3WP5A

The crystal structure of mutant cdbfv e109a from neocallimastix patriciarum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
227
structure length
227
Chain Sequence
EFQSFCSSASHSGQSVKVTGNKVGTIGGVGYELWADSGNNSATFYSDGSFSCTFQNAGDYLCRSGLSFDSTKTPSQIGRMKADFKLVKQNSSNVGYSYVGVYGWTRSPLVAYYIVDNWLSPFPPGDWVGNKKHGSFTIDGAQYTVYENTRTGPSIDGDTTFNQYFSIRQQARDCGTIDISAHFDQWEKLGMTMGKLHEAKVLGEAGNVNGGASGTADFPYAKVYIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDBFV
publication title Structural Analysis of a Glycoside Hydrolase Family 11 Xylanase from Neocallimastix patriciarum: Insights into the Molecular Basis of a Thermophilic Enzyme
doi rcsb
source organism Neocallimastix patriciarum
molecule tags Hydrolase
total genus 56
structure length 227
sequence length 227
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp5A00
4H7MA 3AKRA 3LGRA 1AXKA 1BVVA 3VZLA 1H1AA 1KS4A 1XNCA 2BVVA 3MFCA 2DCZA 4HKWA 1W2UA 4XQWA 3AMMA 1OA4A 3AKPA 1NLRA 3WP4A 1XYNA 1PVXA 5EJ3A 3VZNA 3VHPA 1YNAA 1HIXA 2F6BA 1H8VA 1HV1A 3AKSA 3WP6A 3AKQA 1XNDA 3WP5A 1REFA 3WXPA 1UU4A 4IXLA 2JEMA 2QZ3A 3AMPA 4S2DA 1F5JA 3VZMA 2D98A 3AMNA 4XQDA 3M4FA 4NPRA 3AKTA 5K7PA 2NLRA 5HXVA 3AMQA 2B42B 3VZJA 1UU5A 3WY6A 1T6GC 3WQ0A 4XQ4A 1C5HA 1XNBA 1OLQA 1XYOA 3WP3A 4S2GA 1TE1B 1H4GA 2VULA 2VUJA 3MF9A 3VHOA 3AMHA 3WQ1A 1BCXA 2BWAA 1IGOA 2JENA 1QH6A 2Z79A 3VZOA 1OLRA 3VZKA 3RI8A 1REDA 3RI9A 3VL9A 3ZSEA 1HV0A 3B5LB 2DCJA 1XXNA 3VL8A 3WR0A 1H0BA 4HK8A 4HKLA 2DFCA 2B45X 1M4WA 1KS5A 2VG9A 3EXUA 3VGIA 3VLBB 1BK1A 4HKOA 2NQYA 1XNKA 1UU6A 2C1FA 1OA2A 2B46X 1OA3A 2BWCA 3MF6A 2VGDA 4S2FA 2DCYA 3B7MA 1QH7A 3HD8B 1XYPA 3LB9A 5K9YA 4S2HA 2DCKA 2JICA 2QZ2A 4HK9A 1C5IA 3VHNA 1ENXA 1REEA 1UKRA 1H4HA 3O7OA 2BW8A 2DFBA 3WT3A 3WX5A 3MFAA 3WQ7A 2D97A 4XPVA
chains in the Genus database with same CATH superfamily
5JIUA 3BI3A 1AR71 3VHRA 1JHNA 3JU9A 3LIGA 3UGFA 2IC1A 4CUCA 3S7IA 4QQPA 2WNUC 4JTOA 4XURA 1P8JA 2SBAA 3MFCA 4CUGA 2VCCA 5FZBA 1W0PA 1JN2P 1GUIA 2WT1A 1ZRRA 4CDWC 1OOPB 1W8TA 4FPJA 1RUF3 1CIYA 4MYEA 4K8FA 3ZFEB 4WM7B 4XFHA 1NUKA 1VAVA 4LLOA 4FAHA 4UFLA 4Y24A 4LNVA 4PF1A 4YVWA 3BTZA 4X6QB 2QQWA 4PLNA 1H2LA 1ZA4A 2XWJB 3L9JT 3WG1A 3IAQA 3SHRA 1UWWA 3WP6A 3CIHA 1ZRDA 1NA1A 4J25A 1REFA 3WXPA 3NVCA 4YVSA 5K0UA 1C57A 1OPMA 1DZQA 3IM0A 5DAVA 1Z78A 1F4AA 2AENA 5EV7A 5DMYA 1S0DA 4LPLA 1RITA 1NCQB 1CN1A 1R081 3AKTA 4URTA 2BPA2 1GNYA 2P4EA 4IDZA 4NHYA 3VDAA 4NE9A 4Q4X2 1EV13 1OUXA 1D4M1 4MGYE 4AFDA 4EROA 1ASJ1 2FQPA 3AYAA 1OURA 1PNFA 4FPHA 4YZ4A 4F3JA 3HBZA 4DXZA 3OG2A 3D3AA 1TEIA 2Q8OA 1YFUA 2HWF1 2P34A 1SLCA 1HB1A 2HJIA 2VUAA 5FUNA 4P9WA 3ZFGB 5FZ4A 3VHOA 1PZ7A 4Y5TA 4SLIA 4CDXA 5DAXA 2XONA 1IGOA 3CKHA 2JENA 1EUUA 2XVGA 2VJXA 2YPJA 1W2NA 4MG2A 1DYPA 4QD2A 1HB2A 3THDA 2RS52 3VL9A 4IETA 4BWOA 4DOUA 1RYYA 2W2IA 2BOJA 2HEVF 2R0HA 3SKVA 5E88A 1N1VA 2FDJA 1XXNA 2XVKA 1LOFC 3RYKA 5LEJA 3PIJA 2ZMLA 3PUHA 2AEYA 4JQTA 3W5NA 2VPVA 4P14A 4LIUA 3PUQA 3S57A 5AVAA 3POEA 3THTA 3ZMNA 5D21A 1V9U2 5ABJA 1H6YA 4TTGA 1Y3TA 1BK1A 4QQHA 5I91A 1C1FA 2IVIB 5FRAA 1I6XA 1ULOA 1YC61 4IEYA 5LK5A 4M3CA 1TME2 2BYVE 3VD4A 4YVWC 5KXDA 2YC4A 1UXZA 2FZ2A 5SV5A 4QKFA 2DCYA 2Q1MA 1Y9GA 3TYJA 3UESA 1DCSA 4I3GA 4IE7A 4XF9A 2V4AA 1NT0A 3KV6A 1VAMA 3ACIA 3BVCA 3BOWA 2Q0AA 2LW8A 2J42A 1W6QB 1X8MA 5C70A 3VD3A 1VB4A 5CNAA 1AX1A 2D44A 1VALA 3VBFC 5FK7A 3OUIA 3WDVA 1BEV1 2IXJA 4H14A 4FT8A 1AYM3 2W91A 2VO5A 4HLTA 5FYMA 4GQ7A 2XKOA 1R1A3 2WS93 2QDRA 2ZEYA 4JGYC 4JGZC 4PQQA 1H2NA 5HBAA 2BTVC 1NOVA 2GNDA 1FPN1 3HIFA 5GLZA 2VW1A 2DUOA 4IESA 5KR7A 1YFXA 4JAAA 1NG0A 2W9XA 5FBZA 1NLRA 1JZ7A 2ET7A 2HWC3 1JXNA 5EQUA 4KGQA 5F1RA 2IWGB 4FP3A 2VXRA 4G4FA 3NV4A 3ILFA 4UFMA 3RYRA 5BNNC 5LY1A 1F31A 1Q3EA 3I4IA 1LESA 1XNDA 2X5IA 3AYCA 2VVFA 4IEQA 4R9DA 4ZS3A 2I07B 5T5LA 3RWNA 4XBQA 1YQ5A 2VQAA 1S0GA 5DUVA 1SBDA 2EXHA 2XQXA 3ZXEA 3MIBA 2XJQA 3LE0A 1W0NA 1ONAA 1W9TA 1IG3A 1UMHA 4QX1A 3ZIXA 4M3CF 3L2YA 4TYSA 3WG4A 4PLMA 2W46A 3ZM8A 1MS1A 4OULA 5DDJ2 4BPZA 5ABJC 3POIA 5C3RA 1D0HA 5DQ0A 3WY6A 3OGGA 3ATGA 2EIBA 5C3QA 4LBOA 1MR5A 3CQOA 2NMOA 3SEPA 2JD9A 1XYOA 1FMD2 2PLV3 2RM21 2ARAA 1HRV2 5FFOC 4XJAA 2V73A 4N8MA 4HN0A 4Z2AA 3SH3A 3M3IA 3QH6A 2J1RA 1BBT1 3C7EA 3CU7A 3ZPOA 2D93A 4OHXA 4AEDB 1W8ZA 1M06G 1AHSA 3N9OA 4KBZA 5FY1A 4CRQA 2BZDA 1AR81 4XMIA 3E6DA 2WDBA 4O7XA 1AR61 4OI1A 2LALA 5D8AA 3EB7A 1H30A 5F7UA 1YHFA 2BDRA 2OUJA 3TBDA 4A3ZA 2WLQA 1HV0A 2ZMKA 3G7DA 5JPNB 4CEYC 1W06A 4IE0A 4MGQA 5BV6A 4IUGA 1D2SA 1O8PA 1VBB3 4JVAA 2P37A 3IDCB 4BQYA 1W2AX 1EPZA 4DEVA 2MEV3 3B02A 2ZX1A 4QDRA 4GWIA 2RMU1 1G86A 2YZ4A 1W8HA 4IEUA 4D6RA 5F8PA 5C9AB 4DUWA 1GZWA 1OA2A 2BNOA 4E2GA 2CTVA 2CYFA 5CVRA 1QOSA 4BK4A 1UY1A 4CCCA 4JQRA 5BNOC 5JMCA 1RUI3 4TWTA 2AUYA 2XVLA 3I2OA 4Q0SA 1CR7A 1GSLA 2VY0A 4Q4Y3 5CKNA 5LK7B 3ZOIA 1UL9A 4YW3A 3IIAA 4Q26A 4XFCA 2J1TA 4Y4RA 3T2QA 5FZLA 2FHRA 4OHVA 3O1VA 3WDYA 1RB8G 4BQ3A 2ERFA 4G9SB 1DGRN 4LJHA 2J1SA 1H4HA 2C24A 2RS12 3KS7A 1OQ1A 5CFCB 1AVBA 1ENSA 2ZGUA 1VMJA 5FDBA 2W1SA 1HQLA 3NWKA 3OD0A 1DQ1A 3GDBA 4UFKA 3AP4A 1QEXA 1PMIA 1RUD3 4NN0A 2XJRA 3D6EA 3B9CA 1LU1A 3ZX7A 1N1YA 1RUH2 3EQEA 4OMCA 4FFGA 3SXWA 5AFEA 2RDRA 1PM7A 2EIDA 1COV1 2NMNA 3BCWA 1ENRA 3BTAA 2GU9A 2VL4A 3ZYBA 1SLAA 5FZMA 1RJ8A 4CUBA 2VH9A 4GA9A 4A3XA 3PUAA 5D8AC 4ZXKA 1VRH1 1HV1A 1UPSA 2FCTA 4Y1VA 1QJZA 4NWVA 2A3WA 3VBOB 1OVPA 1W6PB 2VNVA 5A7SA 3T0DA 2FDIA 1BVP1 1VBD1 4QHOA 3AYDA 3ES4A 3HQUA 5DUWA 4NAMA 4Y20B 4W65A 3MLJA 1IPSA 1C8M3 1DQ2A 1DF0A 2GC2A 2JKBA 3DF0A 4Q4V2 4AI3A 2XPJA 2OA2A 4OZOA 4I09A 4FTBA 1RUJ1 1RHI1 5FK8A 1S55A 4RGKA 3IPVB 4Q4W3 1KRIA 2ET1A 4D94A 4LLFA 4NIIA 2JG8C 3M70A 2L9LA 3NMBA 3NV2A 3T09A 3K2OA 5FXVA 5L9VA 5H9RA 3ZN6B 1PK6B 1UZWA 3HQXA 3LQCA 2VQUA 4N43A 2W1QA 1POV0 3JB4C 3S30A 1O6UA 3C2UA 2D6MA 1LR5A 5JXJA 4E4ZA 1J59A 1O4TA 2WNVB 5ACA3 4LHNA 1YQ8A 1N1TA 3D8CA 2VZVA 4D69A 2QQVA 4OFGA 2OVUA 5FZIA 3ZYGA 5A3NA 1G9CA 4XIOA 3J7LA 3OPTA 4XCBA 1HRI3 2QTWB 4OCTA 3T0AA 2A6VA 4YG0A 1YXWA 2ZGKA 2QNKA 2K9ZA 3PVBB 4B29A 2QVSB 3FHAA 3ZKUA 3ILRA 1NY71 1RIRA 4AVTA 1RUNA 4Q2FA 2J1UA 4PDWC 5KHKA 3VKOA 1ZRFA 2B45X 3K4AA 4QPGA 4QX7A 5JUVA 3MW4A 4YM0A 5LATA 1QQP1 4CEWB 2YBPA 4BH9A 2JXAA 4BDVB 3ETPA 5JZGA 3HVDA 4H7LA 2KA3A 2WFF3 5FZ8A 4F8AA 5A6ZA 3VBHA 3H50A 1LOEA 3ZFGC 2UURA 4HL0A 2FCVA 2D6NA 2WYSA 4Q4X1 4S2FA 1CAVA 1L7RA 2EXJA 2O1QA 4BE3A 4M0NA 4UXAA 3TWIA 4YM3A 5FTTC 1UO9A 4LUKA 1S0CA 4IEWA 2QQPA 4M3CE 3GZAA 2ZTNA 1DQ5A 1ZM1A 1OPOA 2R49A 4AGGA 2YB7A 1JU3A 5K9YA 3WG2A 1G9FA 4UW6A 5BY5A 2JE8A 2R32A 3ON7A 5KHIA 1J3PA 1QJEA 4XJWA 3BPZA 2DFBA 3RZJA 2ARXA 2BV4A 2RVAA 4MXVA 3FX3A 3NQHA 3FLRA 4CYDA 1G7YA 2VNGA 2Y60A 2C26A 4FPGA 3ZYFA 2ZJCA 5JAXA 1NCRB 4B4PA 4IEOA 5A32B 4BLJA 4BZ4A 2BP6A 1E5IA 1YIFA 2XKPA 3QD6A 2DTYA 4AFAA 2PHXA 5EWSA 3WF0A 1UX7A 4N53A 4RHV1 2B5HA 3WNXA 1IS3A 5A6XA 5J48A 3VBRA 3TAYA 2G9ZA 1W2OA 4HZFA 3W9AA 1GR3A 1E5HA 3K4ZA 4LK6A 4GZ9A 2GN7A 1YI9A 5LA9A 4NHXA 3MDPA 1CZVA 1HN1A 4XE9A 3NNMA 1V9U1 3D0SA 4YW7A 1W6OB 3CMGA 2E7AA 5FLHA 4H55A 5BPXA 3VD5A 1CD3G 2A7AA 1QJU3 3NV3A 3IWZA 4C90A 2QQNA 1CIWA 3VBSA 3NO8A 3VDDA 3CEWA 2JEMA 3IT8A 1HJFA 4YGCA 1RUG3 1TME1 4CDUA 2OXBA 5F5IA 1OQEA 2Y6KA 2ZGRA 1XPWA 4X8PA 1IS4A 1H1IA 1DIWA 1EAH3 4MADA 4AAXA 1UZ0A 2ZABA 4XUQA 4GMP1 1B09A 1NLSA 3CJXA 1POV3 1R092 1R1A2 1K45A 2WS92 3MPPG 4D3WA 1YQ2A 2Z4FA 2ZGLA 1K12A 1WCUA 3IN9A 5BNPA 1DDLA 5JI7A 2UU8A 2AH2A 1DZRA 3VBHC 1V6MA 1UOBA 4X8NA 4CVUA 4P9IA 3MUZ1 3PVOA 1JYVA 1H4GA 4R52A 4WM8B 4CCLA 2HWC2 2VUJA 2BUKA 3I2KA 5HCBA 3P3NA 4DRRA 2WLPA 2XB6C 4P02B 3MZHA 4DFSA 2ZAAA 4JHZA 4LHKA 2WKKA 3DN7A 2BWAA 2XBO2 1VBC3 2TUNA 5A3TA 1E5SA 2C9AA 5K4LA 3BN6A 4IV1A 5F3EA 3SMHA 4MGTA 4KG8A 4PBPA 1X50A 4RSUA 2QJVA 1SFPA 3NW4A 5GZDA 3NNFA 5FLIA 3NRUA 3WR0A 1LGNA 1H9WA 1HXS3 1HW5A 1MACA 2JDKA 2QQKA 2VMGA 3AX4A 1WW6A 1RXFA 2D6LX 2JKXA 2OPWA 3BKZA 2WYFA 4AW7A 3HJRA 4U2AA 2X09A 3H7JA 1OF3A 2C0ZA 4YVWB 2B39A 2NQYA 2RDQA 3Q8CA 5F5AA 4P9JA 1UPIA 1F8VA 1W6NA 3ZYPA 2AEZA 3WNKA 2E53A 3V0AA 1NA1B 1JHJA 5DDJ1 5FO7B 4AFCA 4YVSB 4D0QA 5K0UB 5E1RA 5CIRA 5FMOL 2A75A 4PLOA 1QNYA 2JX9A 4WBBA 4OQ9A 1KJRA 4LHSA 2RJLA 3ME2A 1FMD1 5J7MA 2K0GA 4HK9A 4K7JA 3MYXA 2DURA 1WCDJ 5FZ6A 3I2HA 2WZR3 3FN9A 3LSDA 3O7OA 4Q0VA 1Q8SA 2EAKA 4GJZA 4MLOA 4SBVA 2FD8A 1H1MA 4AGVA 5JVVA 4JGZB 4H7MA 4JRAA 4L92A 2ARBA 5G04L 2Y33A 2C6SA 1XU1A 4RFRB 2MEV2 3PMSA 3RFRA 4CA9A 2VE1A 1DGWX 1XQNA 5C9AC 2DCZA 5EJ1B 1OD5A 4Z2WA 5JLVA 4IV3A 3KVBA 3Q8BA 3PHMA 4QHZA 2W95A 1LKNA 4XQWA 1W6MA 2CDOA 2G4IA 5T5PA 1YI7A 5A6YA 2JDPA 3GJAA 5E16A 4G3YC 1VMHA 2Y6FA 1LOCA 3AP9A 1QJY1 1LOGA 3AXEA 2GMPA 3RS6A 4Q4Y2 3KMHA 3U11A 3VHPA 2DVAA 1HQWA 2PMWB 3ENRA 1PVC3 1I9RA 3M8LA 1ND2A 4ITCA 4IV1C 3FL7A 3E5QA 2OS2A 2IUWA 2UYAA 2XH6A 1VBA2 4DQAA 1ODNA 5AFBA 3RZZA 5IFTA 4JKKA 1CZTA 1S0FA 2QDNA 4S2DA 5FYBA 2BQPA 1UOJA 4CP9B 4HSJA 1DGRA 3AMNA 4QPIA 5ABJB 1DHKB 1GZ9A 3KT4A 4EQVA 5EZWA 4EWEA 3WNMA 1CONA 5FYZA 4LHLA 4ZHNA 1AL22 4M3CB 3D82A 1VAKA 4UWDA 1RUD2 3OPWA 3CJIA 4ASLA 4XQ4A 1C5HA 1O59A 1XNBA 3POSA 1D2QA 5I0UA 1OLQA 5CBLA 2JDMA 1T2XA 4S2GA 1E5RA 1TE1B 5LA0A 2RS11 1DLLA 1LHWA 2DVBA 4AEMA 3BGAA 3RZKA 1JYTA 5CZKA 3MUY1 4FFIA 5DAWA 4TZDA 5FZCA 3TRSB 1CJDA 1W8OA 3WQ1A 1XU2A 3U10A 5B4NA 1S2EA 1RL3A 3LSEA 2D5HA 4KH9A 2QQLA 4K40A 3VBOC 4CDQC 2W52A 1QJFA 2VCMA 2WO1A 2ZGQA 3BOPA 2ZKLA 1RUH1 3BODA 3E5XA 3GBFA 4FXKB 4O61A 5T52A 3ZYIB 4CEYB 3CHXA 4RS5A 3RMXA 4OHYA 4FP2A 4QU1A 3HN1A 1O8SA 2XJVA 3FUQA 1D0GA 2UYBA 2Z42A 4UBHA 1O3SA 5HPOA 1O3RA 3MHZA 3O1SA 3LDRA 3OSDA 5JSPA 2CAUA 2IXHA 1CAWB 1LB2A 2GMEA 1CVNA 3V64A 3TNPB 1H2MA 4Z82A 4AQTA 3JD71 4NWWA 5J09A 4MVTA 1KJLA 4GULA 3PUIA 3B01A 1GOHA 1PK6C 5T5JA 3TN93 1AR93 2VBBA 4MGIE 5BNOB 4Q4V1 4GH4A 3EHKA 4BQXA 2YHJA 1MS3A 2V5DA 1ND3C 2ZGSA 4EJRA 2YC2A 3DL3A 2VBPA 5T54A 2EF6A 3HQRA 3WEZA 2QCSB 2UY9A 5F3CA 3AZZA 1SMVA 3IMNA 4AI9A 1FXZA 3CZUA 5CADA 3J8F3 1ZRCA 3W21A 3JB8A 2VZTA 5F9TA 1RMU1 4UFIA 3R05A 3OF1A 5FY9A 2EIEA 1YQ6A 3BIEA 2ORZA 4IE5A 1VE0A 4CU9A 1HRI2 4QMAA 2XLAA 3EBRA 3IDEA 4XYXA 1YUDA 4KNCA 4FPFA 1UQXA 4K9SA 2PN5A 3K4DA 3NJXA 5ANQA 3GF6A 2D97A 1X8EA 3KWVA 4ORFA 3KGLA 4AVCA 5JXIA 2VECA 4QXKA 5I8SA 4ISQA 1MS5A 1FNZA 4CEWC 2ZGMA 3JXSA 1XSRA 2RDNA 3AZYA 5T3NA 5JR7B 2D43A 1BZWA 3WNNA 1A6CA 3ZYHA 4E8CA 5HCAA 1LCLA 1SLLA 2WFF2 1FOD3 1PZ8A 1ZZ9A 2W39A 2P2KA 2A6XA 2ZACA 4JX0A 3AMMA 3UJQA 3GBGA 5D8AB 1QNWA 4R9AA 1ZBA3 3AYEA 4Z1VA 1RUC2 1YQCA 1NE4A 1ZNPA 5EJ3A 4YZ2A 2HWB2 4Q5OA 1FV2A 2F6BA 4FOQA 2VAUA 2XDVA 1Y4WA 5IFPA 3AKQA 3WP5A 1WCQA 4K20A 1JYNA 5FZ1A 2IVJA 4UOJA 3J7MA 2QZ3A 5A1LA 3AMPA 2ZAHA 1TG7A 4BMEA 4DXTA 4XEZA 4NIDA 1J84A 1RXGA 3PDQA 4AI1A 5AVPA 1PIV1 2RR13 1SBFA 3NJVA 4MOAA 4QDQA 2JIGA 5FY8A 1PGL2 2MNGA 3U78A 4OI0A 2DUQA 5FYYA 2JG8B 1CGPA 3INAA 2AR6A 1NCRC 4FCAA 1UMZA 5FYSA 1AF9A 2RS31 1GZWB 5F6KA 2LM3A 4IE6A 3KQRA 3EMRA 3EO6A 5FY0A 3DGTA 2Y6LA 5GLVA 2A3YA 5FPLA 5FZ9A 2PAKA 1JBCA 1JUIA 4QX8A 4FFHA 1QXPA 3OJBA 4DB5A 4B7EA 3OPZA 3AFKA 4XVHA 1LOAA 4D7SA 5KXCA 4COVA 4YRDA 3KCXA 4Y1ZA 1CAUA 5F3GA 1FNYA 4GAZA 3AB0A 4PI2A 1WWYA 4RQPC 2P17A 3N7LA 5A7OA 1RUE2 1OLRA 3KCYA 3RI8A 1REDA 1YJLA 3RI9A 3MGUA 1GLHA 4CCKA 3ZXLA 3AZWA 1K5MA 4JTNA 2D3PA 1QDCA 1CAXA 2R043 1SFYA 3POJA 1EAH2 1UZVA 2DU0A 1RGSA 3ZXFA 5AC92 4IEZA 1GQPA 1L7QA 4PDWB 4E2QA 1NYWA 1UZZA 2YG0A 3KQ4B 3VL8A 3QACA 4KL1A 1OKQA 4HK8A 5FZ3A 1YFYA 2ZX0A 1LTEA 2R061 1G8WA 3UKNA 1ACCA 1OXCA 1JOBA 1VP6A 3E1F1 3JQXA 4COUA 1STMA 4XUNA 2A73B 1AYN2 4X6RB 1WCSA 4WM8C 1NXD1 5I0SA 3AJZA 3MIGA 4Y4YA 2JECA 4YW6A 1OHFA 3ALQA 2PAEA 2ZEZA 2BBVA 3AL6A 1R091 2WNOA 2W94A 3K46A 2WS91 1B35C 1A8MA 2HKXA 4F83A 3GZEA 1VBC2 3BPSA 4FPLA 1S0IA 5D1IA 1Z0HA 2A5ZA 1MS0A 1S4CA 3AM2A 1IPKA 2VZRA 4Y1XA 5IVYA 5A7WA 1WLWA 1UYXA 2BBAA 2HWC1 3GHNA 1DYKA 3QCWA 4OYUA 5JOYA 5A3MA 1EYBA 1OH4A 1AR73 4UF0B 4R4XA 5DAPA 4YW1A 5LBEA 1KFXL 2XBO1 3I59B 4FPKA 2LRPA 3OBRA 3PVEA 4WVZA 2XUEA 5FMDA 1BXHA 4AOCA 2DU1A 3DXUA 1FAYA 1Y7BA 1AXKA 4N43B 4DINB 4ASKA 1V70A 1SFNA 2YGLA 3IIIA 3TEXA 1PGW2 3FBMA 3KF3A 3C7GA 3VDBA 4V1PA 1NA1C 3UGGA 1C4RA 4CCDA 2WL1A 4L9BA 4M4PA 4YVSC 1WD4A 1QOTA 4MSVA 1S0EA 2XWBB 5K0UC 1PVXA 3I8TA 1AJOA 4FFFA 5FYUA 4KG0A 1ZZ6A 1YNAA 2WJSA 5A33A 4QXCA 2VBDA 5FP3A 2BGCA 3JBG2 3OB8A 1PO12 2DVDA 2JB4A 4RGGA 4YARA 4JHTA 5FXXA 1LOBA 2AACA 1XE0A 2HWE2 3WF3A 4YWAA 2YFZA 5JOWA 3C7FA 2J22A 1A8DA 3A7QA 2WZR2 4QPGB 1D4M3 3M4FA 5DXDA 1XNTA 3OGRA 1ASJ3 3TEWA 2VMFA 3M3CA 3B69A 3E5UA 4QWNA 2WIIB 4I0AA 4B4QA 4A7YA 3OY8A 2FDGA 5APAA 2E7TA 2VD7A 4P9GA 2JWPA 3VBHB 2HWF3 3HNYM 3FE5A 2FDHA 3M3EA 2JDZA 4W50A 4HVQA 5FJHA 1Q5OA 2H0VA 4CDXC 5GLTA 1D4VB 4R4ZA 1JW6A 3WHTA 3MIDA 4ZZ5A 5HV0A 3OOXA 5KC5A 1RUOA 4NIGA 1SLTA 2VTFA 4L99A 4LO5B 2A6ZA 4MX3A 2WSUA 2MEV1 2Q8DA 2QQOA 2GN3A 3AC0A 3U4SA 4QU2A 1DU3D 1W3VA 4ARXA 1GNHA 4NHLA 5EPAA 4PT6A 3LOIA 4WVMA 5H9SA 4E8DA 5FQ0A 4Q0PA 5J36A 3T3YA 3WDXA 5J96B 3N9PA 4EN8B 4PBOA 2BFUS 4QPYA 3WNLA 3WW4A 3OYWA 4Z92B 4PCRA 1VB2A 1LAJA 2ZZJA 2YYOA 4COWA 4CE8A 4N53B 3DYMA 1W04A 2D5FA 2UWCA 3KSCA 3IB3A 2ZX4A 1VBA1 4YNIA 2VCBA 2TNFA 5FZAA 2W5FA 2VC9A 3EXUA 4MGZE 4LE3A 3T08A 1PO22 1C8NA 1I5ZA 1UKGA 4P00B 4W6YA 4D7TA 5LRSA 1OMIA 4BXSV 4AXOA 4JDOA 5I0RA 2C1FA 3SISA 1ULEA 2X29A 3WNOA 2EA7A 1MZEA 1IG0A 4LEJA 3VBSB 3V0BA 4YM1A 1VBE1 2R073 3ZLIA 1AL21 2EXIA 1PHMA 3LIHA 3T30A 1IQDC 1RUD1 4J6GA 1QH7A 1W9WA 1OUSA 3WINE 2XMLA 3MEPA 2ATFA 5FZEA 4XJ9A 2YUEA 3P5BA 2WWUA 5GZFA 1BEV3 4NMIA 5FOJB 3LA2A 1YIPA 2GNTA 4N7UA 3QOPA 5BNPB 3LDBA 5JPMB 1UZYA 1BK0A 3LFMA 4NOTA 1MEC2 1IZ3A 1GQGA 2VNOA 3BTYA 1ZBE1 1WW5A 5FV3A 2P3JA 2FDFA 3MFAA 3IDAA 3NAPA 1XBFA 4CP1A 1L7LA 5FMOS 2EALA 5A3WA 1FPN3 5M0TA 4C1WA 5FO9B 3T2OA 1ZVFA 1CWPA 4GB33 5C8WA 4QM8A 4QPWA 4GKXA 1KS4A 2YU2A 4OI4A 1QJX2 2Y26A 3GCWA 3TN92 1AR92 4Y26A 3KB5A 1SDWA 4E4SA 4O9EA 2VQ0A 1CX4A 1W90A 2X5IC 2VW2A 2ZPXA 5EP9A 2JDAA 1GANA 4P9XA 2CDPA 1MQTA 3WP4A 4LKDA 3MW2A 1EP0A 4IV1B 2Q1FA 2V72A 1HIXA 3ORJA 3WNPA 1J3RA 2P5BA 5B4XA 1T6BX 3ZXJA 4Y33A 3POWA 4FI9A 3OBTA 3AVSA 2IXKA 1DG6A 5FY4A 1RINA 1BYHA 3BIWE 1OOPA 4LQRA 4M01A 3ABZA 4AI0A 3ZSJA 1QU0A 3I3EA 3DV8A 1DQ4A 4QX3A 4WM7A 2ZHMA 4LK7A 2LROA 4XF0A 5HXVA 1JYWA 3KHCA 3ZVXA 3B93A 3I97A 3D5OA 3PL0A 5FIXA 2WO2A 2C5DA 1SHWB 3K75B 2ENRA 5T50A 5IAVA 2RM23 2W68A 3UT0A 1XE8A 3V0AB 1APNA 4CU8A 4RFT0 1FOD2 3MW3A 1BBT3 1XNAA 3O1TA 2FBEA 1WLDA 3OD4A 1TMF1 4LKEA 2QQMA 4OHWA 2WSVA 1AR83 3AFGA 3AJYA 4KWKA 1GKBA 4ZPIA 1AR63 4I01A 1JOPA 3SCGA 4CDQB 3FBYA 1YWKA 2JDYA 2GDFA 2O8QA 4XJ8A 2YGMA 1LHUA 2F4PA 2B9UA 3VZOA 1BMV2 4YGDA 5KBFA 4GIQA 4LBQD 5FWJA 4V2WA 3C7HA 3WW3A 3GZTB 4YFZA 3F2ZA 3ZSEA 4NVPA 4CCEA 1G9AA 1W8NA 5EJZB 4AR2A 3B5LB 5A6QA 1RUC1 3KT1A 3UKVA 5CKMA 2HWB1 2RR12 1QHDA 3BTXA 4LBQB 2RMU3 1H8TA 4LXLA 4COYA 2VXJA 4C91A 4CPBD 2WA4A 4ISRA 4PQ9A 1NE6A 1W6MB 4FOVA 1RUF2 4FQ4A 1WMEA 4AG4A 2WINB 1NQDA 4QGLA 4AL9A 5CB7A 4DEQA 1ND3B 2Y6JA 2WNEA 4DNYA 3CLPA 3FUOA 1CESA 2AC1A 1ND2B 2JDUA 2CWMA 3HAGA 2E32A 5HCFA 1TQ5A 1PGL1 4IE4A 1MZFA 5FJKA 5FPXA 3N9LA 1UX6A 1VIWB 2X05A 5FZ7A 3DXTA 3KZ4C 5KHGA 1PMHX 4ZONA 4QPIB 1FV3A 1U5ZA 4QGNA 3HNBM 1DBNA 5LCWL 2R042 3N9MA 5HXMA 1LU2A 1EV12 1Q56A 3K3OA 3OUJA 2LS6A 4E9KA 1QOOA 3ZN5A 1LULA 4QXBA 4P9LA 3CJIB 2IZWA 5IT6A 3MICA 4XPVA 1LHOA 3FZ3A 2E51A 5LEKA 1RUE1 4N9IA 2WN2A 1E57A 1Z7S3 3W58A 1OFNA 1COV3 4CSWA 4MXWB 2FMDA 1RJ7A 2H6BA 2NM1A 2V5YA 3HT1A 4XDQA 5AC91 3J26N 3QBQA 2E33A 4GD4A 3R4SA 3IAPA 3AZVA 3HR9A 3I7DA 3I2FA 1TVGA 1KDKA 3AKPA 1VRH3 2CL2A 4Y22A 1POV1 3AP5A 4ONUA 1SZBA 4AF9A 4BMBA 2JIJA 4AGRA 1JOJA 4RS5B 2VZUA 2P6CA 5BYNA 3O1MA 2GC1A 4XDOA 1H8VA 1V6LA 3AK0A 2OT7A 1LEDA 2W3JA 4R9CA 5J98B 3RQ0A 3ZYJB 3ZSKA 3UK9A 1W05A 1AYN1 2XLFA 1PX4A 3X29B 3MIFA 4QB1A 2ILMA 4C1XA 4YW4A 1O5UA 2ZOEB 4NUBA 3E6CC 2VMCA 4LO4B 4QKNA 1RUJ3 1RHI3 3O14A 5F6LB 2WQ8A 4ZXEA 2RS51 2NLRA 1H8TC 1LEMA 3LEGA 3USUA 2XR4A 2E63A 3W20A 2QQIA 5C5UA 3VZJA 5IVCA 3SEEA 3GALA 4GH4B 4N43C 1DQ6A 1VPHA 2VUCA 2GP3A 1T6GC 2C4XA 3B3QE 1CJPA 3WQ0A 5A3PA 1OH3A 3ASIA 4GMP0 5JI9A 1WUVA 1S0JA 5FZGA 1UAIA 2YXSA 4HVOA 4AHXA 5C8CA 4DIQA 1I5PA 1JYCA 5FPBA 4LT5A 5F2SA 3T2TA 1OLMA 4BIFA 1F15A 5JMOA 1SLIA 5FKBA 2VZQA 4D6QA 4RQPB 3O0XA 4UYBA 1WLCA 2AREA 3KVAA 2YBKA 1XE7A 5TSWA 4XTMA 4YYOA 4LBNA 1Y43B 2VW0A 1KD7A 4P08A 2D6OX 3UETA 5F5QA 1VRBA 4XUPA 1PGW1 2PHWA 1AYM2 3JCIA 2E26A 1EUTA 4O65A 4QXHA 4QPGC 1US3A 2P3YA 1F9KA 1W28A 1AL0G 4XXAA 4KWUA 3N3HA 4MUVA 5JZGC 2W1UA 2B7YA 4BK5A 1YLLA 3JBG1 3N7JA 1QQP3 4V2VA 1PO11 1KGYA 1W99A 2VUDA 1H6XA 3IKWA 1GV9A 2HWE1 3FHIB 3PNAA 1ZZ8A 3ETQA 1OSGA 4K6BA 4BJ0A 2VG9A 2B9VA 3CO2A 1S2KA 4FXGB 2DBIA 4J1XA 4NHKA 5GALA 4HXCA 4XHBA 4KWJA 4Q4X3 2WZR1 3LA7A 1ST8A 2EVXA 3H1YA 1G9DA 5F37A 3FLPA 1B35B 4FSJA 2B46X 5FXWA 1PGSA 3OGJA 4HPKB 4JRLA 2YV8A 3ZDSA 5FP9A 2BWCA 5FCCA 3NNLA 4XJUA 4IEVA 2VMDA 2GH8A 3S0MA 1C28A 5J37A 5FP8A 1XSQA 1ZREA 1U5XA 4I02A 3GM8A 5LASA 1OC1A 1OF4A 2PHFA 3ZFFA 3FJSA 2JJ6A 2JE9A 5LB6A 1U5IA 4C0HA 3ZXKA 3M3OA 4MHRA 2HEWF 2IFWA 1MZ5A 4XABA 5FOBB 1HQNA 4N53C 2BW8A 4WVVA 3WLUA 4L8QA 5FREA 1YCIA 2XQRA 3KD4A 3VBRC 3WQ7A 4EWAA 1UD1A 3H3UA 3UYJA 2PLV2 3H8RA 4RD7A 4RHV3 3Q8AA 2R7EB 4CU6A 3OGSA 3WF1A 3I3DA 2TEPA 3HOBA 2RHPA 4UBGA 2ZX2A 1N47A 4JC1A 5IK5A 1YJKA 1UYYA 1ZYBA 3DCQA 2PELA 1CAUB 5IK8A 4OMDA 5GZEA 2JG9A 4GKYA 2VM9A 1UYPA 1V9U3 3VBSC 3VDDC 2OYZA 2YDEA 5FYIA 2WZ8A 3ROUA 2R072 4W6WA 2G9GA 2PXJA 4CDUC 5CFCA 5FY7A 1HRV1 2DWRA 4UAPA 5CISA 1K5MB 2EAAA 3R4UA 1V6JA 1GMMA 1ULPA 1PO21 4CZSA 2WR9A 2Y6HA 4EV0A 5LBCA 3O0VA 3O1PA 1VBB2 3ITQA 3R4DB 1BEV2 4GMP3 5BNPC 2VU9A 3AP7A 3PIGA 2HYKA 1GWMA 1NLQA 1FYUA 1UNBA 2KM2A 1SQ4A 2WAOA 4B1MA 4UW4A 1N3PA 5DUUA 1K5JA 1LGCA 3AMQA 1SPPA 2VR4A 3WDTA 3S5AA 4R8HA 3M1HA 4JV4A 4EN7B 4CDXB 3HBKA 1HB3A 2RE9A 4GB32 4I0WB 4NRMA 4YG3A 1RUI2 5G05L 2A3XA 1QGLA 1MEC1 1PM4A 1V0AA 4XAAA 1JI6A 4IQPA 3VKMA 3T2PA 2A70A 2A6YA 3A21A 5EYXA 1PX3A 1UXXX 5EXOA 4URAA 2FZ1A 2X8KA 4EN6B 2Q30A 5C4WA 4JCKA 1QJX1 3ZFFC 1AR91 4NJ4A 2WBKA 5GM0A 1N1SA 4CU7A 4I3PA 2VTXJ 1UIKA 1Q8OA 1LHVA 1KXGA 2WO3A 5GLWA 5L9BA 4FBFA 2BVBA 2YBSA 1SCRA 4INDA 4AQ6A 4B8EA 2OUHA 2PHRA 3NJYA 3KLSA 4JKMA 4U36A 1GZTA 2XJUA 4HKLA 4QB6A 2Y64A 4ZY9A 3I2GA 1DP0A 2ZCWA 3PMEA 1UY3A 3H7YA 1W03A 1G9BA 3OBAA 2A6WA 5A33B 1F4HA 5L9RA 2PQSA 3MBWA 5I8TA 5IVBA 4XUOA 1AR82 4QB2A 4AWDA 2RV9A 5EHDA 1QY4A 2XL9A 3RGBA 4FAGA 3PUSA 4XXPA 1UF2C 4I2OA 4DUVA 1NAEA 2CU5A 1FMD3 3ACLA 5DG2A 3B7MA 3ZDVA 1X36A 2DV9A 2CGOA 5FZDA 2ZS6B 2HWD3 2LUWA 4CP0A 3P1IA 3G6JB 3LB9A 2QUOA 1C8M2 3EYPA 3KM5A 4ATEA 2AYHA 5C5TA 1A3KA 5HCHA 3OY8B 3VBUA 4DY5A 4A44A 2UWBA 5GKAC 4A45A 2D3SA 2J7MA 4Q4W2 5C6CA 3GBWA 3VV1A 2OQ6A 4GWMA 1JODA 4FOWA 4IV3C 2RMU2 2VOKA 3ZSLA 2CY6A 4CXWA 1BMV1 3RPQA 1GYKA 3HPNA 3SH5A 5JOXA 1FT9A 4QM9A 4K8RB 1O3QA 4RR3A 5LA1A 1O7FA 2X5IB 4HOOA 3FC0A 4B4RA 5FZ0A 1ND2C 5BXXA 2R1DA 3H3ZA 1QJY3 5KHJA 1Q8VA 2RR11 1F5FA 1XJAA 4Z07A 2J1VA 3RSJA 5ACA2 5B2GB 1XYNA 2F17A 3U37A 2W92A 4WVMB 2VMHA 5FQ0B 2XOMA 2WNUA 3POBA 2ADDA 2GC0A 1X9PA 1RUF1 2E31A 3PU8A 4QPIC 5GZGA 2O8OA 3OYWB 4CDWA 5FYTA 5LZ6A 4AHWA 2BJSA 2B4KA 4GALA 4WZFA 4K21A 5KXEA 2NYYA 1GBGA 5F5CA 4DO0A 4KQ7A 4ES9A 5EYYA 2D98A 3A23A 2I45A 4L0PA 1O3TA 3CJIC 4NPRA 3ACFA 4R9BA 2YPDA 1ZZBA 2GZWA 4XUTA 3WZ1A 3MLLA 3SCFA 2WN3A 5FPAA 4ARYA 1CX1A 1JMUB 4UT5A 1Z7S2 4M00A 2NP0A 1COV2 4YGBA 3PJYA 2RS13 3NV1A 4K1YA 5HI0A 2BERA 4LKFA 5LA2A 3ZYRA 1EV11 4OVEA 3V0BB 4XILA 2HEYF 1AUYA 1QIQA 4GWJA 3LEIA 3DKQA 2BGPA 4PIXA 4YM2A 5IYYA 4DUXA 3TEYA 4RS5C 3T4HB 2A1XA 3AL5A 3GCXA 1V00A 1Y9MA 1RUH3 2CSGA 3J7NA 4HVRA 4KGGA 4Q27A 4XZPA 4EWDA 4A6OA 1YYNA 3ST7A 4BM8A 5CKQA 4BQ2A 1OLME 4C0BA 1JS9A 3VBUC 3VZKA 1UY0A 4BQ1A 3ZXDA 3NL1A 3NAPB 3WSOA 1R64A 4ZS2A 5E6HA 2ZGNA 1MS9A 3H1WA 3I2JA 1RUJ2 1IPJA 1DYOA 1RHI2 1OT5A 3A0NA 4OUSA 3WUDA 2YU1A 3ZR6A 4A6SA 1QKQA 3JD73 2O14A 5T55A 3TB0A 1OKOA 3WF4A 4NIAA 4N7IA 4LBLA 1QF3A 4GH4C 1VMFA 1X82A 4N90A 3S5QA 1JZ2A 2R0FA 1HLCA 4Q4V3 1MQTB 2E9QA 1GNZA 3NJZA 5A1AA 1MS4A 1LOFA 5FZFA 3HWJA 1GQHA 4W8JA 1UU6A 4QQLA 3WQBA 3N4MA 1QJU2 5E89A 3WF2A 2QKDA 2KD7A 1RMU3 4E2SA 1RUG2 2H6CA 5DG1A 3TEZA 1RVF3 4OZXA 3BUCA 5FLJA 3N35A 3VB9A 2ZGTA 2QQUA 3DYOA 3HEIA 5KHHA 5L7OA 2GALA 2Q8EA 1POQA 4EE2A 3USSA 2OKXA 2G19A 2JB8A 2UY8A 4HG6B 3I2IA 1NY72 5FP4A 3VHNA 1WA6X 3FMGA 2D6PA 1GFF2 4LOSA 3RMYA 3IMMA 2ZEXA 2R16A 4UW5A 3O5SA 3QH7A 2XLGA 3DKWA 4NPLA 3RNSA 1QQP2 1VJ2A 4XJZA 1VLNA 2Z5WA 1CPMA 3R0RA 3UL2A 3ZIWA 3UGHA 3RG0A 1AYM1 4DRVA 1W8FA 2DTWA 3U1XA 3VBFA 4PJYA 4OQ8A 4Y1UA 5FO8B 1HX6A 2WT2A 4LOTA 1IKQA 4AEKA 1R1A1 4K1ZA 1W2UA 4MHUA 2XJSA 5BUVA 2WO7A 1MS8A 3I54A 4JGYA 4LULA 3D0JA 4CUAA 4JGZA 5IHRA 1QXJA 4XBNA 2VOVA 4AAPA 5JSRA 3OEBA 4IEXA 3LEKA 1YRZA 4LO7A 4UFJA 3BB6A 3S7EA 4OLLA 3SC7X 5DABA 3ZN4A 3I3MA 1WZXA 1PIV3 3VN4A 1HXS2 1H8TB 1J83A 4XQDA 3L2HA 5BNNA 2YFUA 5DZFA 5J1XA 2RS33 1LGBA 4BQ5A 5FYHA 1DQ0A 2PA7A 4RHV2 3QLQA 1NKGA 4Q29A 1QXRA 4XBLA 4MGSA 4XETA 2O0OA 3LDKA 4PIZA 4CP9A 2ZGPA 4P5HA 1LECA 3WP3A 5LRRA 4QX2A 4Q0UA 1ULFA 3JUUA 5E8AA 4YPJA 2WZPP 3THPA 5CG8A 4IGOA 2PFWA 1RTVA 2VTXA 3H9AA 4AFMA 4XFGA 4E4HA 1C3HA 5IW0A 1MVEA 2PLV1 1K5MC 1FI2A 3J7HA 4IGPA 5FAXA 1R083 3HNMA 4IEPA 4L97A 4E27A 1ZZCA 1ODMA 2FMYA 3RJ2X 1QH6A 4HBNA 4LE4A 4MO3M 4XF4A 5L7OC 4NHMA 4QQ2A 3VKLA 2ORXA 3LA3A 2A71A 4FPOB 2WQ4A 2ZHNA 5JZGB 2V09A 4KBBA 5EFUA 3ZSMA 2R071 3MPBA 1W2TA 2C9KA 4XAEA 4AYUA 4KU7A 2Y34A 2R063 5SV8A 2CAVA 3RJRA 1DGWA 1X33A 2YY1A 4BQ4A 2BEOA 1CZSA 1CAVB 1F2NA 2BOIA 2YROA 4DXRA 1Q8PA 2E6VA 4A2UA 1VBB1 3ZXGA 4BCUA 4Y22B 4CEYA 5LWBA 4B7KA 1X7NA 3NNGA 4HFSA 1R093 5A80A 1H2KA 1PVC2 1W39A 4YW2A 3DPRA 1CAWA 4RN5A 4NO4A 1WW7A 3KCCA 3AVRA 3DYPA 3PTRB 1ULCA 4BQWA 3LD8A 3WG3A 4BA6A 5IVVA 1XC6A 3KT7A 4GB31 4XDPA 3KV9A 5IVFA 1RUI1 4NRPA 4Y5SA 5IJRA 4Q1RA 2VOTA 4DY3A 4EN0A 2PHLA 2W87A 4Q4Y1 2VOWA 2PHDA 3USUB 5BNOA 5FYVA 3LCPA 4XMAA 1SEFA 1LODA 2XBO3 3A22A 3VBRB 5DN2A 1WKYA 3SQOA 3VDCA 2JD4A 3WT3A 3SITA 1JYXA 3C3VA 1LJ7A 1O4YA 3T1LA 2ZHKA 1J1LA 5C8CB 1FX5A 2Y6GA 2WWSA 3CF6E 4IL7A 3SNMA 3VD9A 5JXGA 3UJOA 3V56A 1H1AA 1XNCA 2BVVA 2PHTA 1EY2A 1XOYA 2WABA 2ZHLA 2ZKNA 1US2A 4HKWA 3VDDB 2ARCA 3PTYA 2DF7A 4CDUB 4CXYA 1UOGA 4YW5A 4TN7A 5JXHA 1WMXA 5FR3A 4KU8A 1BHGA 4PHZA 4HONA 4A7ZA 1YO8A 3FLTA 3MO4A 2HWD2 4O9GA 4YZ1A 4H3WA 4UW3A 4LO8A 3RRDA 5FP7A 5I8YA 4YZ3A 1JZ4A 1UU4A 2HYXA 4KMQA 4AI8A 3JZVA 4OUEA 1Q8QA 3VZMA 2BNMA 1LNSA 3H0OA 4LO6B 5CAZA 5K7PA 2YC0A 3O1RA 1PNGA 1GICA 2VZ3A 2D6KA 3AP6A 4E4DX 5FBJA 3I3BA 2K2SA 2VQTA 4MV2A 5FZOA 5GLUA 1C8M1 5ERLA 5CFDA 1QDOA 5FZHA 3RDIA 3ECQA 4DZGA 2XL7A 5CEHA 3PVNA 2XJTA 3WW2A 4Y5Z0 2DCTA 2GNMA 1QJY2 3DPRC 2WA3A 4Q4W1 2PQQA 1K3IA 3MI8A 4LA2A 3SH4A 3J8F2 1OBNA 3IZOA 3P6BA 3MF9A 4NAOA 4BXFA 2EIGA 3K77A 3DEMA 3I49A 5CYYA 2JG8A 3OBZA 4QGMA 3ZFFB 1HJGA 3ZFEA 1K42A 4K3UA 4UFHA 1ULGA 2J1EA 2K46A 1OFSA 1GP4A 2Z69A 5FWEA 4HMZA 3J4UH 3VD7A 2UWAA 4AVAA 5ACA1 4AHYA 1GP5A 2P3IA 4ZZ8A 1HDKA 3KF5A 3T0BA 2OIIA 4QKBA 4META 3HN3A 2DBNA 4FQZA 1W6NB 5JOZA 1VBA3 3O1UA 3LFIA 1HRI1 2AZ5A 2VMEA 5C71A 1H0BA 1BQPA 2QQJA 4JDMA 2JG9B 3BALA 1M4WA 2NPIA 1NCQA 1SBEA 4ASMB 1ZBA2 3ES1A 1WBLA 4QX5A 4P9YA 5GZCA 1EPWA 2XGXA 4L2NA 2OQ7A 4DMIA 1AXYA 1VBE3 4AEJA 2OPKA 1AL23 1BJQA 2F4LA 2ADEA 3J9SA 4LR4A 4PIYA 3O1OA 3IDBB 4PDWA 1R1ZA 1G6NA 3N9QA 3ZXAC 3LKJA 2WFF1 1O4ZA 2VGDA 1LRHA 1Z7S1 2Q5TA 5GJ6A 3RZLA 4H2AA 2FCUA 3A4UA 4BB3A 1RC6A 3U4XA 2VMIA 4FOYA 5ANNA 5L73A 4AFBA 3HD8B 1QWRA 4QAWA 5FY5A 5FXZA 3RZGA 1IS6A 3NAPC 3P3PA 3ZFGA 5JR2A 1GOGA 3MV01 4S2HA 1KFUL 2QZ2A 5FUIA 2RJ2A 1SPPB 1ZBE3 2G1MA 3WD5A 2WRAA 1OVSA 5KWRA 1GZCA 4IV3B 2PYTA 2EICA 2XHKA 4EYUA 1BKZA 3JD72 2DDUA 4WV8A 1W8UA 1L3JA 2IXLA 2V4VA 4Q1PA 3WX5A 1ZA7A 1SCSA 5CFDC 1C1LA 3NKGA 3UNPA 1CPNA 3E6BA 3POFA 3PURA 4QX0A 1MQTC 5JCTA 3GHMA 5LW9A 3N7MA 1WMFA 3KV4A 3TOJA 1BVVA 4NR1A 1I3HA 2GAUA 2GP5A 2X10A 1U0AA 2JE7A 3T1MA 4M4RA 1IKPA 1YEWA 4XTPA 3RVHA 2WZEA 4CP2A 2PTMA 4FTSA 3CDZB 4UF0A 5C4WB 2LTNA 2P3KA 3I59A 1OOPC 1RMU2 1UIJA 4XW3A 4WVWA 2ZXQA 2ZEWA 3OGVA 1RVF2 4WM7C 5A3OA 3ZFEC 1I1EA 4OHZA 3VKFC 4AQSA 3HT2A 4D8MA 4AI2A 1AX0A 2VZSA 2KXLA 5I0DA 3H8OA 4YFWA 4BHPA 3WDWA 2HH9A 1JU4A 1PZ9A 1QJU1 4UI9L 5FYCA 5EIYB 4BOWA 5FZKA 2QE3A 1RUG1 1W6QA 4TLFA 1W9SA 5IUQA 1UCXA 4XZUG 1LENA 1EAH1 1NCQC 3CL1A 3OTFA 5D2AA 1UY4A 3LWCA 4AVSA 4AZZA 1TMF3 4TLGA 2W08A 2W47A 2ES3A 2W0XA 4M0HA 1KEXA 1NZCA 2TBVA 4P5YA 3UV9A 4HT1T 4DS0A 4A42A 2WUHA 1QMJA 3ZO0B 4YSFA 4EN9B 3LOBA 2VULA 2Y0OA 4ES8A 2ZBJA 1MVQA 4RYDA 4ZU4A 2NZ9A 1FATA 2VZ1A 1N3OA 1VBD3 1WMDA 4B3NA 1WD3A 1WLTA 5DUXA 2GH2A 3AMHA 3ZR5A 4A4AA 4F7ZA 3BU7A 1BCXA 4XF1A 3VBUB 3WCRA 1JH5A 3PJQA 5JDBA 2VZOA 1LHNA 1IOAA 2D3RA 3DUIA 1AR72 2WWJA 1S0BA 1RUC3 3BU0A 2CNAA 1PIV2 4L11A 4NIHA 2HWB3 1VBC1 2PAMA 5CA6A 4HN1A 3Q8FA 5C3PA 1ZX5A 4ET7A 3I2DA 2RS32 2WFPA 2SLIA 4RR3B 3H8XA 4LBJA 2OW4A 3H1MA 5CU1A 2QFEA 1U12A 4HETA 4LKSA 1TNRA 3MLKA 2D40A 5A70A 1W0OA 2GMMA 2XG3A 1A78A 5I0TA 1KS5A 3H8UA 1YFWA 4NPMA 1HXS1 3NNJA 2R6QA 1J58A 3VGIA 5JIAA 3F95A 1W9FA 3C7OA 2WNUB 3LEMA 4HKOA 5HV4A 3OCPA 2W1WA 5A3UA 4HSLA 1X9TA 4IW3A 4Q0QA 1OA3A 1UMIA 2R30A 4CDWB 2RDSA 3H42B 4W6XA 4EZ4A 3MF6A 4ZU5A 1R082 3FFZA 3POGA 5H9QA 1UY2A 2VVEA 3PLQA 3LZZA 3GJBA 1XYPA 1D4M2 5F32A 1ASJ2 5FUPA 5F3IA 4AEDA 2RJKA 5IVEA 1ALYA 1OD3A 3ZMOA 2BNNA 2HWF2 1RUE3 2R062 1V6NA 4LMFA 4ZU7A 4CCJA 3W5MA 4QHBA 1DZTA 1W3XA 2ZMNA 1O5LA 1ULDA 3IBMA 4GJYA 2G9FA 3RYPA 3E97A 3WV6A 5AC93 4COZA 4A7KA 1MPXA 3LGRA 5IK7A 2MPFA 4FO9A 3LPGA 3GGLA 3GXUA 3POYA 5IK4A 1S2BA 4A41A 5CG9A 1AJKA 1OA4A 2JDNA 1KITA 2VVDA 1BLZA 5FMBA 3ILNA 5A1FA 1JTZX 4IGQA 4EZHA 3I3QA 3ZKYA 5K8SA 2BFUL 2XJPA 3VZNA 5I93A 1AYN3 1O91A 4D6SA 4PF5A 5C9AA 3WDUA 3H3LA 4FPEA 3AKSA 4W4ZA 4AK3A 1UW8A 1N3QA 5FPVA 1SLBA 2P1BA 1IQAA 2RS53 3EJKA 1PVC1 4KI5M 5KXBA 4AQ2A 1W8WA 3KHBA 4MZUA 4DXSA 5T5OA 3LPFA 1JZ5A 1A34A 3BYWA 4FVVA 4ATFA 4BLIA 4OI2A 2I2SA 3B94A 4Y3OA 3FHQA 4I0BA 3CNAA 5L36A 2OZ6A 5C8CC 3JQWA 4B1LA 3V65A 4CXXA 1DFQA 1HB4A 2XUMA 1ZRIA 4WZCA 5LBBA 3U07A 2ZA9A 3GZUC 2DVGA 4AHZA 1NQJA 1GU3A 4CCOA 1CAXB 3THCA 3K51A 1TME3 4CCMA 4AE2A 2ZX3A 5IWFA 4XC9A 5L7OB 1HKDA 1SG3A 1DLCA 4ZKTB 3URFA 4RL7A 2CHHA 4HANA 4AEDC 1S1AA 3RZHA 1J1TA 4LTAA 3WOGA 3N9NA 2JDHA 1WBFA 2GNBA 3JBG3 4XFFA 2IXCA 1FPN2 1PO13 3WCSA 2DCJA 4PI0A 1UYZA 3A0KA 3VBOA 2OX0A 2WC2A 3VKNA 1AZDA 1W6PA 2J1AA 2XHNA 3VBFB 2HWE3 4C8DA 4CDQA 2Q4SA 5C3SA 2E7QA 1GOFA 2HWD1 2DVFA 2X53S 1URXA 2Z2SB 2DFCA 4Y20A 4CCNA 3C8XA 1V6OA 1JZ8A 3M3QA 4XF3A 4JGYB 4CTEA 5A3LA 4XFAA 4LUMA 3AXDA 3NSTA 2PHUA 4LORA 1XNKA 4OUMA 5A7WB 3IPVA 1JZ3A 2CGNA 2NN8A 4AVVA 4GWNA 1PMJX 4LBQA 5FKCA 3TN91 4YG6A 5C33A 3N36A 1JUHA 5IVJA 3ZN6A 3PU3A 5BNQA 1PK6A 1JYIA 4BIOA 4JKLA 4AVBA 2MHFA 2Q1ZB 2KR2A 5BNNB 1ND3A 1CQ9A 2JICA 4N9HA 2BU9A 4YLZA 2Q8CA 2IXIA 3J8F1 2WNVA 1SDDB 3FFQA 4Q8LA 3MIHA 4QKDA 4XOGA 4CPBA 3U75A 3SLIA 3MIEA 4TSVA 1WA4A 2RM22 2H0BA 5DZEA 1TNFA 1GWKA 2ID4A 4KWLA 5IATA 1NZIA 2WQZC 4XACA 2JG9C 3AKRA 1BBT2 1NX9A 3APBA 5DDJ3 3AZXA 1GWLA 3CBNA 5CFCC 2WT0A 3VZLA 1AR62 1VBE2 2Y8KA 2GSYA 4GXLA 1HRV3 4NRQA 2WAAA 3R6SA 4CEWA 1FOD1 1PO23 4FTEA 3ACGA 4Q8KA 3S6PA 1V6KA 2BGOA 5FMCA 1ZBA1 4Z8BA 4MXWA 4LIVA 1KDMA 3Q9OA 4IXLA 3RWKX 1Y9QA 5F39A 3U14A 1ZBE2 2R1BA 1WCKA 1F5JA 3O0WA 5DZGA 5DAQA 3M2MA 2EXKA 5JWPA 2XXZA 2CV6A 2P6HA 4IERA 4LA3A 3K3NA 2DYCA 3CZJA 3B00A 3SCHA 1XRUA 2B42B 5KC6A 4BISA 2GC3A 1MZ6A 1UU5A 5JSOA 1VR3A 5C7GA 3HMYA 4JZRA 1MEC3 4YGEA 3WW1A 3DPRB 5IAXA 4BYYA 5C4WC 4J1WA 5A7NA 2QBXA 4LBMA 4DPNA 3M7AA 4XFBA 1NCRA 1WW4A 5A32A 4LBKA 3FWEA 1UN1A 2YMZA 3LF7A 4I30A 1QJX3 5FPZA 2OZJA 5C3OA 2Y38A 4QDSA 1H9PA 1UOFA 4XCAA 1F35A 2Y0IA 2Z79A 2IFRA 3NKTA 4TXWA 3B9IA 1U5YA 4XFIA 5A7PA 2WNVC 3LAGA 3WHUA 4QQOA 2AGSA 3OUHA 1XB9A 1Q43A 5L19A 5FPUA 5F2WA 3U0ZA 1W6OA 2I74A 4D7YA 5LY2A 2N7GA 4XHXA 3GNEA 4RGAA 4RQPA 5H9PA 3SKJE 1RVF1 2HLEA 4XIKA 2R041 2CWSA 3UKTA 2ETEA 3VUOA 5ISLA 4Y1YA 2ZZQA 1J3QA 3K48A 1V6IA 4QT6A 1TMF2 1HN0A 3OEAA 2BRTA 1VRH2 1GP6A 1NXMA 1AXZA 1WGPA 2DUPA 3KGZA 2B8MA 3GYDA 4FPCA 5LBFA 3VLBB 2VOXA 1D7PM 1AX2A 3T4VA 3ELNA 5A7QA 2HBTA 3MV11 4MH0E 3Q8EA 2HBUA 1VBD2 3O12A 1JZ6A 3WUCA 4FPYA 1KQRA 4YZ5A 2VNRA 2D7FA 3TNQA 4MGKE 1SACA 3D4KA 4RA0A 3RZMA 3ZPYA 3KV5A 4WM8A 4JDNA 1ENQA 1IHMA 3W59A 2DCKA 1TZOA 2ZGOA 1OI6A 4LITA 2FDKA 2VZPA 1C5IA 1B35A 2CGPA 5FZOB 4NROA 5DPNA 1ENXA 1ZZ7A 3WVJA 4HPKA 1REEA 1DGLA 1IS5A 1OQDA 4RR3C 5CFDB 1UKRA 2RG4A 3DECA 4BU2A 5J3UA 3ACHA 2VCAA 3N7KA 1W9YA
chains in the Genus database with same CATH topology
5JIUA 1AR71 3VHRA 1JHNA 3JU9A 2IC1A 3S7IA 4QQPA 2WNUC 4JTOA 2SBAA 3MFCA 1W0PA 1JN2P 2WT1A 1ZRRA 4CDWC 1OOPB 4FPJA 1RUF3 4MYEA 4K8FA 3ZFEB 4WM7B 4XFHA 1VAVA 4LLOA 4FAHA 4Y24A 4LNVA 4YVWA 1ZRCA 4X6QB 4PLNA 1H2LA 1ZA4A 2XWJB 3L9JT 3WG1A 3SHRA 3WP6A 1ZRDA 1NA1A 1REFA 3WXPA 3NVCA 4YVSA 5K0UA 1C57A 1OPMA 1DZQA 3IM0A 1Z78A 2AENA 5EV7A 1S0DA 1RITA 1NCQB 1CN1A 1R081 3AKTA 4URTA 2BPA2 4Q4X2 1EV13 4MGYE 1D4M1 4AFDA 4EROA 1ASJ1 2FQPA 3AYAA 1PNFA 4FPHA 4YZ4A 4F3JA 3HBZA 4DXZA 1TEIA 2Q8OA 1YFUA 2HWF1 2P34A 1SLCA 2HJIA 2VUAA 4P9WA 3ZFGB 3VHOA 1PZ7A 4SLIA 4CDXA 1IGOA 2JENA 2XVGA 2YPJA 1DYPA 4QD2A 4BWOA 2RS52 3VL9A 4IETA 4DOUA 2HEVF 2R0HA 5E88A 1N1VA 1XXNA 2XVKA 1LOFC 3RYKA 5LEJA 2ZMLA 2VPVA 4P14A 5AVAA 3THTA 3ZMNA 5ABJA 1V9U2 1Y3TA 1BK1A 4QQHA 5I91A 1C1FA 5FRAA 1I6XA 4IEYA 5LK5A 4M3CA 1TME2 2BYVE 4YVWC 5KXDA 2FZ2A 5SV5A 2DCYA 2Q1MA 3TYJA 4I3GA 4XF9A 1VAMA 3BOWA 2Q0AA 1W6QB 1X8MA 1VB4A 5CNAA 1AX1A 2D44A 1VALA 3VBFC 3WDVA 1BEV1 2IXJA 4H14A 4FT8A 1AYM3 4HLTA 4GQ7A 2XKOA 1R1A3 2WS93 2QDRA 4JGYC 4JGZC 1H2NA 5HBAA 2BTVC 1NOVA 2GNDA 1FPN1 3HIFA 5GLZA 2VW1A 2DUOA 4IESA 1YFXA 4JAAA 1NG0A 5FBZA 1NLRA 2ET7A 2HWC3 1JXNA 4KGQA 5F1RA 2IWGB 4FP3A 2VXRA 4G4FA 3NV4A 3ILFA 3RYRA 5BNNC 1F31A 1Q3EA 3I4IA 1LESA 1XNDA 2X5IA 3AYCA 2VVFA 4IEQA 4R9DA 3RWNA 2I07B 5T5LA 4XBQA 2VQAA 1S0GA 5DUVA 1SBDA 2EXHA 3ZXEA 3MIBA 2XJQA 1ONAA 3ZIXA 4M3CF 3L2YA 4TYSA 3WG4A 4PLMA 1MS1A 4OULA 5DDJ2 4BPZA 5ABJC 1D0HA 3WY6A 3OGGA 3ATGA 4LBOA 1MR5A 2NMOA 1XYOA 1FMD2 2PLV3 2RM21 5FFOC 1HRV2 4XJAA 2V73A 4HN0A 3SH3A 3M3IA 3QH6A 1BBT1 3CU7A 2D93A 4OHXA 4AEDB 1M06G 1AHSA 4CRQA 1AR81 4XMIA 3E6DA 1AR61 4OI1A 2LALA 5D8AA 1H30A 1YHFA 2OUJA 3TBDA 2WLQA 1HV0A 2ZMKA 3G7DA 5JPNB 4CEYC 5BV6A 1D2SA 4JVAA 1VBB3 2P37A 3IDCB 1EPZA 2MEV3 3B02A 2ZX1A 2RMU1 1G86A 2YZ4A 4IEUA 5C9AB 1GZWA 1OA2A 2BNOA 4E2GA 2CTVA 2CYFA 5CVRA 1QOSA 5BNOC 4JQRA 5JMCA 1RUI3 4TWTA 2AUYA 2XVLA 4Q0SA 1CR7A 1GSLA 2VY0A 4Q4Y3 5LK7B 1UL9A 4YW3A 3IIAA 4Q26A 4XFCA 2FHRA 4OHVA 3WDYA 1RB8G 2ERFA 4G9SB 1DGRN 1H4HA 2RS12 3KS7A 1OQ1A 5CFCB 1AVBA 1ENSA 2ZGUA 5FDBA 3OD0A 1HQLA 3NWKA 1DQ1A 3AP4A 1PMIA 1RUD3 4NN0A 2XJRA 3D6EA 3B9CA 1LU1A 3ZX7A 1N1YA 1RUH2 3EQEA 3SXWA 5AFEA 1PM7A 1COV1 2NMNA 3BCWA 1ENRA 3BTAA 2GU9A 1SLAA 1RJ8A 2VH9A 4GA9A 4A3XA 4ZXKA 5D8AC 1VRH1 1HV1A 1UPSA 4Y1VA 1QJZA 4NWVA 2A3WA 3VBOB 1W6PB 1BVP1 1VBD1 3AYDA 3ES4A 5DUWA 4Y20B 4W65A 3MLJA 1C8M3 1DQ2A 2JKBA 1DF0A 2GC2A 3DF0A 4Q4V2 4AI3A 2XPJA 2OA2A 4I09A 4FTBA 1RUJ1 1RHI1 1S55A 3IPVB 4Q4W3 1KRIA 2ET1A 4D94A 4LLFA 2JG8C 3M70A 3NV2A 5H9RA 3ZN6B 1PK6B 3HQXA 4N43A 1POV0 3JB4C 3S30A 3C2UA 2D6MA 1LR5A 4E4ZA 1J59A 1O4TA 2WNVB 5ACA3 4LHNA 1N1TA 3D8CA 4D69A 4OFGA 2OVUA 3ZYGA 1G9CA 4XIOA 1HRI3 2A6VA 4YG0A 1YXWA 2ZGKA 2QNKA 2K9ZA 3PVBB 4B29A 2QVSB 3ILRA 1NY71 1RIRA 4AVTA 1RUNA 4Q2FA 4PDWC 5KHKA 3VKOA 1ZRFA 2B45X 4QPGA 3MW4A 4YM0A 1QQP1 4CEWB 4BH9A 2JXAA 5JZGA 4H7LA 2KA3A 2WFF3 4F8AA 3VBHA 3H50A 1LOEA 3ZFGC 2UURA 4HL0A 2D6NA 4Q4X1 4S2FA 1CAVA 2EXJA 2O1QA 4BE3A 4M0NA 4UXAA 3TWIA 4YM3A 5FTTC 4LUKA 1S0CA 4IEWA 2QQPA 4M3CE 3GZAA 2ZTNA 1DQ5A 1ZM1A 1OPOA 2R49A 4AGGA 5K9YA 3WG2A 1G9FA 4UW6A 5BY5A 2R32A 5KHIA 1J3PA 4XJWA 3BPZA 2DFBA 2ARXA 4MXVA 3FX3A 3FLRA 4CYDA 1G7YA 2VNGA 4FPGA 2ZJCA 5JAXA 1NCRB 4B4PA 4IEOA 5A32B 4BLJA 4BZ4A 2XKPA 3QD6A 1YIFA 2DTYA 4AFAA 2PHXA 5EWSA 5J48A 4N53A 4RHV1 2B5HA 3WNXA 1IS3A 3VBRA 3TAYA 4HZFA 3W9AA 1GR3A 2GN7A 1YI9A 3MDPA 4XE9A 1V9U1 3D0SA 1W6OB 5BPXA 2E7AA 5FLHA 4H55A 1CD3G 2A7AA 1QJU3 3NV3A 3IWZA 4C90A 1CIWA 3VBSA 3NO8A 3VDDA 3CEWA 2JEMA 3IT8A 4YGCA 1RUG3 1TME1 4CDUA 1OQEA 4X8PA 2ZGRA 1IS4A 1DIWA 1EAH3 1H1IA 2ZABA 4GMP1 1B09A 1NLSA 3CJXA 1POV3 1R092 1R1A2 2WS92 3MPPG 4D3WA 5BNPA 2ZGLA 3IN9A 1DDLA 5JI7A 2UU8A 2AH2A 1DZRA 3VBHC 1V6MA 4X8NA 4P9IA 3PVOA 1H4GA 4R52A 4WM8B 2HWC2 2VUJA 2BUKA 5HCBA 3P3NA 4DRRA 2WLPA 2XB6C 3MZHA 4DFSA 2ZAAA 4LHKA 2WKKA 3DN7A 2BWAA 2XBO2 1VBC3 2TUNA 2C9AA 4IV1A 3SMHA 4KG8A 4PBPA 1X50A 4RSUA 2QJVA 3NW4A 5GZDA 5FLIA 3WR0A 1LGNA 2VMGA 1H9WA 1HXS3 1HW5A 1MACA 3AX4A 4AHXA 1WW6A 2D6LX 4AW7A 4U2AA 3H7JA 2C0ZA 4YVWB 2B39A 2NQYA 4P9JA 1UPIA 1F8VA 1W6NA 3ZYPA 2E53A 3V0AA 1NA1B 5DDJ1 5FO7B 4AFCA 4YVSB 5K0UB 5E1RA 5CIRA 5FMOL 2A75A 4PLOA 1QNYA 2JX9A 4WBBA 1KJRA 2RJLA 3ME2A 1FMD1 5J7MA 2K0GA 4HK9A 4K7JA 3MYXA 2DURA 1WCDJ 2WZR3 3LSDA 3O7OA 4Q0VA 1Q8SA 2EAKA 4SBVA 4MLOA 1H1MA 4AGVA 5JVVA 4JGZB 4H7MA 4JRAA 4L92A 2ARBA 1XU1A 2MEV2 3PMSA 1DGWX 1XQNA 5C9AC 2DCZA 1OD5A 4Z2WA 5JLVA 4IV3A 3PHMA 4XQWA 1LKNA 1W6MA 2G4IA 5T5PA 1YI7A 5E16A 4G3YC 3AP9A 3RS6A 1LOCA 1QJY1 1LOGA 3AXEA 2GMPA 3U11A 4Q4Y2 3KMHA 3VHPA 2DVAA 1HQWA 3ENRA 1PVC3 1I9RA 3M8LA 1ND2A 4ITCA 4IV1C 3E5QA 2UYAA 2XH6A 1VBA2 4DQAA 5AFBA 3RZZA 1S0FA 2QDNA 4S2DA 2BQPA 4HSJA 1DGRA 3AMNA 4QPIA 5ABJB 1DHKB 1GZ9A 3KT4A 5EZWA 4EWEA 1CONA 4LHLA 1AL22 4M3CB 3D82A 1VAKA 1RUD2 4ASLA 3CJIA 4XQ4A 1C5HA 5CBLA 1XNBA 3POSA 1D2QA 5I0UA 1OLQA 4S2GA 1TE1B 2RS11 1DLLA 1LHWA 2DVBA 4AEMA 4TZDA 3TRSB 1CJDA 3WQ1A 1XU2A 3U10A 1RL3A 3LSEA 2D5HA 4KH9A 4K40A 3VBOC 4CDQC 2W52A 3BOPA 2ZGQA 2ZKLA 1RUH1 3BODA 3E5XA 3GBFA 4FXKB 5T52A 4CEYB 3ZYIB 4OHYA 3RMXA 4RS5A 4FP2A 3HN1A 2XJVA 3FUQA 1D0GA 2UYBA 2Z42A 4UBHA 1O3SA 1O3RA 5JSPA 2CAUA 2IXHA 1CAWB 1LB2A 2GMEA 1CVNA 3V64A 3TNPB 1H2MA 4Z82A 4AQTA 3JD71 4NWWA 5J09A 4MVTA 1KJLA 4GULA 3B01A 1PK6C 5T5JA 3TN93 1AR93 5BNOB 4MGIE 4Q4V1 4GH4A 3EHKA 2YHJA 1MS3A 1ND3C 2ZGSA 4EJRA 3DL3A 5T54A 2EF6A 2QCSB 2UY9A 3AZZA 1SMVA 3IMNA 1FXZA 5CADA 3J8F3 3JB8A 5F9TA 1RMU1 3R05A 3OF1A 1HRI2 4QMAA 2XLAA 3EBRA 3IDEA 4XYXA 1YUDA 4KNCA 4FPFA 4K9SA 2PN5A 3GF6A 2D97A 1X8EA 4ORFA 3KGLA 4AVCA 2VECA 4QXKA 5I8SA 4ISQA 1MS5A 1FNZA 4CEWC 2ZGMA 5T3NA 3AZYA 5JR7B 2D43A 1BZWA 5HCAA 1A6CA 1LCLA 1SLLA 2WFF2 1FOD3 1PZ8A 1ZZ9A 2W39A 2P2KA 2A6XA 2ZACA 3UJQA 3AMMA 3GBGA 5D8AB 1QNWA 4R9AA 1ZBA3 3AYEA 4Z1VA 1RUC2 1ZNPA 1NE4A 5EJ3A 4YZ2A 2HWB2 1FV2A 2F6BA 4FOQA 3AKQA 3WP5A 4K20A 2QZ3A 3AMPA 2ZAHA 4BMEA 4XEZA 4AI1A 5AVPA 1PIV1 2RR13 1SBFA 1PGL2 2MNGA 4OI0A 2DUQA 2JG8B 1CGPA 3INAA 2AR6A 1NCRC 4FCAA 1UMZA 1AF9A 2RS31 1GZWB 5F6KA 2LM3A 3KQRA 3EO6A 3DGTA 5GLVA 2A3YA 2PAKA 1JBCA 1JUIA 4DB5A 1QXPA 3OJBA 4B7EA 3OPZA 3AFKA 1LOAA 4D7SA 5KXCA 4COVA 4YRDA 3KCXA 4Y1ZA 1CAUA 1FNYA 3AB0A 4RQPC 2P17A 3N7LA 1RUE2 1OLRA 3KCYA 3RI8A 1REDA 1YJLA 3RI9A 3MGUA 1GLHA 3ZXLA 3AZWA 1K5MA 4JTNA 2D3PA 1QDCA 1CAXA 2R043 1SFYA 4ONUA 1EAH2 2DU0A 4W6WA 1RGSA 3ZXFA 5AC92 4IEZA 4PDWB 4E2QA 1NYWA 1UZZA 3VL8A 3QACA 4KL1A 1OKQA 4HK8A 1YFYA 2ZX0A 1LTEA 2R061 1G8WA 3UKNA 4COUA 1VP6A 3JQXA 2A73B 1AYN2 4X6RB 1WCSA 4WM8C 1NXD1 5I0SA 3AJZA 3MIGA 4Y4YA 2JECA 1OHFA 3ALQA 2PAEA 2BBVA 1R091 2WS91 1B35C 1A8MA 2HKXA 4F83A 1VBC2 4FPLA 1S0IA 5D1IA 1Z0HA 2A5ZA 1MS0A 3AM2A 1IPKA 4Y1XA 1WLWA 2HWC1 3GHNA 5JOYA 1DYKA 3QCWA 5A3MA 1EYBA 1AR73 4R4XA 4YW1A 1KFXL 2XBO1 3I59B 4FPKA 3PVEA 3OBRA 4WVZA 1BXHA 2DU1A 1FAYA 1Y7BA 1AXKA 4N43B 4DINB 1V70A 1SFNA 2YGLA 1PGW2 3FBMA 4V1PA 1NA1C 1C4RA 2WL1A 4L9BA 4YVSC 1WD4A 1QOTA 4MSVA 1S0EA 2XWBB 5K0UC 1PVXA 3I8TA 1AJOA 4KG0A 1ZZ6A 1YNAA 2WJSA 5A33A 2BGCA 3JBG2 1PO12 2DVDA 4RGGA 4YARA 1LOBA 2HWE2 5JOWA 1A8DA 2WZR2 4QPGB 1D4M3 3M4FA 5DXDA 1ASJ3 3M3CA 3B69A 3E5UA 2WIIB 4I0AA 4B4QA 4A7YA 3OY8A 2E7TA 4P9GA 3VBHB 2HWF3 3FE5A 3M3EA 2JDZA 4HVQA 1Q5OA 2H0VA 4CDXC 5GLTA 1D4VB 4R4ZA 1JW6A 3WHTA 3MIDA 5KC5A 1RUOA 1SLTA 4L99A 4LO5B 2A6ZA 4MX3A 2WSUA 2MEV1 2GN3A 4QU2A 1DU3D 1GNHA 4NHLA 3LOIA 4WVMA 5H9SA 5FQ0A 5J36A 4Q0PA 3WDXA 5J96B 4EN8B 4PBOA 2BFUS 4QPYA 3WW4A 3OYWA 4Z92B 4PCRA 1VB2A 2ZZJA 2YYOA 4COWA 4N53B 2D5FA 2UWCA 3KSCA 2ZX4A 1VBA1 4YNIA 2TNFA 3EXUA 4MGZE 4LE3A 1PO22 1C8NA 1I5ZA 1UKGA 4D7TA 4W6YA 5LRSA 1OMIA 4AXOA 4JDOA 5I0RA 2C1FA 3SISA 1ULEA 2X29A 2EA7A 1MZEA 4LEJA 3VBSB 3V0BA 4YM1A 1VBE1 2R073 1AL21 2EXIA 1PHMA 1RUD1 4J6GA 1QH7A 3WINE 3MEPA 2ATFA 4XJ9A 2YUEA 5GZFA 1BEV3 5FOJB 3LA2A 1YIPA 2GNTA 4N7UA 3QOPA 5BNPB 5JPMB 1UZYA 4NOTA 1MEC2 1IZ3A 1GQGA 2VNOA 1ZBE1 1WW5A 2P3JA 3MFAA 3NAPA 4CP1A 5FMOS 2EALA 1FPN3 4C1WA 5FO9B 1ZVFA 4GB33 5C8WA 4QM8A 4GKXA 1KS4A 4OI4A 1QJX2 2Y26A 3TN92 1AR92 4Y26A 3KB5A 1SDWA 4E4SA 4O9EA 2VQ0A 1CX4A 2X5IC 2VW2A 2ZPXA 3WP4A 1GANA 4P9XA 1MQTA 3MW2A 1EP0A 4IV1B 1HIXA 1J3RA 3ZXJA 3POWA 3OBTA 2IXKA 1DG6A 1RINA 1BYHA 3BIWE 1OOPA 4M01A 4AI0A 3ZSJA 1QU0A 3DV8A 1DQ4A 4WM7A 2ZHMA 4XF0A 5HXVA 3ZVXA 3B93A 3D5OA 2C5DA 2ENRA 5T50A 2RM23 2W68A 1XE8A 3V0AB 1APNA 4RFT0 1FOD2 3MW3A 1BBT3 2FBEA 1WLDA 3OD4A 1TMF1 4OHWA 2WSVA 1AR83 3AFGA 3AJYA 4KWKA 1GKBA 1AR63 4I01A 3SCGA 4CDQB 3FBYA 1YWKA 2GDFA 2O8QA 4XJ8A 2YGMA 1LHUA 2F4PA 2B9UA 3VZOA 1BMV2 4YGDA 5KBFA 4GIQA 4LBQD 3WW3A 3GZTB 4YFZA 3ZSEA 4NVPA 1G9AA 3B5LB 1RUC1 3KT1A 3UKVA 2HWB1 2RR12 1QHDA 4LBQB 2RMU3 1H8TA 4C91A 4COYA 2WA4A 4ISRA 4PQ9A 1NE6A 1W6MB 4FOVA 1RUF2 4FQ4A 1WMEA 4AG4A 2WINB 1NQDA 4QGLA 5CB7A 1ND3B 2WNEA 4DNYA 3CLPA 3FUOA 1CESA 1ND2B 3HAGA 2CWMA 5HCFA 1TQ5A 1PGL1 1MZFA 5FPXA 1UX6A 1VIWB 3KZ4C 5KHGA 4QPIB 1FV3A 1U5ZA 4QGNA 1DBNA 2R042 1LU2A 1EV12 1Q56A 4E9KA 1QOOA 3ZN5A 1LULA 4P9LA 3CJIB 2IZWA 5IT6A 3MICA 4XPVA 1LHOA 3FZ3A 2E51A 5LEKA 1RUE1 4N9IA 1E57A 1Z7S3 3W58A 1OFNA 1COV3 4MXWB 2FMDA 1RJ7A 2H6BA 2NM1A 2V5YA 3HT1A 4XDQA 5AC91 3J26N 3QBQA 3R4SA 3AZVA 3HR9A 3I7DA 1KDKA 3AKPA 1VRH3 2CL2A 4Y22A 1POV1 3AP5A 4AF9A 4BMBA 4AGRA 1JOJA 4RS5B 5BYNA 2GC1A 1H8VA 1V6LA 3AK0A 3ZYJB 1LEDA 4R9CA 5J98B 3RQ0A 3ZSKA 3UK9A 1AYN1 2XLFA 3X29B 3MIFA 2ILMA 4C1XA 4YW4A 1O5UA 2ZOEB 3E6CC 4LO4B 1RUJ3 1RHI3 3O14A 5F6LB 2RS51 2NLRA 1H8TC 1LEMA 3USUA 2E63A 3VZJA 3GALA 4GH4B 4N43C 1DQ6A 3B3QE 1T6GC 3WQ0A 1CJPA 3ASIA 4GMP0 5JI9A 1WUVA 1S0JA 1UAIA 2YXSA 4HVOA 5C8CA 1JYCA 4LT5A 3T2TA 4BIFA 1SLIA 4RQPB 3O0XA 1WLCA 2AREA 5TSWA 1XE7A 4XTMA 4YYOA 4LBNA 1Y43B 2VW0A 1KD7A 2D6OX 5F5QA 1PGW1 2PHWA 1AYM2 3JCIA 4QPGC 1F9KA 1AL0G 4XXAA 3N3HA 4MUVA 5JZGC 2B7YA 1YLLA 3JBG1 3N7JA 1QQP3 1PO11 3IKWA 1GV9A 2HWE1 3FHIB 3PNAA 1ZZ8A 3ETQA 1OSGA 4K6BA 2VG9A 3CO2A 4NHKA 1S2KA 4FXGB 4J1XA 5GALA 4XHBA 4KWJA 4Q4X3 2WZR1 3LA7A 2EVXA 3H1YA 1G9DA 4FSJA 3FLPA 1B35B 2B46X 1PGSA 3OGJA 4HPKB 4JRLA 2YV8A 3ZDSA 2BWCA 5FCCA 4XJUA 4IEVA 2GH8A 3S0MA 1C28A 5J37A 1ZREA 1U5XA 4I02A 2PHFA 3ZFFA 3FJSA 2JJ6A 2JE9A 1U5IA 4C0HA 3ZXKA 3M3OA 2HEWF 2IFWA 1MZ5A 5FOBB 1HQNA 4N53C 2BW8A 4WVVA 3WLUA 4L8QA 5FREA 1YCIA 3KD4A 3WQ7A 3VBRC 4EWAA 1UD1A 3H3UA 2PLV2 4RD7A 4RHV3 4UBGA 2TEPA 2RHPA 2ZX2A 1N47A 4JC1A 5IK5A 1YJKA 1ZYBA 2PELA 1CAUB 5IK8A 5GZEA 2JG9A 4GKYA 1V9U3 3VBSC 3VDDC 2OYZA 2YDEA 3ROUA 2R072 2G9GA 4CDUC 5CFCA 1HRV1 2DWRA 1K5MB 2EAAA 3R4UA 1V6JA 1PO21 4CZSA 4EV0A 3O0VA 1VBB2 3R4DB 1BEV2 4GMP3 5BNPC 2VU9A 3AP7A 2HYKA 1FYUA 2KM2A 1SQ4A 4UW4A 1N3PA 5DUUA 1LGCA 3AMQA 3WDTA 4R8HA 3M1HA 4JV4A 4EN7B 4CDXB 2RE9A 4GB32 4I0WB 4YG3A 1RUI2 2A3XA 1QGLA 1MEC1 4IQPA 3VKMA 2A70A 2A6YA 5EYXA 5EXOA 2FZ1A 2X8KA 4EN6B 2Q30A 5C4WA 4JCKA 1QJX1 3ZFFC 1AR91 5GM0A 1N1SA 4I3PA 1UIKA 1Q8OA 1LHVA 1KXGA 5GLWA 4FBFA 2BVBA 1SCRA 4INDA 4AQ6A 4B8EA 2OUHA 2PHRA 3KLSA 4U36A 2XJUA 4HKLA 2ZCWA 3PMEA 3H7YA 1G9BA 2A6WA 5A33B 5I8TA 1AR82 4AWDA 1QY4A 2XL9A 4I2OA 4FAGA 4XXPA 1UF2C 1FMD3 3ACLA 5DG2A 3B7MA 1X36A 2DV9A 2CGOA 2ZS6B 2HWD3 2LUWA 4CP0A 3G6JB 3LB9A 2QUOA 1C8M2 3KM5A 4ATEA 2AYHA 1A3KA 3OY8B 3VBUA 4DY5A 2UWBA 5GKAC 2D3SA 4Q4W2 5C6CA 3GBWA 3VV1A 4GWMA 4FOWA 4IV3C 2RMU2 2VOKA 3ZSLA 2CY6A 1BMV1 3RPQA 1GYKA 3SH5A 5JOXA 1FT9A 4QM9A 1O3QA 4RR3A 1O7FA 2X5IB 3FC0A 4B4RA 1ND2C 5BXXA 2R1DA 3H3ZA 1QJY3 5KHJA 1Q8VA 2RR11 1F5FA 4Z07A 3RSJA 5ACA2 5B2GB 1XYNA 4WVMB 2VMHA 5FQ0B 2WNUA 2GC0A 1RUF1 4QPIC 5GZGA 2O8OA 3OYWB 4CDWA 4AHWA 4GALA 4WZFA 4K21A 5KXEA 2NYYA 1GBGA 4KQ7A 4ES9A 5EYYA 2D98A 2I45A 1O3TA 3CJIC 4NPRA 4R9BA 1ZZBA 2GZWA 3WZ1A 3MLLA 3SCFA 1Z7S2 4M00A 2NP0A 1COV2 4YGBA 3PJYA 2RS13 3NV1A 4K1YA 5HI0A 3ZYRA 3V0BB 1EV11 4OVEA 4XILA 2HEYF 1AUYA 4PIXA 4YM2A 4RS5C 1V00A 1RUH3 4HVRA 4KGGA 4XZPA 4Q27A 4EWDA 4BM8A 1YYNA 3ST7A 4C0BA 3VZKA 3VBUC 4BQ1A 3ZXDA 3NL1A 3NAPB 2ZGNA 1MS9A 3H1WA 1RUJ2 1IPJA 1RHI2 4OUSA 3A0NA 3WUDA 1QKQA 3JD73 3TB0A 5T55A 4N7IA 4LBLA 1QF3A 4GH4C 4N90A 1X82A 2R0FA 1HLCA 4Q4V3 1MQTB 2E9QA 1GNZA 3NJZA 1MS4A 1LOFA 3HWJA 1GQHA 1UU6A 4QQLA 3N4MA 1QJU2 5E89A 2QKDA 1RMU3 4E2SA 1RUG2 2H6CA 5DG1A 1RVF3 4OZXA 5FLJA 3N35A 2ZGTA 5KHHA 5L7OA 2GALA 3USSA 2UY8A 1NY72 3VHNA 3FMGA 2D6PA 1GFF2 3RMYA 2R16A 4UW5A 3O5SA 3QH7A 2XLGA 3DKWA 3RNSA 1QQP2 1VJ2A 4XJZA 1VLNA 2Z5WA 1CPMA 3R0RA 3UL2A 3ZIWA 3RG0A 1AYM1 4DRVA 2DTWA 3VBFA 4PJYA 4Y1UA 5FO8B 1HX6A 2WT2A 1IKQA 4AEKA 1R1A1 4K1ZA 1W2UA 2XJSA 5BUVA 1MS8A 3I54A 4JGYA 4LULA 3D0JA 4JGZA 1QXJA 4XBNA 2VOVA 5JSRA 4IEXA 1YRZA 4LO7A 3BB6A 3S7EA 4OLLA 3ZN4A 3VN4A 1PIV3 1HXS2 1H8TB 4XQDA 3L2HA 5BNNA 5DZFA 2RS33 1LGBA 1DQ0A 2PA7A 4RHV2 3QLQA 4Q29A 1QXRA 4XBLA 4XETA 2O0OA 4PIZA 2ZGPA 4P5HA 1LECA 3WP3A 5LRRA 4Q0UA 1ULFA 3JUUA 5E8AA 2WZPP 3THPA 5CG8A 2PFWA 1RTVA 3H9AA 4AFMA 4XFGA 1C3HA 1MVEA 2PLV1 1K5MC 1FI2A 5FAXA 1R083 4IEPA 4L97A 4E27A 1ZZCA 5L7OC 2FMYA 3RJ2X 1QH6A 4HBNA 4LE4A 4XF4A 4NHMA 4QQ2A 3VKLA 3LA3A 2A71A 4FPOB 2WQ4A 2ZHNA 5JZGB 2V09A 4KBBA 5EFUA 3ZSMA 2R071 3MPBA 4AYUA 4KU7A 2R063