3WP5A

The crystal structure of mutant cdbfv e109a from neocallimastix patriciarum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
227
structure length
227
Chain Sequence
b'EFQSFCSSASHSGQSVKVTGNKVGTIGGVGYELWADSGNNSATFYSDGSFSCTFQNAGDYLCRSGLSFDSTKTPSQIGRMKADFKLVKQNSSNVGYSYVGVYGWTRSPLVAYYIVDNWLSPFPPGDWVGNKKHGSFTIDGAQYTVYENTRTGPSIDGDTTFNQYFSIRQQARDCGTIDISAHFDQWEKLGMTMGKLHEAKVLGEAGNVNGGASGTADFPYAKVYIGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDBFV
molecule tags Hydrolase
source organism Neocallimastix patriciarum
publication title Structural Analysis of a Glycoside Hydrolase Family 11 Xylanase from Neocallimastix patriciarum: Insights into the Molecular Basis of a Thermophilic Enzyme
doi rcsb
total genus 56
structure length 227
sequence length 227
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp5A00
1KS5A 1H0BA 1TE1B 3AMQA 2QZ3A 3AMNA 2BWCA 3VL8A 3VZOA 3MF9A 3WR0A 2DCKA 1HIXA 3EXUA 1OLRA 2VG9A 1OA3A 1BK1A 4HK9A 4HKWA 3AMHA 3VZNA 2B45X 1H1AA 2C1FA 2VULA 3WP6A 3AMPA 1REDA 3WXPA 1C5HA 3B5LB 3HD8B 2DFCA 1F5JA 2BWAA 1QH6A 2D98A 5EJ3A 3WQ1A 5K7PA 4HK8A 1XXNA 3WP4A 1REEA 3AKRA 4NPRA 1BCXA 1XNBA 3MFCA 3WX5A 1ENXA 1YNAA 2DCZA 1BVVA 4XQ4A 3WY6A 1QH7A 3WP3A 1H4HA 2F6BA 3AKSA 1OA2A 1XNCA 1UU6A 3O7OA 1UU5A 3AMMA 3VZLA 1H4GA 2B42B 4IXLA 3AKPA 4XQWA 1IGOA 4S2FA 1T6GC 3AKQA 4XQDA 5HXVA 3VHNA 4S2DA 1H8VA 2BW8A 2VUJA 2JICA 5K9YA 1C5IA 3LGRA 3WQ0A 3MFAA 3RI8A 2DCYA 2VGDA 3VGIA 3AKTA 3M4FA 2QZ2A 1AXKA 1HV1A 4HKLA 3MF6A 2BVVA 1HV0A 1W2UA 1XYOA 3ZSEA 1PVXA 1NLRA 2D97A 3VHOA 2NQYA 3WQ7A 1XNKA 2Z79A 3VLBB 1XYPA 1UU4A 4H7MA 3VZKA 1XYNA 1OA4A 4HKOA 3VZMA 3VL9A 3VZJA 4XPVA 4S2HA 2DFBA 2NLRA 3WP5A 4S2GA 2JEMA 1UKRA 3B7MA 2DCJA 2B46X 1OLQA 3VHPA 3WT3A 3RI9A 1M4WA 1XNDA 3LB9A 1REFA 1KS4A 2JENA
chains in the Genus database with same CATH superfamily
2Q1ZB 1Q3EA 5FO7B 3PURA 4CXWA 3T09A 3WNOA 2HBTA 2VMHA 2O1QA 3GDBA 4L8QA 5DABA 2DCKA 1RJ7A 3NWKA 5FP4A 4LUMA 3TNQA 4A7ZA 3D0SA 4ZXEA 3P3NA 4W65A 4XF1A 1G6NA 4I0BA 3FFZA 4HK9A 2TUNA 1MVEA 1LGCA 2P6CA 2WO7A 3AMHA 5CKNA 5K4LA 5C3PA 3GJAA 2I2SA 4QDSA 4XE9A 1W6NA 4HANA 1W8HA 2AEYA 2VUCA 3HD8B 3NV3A 1MS0A 1QU0A 1ND3C 1SG3A 1SDDB 1BEV2 1LOEA 1W6QA 3W5MA 2CGNA 3A21A 4OQ9A 2XWJB 1GP5A 2YYOA 1AR93 2JG8B 1LENA 1OOPB 2HWC3 2PHLA 4GXLA 2D3RA 4XDOA 1BBT1 1LHNA 2XOMA 3DUIA 4Q4V2 1VBA1 4CCDA 5E88A 3LA2A 2PQSA 2VUAA 5AC93 1CZVA 4E8CA 2ZX1A 4UW5A 1UY4A 1W9SA 2X8KA 2XUMA 2VM9A 3B01A 2YU1A 3M3CA 1RUJ1 3MIHA 4K9SA 1H4HA 1VBC2 1UYPA 3ILFA 4DMIA 4U2AA 4XUQA 1COV3 3PIJA 4YVWC 5ABJC 2ARCA 1ZRDA 4UYBA 1J84A 1MZFA 5CB7A 3LIHA 1ACCA 2A73B 5CKQA 4NROA 3EHKA 5IVFA 2BTVC 3VBOB 4BK5A 4URAA 2VC9A 1IGOA 4XFCA 1VMJA 2V4VA 1RUE2 5HXMA 4WVZA 3WF4A 1FT9A 1IQDC 2VCMA 3IIIA 3THDA 4QXKA 2I45A 4TXWA 3FBYA 3X29B 3I49A 1IPSA 1PGL2 2KXLA 1I3HA 4D8MA 1JZ7A 3PU3A 2FD8A 1WCDJ 1ZRIA 4KWLA 1RMU1 3FFQA 3LKJA 3NAPA 2D44A 1FOD2 4PDWA 5JAXA 3I3DA 1JOBA 1O7FA 2VCCA 5JMCA 1BMV1 4QX0A 3DL3A 3VBUA 1NCQB 1LTEA 1OURA 2XG3A 4DXZA 5CYYA 4E2QA 3HOBA 4XURA 5DUXA 2PLV2 3D6EA 3AZYA 3M8LA 1EUUA 1WUVA 5T5OA 2WAOA 2FDJA 3VLBB 4M01A 3UKVA 5IVVA 3RGBA 4UWDA 1OLME 4LULA 2RM23 4GH4B 4P00B 2PHUA 1JU4A 1VRH2 3FLPA 1D2SA 1YFUA 4NPMA 4XDQA 3THPA 3DECA 1MEC2 5I0SA 5FQ0B 2F4LA 1PK6C 1AX0A 4DOUA 3EB7A 4LMFA 2C24A 5F2WA 4CDQC 5KXEA 3R6SA 5GZGA 2ZGRA 2FMYA 2P3KA 2ZHKA 1G86A 4N43A 1GOGA 2JE7A 4CSWA 3MICA 4EN9B 2QQUA 2VPVA 2XJRA 1E5IA 5A6YA 5FZBA 4MGTA 2EIEA 3E5UA 2HEWF 3WF3A 4N53B 1YYNA 1OLQA 1LJ7A 3RI9A 2Q4SA 2B39A 5CFCB 5FO8B 1KS4A 2ZBJA 3FN9A 5CA6A 1DBNA 1E5RA 1H8TA 2VNRA 1QJY1 2BYVE 2QZ3A 2JXAA 2V73A 3FJSA 1W6OB 1UPSA 4Z92B 2BU9A 4LBJA 2JG8A 4RGGA 5EV7A 1O4TA 4Y1ZA 2VMCA 1RINA 1DQ0A 1GQPA 2VG9A 2WQZC 4PQ9A 4Q4Y3 3RSJA 4CP2A 1WCSA 2H6CA 3AP9A 3IIAA 4HOOA 5IUQA 1HJFA 3NNLA 4AE2A 3GALA 1C28A 1LGBA 2WR9A 2KR2A 4P9WA 1NYWA 1MEC3 2D40A 4FQZA 4FOVA 4XUPA 2EF6A 4Q0VA 2D6KA 3AYCA 3H1MA 5FY0A 3ZSMA 1VB4A 2VOTA 1XC6A 2WZPP 2ERFA 1RIRA 3BIWE 2GH8A 3KCYA 1VBB3 1MS9A 5LBEA 5A1AA 3T30A 1ZA4A 1AL22 3KHBA 4JX0A 3U07A 3KS7A 4YW3A 1AR82 1VBE1 3R0RA 3USUB 5E1RA 3KSCA 2EXKA 2RS53 1RXFA 4QXCA 5FY5A 4XHBA 5GJ6A 1JZ5A 5FPBA 1WCQA 2JDUA 3M7AA 3TEZA 1J59A 1QOOA 3W9AA 5A32B 2F6BA 2XLAA 1LESA 1WMEA 2C26A 1NXMA 4IETA 4BK4A 4Q0UA 4HZFA 5BNOB 3GZAA 1F9KA 2XMLA 1PGSA 4XJ9A 4IXLA 4AR2A 3ACIA 3RJ2X 1YEWA 1W3VA 4ZZ8A 1UY2A 4HG6B 1DCSA 2XLFA 2Z5WA 1QKQA 1V6NA 1BEV1 1GZ9A 3HPNA 2VCAA 4LK6A 2WLQA 3S5QA 4OI4A 4AGRA 4DY3A 1O3TA 3BTYA 3C3VA 1SHWB 1GP4A 3NJYA 5FYTA 3PMEA 3AZXA 4FSJA 3HNBM 5LA1A 3RZMA 2WYFA 4O61A 1RUF2 3TWIA 3SH4A 3T0BA 4BCUA 3MFAA 3KCCA 1BZWA 3O0VA 3I2OA 5JXJA 5B4XA 2QE3A 3QH7A 1IPKA 4IERA 3UNPA 5FYMA 2LROA 4XFAA 3MUY1 4BQXA 4E4HA 3HAGA 3NNMA 1LULA 3CIHA 4ZXKA 2LM3A 1HKDA 1UO9A 4PI0A 1W2UA 1HN1A 3JBG3 4LBQB 2A75A 1KQRA 1SFPA 1CJDA 3NJZA 4WM7B 4EN8B 2GH2A 2Q8EA 3WNMA 3WDUA 4BXSV 4KL1A 2BOJA 4HVRA 4PBOA 3ETQA 2WINB 1V6IA 1WMFA 1UU4A 3Q8CA 4XUOA 4XF3A 3SHRA 3VKFC 3RRDA 1GANA 2FHRA 1WZXA 4Q2FA 1SZBA 3E6DA 4CP9A 5FPUA 1OC1A 1PZ9A 5FBJA 2FDGA 3LWCA 4QX3A 4BISA 2P34A 2VQAA 3EBRA 3WNKA 5FJHA 1AR73 4XJ8A 2YROA 2CDOA 2FCVA 3O14A 4QX7A 3KWVA 4RR3C 3BB6A 3BGAA 2Y60A 3AL6A 4XBLA 4Q4Y2 2HWD2 3UKTA 1OOPC 1W6MB 2B46X 3F95A 4XIKA 2PHTA 3R4DB 2K9ZA 1MZ5A 4O9GA 1D4M3 4JAAA 2VTXJ 4DRRA 1HB3A 1VP6A 5C8CC 2VTFA 4M0HA 2XBO2 2RHPA 3D0JA 2DBIA 3JU9A 2R7EB 1R093 4MO3M 5EJZB 2JDZA 4PHZA 5J1XA 1CAUA 2B45X 4AQTA 1MS5A 2P2KA 5LEJA 4GJZA 3MW4A 4LOSA 5FP7A 1PZ8A 4KU7A 4XXAA 5DAQA 3AJYA 5K8SA 4FXGB 3U4SA 4OUEA 1SBDA 4CUAA 1ZZ9A 1PVC2 3W20A 3P5BA 1OQ1A 3VDDA 1DG6A 1I5ZA 2BNOA 2VR4A 3P6BA 4Q4W2 2RS33 1W2OA 4CEYC 2OXBA 3RMYA 1GZWA 1X8EA 3T08A 1GBGA 1ZZBA 5DG2A 4LBOA 3VN4A 4I0WB 4OMCA 1UYXA 4QQHA 2BDRA 4RGKA 4JGZC 4MZUA 1R1A2 3TNPB 4C0HA 1YQ2A 1LHVA 4BQWA 2RR13 1Z7S1 1XNCA 3GYDA 4OI2A 4QX5A 5A3NA 5IK5A 3M70A 5FZMA 3UK9A 5L36A 3Q8EA 4DEQA 1JZ2A 4ASLA 5F7UA 5A1LA 1Y3TA 4P5HA 1AJKA 4Q4X3 4ISRA 4XQWA 4KU8A 4YLZA 4LITA 1W6MA 1RUG2 3IBMA 3NRUA 4AVAA 2W2IA 5DUUA 4JTOA 4XQDA 1YI9A 1NCQC 2CDPA 3GCWA 1OLMA 2W1WA 1DU3D 3IDAA 1VBE2 3MLLA 5C3OA 1EV12 1UOFA 2B9VA 2IUWA 2VXRA 3A0NA 2Q5TA 3L2HA 4CU6A 3HVDA 1XRUA 3M3OA 3HIFA 4BJ0A 1EY2A 5A3TA 4K7JA 1JOJA 2EXJA 2QNKA 4PI2A 4XF9A 2RDNA 3LFIA 1AR91 3JQWA 1NLRA 1HB2A 1ZZ6A 5JDBA 5LK5A 5JOXA 4C1XA 2WFF3 1BBT3 3U37A 4PIZA 1U12A 3JB8A 5ERLA 2J1UA 2YXSA 5HV0A 3DKQA 5GKAC 4COZA 2A3YA 4PF1A 5AC91 3B9IA 4O65A 3R05A 4IESA 5FY4A 4BHPA 2DURA 2AENA 3SXWA 4R9DA 1JTZX 1BVP1 3K4ZA 5FP3A 3WG2A 1KDKA 1LOAA 4KI5M 3KF3A 2WZR3 4OFGA 1J1TA 1GWMA 4OI0A 3EYPA 1DZQA 5CKMA 2PHXA 4HONA 4OMDA 4Y1XA 1F4AA 3VZJA 4EN6B 4Q4W3 3W21A 1W0OA 2VW0A 2ZGMA 4QPIA 1YFXA 2JG9C 2NLRA 2R1BA 3F2ZA 4XJAA 5LA0A 4LO4B 3OY8B 4AW7A 4RFRB 3NSTA 4EN0A 4B4PA 2QDNA 2QQLA 1MS1A 4DUXA 1M4WA 1XNDA 1J1LA 4F3JA 1UX6A 3FUOA 3MPPG 3ZPYA 4HBNA 4XJUA 1ZREA 4YRDA 1NY72 3B94A 3AMNA 1QQP1 3N9LA 2B5HA 4BLJA 4CCLA 5JPMB 5A7OA 4HETA 5FZOB 3INAA 4A3XA 1WKYA 3JD72 1N3QA 4DQAA 5AFBA 1OA3A 2R062 1DGWA 1RTVA 2R061 3BCWA 2H6BA 5J37A 2B8MA 2ARBA 1QJX3 4GZ9A 5H9SA 1QDCA 1POV3 2J1TA 4UW4A 1ULDA 3CL1A 2LW8A 2E7TA 1V0AA 3TYJA 1QJY3 1QY4A 3USSA 4LUKA 1LECA 3W59A 2QQOA 3HWJA 2GU9A 5A7PA 4FPOB 1PO12 3PU8A 2C0ZA 1AHSA 3TRSB 4COVA 2J42A 1O3SA 2PLV3 3MGUA 5J36A 1XXNA 2V09A 1MVQA 1JUIA 1CONA 1VMFA 3NJXA 5DUWA 5C3RA 1JYWA 4FPCA 3AP5A 5HCHA 2X5IA 2DVBA 4XAEA 4MOAA 1UXXX 2XR4A 5BNOC 3CNAA 3J8F2 3UV9A 3MW3A 4NPLA 4AWDA 1VBC1 4QDRA 3WP3A 4UFIA 5I8YA 1AX2A 4IE7A 3WV6A 5F3GA 3POIA 5EZWA 4WM8B 1Y4WA 5DDJ1 1AL23 3VZLA 2VQUA 4IEXA 4ZS3A 1B35A 5C7GA 1KJLA 2B42B 2WRAA 4Y20B 1P8JA 1BBT2 2AEZA 3VBFA 2WSUA 4BU2A 4P5YA 5I0RA 3VV1A 1B09A 4LO6B 3O0XA 1OKQA 2YMZA 3AKQA 3I3EA 5FY7A 1R1A3 4S2DA 3U14A 5JR7B 1S0IA 2QBXA 4UI9L 3RNSA 1RUI2 2BW8A 1OBNA 2R073 5D21A 4PIYA 1C5IA 2UWBA 4N9HA 5CG8A 4FFGA 3MV11 5GLZA 3K48A 2LRPA 4X8NA 4ATFA 1ZA7A 5FXZA 4BXFA 4GWJA 4I01A 1VJ2A 1AXKA 1J58A 1YUDA 1HV1A 1PIV2 2PXJA 3GBWA 3MF6A 4L2NA 1KFXL 4PDWC 3ILNA 1UIKA 4QPGA 5FYVA 1AJOA 3DYPA 4AXOA 3RDIA 5FYSA 1RHI1 2VXJA 3FMGA 5F5AA 3QLQA 1DLCA 1JHJA 1NAEA 3IPVB 3USUA 4P08A 4JVAA 5F3IA 1PX4A 1NT0A 3FHAA 4L0PA 5IFPA 1HXS2 4ZU5A 3SCGA 3WDXA 3J8F3 2GDFA 2ZX2A 3ATGA 1QXRA 3RFRA 3I2KA 2ZKNA 4TYSA 3ME2A 4FVVA 3SNMA 3WEZA 1O91A 2VZVA 3LEMA 4B29A 3CQOA 4NAOA 4BWOA 2YY1A 3O1TA 1RVF1 3OD4A 1JZ6A 3S0MA 1IOAA 4QXBA 4Z1VA 1N1YA 3NNJA 4A42A 4FP3A 3JZVA 2YC4A 3K3NA 1GOHA 1Y43B 1AR61 3B02A 4UF0A 4NAMA 1U5ZA 2DTYA 4S2GA 2ATFA 2ZX0A 1SCRA 2DCJA 3J9SA 1YO8A 3PUAA 1YXWA 4NHXA 4EV0A 4GWNA 2IWGB 1POV0 2YZ4A 4YZ3A 3DEMA 5IVEA 4Y26A 2WABA 5C4WA 2A6WA 3I3BA 2QTWB 3VBHB 1FAYA 1MS8A 2W47A 2G9GA 3V0BA 3WR0A 1ST8A 2RG4A 3CKHA 4AEDC 1TME3 3VKLA 1LU2A 3OGSA 3PMSA 1IKPA 2DUQA 1DQ5A 3UGHA 3MLJA 4QHZA 5A7WB 1JOPA 3ZFEC 3ROUA 1FPN2 5JMOA 1PMHX 4QQLA 1AR72 2QQWA 3FE5A 5CNAA 4K1YA 5BUVA 3W58A 5M0TA 5IK4A 4IE6A 1OPMA 4WM7A 2HKXA 3LAGA 2E53A 1HRV2 5F6LB 2UURA 4GULA 1DGRA 1OQEA 4LO5B 4YYOA 2AGSA 2AYHA 1HXS3 2Q1FA 2ZGLA 1HDKA 4H2AA 4QT6A 4AHYA 4BQYA 2JX9A 4NVPA 2YDEA 5DAXA 1VE0A 4IDZA 4JHTA 4P9JA 4QKDA 2PHRA 3WNPA 1YQ5A 4FT8A 2GMMA 4I3GA 1QQP2 2X5IC 2ZGOA 4NHLA 4BLIA 1LEDA 2DCZA 2DU0A 2VOVA 2ZEWA 3DYOA 4P9IA 2A6YA 3E5QA 3OBRA 4D7TA 2MEV3 5GLWA 4XDPA 1ZBA2 4OHZA 1FNYA 5HCFA 1UD1A 5T5JA 4W4ZA 2OIIA 4R4ZA 1FOD3 4Y22A 5J7MA 1C8M1 5DG1A 2Y6JA 3POWA 1GNZA 4MV2A 4N43B 4ASKA 2EA7A 2OYZA 4TZDA 4OHYA 3KGZA 4N8MA 5FYZA 5FZ3A 5FPXA 2HJIA 2EIBA 4ZHNA 1Q43A 3A22A 4M3CB 4WVMA 1W3XA 2J22A 3IDEA 4E8DA 4FBFA 3HJRA 5FWEA 2ZABA 2ZXQA 1TNFA 1XSQA 5ACA3 5BNPB 1V9U1 4OHXA 1SACA 5IFTA 2LTNA 3JUUA 3ZFGA 1AZDA 4NR1A 1HQNA 3I4IA 1RVF2 4N7UA 2ZGUA 4AI8A 4OCTA 4IV3A 4CEWA 1VBD1 3POJA 3O1SA 5D1IA 1WLWA 1RUG3 3MLKA 4FI9A 5A3OA 5IYYA 1RUE3 4DNYA 2ZX3A 5FZIA 3WDYA 1RUH1 4GD4A 5AVAA 3ZFFC 4CDUC 3I59B 4AI1A 1C8M3 1G7YA 4FP2A 4IV1A 3T2QA 2E7AA 2KD7A 1UNBA 5K0UA 1RUC1 2XONA 3WQBA 1MZ6A 2GMEA 3AYAA 5DZGA 1CJPA 1NA1B 1AXYA 1X50A 3AJZA 3KM5A 1XYNA 1NE4A 4YWAA 1ZZCA 4LLFA 4YARA 4YG0A 3ACHA 1QOSA 3K77A 4BQ2A 5I91A 1W6NB 1V9U3 1BLZA 3PVEA 4JZRA 2H0BA 1GUIA 4XTPA 5DXDA 3ZXFA 1WWYA 3NVCA 4XYXA 2VBPA 2WL1A 1U0AA 3N7MA 4KH9A 3U11A 1JS9A 2YFUA 4Q4X1 5F6KA 5GZFA 1O4ZA 1ND2A 1W9YA 4ZONA 4CCKA 5EPAA 4LBQD 4PDWB 1W6PB 3P1IA 4FTSA 3A0KA 2J7MA 3ZXDA 1L3JA 1F5FA 4QDQA 4DO0A 4BZ4A 3TB0A 1WBLA 5LW9A 5DZFA 1WLDA 3ZYHA 3HNMA 5JSRA 5C8CA 3LE0A 5HCAA 5KHJA 1RUC3 1CVNA 2CWMA 4UW3A 1DFQA 3OGGA 4HN0A 4Z82A 4LE4A 1HIXA 2VMIA 1SEFA 2XVGA 4FPFA 4UF0B 3RMXA 4XUNA 5E8AA 1BK1A 4Q5OA 5GLUA 4J1XA 2WSVA 2D5HA 2ES3A 3PUHA 4GB32 1JU3A 2RS51 2X09A 5FV3A 2ZX4A 1W8WA 1IHMA 4XF0A 1AF9A 1W06A 4JCKA 2GALA 2VE1A 3LOIA 2VJXA 2WFF1 2VZTA 4Q4V1 2JD9A 4Y33A 5A33A 3T4VA 1YFYA 1BJQA 2Y6HA 1F4HA 1ZRRA 4LE3A 2UY9A 1YIFA 2Z2SB 1TEIA 4FCAA 3C8XA 4HXCA 3VBFC 5TSWA 4A45A 5EJ3A 3GHNA 2WLPA 3WNXA 5JI9A 2XKOA 1Y7BA 5CEHA 1CX4A 5K7PA 2K46A 1STMA 1O59A 2GAUA 2FCUA 4UOJA 3PVOA 4CP1A 1CQ9A 2VQ0A 1V6KA 2F4PA 4AFAA 4YG3A 4AVTA 4LXLA 1JUHA 1BVVA 2TNFA 4K3UA 4CYDA 1AXZA 5FZEA 4QPGB 5CFDA 4B4RA 1HQWA 4BDVB 4XTMA 3DF0A 4TWTA 5FXXA 3ZN6B 2VW2A 1YQCA 2OA2A 3MIBA 1H4GA 4M00A 5A3MA 4HLTA 5FMOS 1S4CA 2BJSA 5DUVA 5C70A 3POBA 3ZYRA 2HWE3 4QWNA 4S2FA 1QQP3 4WM8C 1W8TA 4IEQA 1FV2A 1QJX2 2WQ4A 2ZMLA 3I2DA 3AP7A 4YZ1A 1SBEA 2FMDA 4MLOA 2UWCA 4XETA 1ZBE1 4LIUA 3IM0A 5L9VA 2LALA 3IDBB 3IB3A 3UT0A 3WD5A 3WCSA 3BALA 5FYCA 4LBNA 3V64A 5C3QA 4RHV2 3B00A 3EO6A 3AL5A 3ZX7A 1Q8SA 4FQ4A 5HV4A 5L9RA 1K5JA 2OQ7A 4R4XA 3T0DA 4XMAA 4Z8BA 1S0JA 5BNPA 1LOFA 5KXBA 2CYFA 1K12A 1L7RA 2HWD3 3ZSEA 3VKNA 1H2NA 3MO4A 2OS2A 3VHOA 1ASJ2 5A7SA 4B1LA 5IVCA 1XNKA 4W8JA 2P1BA 1ENQA 4IEUA 5FQ0A 1DDLA 1LCLA 1VPHA 3ZN4A 5DDJ2 2HWF2 2VQTA 4XC9A 2VY0A 3ACLA 1VBB2 3M1HA 5C4WC 4IEWA 3H42B 2VZ3A 3KV5A 4IE4A 4IV1B 5CU1A 1VBC3 4GQ7A 1WGPA 1O3QA 3ZYGA 1FPN1 1D4M1 1KXGA 5JCTA 5K0UB 3OJBA 3RYRA 3POFA 3VKMA 2A1XA 4HPKA 4QPGC 4D0QA 4AAXA 3RZKA 4XPVA 2BOIA 4B8EA 2XBO3 2R072 4K8FA 1QJY2 2RE9A 3PVNA 2P37A 4RQPC 3GGLA 1VR3A 2GMPA 2VECA 2JIGA 3JQXA 4CP9B 2XVLA 5LA2A 3LB9A 3UETA 1H0BA 1X9TA 2QQJA 4MYEA 3S7IA 4H14A 4XBNA 1PO22 1NCRC 2PAKA 2Y8KA 1W39A 4RGAA 5F8PA 3VZOA 2XHKA 1Q8OA 2JG8C 4G3YC 2VOWA 1K45A 4CCJA 1Y9QA 2P4EA 2CWSA 2VMDA 2XJVA 2ZOEB 3H8OA 4FFIA 4UT5A 4NHMA 5I0UA 3E97A 1PGW2 1UQXA 2E9QA 1SFYA 4L97A 5FY1A 2NP0A 1GKBA 2Y34A 5GALA 2FDKA 3IPVA 5DAWA 1VMHA 1K5MA 5FZ1A 1F5JA 1C4RA 3LEGA 2RV9A 1BQPA 2JDKA 4HK8A 3LSDA 3OBAA 2BBVA 1Y9GA 4OUSA 5LRSA 2VUDA 2G9ZA 1OF4A 1UZYA 2V72A 3E6BA 1XPWA 2VMEA 1ZRFA 4EWAA 4WVMB 4X8PA 2QQNA 1ZYBA 2HWB2 1QH7A 4QPWA 5CFDC 2EXHA 3ZPOA 4AFDA 4LO7A 2EIGA 4QMAA 4QQPA 4NHYA 4NIIA 4AZZA 4WM7C 4DFSA 1UX7A 1F31A 3N7JA 3RZHA 4Y4YA 4OLLA 2NZ9A 2BV4A 4FOQA 2A70A 4QB2A 1BK0A 2Q8DA 4FFFA 3BU0A 1HRI1 4RD7A 5A3UA 4NRQA 2Y0OA 2RS32 4Q0PA 1MR5A 3BOWA 1H8VA 2HWC1 4Y5Z0 5FBZA 1OI6A 2OUJA 4WBBA 4JKMA 1EYBA 2NM1A 1CAXB 2TBVA 4URTA 1H6XA 5FUPA 4UAPA 1CAUB 5EYYA 2X05A 4CU8A 4EWEA 1NX9A 1DIWA 1Q5OA 2ZA9A 5FIXA 1KGYA 1JYIA 3AVSA 1SMVA 5FMDA 3ZO0B 4CCOA 1UOBA 3CZJA 4DUVA 2QFEA 1MQTC 2CGPA 2W95A 3K75B 1DZTA 2W1SA 5A70A 4I02A 4QD2A 2VZPA 4BE3A 5G04L 4KWKA 1UAIA 3WQ7A 3IAQA 2P17A 3VBFB 1YQ6A 2YUEA 2EVXA 1CD3G 3U10A 1RGSA 2PA7A 5D8AB 3FX3A 4YNIA 4IUGA 4RL7A 3HT2A 1US3A 4RS5C 2JECA 2XJTA 2VZQA 3ENRA 2R1DA 3RWNA 1X33A 1S0EA 2AUYA 1EP0A 2NMOA 3H8RA 4RQPB 2CNAA 5FMBA 2Q30A 2VZOA 3NKGA 2D93A 1NOVA 2JIJA 1H2MA 1UYYA 3ZLIA 4JDNA 1HLCA 1EAH2 3NNFA 1QJU3 4MGQA 4QGLA 4EQVA 4MGZE 4CPBD 3AVRA 4IV1C 5LZ6A 3VDDC 3QCWA 5D2AA 5K0UC 2PHFA 1NKGA 4D7YA 1SFNA 3ELNA 2D43A 4K8RB 5F2SA 4AI9A 3GBGA 4HVOA 4XABA 4C8DA 2WFPA 5E6HA 3V56A 3ORJA 1UF2C 2VNVA 2UYAA 2D3SA 4AEDA 1I9RA 1A6CA 5GZCA 3ES4A 1RC6A 4DXRA 2E26A 2HEVF 3TAYA 2QJVA 5IHRA 2QKDA 4NIAA 3VZNA 1KFUL 4X6RB 1CWPA 5IK7A 5FXVA 5FFOC 1B35B 2PMWB 2PTMA 5FK7A 5LBCA 4CXXA 2PFWA 2SLIA 4P02B 1S0FA 2MPFA 2RS31 3CLPA 3WUDA 4EYUA 4CEYB 1ND3A 1OMIA 4WZFA 4CDWB 2WAAA 1JH5A 3BOPA 3H8UA 3MV01 3HN3A 4YVSB 1S2BA 1IZ3A 2GN7A 2OT7A 5APAA 3POYA 4FFHA 4ES9A 5I0DA 4ZZ5A 1LAJA 3S57A 2FDHA 4FTBA 2YU2A 3BU7A 3RZJA 2ZACA 2FDFA 3DPRC 4PJYA 4XFBA 2CV6A 5C8WA 5LBFA 1I5PA 5CG9A 5ISLA 5L9BA 4Y1VA 5HCBA 4EJRA 1W8FA 1H30A 2XH6A 3WDVA 1GYKA 1JZ8A 3WNLA 5JWPA 1A78A 1OA2A 2RMU3 4LK7A 4QPIB 5SV8A 3VBUB 4ORFA 3ALQA 3ILRA 4XILA 1SDWA 3TEYA 4ES8A 4NIDA 3NV4A 5FZDA 1O5LA 2Y6LA 2ZCWA 2RS12 2D5FA 5L73A 1ND2B 4TTGA 4Q1RA 1EV11 3OBTA 3HN1A 2G4IA 2ZAHA 5HXVA 3KV9A 1POQA 2ILMA 3AK0A 3M3IA 3VBSB 2OZ6A 4KG0A 3IT8A 4PLOA 1WMXA 2VUJA 3H1WA 4ZPIA 2YBKA 3C7GA 3CF6E 3LGRA 4AEJA 1J83A 1YJLA 4M3CA 1UPIA 4NJ4A 4AI3A 3P3PA 3WHUA 2ZGTA 1SLTA 1GOFA 4LKSA 3U4XA 1NZCA 2P3IA 4NHKA 2HWE1 3H3ZA 1JBCA 2JDHA 4HKLA 3N7KA 1UKGA 5T3NA 1W2AX 1HV0A 5BNNB 1A8MA 1IG0A 4Y22B 4YFZA 3OOXA 3AM2A 4BMBA 1ND3B 2R041 4XZUG 2R042 5LATA 3CJIB 5KXDA 3J4UH 4BIFA 2A5ZA 3S5AA 3LOBA 2DUOA 5JIUA 1F35A 3KT1A 4BQ4A 4MGIE 3OUJA 4IEZA 1NZIA 3BKZA 2XQXA 2JE8A 4Q4W1 5FMOL 3BYWA 2D6LX 5LEKA 1LODA 4W6XA 4XFHA 5IT6A 1N47A 1UZVA 5FZAA 1HJGA 4PQQA 3O1PA 1CGPA 1W0PA 1K3IA 1YRZA 1AYN2 4KGQA 2DFBA 4M4PA 3WP5A 2JEMA 2IXCA 5SV5A 3ZN6A 4CA9A 1VLNA 4QKBA 5CADA 1MQTB 5FZ6A 3KHCA 4E2GA 1ONAA 4H7LA 3UGFA 4A2UA 1W9WA 3J7NA 1MS4A 1RUD2 1DYKA 4CEYA 1QJZA 1TE1B 2R49A 2HWF3 3FHQA 3JXSA 1W6PA 5JI7A 2BFUS 3ZN5A 2ZHLA 3OUIA 5LRRA 3VKOA 4A6OA 1UY1A 3FHIB 5GZEA 5C9AC 2DWRA 3WOGA 4QKFA 3VBRB 5CAZA 3BIEA 3A23A 1X9PA 5JVVA 3ZMOA 2HWD1 1V6OA 2VULA 3EQEA 2WO2A 4CUBA 3CMGA 3PTRB 4Q0QA 4R9BA 3THTA 3DXTA 5FR3A 5JLVA 5JXIA 4YM0A 1C5HA 3EMRA 1VBA2 1LKNA 4LKEA 5HBAA 1JN2P 3FBMA 1PNFA 1G9FA 1UZZA 1VIWB 2D98A 2C6SA 2DU1A 4RHV3 4UBGA 4MH0E 5KHHA 5BYNA 1POV1 4XACA 4NUBA 4D6QA 2YB7A 4FPEA 3H3UA 4CVUA 1LB2A 1C1LA 2A3WA 5FK8A 1REEA 2O0OA 1LRHA 1QEXA 1XNBA 4Q27A 4YZ2A 1YNAA 3MZHA 5BXXA 1TMF1 4DXTA 3J7HA 4IEOA 1GICA 2JDNA 4HPKB 4XQ4A 2VL4A 2ZGQA 3AKSA 4IGQA 1PMJX 2Y64A 4QM9A 1HB4A 2B4KA 1LHOA 4I3PA 1QWRA 1WMDA 2HEYF 4B4QA 5A6ZA 3CBNA 1MACA 3TEXA 1OH4A 3H1YA 4IL7A 2GC3A 3I2IA 2NMNA 4QXHA 3ZXJA 2EXIA 1SLBA 3G7DA 2VBDA 4XBQA 4NO4A 4N53C 2VH9A 1O3RA 2XJSA 3EJKA 1UOGA 1ZRCA 3ES1A 5DDJ3 1F2NA 4GKXA 4MG2A 5CZKA 4KQ7A 3H50A 1WD4A 1ZZ7A 5LCWL 2D6MA 5FYUA 5FKBA 1W8ZA 4CUGA 1UIJA 3DPRB 4QX2A 5JOZA 2EALA 3VBOC 2DCYA 5FOJB 1RHI3 2CAUA 4K40A 4V1PA 4M4RA 3A4UA 3SEPA 2QZ2A 4CE8A 2K0GA 1EAH1 2VNOA 4LORA 4Q4Y1 4AYUA 5FKCA 3H3LA 5GZDA 2IXJA 1ULGA 4ISQA 4Q26A 1IS5A 1PO13 2FCTA 3I7DA 4QM8A 2D97A 3UYJA 1KD7A 4ZU7A 2IVIB 3ON7A 4KBBA 3I8TA 4FPJA 2C9KA 1NCRB 4TLGA 3RWKX 3ZFGB 2BVBA 4AVSA 2NPIA 2AH2A 2DVGA 1ZX5A 1VBB1 1GU3A 4TN7A 1YHFA 2L9LA 3VZKA 3AP4A 1T6BX 3LZZA 3NJVA 4ASMB 3BUCA 1RUJ3 2W9XA 1D7PM 3PNAA 3FLRA 4JDOA 1AR63 4Q8LA 1LOGA 2C5DA 2ZHNA 3H9AA 1O4YA 1ODNA 2RDQA 4JKLA 2UY8A 3AXEA 3UGGA 3KZ4C 2NN8A 2PAMA 4BYYA 3J8F1 2OW4A 4RR3A 4YSFA 3WF1A 2HWC2 4CDWA 2OUHA 4YVSC 4ITCA 5F5CA 5BPXA 3VBRA 3GZEA 4JRLA 4COWA 3GZTB 4D3WA 4GH4C 2W68A 2AC1A 1DQ4A 1RB8G 4UW6A 2JB8A 5I0TA 4ET7A 4HT1T 4OQ8A 3MUZ1 3OF1A 1ZM1A 4QB1A 5B2GB 2FQPA 1KS5A 4LBKA 3PDQA 2A3XA 3AYDA 1XQNA 2R32A 4GMP1 3U78A 2AR6A 4HFSA 5JOYA 4LNVA 2WN3A 3S6PA 4BIOA 4CTEA 4MX3A 3AZZA 4MGYE 2W3JA 5ANNA 3HNYM 4YW6A 2VOXA 4H55A 5DN2A 4QHBA 4RFT0 1H1AA 1OSGA 2C1FA 3SC7X 3LEIA 5FLIA 3GJBA 2AREA 4YM1A 3MHZA 4JGYA 1EUTA 4GMP0 5CBLA 3OGVA 1K5MC 2QQIA 2WNUC 5C8CB 4LEJA 4KWUA 1QH6A 2YHJA 4ARXA 4MGKE 2RM21 3LPGA 3RZZA 1RHI2 4LHNA 2YBPA 2P3JA 1WLCA 1XNAA 2ZJCA 3K4DA 2R6QA 3WP4A 4D6SA 4XZPA 3KCXA 4HVQA 1FOD1 1HXS1 1NY71 3MFCA 3WX5A 3VUOA 1A34A 2W46A 4JGZA 5FYYA 4DIQA 2GNBA 4AG4A 4FAHA 2KA3A 1G9AA 1J3QA 4OYUA 5FRAA 4JQTA 1LOCA 3ITQA 1ZBA1 3PUSA 1EPWA 3DCQA 1ZBE3 2O14A 1V6LA 1AYM3 1A8DA 3MBWA 2F17A 2BP6A 4AFCA 5DMYA 2ZMKA 3AMMA 3AX4A 5FPLA 2MEV1 5I93A 1W8UA 3LCPA 4I0AA 5AFEA 3GF6A 4IEVA 2GC2A 1XU2A 1PHMA 5L19A 3IAPA 4A41A 2N7GA 2V5YA 3V65A 1UW8A 2WA3A 3ZKYA 1NCQA 4Y4RA 2OVUA 4Y20A 1OD5A 4MXVA 5EWSA 1N3OA 5FDBA 2RVAA 5LA9A 3NKTA 3VBHA 4LTAA 4UFHA 3VDAA 3RI8A 3B93A 5HPOA 2FZ2A 2GC0A 5JZGB 4FXKB 1C8NA 3WSOA 5T5PA 3SCHA 1V00A 3QD6A 3PLQA 3NAPC 3LA7A 4JQRA 1XJAA 4M3CE 4HMZA 1PNGA 3ACGA 1XYOA 1FPN3 2XVKA 4LJHA 4UFLA 4AFMA 5DAVA 2ZGPA 4LKDA 5FXWA 1VBD3 3IKWA 2GNMA 1Z0HA 1W8NA 5FY9A 4COUA 1NXD1 1O6UA 4FO9A 5FZGA 1VBE3 2WWJA 2EAKA 1RUG1 5T52A 3C7HA 1RL3A 4LHKA 2E33A 3VBOA 4IEYA 3W5NA 4R9CA 3WG3A 4AFBA 4H7MA 1GNYA 1UY3A 4QU1A 1FV3A 3MDPA 1WBFA 2B9UA 1QMJA 3ACFA 3I2GA 3AYEA 1TME2 3I2HA 5FUNA 2RMU1 1OT5A 4J25A 5ACA2 5JR2A 3ZDSA 4AEMA 1NA1C 3NL1A 1A3KA 1NLQA 3MIGA 1V6JA 4E4DX 3SKJE 2IZWA 5A80A 4P14A 4XXPA 4N43C 1N3PA 1XBFA 1ZNPA 2UYBA 2YPDA 1QNWA 1Z7S3 1W9FA 4QAWA 1MS3A 4QGMA 2MHFA 2RS52 1ND2C 1CPNA 4LR4A 3POEA 4LKFA 5FZFA 4F7ZA 1QGLA 4E4ZA 3URFA 3VHPA 5LK7B 1CPMA 1WLTA 3RYKA 3ZSKA 5GLVA 1REFA 4TLFA 2X5IB 4L92A 1GLHA 1XB9A 5DPNA 3SLIA 4IGOA 2JDAA 2W87A 1LR5A 3BODA 3O5SA 5F32A 2ARAA 4MUVA 4FAGA 1LU1A 2Y33A 4H3WA 3JCIA 5FYHA 4GAZA 3C7FA 5C3SA 1W2NA 1RVF3 1HX6A 2SBAA 3VDDB 5GLTA 2R043 1DGRN 4Q8KA 3SMHA 4MXWB 3ZOIA 4DS0A 2JE9A 4OUMA 4YM2A 4N53A 2GNTA 1Q8QA 1UY0A 1OF3A 5L7OA 4FTEA 1QF3A 2BEOA 3MW2A 5F39A 3ZIXA 2WYSA 2HBUA 3LEKA 3VDBA 3AKRA 2JDMA 5IWFA 5C9AA 1CAWB 4DEVA 1DP0A 1XOYA 1AR71 4Y3OA 4EROA 4GKYA 5FZCA 2DF7A 1JYNA 3AP6A 5KHGA 3R4SA 1RUD3 4XFIA 4N90A 4RHV1 1HRV1 3ZFFB 1SLLA 3WCRA 4DINB 3KGLA 1UU5A 4CPBA 4JGZB 1CAXA 2DYCA 3CJIC 4FPKA 1ZVFA 4DXSA 1KEXA 3JB4C 4L11A 4XAAA 1PMIA 3T2PA 5HI0A 1GP6A 3AKPA 3MPBA 1AYN3 1UMHA 3CEWA 3VD4A 3L2YA 2XJUA 2J1SA 3GXUA 1T6GC 1K5MB 2VVDA 4P9GA 3HQUA 2VZRA 1Q8PA 5T50A 4NIHA 4E4SA 1YFWA 2JJ6A 2EIDA 4CDXB 3LDKA 5KHKA 3MI8A 2IFWA 4E27A 3J26N 4YW4A 1RUNA 1T2XA 2VGDA 3N9QA 3VGIA 3WINE 4K6BA 3T3YA 4KG8A 3UJOA 3ST7A 5A33B 4RN5A 3E1F1 5J3UA 1PVXA 3S7EA 1YWKA 5CVRA 3QBQA 5J48A 5LWBA 3POGA 2OX0A 4GH4A 4BM8A 2ADEA 2I07B 3JD73 3BPSA 3ZXAC 1D4M2 4YFWA 2Z79A 2CY6A 2DDUA 2P6HA 2WKKA 2XKPA 1XYPA 2W08A 3DGTA 1QJU1 2DBNA 3ETPA 3N36A 4FOWA 1H8TC 4OULA 3V0BB 1JZ3A 3T4HB 2A6ZA 2J1EA 2VMFA 2BGCA 3QH6A 3U1XA 1RXGA 1N1VA 2RR11 1ODMA 4IV3C 4BQ3A 4CEWC 1PM7A 3D4KA 4UFKA 2VAUA 3Q8FA 5C4WB 1IS6A 4DB5A 2E31A 1W9TA 2ARXA 5EP9A 4D69A 3FC0A 1RUI1 3OCPA 4E9KA 1RUOA 3A7QA 3NNGA 1US2A 4QB6A 3ZFFA 2NYYA 3CZUA 4PF5A 3KF5A 3H7YA 4GA9A 3WW3A 4M0NA 3RZGA 1UL9A 1RUE1 2OPKA 1N1TA 3WDTA 1AL21 3WT3A 1MZEA 4XFFA 2VOKA 1BHGA 2P3YA 2RDRA 4IE0A 4QHOA 5FZ0A 2BGOA 1E5SA 5FYIA 4L99A 3UESA 1OFNA 2YC2A 1SCSA 4LHLA 4SLIA 3VL8A 3IMMA 2EAAA 3HBZA 4LLOA 2BRTA 2JB4A 1CIWA 1UMZA 4UXAA 4WV8A 5B4NA 2WS92 2GP3A 4GWMA 2BBAA 2DUPA 4Z2WA 3ZMNA 5JZGC 1XE7A 3AMPA 3N7LA 1WCKA 4LBLA 1GWKA 1VRH1 2WA4A 1JI6A 3LIGA 4JC1A 3SKVA 3WXPA 5F9TA 2ZZJA 3NV1A 4AQ6A 3BN6A 4GMP3 1RUI3 4BQ5A 1SLIA 2VNGA 4AVVA 4AVCA 4AI2A 1ENRA 1S0CA 4MVTA 3WQ1A 3O12A 4B1MA 3O1RA 1UOJA 4DPNA 3ZXKA 1SLCA 2WO3A 5KXCA 1COV1 4NPRA 3HMYA 4IGPA 3IWZA 4ONUA 1ENXA 1EV13 4XOGA 3VBHC 1H6YA 2A71A 3ZYFA 5A3PA 3OPWA 1QXJA 1W05A 5I8SA 2D6OX 1NQDA 3AZWA 1PO23 2IXKA 2JG9B 4V2VA 2A6XA 1FX5A 2ZKLA 3E5XA 4I30A 4QU2A 2Z69A 4FOYA 4DY5A 5L7OB 2WNUA 5A3LA 3OBZA 3CJIA 3GM8A 1VRH3 1HB1A 4PIXA 2BFUL 2WDBA 3AC0A 3RG0A 2TEPA 2ZAAA 2WNVB 4YW1A 1JYXA 4G9SB 3B3QE 2ID4A 4Y24A 4Z07A 2YPJA 1ZBA3 1LEMA 4W6YA 2ZMNA 1KRIA 3HQXA 1PIV1 2E32A 1ULFA 4UBHA 1DGLA 2R30A 1PGW1 1IS3A 2J1AA 3VD9A 1UYZA 3DKWA 5C9AB 5I8TA 1NA1A 5IVJA 1G8WA 2VZUA 1TME1 1K42A 1J3PA 1G9BA 3D8CA 1QJFA 1H1MA 3QACA 1PO21 1VALA 2X10A 4KNCA 2I74A 4WZCA 1Q56A 2CL2A 5T5LA 3I2FA 1BXHA 1UMIA 2LS6A 5A6XA 2XQRA 3ZXGA 3N9OA 1PGL1 3M2MA 3OD0A 5IAVA 4IV3B 4Q1PA 4CEWB 2WN2A 1E5HA 1R081 1JMUB 3OGJA 4AAPA 5C5UA 3CO2A 2YG0A 1AL0G 4AK3A 2QQKA 4QX8A 1AR83 3OUHA 5F1RA 2WIIB 1V6MA 2YC0A 3GNEA 3PJYA 1GFF2 1CAVB 4Q0SA 5FLHA 4AHZA 2UWAA 2Q8CA 5H9RA 3WVJA 4LHSA 2R0FA 2GC1A 1S0GA 2MEV2 3PIGA 2XJPA 2D6NA 3WF2A 5T54A 2RJLA 2OPWA 2WS93 2XB6C 4OI1A 1W28A 1S1AA 4YGCA 1GZCA 1R1ZA 5JOWA 1NE6A 2DV9A 3O1VA 5JIAA 2W39A 5F5QA 1FMD1 1ASJ1 3PL0A 2JD4A 1VAKA 4CCCA 1WW5A 2LUWA 2DTWA 1IS4A 3EXUA 4F83A 1JYCA 1Z7S2 3LSEA 2W92A 5FCCA 4HKWA 5C71A 4LIVA 2VW1A 3JBG2 5BNNA 5FO9B 3VD5A 4UFJA 4J6GA 5J96B 3S30A 3OEBA 1H9PA 2Q8OA 5ANQA 3TOJA 4BOWA 3B5LB 2D3PA 3KQ4B 4COYA 4B7KA 2W5FA 2J1VA 3IMNA 2PELA 3MEPA 3OPTA 3RYPA 1UCXA 1UWWA 5FUIA 2CTVA 2C9AA 3KT7A 4PLNA 4B3NA 1NG0A 2HYXA 5IVBA 2G1MA 4C1WA 2RS11 3D82A 5IVYA 3NW4A 3VDCA 1AX1A 1NCRA 4DUWA 5CFCC 5KWRA 1FMD3 4GB33 1GZTA 4YGBA 3M3QA 4AQ2A 3WG1A 1H8TB 3PUIA 5IATA 5JXGA 1F15A 1QOTA 4UFMA 1RUF3 3U0ZA 3KMHA 2QQVA 4AEKA 1O5UA 1DQ2A 2CGOA 3K4AA 5A3WA 4XFGA 5FP8A 2QQMA 2O8OA 1G9CA 3OYWA 2W94A 3O7OA 5C33A 4CU9A 1QDOA 4O7XA 1BMV2 5F5IA 4RR3B 1MQTA 4V2WA 5EXOA 2DVDA 2PN5A 4R8HA 3VBSC 3KVAA 4JDMA 3LD8A 1U5IA 1VRBA 1EAH3 2WT2A 2PQQA 4NRMA 5CIRA 2XGXA 2UU8A 1W6QB 3D3AA 1AR92 1H1IA 4FPYA 5FJKA 5L7OC 4INDA 4W50A 3T0AA 1DHKB 3VHNA 2CHHA 4MGSA 1HRV3 2FDIA 3B69A 3UJQA 2ETEA 1YCIA 1GWLA 4JRAA 2JICA 3WQ0A 1QJU2 3TN93 4MADA 4YGEA 4GB31 3KLSA 1JXNA 3SISA 2XLGA 3PVBB 3M4FA 4G4FA 2VTXA 1YJKA 3T2TA 1KDMA 4A4AA 4HL0A 1XE8A 4PBPA 1R092 1OUXA 1AR62 1FXZA 3SH3A 2BVVA 4CRQA 3PTYA 2XUEA 3B9CA 2JG9A 2E63A 1YC61 2JDPA 3C7OA 2VZSA 4CDQB 1DQ1A 2GP5A 5KHIA 2BNMA 5IJRA 3GCXA 5DAPA 3BVCA 3V0AB 1W0NA 4DZGA 4PT6A 5A6QA 5FPVA 1CR7A 5FZOA 3N35A 1OQDA 1H9WA 1MPXA 3SCFA 1TG7A 2XPJA 3VD3A 2WZEA 4NWWA 1OA4A 4AQSA 3E6CC 3MIDA 3ZYPA 2Y6GA 3LQCA 4BB3A 1QJX1 4WVVA 3WF0A 1ENSA 1CAWA 1WD3A 3HQRA 3OY8A 3FWEA 4MHUA 1RJ8A 4NMIA 4ZS2A 2CSGA 4QKNA 1HN0A 3JD71 2WUHA 3M3EA 5J98B 5JZGA 1JYVA 1WA4A 1AYN1 2VO5A 1UKRA 3OYWB 1U5YA 3MYXA 3ZDVA 1APNA 2GNDA 5D8AA 5FOBB 4Y1YA 1CZTA 2PLV1 2VU9A 4NOTA 4WVWA 2VVEA 2YV8A 1XE0A 3HBKA 2CU5A 5LASA 2WT1A 5ACA1 4FPHA 3O1OA 1FNZA 3DPRA 1WW7A 2BWCA 3OG2A 3MF9A 3I97A 2ADDA 4P9YA 1IQAA 4QX1A 2WZR2 4J1WA 1YLLA 2P5BA 1VAMA 1Y9MA 2BNNA 1GR3A 2XJQA 4K20A 3ZFEA 3ZSJA 5E16A 5FZHA 1WCUA 3I3QA 4D6RA 2WNOA 2YGMA 5BNNC 4EN7B 1REDA 1C8M2 5H9QA 4XMIA 2WFF2 4NWVA 1NQJA 1R091 1HRI2 1S2KA 2ZHMA 2WNEA 3C7EA 1PVC1 1OHFA 1HQLA 1W99A 1TMF2 1H2LA 2BQPA 5H9PA 3IN9A 4LA2A 1OXCA 2JDYA 2PYTA 3N9PA 3ZYJB 2R071 3DV8A 4R9AA 1JHNA 2VBBA 2YFZA 3BPZA 3OSDA 1SBFA 3FZ3A 3HR9A 2XDVA 4AHWA 1JZ4A 2IXHA 4XEZA 1ULEA 2BGPA 2GN3A 3RVHA 4F8AA 2VMGA 4LQRA 4BA6A 1KJRA 3AFGA 2E6VA 3LPFA 4JGYB 4AF9A 4NE9A 2XXZA 1RUJ2 3ZSLA 2XL9A 4CXYA 3SQOA 1LNSA 4YVWA 2V4AA 4HN1A 2WNVC 3UL2A 2X29A 3Q8BA 4YW7A 1O8PA 4LA3A 5A1FA 5FZLA 2AACA 1RMU2 3ECQA 3N4MA 1C57A 4Z2AA 5EQUA 1JYTA 1DZRA 1W04A 2JKXA 4AGVA 2W91A 4C91A 5FPZA 2XL7A 4Q29A 4E2SA 5EYXA 5KR7A 1ALYA 1YI7A 4A44A 4XCBA 5BNQA 4XW3A 1ULOA 3I59A 2WWSA 4LOTA 4XUTA 1X8MA 5K9YA 4YM3A 2R0HA 2E7QA 3WZ1A 3ZFGC 4XJZA 2A7AA 4LBMA 1LOBA 4CCMA 1D2QA 1WW6A 4Q4V3 1LHWA 1ZBE2 1PZ7A 4EZHA 5JPNB 1PM4A 1FI2A 4CCNA 1DQ6A 1W8OA 2K2SA 1B35C 1VB2A 1VAVA 2H0VA 3ASIA 4RA0A 2HWB1 4CDUA 5LY2A 1L7LA 5DQ0A 5BV6A 1HW5A 5T55A 1RITA 2WZR1 4NN0A 1OVSA 3OPZA 4KMQA 4YZ4A 4A7YA 2IXLA 1CAVA 1UZ0A 4CCEA 3LDBA 4A6SA 4CU7A 2B7YA 4YPJA 5DZEA 4RS5A 4OZXA 4BMEA 1VBA3 3VL9A 3JBG1 3KV6A 5A7NA 2Q1MA 1SLAA 4CDXA 1CN1A 4OVEA 5JSPA 2JWPA 4CDQA 4NIGA 5FPAA 4QPYA 1OVPA 4I09A 2WNUB 1DLLA 1C1FA 3BTAA 4QPIC 4LT5A 4B7EA 2HWE2 3FLTA 2W0XA 1XSRA 3B7MA 4XIOA 3VBRC 3RZLA 1R083 4D7SA 1TNRA 3N9NA 2Y6KA 2BERA 3ZM8A 4JHZA 5IW0A 5GM0A 1J3RA 1S55A 3LDRA 4JTNA 4ARYA 2HWB3 3AFKA 2JENA 5FZ9A 3I54A 2PHDA 4L9BA 1HRI3 1Q8VA 2ZZQA 1IPJA 4BQ1A 5E89A 3MIEA 3RQ0A 2Z42A 2HLEA 4XCAA 1M06G 4BH9A 4C90A 2WS91 2RJ2A 1OUSA 1C3HA 4GALA 5LB6A 2YGLA 5LY1A 5F37A 1O8SA 1GSLA 3WP6A 5FYBA 5FZ7A 3J7MA 2D7FA 3WNNA 4A3ZA 1AVBA 1OFSA 1ASJ3 1R64A 4O9EA 1CESA 1RMU3 1ZZ8A 3NAPB 2W1UA 4CP0A 5IK8A 1RUD1 4Y5SA 2BWAA 2Y6FA 4M3CF 4Y1UA 4KGGA 3Q9OA 1IG3A 3GBFA 2QQPA 1W2TA 2Q0AA 4BPZA 1N1SA 1LHUA 1CIYA 1V70A 4OHWA 4YZ5A 1AR81 4IEPA 4HSJA 5BY5A 3CHXA 4META 2WC2A 2HYKA 2ORZA 5FZKA 4CZSA 4JV4A 4ZU4A 2OKXA 3ZXEA 5BNOA 1ULPA 4EE2A 3WY6A 1CX1A 1GQHA 3DN7A 3K2OA 3VB9A 4QQOA 4RYDA 2WJSA 4AHXA 1RUH3 2DVAA 2ORXA 3WW4A 4NRPA 3NO8A 4ZKTB 3HT1A 2WO1A 5CISA 4Y5TA 3WLUA 2XHNA 1OPOA 4IQPA 5CFDB 3V0AA 1FMD2 4MHRA 1XNTA 2Y0IA 1RUF1 3KD4A 1KITA 1AYM1 4WM8A 1L7QA 3WUCA 3SH5A 3APBA 3ZIWA 5CFCA 5JXHA 1I1EA 4KBZA 4N7IA 5KC6A 4ATEA 5FTTC 3N9MA 3RS6A 4K21A 3G6JB 3POSA 1DGWX 2ET7A 5EJ1B 3KB5A 1R1A1 3WW2A 1AUYA 2RMU2 3ZKUA 1D0GA 1JW6A 3R4UA 5JSOA 2Z4FA 2BUKA 3KV4A 1BYHA 4YVSA 2G9FA 2R16A 5FZ8A 4YVWB 2AZ5A 1JODA 3VBSA 1UN1A 3O1UA 2DVFA 3BTZA 1QXPA 5D8AC 1QIQA 1TVGA 2RS13 3BTXA 2IC1A 2NQYA 1D4VB 1GZWB 3TEWA 2ZTNA 1S2EA 1GQGA 5AVPA 1UZWA 1R082 3K46A 2ENRA 4YW5A 2FZ1A 3K51A 4EZ4A 1X82A 3LF7A 1TZOA 2MNGA 5F3EA 2E51A 4DRVA 3K3OA 3ZVXA 1CZSA 2A6VA 2J1RA 3UKNA 5FMCA 2D6PA 4CDXC 3VHRA 1G9DA 1GV9A 3FL7A 2C4XA 1DF0A 1SPPB 4S2HA 4YGDA 4I2OA 3VBUC 3NMBA 1GMMA 2ZGKA 2ET1A 1OOPA 1NLSA 1XU1A 3DYMA 3T1LA 1RYYA 1PO11 2ZEXA 4CDUB 1PK6B 1YQ8A 5FREA 1OD3A 3CU7A 4OZOA 1QJEA 2OZJA 3AMQA 3ZR6A 1MEC1 1BKZA 3TN92 5C6CA 1QNYA 1BEV3 3TN91 1RUH2 1W03A 3CJXA 5J09A 4XF4A 4IE5A 4U36A 2GZWA 2DCTA 2ZEZA 2IXIA 1VBD2 2W1QA 4SBVA 4LPLA 3RJRA 3SEEA 4K1ZA 3T1MA 2RDSA 5F3CA 4FPGA 1I6XA 2YBSA 1NUKA 5FP9A 1OLRA 1DYPA 2ZGSA 3FUQA 1SQ4A 3VD7A 2VCBA 1V9U2 2FBEA 2IVJA 5FZ4A 3ZXLA 1U5XA 3AXDA 3H7JA 4AEDB 4R52A 4OHVA 3LA3A 4PLMA 2WQ8A 2DFCA 4LO8A 1D0HA 3CDZB 1UXZA 3BI3A 3HEIA 2PAEA 2VZ1A 1AYM2 4EWDA 1F8VA 5C5TA 2QCSB 1GNHA 1WA6X 2IFRA 2R063 2ZPXA 1DYOA 3D5OA 3N3HA 3AZVA 4N9IA 2HH9A 1BCXA 3I2JA 5FAXA 1RUC2 5EFUA 2Y38A 5KC5A 1QHDA 2V5DA 1PX3A 4HSLA 3H8XA 1FYUA 3PHMA 3O1MA 5IAXA 4KWJA 3O0WA 4QGNA 2XWBB 5ABJA 1H2KA 2WWUA 2JKBA 4CUCA 3U75A 1PIV3 2VD7A 4AVBA 2O8QA 1UU6A 2G19A 2KM2A 3OEAA 3IZOA 5A7WA 4JGYC 5BNPC 5FWJA 4FPLA 2BZDA 1W90A 2QVSB 2OQ6A 4X6QB 5ABJB 2PHWA 4JKKA 3PJQA 4AL9A 2ZS6B 3WDWA 1EPZA 3GZUC 4RS5B 3ZYBA 3ZR5A 3QOPA 5A7QA 3RPQA 2WBKA 5EHDA 1FATA 1COV2 1ULCA 2ZGNA 4AI0A 1YIPA 1S0DA 3PUQA 2ZEYA 4A7KA 5AC92 1X7NA 2HWF1 3OTFA 3ZFEB 4AOCA 2EICA 4YW2A 3AKTA 3AB0A 2XBO1 3J7LA 5KBFA 2GSYA 2RR12 2VVFA 2RJKA 3I3MA 2WNVA 1OKOA 5A32A 3IDCB 4C0BA 2CAVA 2QDRA 1PVC3 2QUOA 3MIFA 2W52A 4XJWA 3T2OA 5EIYB 3WG4A 4W6WA 4RQPA 1IKQA 1Z78A 3NV2A 4ZY9A 1WW4A 3WW1A 1LGNA 4MXWA 3WHTA 1TQ5A 3L9JT 4XVHA 3KVBA 4AGGA 4XHXA 5FY8A 1X36A 2WZ8A 3DXUA 4IW3A 3LFMA 3KT4A 1OH3A 3ABZA 2Y26A 4HKOA 3OGRA 4RSUA 3VZMA 1PK6A 4P9XA 1E57A 5G05L 3H0OA 4GJYA 3NQHA 1TMF3 4PCRA 3THCA 3SITA 3ZYIB 1LOFC 4CDWC 4GWIA 2BPA2 1S0BA 4MSVA 4Q4X2 4P9LA 2WT0A 4YG6A 5FLJA 1URXA 2RM22 1W6OA 3Q8AA 4D94A 4TSVA 3OB8A 4QQ2A 3C2UA 4LBQA 2X53S 1SPPA 3KQRA 5JUVA 5LBBA 3GHMA 4GIQA 3TBDA
chains in the Genus database with same CATH topology
2Q1ZB 1Q3EA 5FO7B 2VMHA 2O1QA 4L8QA 2DCKA 1RJ7A 3NWKA 4LUMA 3TNQA 4A7ZA 3D0SA 3P3NA 4W65A 4XF1A 1G6NA 4I0BA 3FFZA 4HK9A 2TUNA 1MVEA 1LGCA 3AMHA 2I2SA 4XE9A 1W6NA 4HANA 3HD8B 3NV3A 1MS0A 1QU0A 1ND3C 1BEV2 1LOEA 1W6QA 2CGNA 2XWJB 2YYOA 1AR93 2JG8B 1LENA 1OOPB 2HWC3 2PHLA 4GXLA 2D3RA 1BBT1 1LHNA 3DUIA 4Q4V2 1VBA1 5E88A 3LA2A 2VUAA 5AC93 2ZX1A 4UW5A 2X8KA 2XUMA 3B01A 3MIHA 3M3CA 4K9SA 1RUJ1 3VKNA 4DMIA 1H4HA 1VBC2 3ILFA 4U2AA 1COV3 5ABJC 4YVWC 1ZRDA 1MZFA 5CB7A 2A73B 3EHKA 2BTVC 3VBOB 1IGOA 4XFCA 1RUE2 4WVZA 1FT9A 4QXKA 2I45A 3X29B 3FBYA 1PGL2 2KXLA 1I3HA 1WCDJ 4KWLA 1RMU1 3FFQA 3LKJA 3NAPA 2D44A 1FOD2 4PDWA 5JAXA 1O7FA 1BMV1 5JMCA 3DL3A 3VBUA 1NCQB 1LTEA 2XG3A 4DXZA 4E2QA 5DUXA 2PLV2 3D6EA 3AZYA 3M8LA 1WUVA 5T5OA 3VLBB 4M01A 3UKVA 4LULA 2RM23 4GH4B 2PHUA 1VRH2 3FLPA 1D2SA 1YFUA 4XDQA 3THPA 1MEC2 5I0SA 5FQ0B 1PK6C 1AX0A 4DOUA 4CDQC 5KXEA 3R6SA 5GZGA 2ZGRA 2FMYA 2P3KA 2ZHKA 1G86A 4N43A 2JE7A 4EN9B 3MICA 2VPVA 2XJRA 3E5UA 2HEWF 4N53B 1YYNA 1OLQA 1LJ7A 3RI9A 2Q4SA 2B39A 5CFCB 5FO8B 1KS4A 2ZBJA 5CA6A 1DBNA 1H8TA 2VNRA 1QJY1 2BYVE 2QZ3A 2JXAA 2V73A 3FJSA 1W6OB 1UPSA 4Z92B 4LBJA 2JG8A 4RGGA 5EV7A 1O4TA 4Y1ZA 1RINA 1DQ0A 2VG9A 2WQZC 4PQ9A 4Q4Y3 3RSJA 4CP2A 1WCSA 2H6CA 3AP9A 3IIAA 5IUQA 4AE2A 3GALA 1C28A 1LGBA 4P9WA 1NYWA 1MEC3 2D40A 4FQZA 4FOVA 3ZSMA 2EF6A 4Q0VA 3AYCA 2D6KA 3H1MA 1VB4A 2WZPP 2ERFA 1RIRA 3BIWE 2GH8A 3KCYA 1VBB3 1MS9A 1ZA4A 1AL22 3U07A 3KS7A 4YW3A 1AR82 1VBE1 3R0RA 3USUB 5E1RA 3KSCA 2EXKA 2RS53 4XHBA 5GJ6A 3M7AA 1J59A 1QOOA 3W9AA 5A32B 2F6BA 2XLAA 1LESA 1WMEA 1NXMA 4IETA 4Q0UA 4HZFA 5BNOB 3GZAA 1F9KA 1PGSA 4XJ9A 4IXLA 3RJ2X 2XLFA 2Z5WA 1QKQA 1V6NA 1BEV1 1GZ9A 1O3TA 2WLQA 4OI4A 4AGRA 4DY3A 3C3VA 3PMEA 3AZXA 4FSJA 1RUF2 3TWIA 3SH4A 4BCUA 3MFAA 3KCCA 1BZWA 3O0VA 2QE3A 3QH7A 1IPKA 4IERA 4XFAA 3HAGA 1LULA 4ZXKA 2LM3A 1HKDA 1W2UA 3JBG3 4LBQB 2A75A 1KQRA 1CJDA 3NJZA 4WM7B 4EN8B 2GH2A 3WDUA 4KL1A 4HVRA 4PBOA 3ETQA 2WINB 1V6IA 1WMFA 1UU4A 4XF3A 3SHRA 3VKFC 3RRDA 1GANA 2FHRA 4Q2FA 3E6DA 1PZ9A 3LWCA 2P34A 2VQAA 3EBRA 1AR73 4XJ8A 2YROA 3O14A 4RR3C 3BB6A 4XBLA 4Q4Y2 2HWD2 3UKTA 1OOPC 1W6MB 2B46X 4XIKA 2PHTA 3R4DB 2K9ZA 1MZ5A 4O9GA 1D4M3 4JAAA 4DRRA 1VP6A 5C8CC 4M0HA 2XBO2 2RHPA 3D0JA 3JU9A 1R093 2JDZA 1CAUA 2B45X 4AQTA 1MS5A 2P2KA 5LEJA 3MW4A 1PZ8A 4KU7A 4XXAA 3AJYA 5K8SA 4FXGB 1SBDA 1ZZ9A 1PVC2 1OQ1A 3VDDA 1DG6A 1I5ZA 2BNOA 4Q4W2 4CEYC 2RS33 3RMYA 1GZWA 1X8EA 3VN4A 1GBGA 1ZZBA 5DG2A 4LBOA 4I0WB 4QQHA 4JGZC 4MZUA 1R1A2 3TNPB 4C0HA 1LHVA 2RR13 1Z7S1 1XNCA 3GYDA 4OI2A 4QX5A 3M70A 3UK9A 5L36A 4ASLA 1Y3TA 4P5HA 1AJKA 4Q4X3 4ISRA 4XQWA 4KU8A 4YLZA 1W6MA 1RUG2 3IBMA 4AVAA 5DUUA 4JTOA 4XQDA 1YI9A 1NCQC 1DU3D 1VBE2 3MLLA 1EV12 2VXRA 3A0NA 2Q5TA 3L2HA 1XRUA 3M3OA 3HIFA 1EY2A 4K7JA 1JOJA 2EXJA 2QNKA 4XF9A 1AR91 3JQWA 1NLRA 1ZZ6A 5JDBA 5LK5A 5JOXA 4C1XA 2WFF3 1BBT3 4PIZA 1U12A 3JB8A 2YXSA 5GKAC 4COZA 2A3YA 5AC91 3B9IA 3R05A 4IESA 4BHPA 2DURA 2AENA 3SXWA 4R9DA 1JTZX 1BVP1 3WG2A 1KDKA 1LOAA 2WZR3 4OFGA 1J1TA 4OI0A 1DZQA 2PHXA 4Y1XA 3VZJA 4EN6B 4Q4W3 1W0OA 2VW0A 2ZGMA 4QPIA 1YFXA 2JG9C 2NLRA 2R1BA 4XJAA 3ZX7A 4LO4B 3OY8B 4AW7A 4EN0A 3NSTA 4B4PA 2QDNA 1MS1A 1M4WA 1XNDA 1J1LA 4F3JA 1UX6A 3FUOA 3MPPG 3ZPYA 4HBNA 4XJUA 1ZREA 4YRDA 1NY72 3B94A 3AMNA 1QQP1 2B5HA 4BLJA 5JPMB 4HETA 3INAA 4A3XA 3JD72 1N3QA 4DQAA 5AFBA 1OA3A 2R062 3BCWA 1DGWA 1RTVA 2R061 2H6BA 5J37A 2B8MA 2ARBA 1QJX3 5H9SA 1QDCA 1POV3 4UW4A 1ULDA 3CL1A 2E7TA 3TYJA 1QJY3 1QY4A 3USSA 4LUKA 1LECA 3W59A 3HWJA 2GU9A 4FPOB 1PO12 3TRSB 2C0ZA 1AHSA 4COVA 1O3SA 2PLV3 3MGUA 5J36A 1XXNA 2V09A 1MVQA 1JUIA 1CONA 5DUWA 4FPCA 3AP5A 2X5IA 2DVBA 5BNOC 3CNAA 3J8F2 3UV9A 3MW3A 4AWDA 1VBC1 3WP3A 5I8YA 1AX2A 3WV6A 5EZWA 4WM8B 5DDJ1 1AL23 3VZLA 4IEXA 1B35A 1KJLA 2B42B 4Y20B 1BBT2 3VBFA 2WSUA 5I0RA 3VV1A 1B09A 4LO6B 3O0XA 1OKQA 2YMZA 3AKQA 1R1A3 4S2DA 5JR7B 1S0IA 3RNSA 1RUI2 2BW8A 2R073 4PIYA 1C5IA 2UWBA 4N9HA 5CG8A 5GLZA 3K48A 4X8NA 4ATFA 4I01A 1VJ2A 1AXKA 1J58A 1YUDA 1HV1A 1PIV2 3GBWA 4L2NA 3MF6A 4PDWC 1KFXL 4QPGA 3ILNA 1UIKA 1AJOA 4AXOA 3RDIA 1RHI1 3FMGA 3QLQA 3IPVB 3USUA 4JVAA 1HXS2 4ZU5A 3SCGA 3WDXA 3J8F3 2GDFA 2ZX2A 3ATGA 1QXRA 4TYSA 2ZKNA 3ME2A 4FVVA 3SNMA 1O91A 4B29A 4BWOA 2YY1A 1RVF1 3OD4A 3S0MA 1IOAA 4Z1VA 1N1YA 4FP3A 3JZVA 1Y43B 1AR61 3B02A 1U5ZA 2DTYA 4S2GA 2ATFA 2ZX0A 1SCRA 2DCJA 3J9SA 1YO8A 1YXWA 4EV0A 4GWNA 2IWGB 1POV0 2YZ4A 4YZ3A 4Y26A 5C4WA 2A6WA 3VBHB 1FAYA 1MS8A 2G9GA 3V0BA 3WR0A 4AEDC 1TME3 3VKLA 1LU2A 3PMSA 1IKPA 2DUQA 1DQ5A 3ZFEC 3MLJA 3ROUA 1FPN2 4QQLA 1AR72 3FE5A 5CNAA 4K1YA 5BUVA 3W58A 5IK4A 1OPMA 4WM7A 2HKXA 3LAGA 2E53A 1HRV2 5F6LB 2UURA 4GULA 1DGRA 1OQEA 4LO5B 4YYOA 2AGSA 2AYHA 1HXS3 2ZGLA 1HDKA 4QT6A 4AHYA 2JX9A 4NVPA 2YDEA 4P9JA 2PHRA 4FT8A 2GMMA 4I3GA 1QQP2 2X5IC 2ZGOA 4NHLA 4BLIA 1LEDA 2DCZA 2DU0A 2VOVA 4P9IA 2A6YA 3E5QA 3OBRA 4D7TA 2MEV3 5GLWA 4OHZA 1ZBA2 1FNYA 5HCFA 1UD1A 5T5JA 2OIIA 4R4ZA 1FOD3 4Y22A 5J7MA 1C8M1 5DG1A 3POWA 1GNZA 4MV2A 4N43B 2EA7A 2OYZA 4TZDA 4OHYA 3KGZA 5FPXA 2HJIA 1Q43A 4M3CB 4WVMA 3IDEA 4FBFA 2ZABA 1TNFA 5ACA3 5BNPB 1V9U1 4OHXA 1SACA 2LTNA 3JUUA 3ZFGA 1AZDA 4NR1A 1HQNA 3I4IA 1RVF2 4N7UA 2ZGUA 4AI8A 4IV3A 4CEWA 1VBD1 5D1IA 1WLWA 1RUG3 3MLKA 1RUE3 4DNYA 2ZX3A 3WDYA 1RUH1 3ZFFC 5AVAA 4CDUC 3I59B 4AI1A 1C8M3 1G7YA 4FP2A 4IV1A 2E7AA 5K0UA 1RUC1 1MZ6A 2GMEA 3AYAA 5DZGA 1CJPA 1NA1B 1AXYA 1X50A 3AJZA 3KM5A 1XYNA 1NE4A 4YARA 1ZZCA 4LLFA 4YG0A 1QOSA 5I91A 1W6NB 1V9U3 3ZXFA 3PVEA 5DXDA 2H0BA 4XTPA 3NVCA 4XYXA 2WL1A 1U0AA 3N7MA 4KH9A 3U11A 4Q4X1 5F6KA 5GZFA 1O4ZA 1ND2A 4LBQD 4PDWB 1W6PB 4FTSA 3A0KA 3ZXDA 1L3JA 1F5FA 4BZ4A 3TB0A 1WBLA 5DZFA 1WLDA 5JSRA 5C8CA 5HCAA 5KHJA 1RUC3 1CVNA 2CWMA 4UW3A 1DFQA 3OGGA 4HN0A 4Z82A 4LE4A 1HIXA 2VMIA 1SEFA 2XVGA 4FPFA 3RMXA 5E8AA 1BK1A 5GLUA 4J1XA 2WSVA 2D5HA 2ES3A 4GB32 2RS51 2ZX4A 4XF0A 1IHMA 1AF9A 4JCKA 2GALA 3LOIA 2WFF1 4Q4V1 5A33A 1YFYA 1BJQA 4LE3A 1ZRRA 2UY9A 1YIFA 2Z2SB 1TEIA 4FCAA 3VBFC 5TSWA 5EJ3A 3GHNA 2WLPA 3WNXA 5JI9A 2XKOA 1Y7BA 1CX4A 5K7PA 2GAUA 3PVOA 4CP1A 1CQ9A 2VQ0A 1V6KA 2F4PA 4AFAA 4YG3A 4AVTA 1JUHA 1BVVA 2TNFA 4K3UA 4CYDA 1AXZA 4QPGB 5CFDA 4B4RA 1HQWA 4XTMA 3DF0A 4TWTA 3ZN6B 2VW2A 2OA2A 3MIBA 1H4GA 4M00A 5A3MA 4HLTA 5FMOS 5DUVA 3ZYRA 2HWE3 4S2FA 4WM8C 1QQP3 4IEQA 1FV2A 1QJX2 2WQ4A 2ZMLA 3I2DA 3AP7A 4YZ1A 1SBEA 2FMDA 4MLOA 2UWCA 4XETA 1ZBE1 3IM0A 2LALA 3IDBB 3WD5A 3WCSA 3BALA 3V64A 4LBNA 4RHV2 3B00A 3EO6A 1Q8SA 4FQ4A 4R4XA 4XMAA 4Z8BA 1S0JA 5BNPA 1LOFA 5KXBA 2CYFA 2HWD3 3ZSEA 1H2NA 3VHOA 1ASJ2 1XNKA 5FQ0A 4IEUA 1ENQA 1DDLA 1LCLA 3ZN4A 5DDJ2 2HWF2 2VY0A 3ACLA 1VBB2 3M1HA 5C4WC 4IEWA 4IV1B 1M06G 5CU1A 1VBC3 4GQ7A 1WGPA 1O3QA 3ZYGA 1FPN1 1D4M1 1KXGA 5JCTA 5K0UB 3OJBA 3RYRA 3VKMA 4HPKA 4QPGC 4XPVA 4B8EA 2XBO3 2R072 4K8FA 1QJY2 2RE9A 3PVNA 2P37A 4RQPC 1VR3A 2GMPA 2VECA 3JQXA 2XVLA 3LB9A 1H0BA 4MYEA 3S7IA 4H14A 4XBNA 1PO22 1NCRC 2PAKA 1W39A 4RGAA 3VZOA 2XHKA 1Q8OA 2JG8C 4G3YC 2VOWA 1Y9QA 2CWSA 2XJVA 2ZOEB 4NHMA 5I0UA 3E97A 1PGW2 2E9QA 1SFYA 4L97A 2NP0A 1GKBA 5GALA 3IPVA 1K5MA 1F5JA 1C4RA 1BQPA 4HK8A 3LSDA 2BBVA 4OUSA 5LRSA 1UZYA 3E6BA 1ZRFA 4EWAA 4WVMB 4X8PA 1ZYBA 2HWB2 1QH7A 5CFDC 2EXHA 4AFDA 4LO7A 2EIGA 4QMAA 4QQPA 4WM7C 4DFSA 1F31A 3N7JA 4Y4YA 4OLLA 2NZ9A 4FOQA 2A70A 1HRI1 4RD7A 2Y0OA 2RS32 4Q0PA 1MR5A 3BOWA 1H8VA 2HWC1 4Y5Z0 5FBZA 1OI6A 2OUJA 4WBBA 1EYBA 2NM1A 1CAXB 2TBVA 4URTA 4EWEA 1CAUB 5EYYA 1DIWA 1Q5OA 2ZA9A 1JYIA 1SMVA 3ZO0B 2QFEA 1MQTC 2CGPA 1DZTA 4I02A 4QD2A 4BE3A 4KWKA 1UAIA 3WQ7A 2P17A 3VBFB 2YUEA 2EVXA 1CD3G 3U10A 1RGSA 2PA7A 5D8AB 3FX3A 4YNIA 4RL7A 3HT2A 4RS5C 2XJTA 2JECA 3ENRA 2R1DA 3RWNA 1X33A 1S0EA 2AUYA 1EP0A 2NMOA 4RQPB 2CNAA 2Q30A 3NKGA 2D93A 1NOVA 1H2MA 4JDNA 1HLCA 1EAH2 4QGLA 1QJU3 4MGZE 4IV1C 3VDDC 3QCWA 5K0UC 2PHFA 4D7YA 1SFNA 3ELNA 2D43A 3GBGA 4HVOA 2WFPA 3V56A 1UF2C 2UYAA 2D3SA 4AEDA 1I9RA 1A6CA 5GZCA 3ES4A 1RC6A 2HEVF 3TAYA 2QJVA 2QKDA 3VZNA 1KFUL 4X6RB 5IK7A 5FFOC 1B35B 2PTMA 2PFWA 2SLIA 1S0FA 2MPFA 2RS31 3CLPA 3WUDA 4CEYB 1ND3A 1OMIA 4WZFA 4CDWB 1JH5A 3BOPA 3H8UA 4YVSB 1S2BA 1IZ3A 2GN7A 3POYA 4ES9A 4FTBA 3BU7A 2ZACA 3DPRC 4PJYA 4XFBA 2CV6A 5C8WA 5CG9A 4Y1VA 5HCBA 4EJRA 1H30A 2XH6A 3WDVA 1GYKA 5JWPA 1A78A 1OA2A 2RMU3 4QPIB 5SV8A 3VBUB 4ORFA 3ALQA 3ILRA 4XILA 1SDWA 4ES8A 3NV4A 1O5LA 2ZCWA 2RS12 2D5FA 5L73A 1ND2B 4Q1RA 1EV11 3OBTA 3HN1A 2G4IA 2ZAHA 5HXVA 2ILMA 3AK0A 3M3IA 3VBSB 2OZ6A 4KG0A 3IT8A 4PLOA 2VUJA 3H1WA 3CF6E 3LGRA 4AEJA 1YJLA 4M3CA 1UPIA 4AI3A 3P3PA 3WHUA 2ZGTA 1SLTA 3U4XA 1NZCA 2P3IA 4NHKA 2HWE1 3H3ZA 1JBCA 4HKLA 3N7KA 1UKGA 5T3NA 1HV0A 5BNNB 1A8MA 4Y22B 4YFZA 3AM2A 4BMBA 1ND3B 2R041 5KXDA 2R042 3CJIB 3J4UH 4BIFA 2A5ZA 3LOBA 2DUOA 5JIUA 3KT1A 4MGIE 4IEZA 5FMOL 4Q4W1 2D6LX 5LEKA 1LODA 4W6XA 4XFHA 5IT6A 1N47A 1CGPA 1W0PA 1YRZA 1AYN2 4KGQA 2DFBA 3WP5A 2JEMA 2IXCA 5SV5A 3ZN6A 1VLNA 5CADA 1MQTB 4E2GA 1ONAA 4H7LA 4A2UA 1MS4A 1RUD2 1DYKA 4CEYA 1QJZA 1TE1B 2R49A 2HWF3 5JI7A 1W6PA 2BFUS 3ZN5A 2ZHLA 5LRRA 3VKOA 3FHIB 5GZEA 5C9AC 2DWRA 3WOGA 3VBRB 5CAZA 5JVVA 3ZMOA 2HWD1 1V6OA 2VULA 3EQEA 3THTA 4Q0QA 4R9BA 5JLVA 4YM0A 1C5HA 1VBA2 1LKNA 5HBAA 1JN2P 3FBMA 1PNFA 1G9FA 1UZZA 1VIWB 2DU1A 2D98A 4UBGA 4RHV3 5KHHA 4MH0E 5BYNA 1POV1 4FPEA 3H3UA 1LB2A 1C1LA 2A3WA 1REEA 2O0OA 1LRHA 1XNBA 4Q27A 4YZ2A 1YNAA 3MZHA 5BXXA 1TMF1 4IEOA 1GICA 4HPKB 4XQ4A 2ZGQA 3AKSA 4QM9A 4I3PA 1LHOA 1QWRA 1WMDA 2HEYF 4B4QA 1MACA 3H1YA 4IL7A 2GC3A 3ZXJA 2NMNA 2EXIA 1SLBA 3G7DA 4XBQA 4NO4A 4N53C 2VH9A 1O3RA 2XJSA 3EJKA 1ZRCA 3ES1A 5DDJ3 1F2NA 4GKXA 4KQ7A 3H50A 1WD4A 1ZZ7A 2D6MA 5JOZA 1UIJA 3DPRB 2EALA 2DCYA 5FOJB 1RHI3 2CAUA 4K40A 4V1PA 3A4UA 2QZ2A 2K0GA 1EAH1 2VNOA 4Q4Y1 4AYUA 5GZDA 2IXJA 1ULGA 4ISQA 4Q26A 1IS5A 1PO13 3I7DA 4QM8A 2D97A 1KD7A 4ZU7A 4KBBA 3I8TA 4FPJA 1NCRB 3ZFGB 2BVBA 4AVSA 2NPIA 2AH2A 2DVGA 1ZX5A 1VBB1 1YHFA 3VZKA 3AP4A 3LZZA 4ASMB 1RUJ3 3PNAA 4Q8LA 4JDOA 3FLRA 1AR63 1LOGA 2C5DA 2ZHNA 3H9AA 1O4YA 2UY8A 3AXEA 3KZ4C 2NN8A 2PAMA 4BYYA 3J8F1 2OW4A 4RR3A 4YSFA 2HWC2 4CDWA 2OUHA 4YVSC 4ITCA 5BPXA 3VBRA 4JRLA 4COWA 3GZTB 4D3WA 4GH4C 2W68A 1DQ4A 1RB8G 4UW6A 5I0TA 4HT1T 3OF1A 1ZM1A 5B2GB 2FQPA 1KS5A 4LBKA 2A3XA 3AYDA 1XQNA 2R32A 4GMP1 2AR6A 4HFSA 5JOYA 4LNVA 4BIOA 4CTEA 4MX3A 3AZZA 4MGYE 2VOXA 4H55A 4QHBA 4RFT0 1H1AA 1OSGA 2C1FA 5FLIA 2AREA 4YM1A 4JGYA 4GMP0 5CBLA 1K5MC 2WNUC 5C8CB 4LEJA 1QH6A 2YHJA 4MGKE 2RM21 3RZZA 1RHI2 4LHNA 2P3JA 1WLCA 3WP4A 2ZJCA 2R6QA 4XZPA 3KCXA 4HVQA 1FOD1 1HXS1 1NY71 3MFCA 3WX5A 3VUOA 4JGZA 2GNBA 4AG4A 4FAHA 2KA3A 1G9AA 1J3QA 5FRAA 1LOCA 1ZBA1 1EPWA 1ZBE3 1V6LA 1AYM3 1A8DA 4AFCA 2ZMKA 3AMMA 3AX4A 2MEV1 5I93A 3LCPA 4I0AA 5AFEA 3GF6A 4IEVA 2GC2A 1XU2A 1PHMA 5L19A 2N7GA 2V5YA 3V65A 1UW8A 2WA3A 1NCQA 2OVUA 4Y20A 1OD5A 4MXVA 5EWSA 1N3OA 5FDBA 3NKTA 3VBHA 4LTAA 3RI8A 3B93A 2FZ2A 2GC0A 5JZGB 4FXKB 1C8NA 5T5PA 3SCHA 1V00A 3QD6A 3PLQA 3NAPC 3LA7A 4JQRA 4M3CE 4HMZA 1PNGA 4AFMA 1XYOA 1FPN3 2XVKA 2ZGPA 1VBD3 3IKWA 2GNMA 1Z0HA 4COUA 1NXD1 5IK5A 4FO9A 5T52A 1VBE3 2EAKA 1RUG1 1RL3A 4LHKA 3VBOA 4IEYA 4R9CA 3WG3A 4AFBA 4H7MA 1FV3A 3MDPA 1WBFA 2B9UA 1QMJA 3AYEA 1TME2 5ACA2 2RMU1 3ZDSA 4AEMA 1NA1C 3NL1A 1A3KA 3MIGA 4E4DX 1V6JA 2IZWA 4P14A 4XXPA 4N43C 1N3PA 1ZNPA 2UYBA 1QNWA 1Z7S3 1MS3A 4QGMA 2MHFA 2RS52 1ND2C 1CPNA 4LR4A 4F7ZA 1QGLA 4E4ZA 3URFA 3VHPA 5LK7B 1CPMA 1WLTA 3RYKA 3ZSKA 5GLVA 1REFA 4TLFA 2X5IB 4L92A 1GLHA 3SLIA 1LR5A 3BODA 3O5SA 4FAGA 4MUVA 1LU1A 4H3WA 3JCIA 1RVF3 1HX6A 2SBAA 3VDDB 5GLTA 2R043 1DGRN 4Q8KA 3SMHA 4MXWB 4DS0A 2JE9A 4OUMA 4YM2A 4N53A 2GNTA 1Q8QA 5L7OA 4FTEA 1QF3A 2BEOA 3MW2A 3ZIXA 3AKRA 5C9AA 1CAWB 1AR71 4EROA 4GKYA 2DF7A 3AP6A 5KHGA 3R4SA 1RUD3 4XFIA 4N90A 4RHV1 1HRV1 3ZFFB 1SLLA 3WCRA 4DINB 3KGLA 1UU5A 4JGZB 1CAXA 2DYCA 3CJIC 4FPKA 1ZVFA 3JB4C 4L11A 5HI0A 1PMIA 3AKPA 3MPBA 1AYN3 3CEWA 3L2YA 2XJUA 1T6GC 1K5MB 2VVDA 4P9GA 1Q8PA 5T50A 4E4SA 1YFWA 2JJ6A 4CDXB 5KHKA 3MI8A 2IFWA 4E27A 3J26N 4YW4A 1RUNA 2VGDA 3VGIA 3WINE 4K6BA 4KG8A 3UJOA 3ST7A 5A33B 5J3UA 1PVXA 3S7EA 1YWKA 5CVRA 3QBQA 5J48A 4BM8A 4GH4A 2I07B 3JD73 3ZXAC 1D4M2 4YFWA 2Z79A 2CY6A 2WKKA 2XKPA 3DGTA 3S6PA 1XYPA 2W08A 3VBOC 1QJU1 3N36A 4OULA 3V0BB 4FOWA 1H8TC 2A6ZA 3QH6A 2BGCA 1N1VA 2RR11 4IV3C 4CEWC 1PM7A 3D4KA 5C4WB 1IS6A 4DB5A 2ARXA 4D69A 3FC0A 1RUI1 3OCPA 4E9KA 1RUOA 3ZFFA 2NYYA 4PF5A 3H7YA 4GA9A 3WW3A 4M0NA 1UL9A 1RUE1 2OPKA 1N1TA 3WDTA 1AL21 3WT3A 1MZEA 4XFFA 2VOKA 4L99A 1OFNA 4LHLA 1SCSA 4SLIA 3VL8A 2EAAA 3HBZA 4LLOA 1CIWA 1UMZA 4UXAA 4WV8A 2WS92 4GWMA 2DUPA 4Z2WA 3ZMNA 5JZGC 1XE7A 3AMPA 3N7LA 1WCKA 4LBLA 1VRH1 2WA4A 4JC1A 3WXPA 5F9TA 2ZZJA 3NV1A 4AQ6A 4GMP3 1RUI3 1SLIA 2VNGA 4AVVA 4AVCA 4AI2A 1ENRA 1S0CA 4MVTA 3WQ1A 3O12A 4DPNA 3ZXKA 1SLCA 5KXCA 1COV1 4NPRA 3HMYA 3IWZA 4ONUA 1ENXA 1EV13 4XOGA 3VBHC 2A71A 1QXJA 5I8SA 2D6OX 1NQDA 3AZWA 1PO23 2IXKA 2JG9B 2A6XA 1FX5A 2ZKLA 3E5XA 4I30A 4QU2A 2Z69A 4FOYA 4DY5A 5L7OB 2WNUA 5A3LA 3CJIA 1VRH3 4PIXA 2BFUL 3RG0A 2TEPA 2ZAAA 2WNVB 4YW1A 4G9SB 3B3QE 4Y24A 4Z07A 2YPJA 1ZBA3 1LEMA 4W6YA 2ZMNA 1KRIA 3HQXA 1PIV1 1ULFA 4UBHA 1DGLA 2R30A 1PGW1 1IS3A 3DKWA 5C9AB 5I8TA 1NA1A 1G8WA 1TME1 1J3PA 1G9BA