPA 4UEOA 2FEOA 3GJ5A 3RBZA 3V4VB 3RTGA 5KQPA 3FHTA 3CF2A 2ODQA 4Z3OA 2QLMA 1FKAH 5DTQA 4BMNA 1JHRA 1O54A 1ZWKA 3CN9A 4Q5IA 1XCLA 4A03A 1A9SA 3V5NA 4GI7A 3N6XA 1N9ZA 2UUOA 1UT8A 2G09A 2JFFA 2C7BA 1SVKA 2VF7A 1YHNA 3CLRC 3E5MA 1UBUS 4EA7A 4TKZA 1AQIA 1SUWA 1WYGA 2REXB 1TWGA 3HNPA 4FE4A 1NI3A 2AI1A 1Q44A 2VUHB 2XB9A 3FLMA 3S1AA 4RSHA 4EELA 1Y1WG 5KFAA 2QUJA 4RTPA 1BWSA 2XI4A 4KQCA 2ZOSA 4IH1A 4PQYA 5IF9A 1MW8X 1GUAA 1SIWA 3AR7A 3QFRA 3MFQA 4Q9KA 2R8ZA 2CV0A 3QQ5A 4DWOA 1U2DC 2OP0A 2W0SA 4HAWA 2YYSA 2JS7A 3K9LA 4W63A 5F3RA 4G1CA 4MV1A 2PG3A 3VU1A 4HB0A 1N2CB 2J31A 5SICE 3T0IA 2DB3A 2PH7A 2P30A 4DC1A 3U61B 1LKZA 1TCBA 2UV8A 3QXCA 1VQNH 4KLAA 2FMFA 3RARA 4MKIA 4O4JB 5DM1A 4N8SA 3L84A 4BVKA 4P2BA 2G9ZA 4IY1A 2ZYGA 1JKJB 1E6LA 5JS7A 4KZKA 2G25A 3CEAA 2NG1A 3CC4H 4F72A 5GZ3A 1E7YA 5KFJA 3T3GA 2J5RA 2REBA 3FX2A 4D2IA 1UH5A 4JQSA 1ZGCA 2ZIWB 1R6BX 4C0QC 4CCAA 1MB3A 4HLQB 1E3LA 1OZ0A 4CQLB 4PRLA 1MIOB 4GYWA 1X7XB 4DUYB 3H9BA 2H07A 1SULA 4D45A 1ONOA 2EEPA 3IJ5A 1MIOA 3S2SA 3PVCA 3WWEA 2XNJA 4BNMA 1D4OA 1E1DA 3UK2A 3U7QA 3DD5A 2AOVA 3KE8A 3T5CA 1VQ7H 2YWFA 3MWLA 2ODNA 4UD2A 1HLPA 1KA9H 2OM2A 1HMYA 5CLIA 3ZJVA 2RH8A 5JY1A 3AHDA 3NHZA 2YWJA 2H65A 3KZKA 4XEUA 3R7NA 4PHCA 4CKEA 4RMIA 4E4RA 3RYCB 3ST7A 1ECLA 4RSMA 5H80A 3S2FA 2JAHA 1FSZA 3CXCH 1X94A 1RMYA 4HGYA 3WIOA 1OT3A 3HR4A 2VYVA 3AVOA 4DIFA 4DV6H 4J16C 3EGCA 4UUNA 2RBEA 3BWVA 2XMCA 2ZJZA 4C14A 1J6UA 1I94B 4NPCA 3NEPX 3KT6A 1IB6A 2X7JA 1DRVA 3L0PA 3P9NA 5A4DA 1F48A 1N6PA 4K03A 3JALA 3HSKA 4LX0A 4F4HA 1BE8A 2G9QA 2XMZA 3U9SA 1AQLA 3GLSA 4R0MA 1G59A 4EGCB 4BYGA 4YUYA 3HJTA 1ZN8A 2HTFA 1U2ZA 4Z4GA 4XWOA 3GX1A 4U1RA 3WWHA 4PNZA 2BZSA 3I6MA 1MENA 1B4DA 1V26A 2P9YA 4LZJA 3C3DA 4R40A 3TRIA 3X3HA 4YLYA 1OX5A 1RCTE 1WDMA 2VOEA 2IYFA 2VTDA 4UHDA 4FQ5A 1ECBA 3FYDA 3M6FA 1FUKA 2AK2A 3JAKA 1C9YA 3PQDA 4E12A 1K9SA 2HHFA 1Y4DE 1WZEA 3A9CA 4O7LA 2QV7A 3FCUB 4GQIA 4PZLA 1GPMA 3PXXA 4CIDA 3NBFA 2QTBA 4AECA 4TZ0A 1GADO 3P45A 1SCIA 1SK8A 2IXFA 1H42A 3B5EA 3ZWBA 5KYGA 2ZJOA 2PS1A 4KXVA 4OL9A 1M2VB 4QICA 3REOA 3EJ6A 2VXCA 3TD2A 2QVLA 4AMZA 3KOZA 6Q21A 4F4WA 3HNRA 4PLPA 3C3MA 2PGIA 3GROA 1C8KA 2C8LA 4XD7A 1K88A 4RCZA 2CLEB 1AK1A 3NAGA 4GXTA 3UMCA 4EEYA 3HBNA 1U28C 2GUWA 1I33A 1RE0A 2YJ4A 1GL3A 4AI6A 1IVSA 4XCQA 3IVGA 2W6PA 1Y6QA 3U56A 1K8YB 4H4DA 4RL6A 2CKMA 4LY0A 5DIFA 4FQ8A 4D4MA 4O5OA 4UFPA 1P2SA 3HJBA 1IY2A 1USGA 2QNIA 4RFSB 1C80A 4G81A 4HY3A 5CM2Z 4NFYA 1A9QA 1D2NA 2WF5A 3UMFA 3FWYA 2FFHA 2NZJA 1NR7A 2EATA 3G7UA 3G2NA 5FEMA 3ZWMA 2QVBA 3LBNA 3CC8A 3CWZA 2CN1A 3HYRA 3KRTA 5KFEA 2JLXA 4MWSA 3K16A 4J0CA 1KYIA 4MWTA 5FFNA 4XGRA 3DCIA 2NSDA 2BN4A 3RK1A 1KC3A 1PW7A 4UUAA 1EVLA 2FR0A 2GXQA 4JLAA 4B4KA 2AL7A 3RVLA 1BZYA 4CPDA 4CLHA 2WHQA 4MUJA 1G42A 2GCGA 2DFVA 2E3JA 3BACA 5GOTA 4ECTA 5IUJC 1NN5A 2O0MA 2VP3A 1Z13A 2YQZA 2O23A 4Q4LA 4XAQA 4L9SA 3QWUA 1J42A 1IN6A 4ND2A 2OBMA 2IYVA 2BFPA 2FN9A 3AUXA 4FDUA 2XMRA 5FTNA 5FWXA 1E7QA 4UDOA 5BSGA 6PFKA 1VMAA 3A1NA 3KTDA 4F46A 1R6TA 4UC0A 3B6ZA 3WYEA 2XCTB 1LJ8A 1ADGA 2ZDQA 1E5DA 2F8SA 2IZ1A 3VR6A 1ZD3A 1UBHS 2Q5QA 4P4NA 1LTHR 1ZIDA 4JX9A 4OBWA 5AJYA 3THWA 1M7BA 3FOCA 4ZQBA 2GPBA 2J9FB 4KRGA 5FR9A 4ECXA 1ZCJA 1WPXA 4R98A 5THXA 3AERA 2I55A 3R5FA 4GPBA 2G0TA 2C31A 1E0DA 2WFMA 4S1OA 5DW0A 1VI5A 4UM7A 3TL2A 1Z6PA 4P81A 4J3NA 1WY7A 2GM3A 1R74A 3NXKA 4MP3A 5HOQA 3B1XA 4OK5A 5CXQA 4EGJA 4F86A 1IG0A 2AGOA 1HZJA 4Y2XA 4XVUA 3HKCA 4IDPA 1W29A 3KKNA 1DCMA 2CYAA 4B4WA 1CX9B 4DOMA 4JGBA 3VMFA 3D7KA 1KNQA 3V6HA 1RJWA 1XWIA 4Q1EA 3DHEA 4A16A 4YT2A 1P2VA 4B6QA 3P9XA 4OYLA 1Y6JA 1IK6A 1IY1A 2QJOA 3L1HA 2WSMA 2HLNA 2QGZA 1DCTA 2GN2A 1NVKA 2BEVB 2CFIA 1N77A 4EFNA 1DTSA 1E98A 4R1LA 5E3IA 2XUOA 3HA5A 3ESCA 3D3JA 2VC2B 5AIAA 1EK5A 4J0MA 4YTEA 3NRZC 1NBME 1JKXA 3AGPA 4JL8A 4WXHA 3R74A 4F4UA 5J58A 5KFHA 4GKKB 3CUEF 2KWIA 1TAGA 1G9XA 4GNKA 3AI2A 4RJ2A 4UNSA 5DCLA 4W5RA 4JCCA 3IDSA 2QA4H 4CCYB 5SZJA 2O8DB 1N33H 1J7JA 1E7WA 2ZZKA 3D1VA 1IQPA 3IXLA 3WLQA 2HCTA 4YJ2B 4N5DA 4BMSA 3H3JA 3I09A 2FOIA 3KSRA 5C31A 2ZBRA 4YV1A 4A0GA 5JCJD 3RADC 1MF7A 3DHYA 5JWOA 2PUFA 1DG1G 2CNNA 2Q21A 5FQOA 5FJIA 5IN4A 1NMYA 3L6EA 1MRSA 1YVDA 2N1MA 2P0AA 1SQ6A 1YK0A 3C0KA 4BQSA 1TM1E 4EI8A 2XWBF 3GMDA 3VJRA 4G0WA 3MTGA 5L45A 1MHTA 3R9IA 2LZ0A 3RABA 1Z5VA 4JD5A 5H3CA 1SCBA 1SB3A 1EFLA 2JGFA 3U1VA 1DX4A 3I05A 2G7ZA 3H1FA 3D0RA 1XVVA 2J67A 3MYYA 3N70A 4EBBA 4YK7A 5DKFA 3P94A 4CTJA 2QU7A 2XCOA 1O96B 2I4TA 1YAHA 3LX8A 2I2AA 3D59A 2XIQA 3L02A 1HQDA 2V9PA 1E6WA 4QOJA 1DWQA 5LMUB 2CWWA 4WSOA 5I7SA 2ROQA 1P4HA 2HK6A 1MQSA 3I72A 1VL2A 1U9ZA 4NNJA 4YRCA 3RUHA 4KQEA 4LJAA 3V80A 1WCMA 2PXCA 3DUFB 3GRUA 4XPZA 2WHRA 4DXAA 1VE1A 5KTNA 4M1WA 5JQGF 5F9LA 2FF5A 3IDZA 1HDZA 2H1SA 2HBQA 5H16A 1PS9A 2BR4A 4HRYA 1B33N 4L7QA 1J2JA 1E6UA 2JIQA 2O2CA 4FSXA 5L9AA 2R5NA 4BNHA 5A71A 1QO0D 2IUUA 4Q3OA 3ZKWB 3D3EA 1V5EA 2PA3A 3JD0A 1O4UA 2IE8A 4HNRA 4XFDA 4KFSA 4OG2A 4UDXX 4B9AA 3NB0A 1A95A 2ZTHA 5IT4A 3DTVA 3HYSA 3I04A 1UJMA 3K5WA 3P0IA 4M8SA 4PINA 5EMNA 3A2KA 2L69A 2D2EA 1XAIA 4H1HA 1F0NA 5I9BA 5D6NA 3U44A 1U7DA 2D1SA 5T41A 4NV0A 1W8DA 4YCSA 5JXHA 3DMHA 1NVFA 3A6JA 1UPCA 4ECSA 2POQX 3PPWA 3VTFA 4RHYA 1WSCA 2AD5A 2FPKA 3IPCA 2C1ZA 3W5SA 1AUOA 4GWGA 4ZVOA 4PYNA 3X1MA 1Z75A 3JATB 1PQYA 5IASA 1HI9A 5F2EA 4KO2S 2JIBA 2AG6A 3VVCA 2Q7OE 2VAWA 2GN8A 4MEJA 3JATA 2VF5X 3DAFA 2MSLA 3QVKA 1RI4A 3MEQA 2X0NA 3MYRA 2X1LA 5CFMA 1UAYA 4RULA 1X9HA 1UXHA 1G3UA 4H7IA 2X5RA 4U3JA 4ZI7B 4L6AA 5JPDA 1HDRA 3GNTA 4B85A 4LOAA 4YJFA 1G98A 1XA4A 4J0IA 3Q3EA 3THYB 3MIIA 4FD3A 3NWEA 5KINB 4A3DG 4PO9A 4EI7A 4QFMA 1ISSA 3D8RA 4F2WA 5F2NA 4L5JA 2AUNA 2GNPA 1P45A 1T2NA 3EOAI 2P5YA 1WMSA 1D4ZA 2C57A 4NCBA 3EIEA 3BE4A 1Z3CA 1UMBA 1ENOA 1PWZA 2C96A 1T2AA 3O8OB 5C4MA 1RM4A 4K87A 3BDIA 3L82B 1V5FA 3P0HA 4LJRA 4FSHA 1U9YA 3LRTA 2J6UA 3T7EA 1WEHA 1FIUA 5C3UA 1NQOA 3OLQA 1ORIA 5U4XA 4CYMA 4JNCA 1C4WA 3CR7A 5KT7A 4GRAA 1PNVA 1DQRA 4P08A 3ZOZA 3ZX4A 1UXIA 1JJFA 2GQ0A 2A33A 1DS6A 3TYXA 3ET5A 4FMBB 3Q8RB 5AKXA 3IILA 3BJZA 2QGFA 3FUWA 5ER6A 1OBGA 5DBFA 3RWBA 4TKVA 2P6OA 3ANMA 3BSSA 4MRPA 1Z0UA 3VUFA 1GGFA 4XOIA 1TJNA 3GIPA 1PBNA 1NW5A 2B1GA 2G17A 3EGOA 3L1JA 1KQ3A 3H4IA 3MWDB 3OJEA 2AGPA 4R7ZA 2ZBUA 4W7SA 3TLZA 4WCEJ 3JZIA 2PH3A 2H08A 1QUFA 3D7MA 4NX2A 4ZI7F 1R3DA 3TF5A 2H31A 2V1UA 1B8OA 2F1KA 2PUJA 3SXUB 1X77A 1ICIA 1V16A 4WCFC 4F56A 4HGOA 1M90J 1RLTA 1VMKA 3H83A 2COJA 4NZYA 4FDVA 4DDKA 4G0MA 5FA8A 3SVZA 2ZREA 1OFIA 3OZEA 5I5VA 1KQFA 4DUZB 2WU3A 2FE1A 1MAHA 1P2TA 1RLMA 4ARZA 2VP6A 4K2HA 3N3AC 1BMFA 1SH7A 5BORA 3KB2A 3PJEA 1QOZA 2I22A 2OZLB 1QOPB 2RK4A 2WK1A 1XP5A 3F97A 2W90A 3KU4A 5KSWB 2G1PA 3ZDEA 2CJWB 4NH0A 3NFYA 2G8NA 3DAHA 3RSGA 2G07A 3GLTA 2GHRA 2ISCA 1WMDA 1TM2A 3N6RA 4OHMA 4E3ZA 2JFVA 3STTA 2Z95A 2I9PA 4BTVA 1L8XA 3OPMA 3TM4A 2B99A 1YDGA 3BH7A 4YALA 2WSBA 3B51X 5SY9A 3ITEA 1QIIA 1BE0A 4FXOA 1FFBA 3FCCA 2Z0MA 4UMEA 3EG5A 2NSLA 2O50A 4G5RA 3VV3A 1P81A 3UG7A 3WTBA 2PUCA 4MHSA 3PIOJ 3QY0A 1YKSA 3RDPA 5J4KA 4KAXA 2QX4A 1BA2A 3EXFB 1WRVA 2BQUA 3KSBC 1A48A 2YMMA 3NRCA 4U7WA 5EWMA 3A4YA 4EW2A 4KMRA 4B09A 3K71B 2R7MA 2V5AA 4M7EA 1TMKA 3IKMB 4E5KA 3OIGA 3PUVA 3PIDA 3EC2A 3VZDA 2JLZA 5EIXA 3ZOKA 4TQSA 2JFZA 1PVVA 4R05A 4UEJA 1EUDB 4AJLA 1X92A 5DGHA 3N2LA 3NTOA 2B4YA 3ROGA 5ICEA 5H83A 3EYWA 3HDYA 5F7ZA 3GJXC 1FXWA 3AY0A 4G84A 3W7VA 3PIRA 3U3XA 2K4MA 4DUPA 3TIXB 4OQQA 2D5BA 4ZCIA 3SMQA 3TPCA 1ZNYA 3L7OA 4YHBA 4BLSA 4ZCMA 3T9BA 4Y0AA 3D6AA 4G1UC 3CX7A 1RBMA 3N0TA 2YC4C 1M2KA 2EIYA 2FMIA 4V0LA 3BAZA 1LF5A 2XW6A 3I4NG 1JSCA 2IEAA 2X2PA 5D3MB 3FTPA 1RBZA 2HA4A 2ZWMA 4N3CA 5FF9A 3GTKA 1H6DA 4GZMA 4BFWA 4BE7B 4KITB 2QI9F 3K5HA 4J90A 1NVBA 2N1BA 3BXGA 1WXGA 4B45A 4WLFA 2FVXA 4V1CI 4L28A 4OH7A 4EWLA 3H84A 1DG9A 1GAXA 1T0HB 1D1QA 1JU4A 1NKSA 1T9DA 1F0YA 1Q0HA 1B2LA 2OGWA 2QP3A 2WJ3A 2XJ9A 1T6BY 1IN5A 1DBWA 3BL8A 4HXEB 1KRWA 1Y1RA 5CFLA 5KJ6A 3UQ8A 2GN4A 1P9LA 1ISIA 3H2HA 2NU9A 2BLLA 2NW6A 4WAUA 4BBPA 4H1TA 5KWVA 2WK5A 4EATA 5LLSA 3LLUA 1I4OA 4YHHB 5AVUA 5KSOA 3A6DA 3KXDA 1ONSA 4G1FA 3THRA 5KNDH 3CLTC 3LO5A 2Z6UA 1PS8A 2ZLBA 3QTLA 2B3TA 2JGRA 5AW8A 2G3YA 4L4ZA 2VZLA 4PSKA 3SY8A 4LQCA 3WKAA 4EZEA 1T36B 1CP2A 1YCFA 4HWSA 3TPFA 3K9FC 3AVVA 5E9WA 4XQGA 1LPMA 4ID9A 3KFLA 1O9BA 1S3IA 2DBQA 1HNZH 2Y0SA 2EW2A 2N3ZA 2POCA 2H18A 4FK8A 2FN7A 4U7PB 3C74A 4NBKA 5AKHA 2J0SA 4IOJA 1RAIA 3B9PA 1P0FA 5A2QA 4J9RA 4DR5H 1VS0A 1K2VN 5EP4A 1WP4A 1KAOA 2C9ZA 1QCYA 2YVQA 3B6EA 3I2IA 3IUPA 4WOKA 3ZY2A 5FOTA 2XXBA 4MMYB 3X1ZA 1AJEA 3FPGA 1GU1A 4NQRA 1CQXA 3C24A 4KYUA 5FI0B 4A4DA 4MV8A 4GLWA 1LD3A 1CJVC 3N28A 1U2QA 4IL5A 4BV9A 1RQ2A 1CFZA 4IHJA 2ZPTX 4Z0HO 3K7EA 2HEGA 3EFOA 1LCIA 5AM0A 4BE4A 5M04A 1S7CA 3HCFA 4P3OA 5DXJA 1JR6A 1AS2A 1ENZA 3UMGA 4CTKA 4CV0A 3B5IA 4DV1B 4LHMA 4EFLA 4EPRA 4GZ6A 3D31A 2GM4A 1THMA 1AGNA 1ATIA 4GOOD 3ACCA 4IUDS 4DQKA 1RYNA 3SGIA 2I29A 2R8OA 5F51A 3VC2A 4BFTA 5J2TB 1EWKA 4PGFA 1L5MA 1U8EA 1K7EB 4UFNA 1U4SA 3K09A 2K87A 1FNDA 1HDEA 1U4OA 3EBLA 4GXQA 4U6PA 3DEKA 4ETMA 1KJIA 2JD2A 2XWPA 5ICMA 1V9LA 421PA 1ZOSA 2VUIB 4LJ6A 2XTJA 3GFSA 2HL6A 5ITVA 4HSEA 1UEIA 4BGDA 3AJ8A 1T9KA 4XW2A 1AGRA 4FX2A 2IBKA 3OEHA 3LU1A 4GX1A 2NXJA 4DVJA 5EE1A 3PE4A 5REQA 2QD2A 2HA7A 1L5ZA 1KO7A 2IYYA 2W8ZA 3I9MA 1G5FA 3JQDA 3P2IA 4RD4A 5FD8A 1UPAA 1WETA 3C14C 1TMGE 1ZIOA 2ZIAA 3KXLA 4GMXA 4XYMB 2PMZA 1N57A 1FYXA 1HC7A 3OIFA 3ZWAA 3I0NA 2HUPA 3PFKA 3VO1A 4QSMA 2O2DA 4WXYB 2X0JA 5EQFA 4QDOA 1UJBA 5E6UB 5BSMA 1W52X 3LDFA 1KOGA 1OFTA 4J9NA 1J9GA 3TR0A 2P69A 4FEEA 1KZ9A 4E1BA 1OREA 1CUSA 1E2HA 2FW6A 1W49A 3QWAA 4JDUA 4PZYA 3SSMA 1CKEA 3RS4A 3JYLA 1AUPA 2P9JA 2NU7B 3PE6A 5G4KA 3ZWYA 4KQ9A 3AR3A 5KCMA 1IJFA 3O8DA 3W2TA 2JK1A 1YZ3A 3GLUA 4CKYA 2Q4EA 1EK2A 3OM9A 4R81A 3FOFC 2PUDA 4OP3A 4Y6GB 1E2LA 4AXBA 3OUUA 3GJTA 5H5JA 3B60A 2WMDA 3CRMA 1X8LA 2OP1A 4N40A 5BYJA 2YDYA 1N5MA 1YUNA 1GT91 3HA3A 2CL5A 2PTGA 4IRUB 3IL2A 4B87A 1Z7BA 3FPJA 3V7YA 4DJAA 1EESA 2ERYA 4D4HA 1RXCA 3RH0A 1DWOA 2NV0A 5HGXA 4IWYA 4M54A 2ZIUB 4R7TA 1BE6A 3SNHA 3GJ4A 4KH0A 2QG6A 5HIAA 4YYZA 4TSKA 2DR3A 4I99A 3DFUA 3EUWA 3AB7A 4OTZA 3IJPA 5DCWA 1SVLA 1W59A 4WNAA 3RSCA 4P7GA 2O57A 1CKOA 4AJJA 3PRKE 4Q9LA 4TSFD 5FPTA 4YRJA 2YN2A 1JQBA 1Y63A 1KJJA 4MH0R 1YRAA 4RDHA 2B8EA 4BWSC 3EGVA 2JKZA 5CDYA 5JD4A 3EC7A 2UVVA 1WY5A 1M8PA 2LRHA 5CLFA 5L51A 3WGTA 1Q1EA 5DV9A 1CRZA 2C2XA 2V7EA 1K06A 2CQYA 2EWVA 1QK5A 3H7AA 4IDEA 2VT3A 4KG7A 2ZSBA 3F6SA 4MUHA 1IEQA 2VH1A 5K3SA 2ZXFA 5D85A 2WYIA 3R5TA 3PPIA 3G2JA 3FUVA 5ELMA 1DX6A 2FMAA 4YVFA 4P7JA 1Z73A 2FE3A 1XSEA 2GM9A 1VGRA 1SR8A 2IY7A 1GD1O 2UKDA 4M6WB 4HH3C 2J3KA 3OIWA 1XQXA 2FLPA 2WYHA 3DEYX 2A7QA 3M89A 4J03A 4QYMA 5IF3A 1CZOA 3ZJUA 4TYWA 3VHRA 2AJTA 4CFZA 2F8TA 3DCYA 5C8YF 4C0KA 1R6AA 3R77A 1T5LA 4OLBA 3GTOA 1SCNE 1SHJA 4GOND 3E9QA 2AG5A 1I8TA 3A1DA 4NU8X 4WZBA 3ICCA 2DX7A 1MXFA 4DILA 5TT0A 3DP9A 4UZEA 4F3CA 4ZRNA 3SR3A 3N8KA 3TCNA 1DUIA 5JSQA 3TIGA 3NV9A 3PA8A 1CR6A 1FTYA 2A57A 2ZS9A 3ZQ6A 4F1WA 1RQLA 3UJHA 2R8GA 1R0KA 1H4VB 2UYOA 4LSXA 1YOVA 2X4DA 3FKQA 3DL0A 3AHJA 4ARUA 4E5SA 3JQAB 3O4GA 1FZTA 3ND6A 1QHHB 5GJVC 2AX3A 4PZEA 2BKUA 3CRW1 5LYJF 1BN6A 3L4JA 1M1NA 2P8JA 2PSSA 3LKBA 2NQ2C 4RANA 4R51A 4PANA 3W4KA 4KR6A 1VL1A 4F3NA 1NP6A 3BUSA 3C7CB 1SFOA 2QE6A 4GD3Q 1Q74A 2E4ZA 4K9RA 1X7XA 3RS7A 1EE1A 1QR2A 2BFEA 2V6GA 2ZJ8A 5C4GB 3O84A 4MA5A 3I01A 4OKNA 4QYIA 1LLUA 2BFEB 2O2YA 3U0VA 3UB4A 5BN5B 4L74A 1UP4A 1JG7A 4HGNA 4UVHA 2ONYA 4WZAA 1P16A 3D6MA 3GFQA 2MR5A 3DLBA 3NJ8A 1TZ2A 4GRDA 3IXMA 2BF4A 2ZYAA 1MV5A 3VVBA 1U6JA 3W04A 2V3VA 2XD9A 1DC6A 2A0UA 4C6HA 3HN7A 3AY6A 1U8TA 3N7UA 4IYRA 5IC5A 1NV8A 1R4NB 2DHEA 3KUUA 3X1XA 2WVAA 3C3XA 3NBKA 3QBTA 3HKZA 2IYOA 1YONA 3RM3A 5AMXA 4UHKA 3R3JA 5DLEA 5TXGA 4MPDA 3D3WA 1O94C 2WJPA 1E2KA 2QN2A 3B6IA 3TCXB 1BS9A 1WS6A 4Q15A 1SKYB 3HM2A 1TO1E 1H6AA 4LCEA 3UUEA 5U4QA 3HLKA 2FWBA 5CYGA 2ABJA 2H5IA 5ECDA 3V7WA 1UKEA 8LDHA 4W9MC 2VTBA 3KAJA 1WDLA 5C52B 4L5BA 3IBSA 4TUYB 3N8NA 1CEQA 2BI4A 1C7EA 1GNLA 4BP8A 2VTBB 1YBFA 1MAWA 1P62B 2GD1O 1PJ4A 4JROA 2Q6VA 2TS1A 4W99A 1E2EA 2ZKLA 1XTZA 3DNMA 1IRXA 1DDGA 1PEAA 2EDCA 2Y1LA 4IV0A 1SZDA 4HRAA 2O03A 1G41A 2DQYA 3BZWA 2YICA 4K28A 4EEZA 4FWTA 2REQB 2IU3A 2I5PO 3PC7A 4EHDA 4XIGS 3G5UA 2Z30A 4YGYA 5DM60 3T1TA 1A5AB 2B5WA 3CX4A 3DZIA 5KOHB 2BFCA 1ZN7A 1P1FA 4ED9A 1TADA 3RVDA 3OM1A 4I55F 5AP9A 2Y0BA 2PUWA 1W25A 1UPFA 3IEIA 4KGZA 4CKZA 4DQDA 3BTVA 4ND7A 3HK2A 1Z82A 3ISVA 1XZFA 3EXHC 3UCFA 4RKRA 1RYYA 1KZHA 4D82A 2BTOA 3I92A 4BQNA 4IDNA 4ES6A 5F12A 1TRHA 4N39A 1J20A 1NJFA 1NASA 2C98A 3K8ZA 4DCNA 1F5NA 1Q1QA 1UBJS 4Y8VB 3I76A 1HNWH 4KE6A 4PHFA 4ZVKA 3O74A 3MLBA 1JHDA 4J0DA 1B6TA 2YJ3A 3WOHA 3HSSA 5BSWA 2JJ2A 1EEHA 1VIMA 3OIUA 1RJPA 2XE4A 2J9FA 1CWUA 5FPHA 3UJCA 5GV7A 3H8JA 2PKQO 4MRMB 4A36A 3ED5A 4NFSA 1MX5A 3NHLA 3OZSA 1IPEA 1JA0A 2CMGA 1KGDA 1TQ4A 2I2CA 2IOHA 5DHFA 1E1NA 3A1SA 4ZOQI 5CYOA 4L9RA 1FJHA 1XZDA 4RAOA 1KK3A 4ALNA 1GNVA 5IVHA 3EZ7A 2FPIA 1FFXA 3H2JA 1ZGGA 1NJ5A 1VCNA 4QGHA 4B40A 2ET6A 4HS9A 1QIKA 3GJ3A 3I4LA 3OOJA 4ZK6A 1E3IA 4US2R 1EVZA 2CXPA 1LS1A 4GLLA 2QMHA 1X80B 3BCHA 5HVNA 1WXWA 2VDUE 2XE6A 1W0JA 3UAOA 4YP1A 3WLIA 1KEVA 4XCVA 4MDHA 1NBWB 4EG0A 3DVAB 2XGPA 3IB6A 2Q3BA 2Z3VA 1BSVA 2PRIA 4J2OA 2RGVA 2NAFA 4MRSA 2JI6A 3RYFA 1VQ6H 4RAZA 3NGDA 2ASDA 3BIXA 3N53A 3OLWA 5AW9A 4EO4A 3TQHA 5I7UA 1DT3A 5FRDA 3O3MB 4ZP1A 3GB8B 3CVWA 2CFCA 2D62A 4IDGA 1Y4ZA 4TM7A 2QMOA 2B83A 2VBIA 1ZMXA 1AKQA 4F8JA 3IXQA 3Q8WA 3RBEA 2NO9A 2PVSA 2R48A 4U0JA 3U3JA 2DETA 1GUYA 1MO5A 2XE7A 1H22A 2IU6A 4YXWD 4YPVA 1MH1A 1G291 3O94A 1J2RA 1RYHA 1FP2A 4YJ2A 9MHTA 1Z0JA 2H59A 1M10A 2ODAA 3A1FA 4MR7A 2AGVA 5J63A 2NNLD 3R3WA 3VNQA 1SXPA 2XQKA 4XIJA 1BWQA 1TO6A 4KXXA 3B7WA 3QFFA 3V2IA 3OLZA 4DCJA 2CJFA 3FPCA 1MO3A 1R00A 1KDZA 1NQTA 1WB6A 2Y8EA 1EXNA 1OWPA 1QFYA 4IS2A 4S1TA 4JN6B 4UKDA 4ZREA 2Q2OA 4WCFB 1DWPA 4HX5A 1KZYC 3E9DA 4LH6A 4U5QA 5K3FB 1E5TA 1I10A 3LQSA 2QB5A 1BW9B 1GZ7A 5IJ0A 1Z0DA 9ATCA 2FDXA 4YRKA 1CUVA 3FWHA 1A3CA 4FS3A 1HV8A 1USWA 1WF3A 3DQZA 3OFJA 4JLMA 3RQIA 3JAMW 3RUEA 1XMSA 1ZUIA 3WGYA 2BFFB 3M6AA 3LT4A 2HHHH 2X8JA 1WZUA 1GN8A 1X8XA 2ZANA 3G9XA 4GRIA 1WSBA 3R7WA 3NAMA 4X6UA 3T9AA 1F20A 4JYAH 3K0AB 4A1OA 1HWYA 5AYYA 4EQ5A 2RGNA 2XA1A 3WB1A 3KPYA 1OC4A 1PI3A 4GKBA 5A9SA 4XUDA 5JSYA 3BRQA 4C0LA 1CS0A 3ASYA 4H7KA 4EQ6A 3X1WA 3GEHA 4LMBA 1UBTS 2B94A 3RIEA 1GTSA 1H3EA 1KDTA 1K7YA 5COQA 1PJCA 1E8MA 1IZYA 4CC5A 1LV7A 4MUMA 1ML4A 4NV3A 3WFIA 1LLDA 3A6LA 3VPAA 3L6UA 4DN6A 2HIVA 2VRCD 3A26A 2R8XA 3K1TA 4RPHA 1JTVA 4GKAA 1ECPA 3FMAA 4G56A 5DCYA 1O5TA 2X14A 5ITZA 1QH9A 2ZATA 4P4TA 3EVBA 1UKCA 3NJ4A 1Y81A 1XQ6A 3EQZA 1N4AA 3GRZA 3FB4A 2BHRA 4H3KB 3ZNQA 2GCOB 4DTIA 5HZMA 3BREA 3KCQA 1NYTA 3MXOA 1T2FA 3C1OA 4P93A 4W8HA 3O8BA 5TARA 4YPOA 3I61A 5EJFA 1YC2A 2H1CA 1X0VA 4OA5A 4DJDC 3NBYB 3R20A 9GPBA 3EY4A 1Z83A 1DADA 2EW8A 2OYRA 5EP3A 3CUVA 1S0NA 2R8KA 2F1IA 3S8EA 1H8HA 2VUUA 1FJ2A 5LBIA 4B83A 5K4HA 1IULA 4JI1B 3KHLA 4RVGA 4B76A 4YV0A 3TNFA 4DAEA 1N2SA 4UTXA 4CT4B 1ZHHA 1SIOA 2HV8A 3PKJA 3AKYA 5KFZA 3PX7A 1Z0IA 2W7OA 4RCYA 1P4SA 1IE3A 5ALZA 3FR7A 4LHEA 1VRVA 3HXTA 5C7OO 5FOWA 3GT4A 1QTIA 4HLUC 4C7YA 3BIIE 2PYDA 2OO5A 9ABPA 2XCAA 1IB0A 1LB1B 1BFUA 2OC4A 4M99A 4FFOA 3QI7A 1QHEA 4L16A 4DR2H 2EHDA 1CIPA 2EXXA 3WC4A 1TTHA 4YYYA 3JAWA 3L07A 3CEJA 2H2FA 4QDUA 4QTUB 1NX6A 3VKVA 4HB3A 4LAFA 1K7CA 4X93A 4XZ3B 4O2RA 3VU3A 4BP1A 3JTEA 1D4FA 3SYMA 3Q8SB 4TV8B 1JNYA 2JEZA 4JBXA 3REQB 4CWAA 1RBQA 3FMIA 2XZTA 3R0ZA 1Y1WA 4GC5A 1GGKA 3VR5H 3U4MA 4RZUA 2D13A 1C7IA 2FGJA 2FUG1 3MWEB 1B8NA 1JXOA 1TCAA 4HI0E 3AB8A 2X6QA 3QVLA 4WUTA 2QJTA 2ILTA 3C5EA 4YR2A 1YMUA 2ZBEA 3LWBA 1KAMA 1WXDA 1RPTA 3AXSA 3T0GA 3AV0B 2CD7A 3TTTA 2BMWA 1EWVA 1IY0A 3QZ7A 1BDMA 1PD0A 4OQDA 3A2NA 1IFXA 3LA8A 1E63A 3DTNA 1EPUA 4UDNA 2HFJA 2V96A 4TQGA 3TDKA 3GUYA 2K5UA 1TWHA 1Q7EA 3PZRA 4WZBE 5LIPA 2JJ8A 4OHBA 3RWOA 1MOSA 4Q02A 3WYFA 3LGXA 5AXDA 3ECCA 4K6GA 5TEVA 1JKFA 1N2GA 1XUOA 2QROA 3F3MA 1NNSA 1RKUA 1OFHA 2E6UX 3FSEA 4I46A 1T5TA 4XKJA 2A9RA 3M33A 3T3HA 3FC4A 4UOQA 3IHKA 3QKTA 3RIZA 4MR9B 2JL1A 4MPJA 4W9NA 4ZAVA 2O8CA 1EHYA 3LHIA 5B2EA 1C7ZA 1ESZA 1VG8A 1ZUD1 1W0KA 1SU7A 1Z4JA 4ER7A 5HIJA 3TJRA 3WAGA 3A4VA 4K26A 1HYHA 3ZGXA 1T43A 5KB3A 1LPPA 1R5JA 2DWQA 4RD1A 4QJFA 4RADA 3USZA 5JJBA 3Q8LA 1H3NA 1TC2A 3U4QB 3GYBA 3B1FA 3LUGA 1FMLA 4A2WA 5K3OA 5KFFA 3HDVA 3DFFA 3ESDA 4GP9A 4OXRA 5CT8A 8ABPA 4JI7H 2E4AA 2Q8QA 3NWJA 4WI1A 5JTTA 2OV3A 2QL6A 1NRJB 1HLGA 1TJ4A 5LA6F 4LMYA 2A67A 1PN3A 4N9WA 5LBUA 1E5XA 3PNYA 3F8TA 4QPZA 3SIXA 1K3FA 5B1YA 2ID4A 2BUAA 4DCUA 5JYDA 1H4QA 4ARCA 3F98A 4AYBE 4YACA 1ZNQO 1F8UA 3JSNA 1IAQA 1Q7BA 3QENA 1LQ2A 2HZBA 5EESA 3ZLTA 5DQGA 2YY5A 1TQHA 3AL2A 5E1MA 3V4FA 1D9XA 4DLSA 1ZDMA 3AESB 4FP9A 3UFXB 1B1AA 3WLJA 4C30A 4KBYA 1N1GA 2GZ1A 4BCDA 1X86B 3EXFA 1FTQA 1L7RA 4OSPA 3T7DA 4CQNA 1B2RA 2FLLA 1WB4A 3L7AA 4EY7A 1SVNA 2HGSA 2J85A 4YCCA 1HNZB 2C2HA 1NW8A 2YUIA 2DWUA 1I4TD 1XBTA 3QE0A 3SCZA 1O6FA 4O7RA 1WCIA 1Z36A 2Q50A 4R9NA 3LK6A 5E4YA 3SQLA 4BDTA 1H9CA 3CH6A 1KJNA 5LQAA 4EYHB 2IEZA 3OICA 3REFA 1DBVO 2Q7DA 3ORQA 2HPHA 4FT2A 3ONNA 4OQMA 3TZ6A 2OH2A 1Z45A 1KSHA 2X5KO 1K7FB 2QSUA 3MAAC 1XEXA 1ZEJA 3AILA 1RQRA 2H1HA 2QN1A 3D6UA 1RP7A 3FHCB 5AKLA 4HN2A 4CF6A 2UUCB 3GTQA 4IZHA