3WP5A

The crystal structure of mutant cdbfv e109a from neocallimastix patriciarum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
227
structure length
227
Chain Sequence
EFQSFCSSASHSGQSVKVTGNKVGTIGGVGYELWADSGNNSATFYSDGSFSCTFQNAGDYLCRSGLSFDSTKTPSQIGRMKADFKLVKQNSSNVGYSYVGVYGWTRSPLVAYYIVDNWLSPFPPGDWVGNKKHGSFTIDGAQYTVYENTRTGPSIDGDTTFNQYFSIRQQARDCGTIDISAHFDQWEKLGMTMGKLHEAKVLGEAGNVNGGASGTADFPYAKVYIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDBFV
publication title Structural Analysis of a Glycoside Hydrolase Family 11 Xylanase from Neocallimastix patriciarum: Insights into the Molecular Basis of a Thermophilic Enzyme
doi rcsb
source organism Neocallimastix patriciarum
molecule tags Hydrolase
total genus 56
structure length 227
sequence length 227
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp5A00
1BCXA 3WXPA 3VHNA 1C5IA 3VZJA 1OA3A 3M4FA 3WQ1A 3AMPA 3WQ7A 3AKTA 2DFBA 1C5HA 1YNAA 2QZ2A 2JICA 3WQ0A 1XYNA 3WR0A 1H1AA 1BVVA 1IGOA 4IXLA 2VULA 1REFA 3AMQA 3VZNA 3WT3A 3O7OA 3VZKA 3B7MA 3WP4A 3VLBB 3VHOA 2B46X 2BVVA 1UKRA 1F5JA 1QH7A 3AKQA 1HV1A 3RI9A 5EJ3A 3WP6A 1UU5A 3B5LB 3LGRA 1W2UA 2Z79A 5K7PA 4HK9A 1H4GA 2DCKA 1XNDA 1XNKA 4S2FA 2BWCA 3VZLA 2DCYA 1H4HA 3VGIA 4XQDA 2F6BA 4HK8A 1OLRA 4XQ4A 3WX5A 2QZ3A 2NLRA 1HV0A 2VG9A 5HXVA 2D97A 1H8VA 2JENA 4S2GA 2B42B 2BWAA 4S2DA 1T6GC 2C1FA 3AMMA 3AKRA 1PVXA 3VL8A 2VUJA 2BW8A 3AKPA 4NPRA 1TE1B 3VHPA 1UU6A 1OLQA 3ZSEA 3EXUA 1XYOA 5K9YA 1KS4A 1XYPA 4HKWA 1QH6A 3HD8B 3WP5A 2DCZA 1H0BA 1REEA 3LB9A 2DFCA 3VL9A 1NLRA 1XNBA 4H7MA 1UU4A 2DCJA 1OA2A 1BK1A 1REDA 2D98A 3VZOA 2JEMA 4XQWA 4XPVA 3WY6A 3AMNA 1OA4A 3AMHA 1KS5A 3MF9A 4HKOA 3MF6A 3RI8A 3MFCA 4HKLA 2NQYA 2VGDA 4S2HA 3MFAA 3AKSA 3VZMA 1M4WA 1ENXA 1AXKA 2B45X 3WP3A 1HIXA 1XNCA 1XXNA
chains in the Genus database with same CATH superfamily
5AC92 1HKDA 4AHXA 2ILMA 1RJ7A 2XDVA 4XDQA 4XJ9A 2PHWA 2QQVA 1W2NA 1S0GA 5C71A 3ZPYA 4Q5OA 4UXAA 4JKKA 3WQ7A 1XSQA 3AKTA 2Y64A 4AAXA 2ZA9A 3OBRA 1NZIA 1HB4A 3N9LA 1TMF2 3R4SA 1ASJ1 5IVVA 5EJZB 2RE9A 1PK6C 1QOSA 2XBO2 2RJLA 4PDWA 1HJGA 3WT3A 1K5JA 4HMZA 1DGRN 4CP9B 3WLUA 4KQ7A 3WP4A 5JIUA 2MEV2 1WBFA 4PI0A 4V2WA 3NVCA 3AFKA 4LLOA 2ZEYA 1JOJA 5FZBA 4KNCA 1IPSA 3AKQA 3K2OA 3TRSB 3SKVA 1LOEA 3OBTA 1RXFA 4P9XA 1PZ8A 3I54A 2IFRA 3ETPA 2FDHA 4IL7A 3USSA 1W2OA 5C3QA 4CP0A 2HJIA 2IVJA 5IK5A 4S2FA 1RHI3 1JYWA 2Y6LA 1H8TB 4COZA 1H4HA 4BPZA 5GLVA 1SFNA 4IEZA 2VMDA 3OGJA 3FLPA 5FMOL 1C3HA 4PDWC 4XE9A 5GKAC 1A8MA 3MV01 2YFZA 3WX5A 4GWMA 3LCPA 4CDXA 4K3UA 3ORJA 1WKYA 1UQXA 5HXVA 4OUMA 1AL21 2P5BA 1UPSA 2VD7A 4M3CB 4EWEA 1POV0 4K8RB 2X8KA 4Q4X1 2BNNA 5FWEA 1ULEA 1IG3A 5FPXA 3PVBB 5E88A 4EN7B 2WWUA 3ACLA 2AC1A 3I3EA 1TME2 2JB4A 4XJUA 2RMU1 2C4XA 2WNVA 4RHV1 4Z2WA 3KCCA 5A3NA 5DUVA 3AX4A 4WZFA 3N7KA 5EP9A 3B9CA 3BIWE 1RUE3 3D6EA 2ETEA 2X53S 4META 1QNWA 3JQXA 4URTA 2W1SA 4XBQA 4NHMA 4BXFA 1TQ5A 2P34A 1UY0A 3POWA 4KH9A 5LA2A 2K9ZA 3RWKX 1PIV3 4AEMA 1OVPA 2ZKLA 3VBFB 4CDXC 2VBPA 4CYDA 5JZGC 4A6SA 2K2SA 5B2GB 4PJYA 4XETA 4XQWA 2W1QA 2D7FA 4I0AA 1OH3A 4BJ0A 1SDDB 2HYKA 2D3SA 2GNBA 4LT5A 3KGZA 4A7KA 3H8RA 2VNRA 2W87A 3AJYA 1LR5A 3MICA 4C1XA 3APBA 3BGAA 1PNFA 2ZX1A 4R52A 1YWKA 3MFAA 4NHXA 3CDZB 5FAXA 1SCSA 4LBOA 4QX3A 5F3CA 3NNGA 4Y1UA 1QY4A 4KWUA 2CAVA 2PHTA 5HCAA 4OI0A 1V9U2 2Y8KA 3OBAA 5A32B 5FIXA 4BMBA 2E6VA 3D82A 4HPKB 5I0UA 3BVCA 3OB8A 2XLFA 2YHJA 1BEV2 3Q8AA 1XJAA 1NE6A 1IOAA 1B35B 3I3DA 1ALYA 1UL9A 4MGZE 3NJVA 3BTYA 2HKXA 4RGGA 2Z5WA 3AMPA 4GMP0 1YC61 3K4ZA 4ISQA 4QKDA 5GLZA 4B4RA 4COWA 2DFBA 1QJU2 1FX5A 5DAWA 2BU9A 4IE5A 3IDAA 4XFHA 1C5HA 2GN3A 1JYCA 1O4TA 2BBAA 2A71A 2JE7A 3IPVA 4Z92B 2A6YA 4OUEA 4Y1XA 3ABZA 5FZGA 3O1SA 1RUC2 1ZRCA 4UBGA 1VRH1 1TNFA 4K1ZA 4SLIA 4Z82A 4HXCA 4OCTA 3VLBB 2JWPA 5IVJA 1O5LA 4BISA 5C9AC 1VALA 3ELNA 3FHIB 3QBQA 4YW6A 1ZRDA 4FQZA 2ZHNA 3ZFEB 5BYNA 5E8AA 2BJSA 5I8SA 5FO8B 1RUF3 2OKXA 1F5JA 3I7DA 3ES4A 3WF1A 4COVA 5A3LA 5JXGA 3Q8EA 1ENQA 4FI9A 1C8M1 2XONA 1JW6A 4LOSA 1ACCA 2W2IA 1LAJA 1ST8A 2Z79A 5JI7A 1NXMA 4ARXA 3AJZA 5JOYA 1CAVA 3MO4A 1H1IA 2OW4A 2VBDA 3RZGA 5LBEA 1MS3A 5FZEA 3C8XA 1JYXA 2G9FA 2F6BA 4CDUC 1KDKA 4CXYA 1W9YA 4C91A 4AI9A 4DEVA 3ZXDA 2P3KA 5FJKA 4BDVB 2QKDA 3KHBA 3LAGA 1A3KA 1QXPA 2F4LA 3VDAA 2QCSB 2HWF3 4QPGA 5FZOA 3O1PA 2CGNA 2ZHLA 1P8JA 4S2GA 3VDBA 3HQUA 4UYBA 1X82A 2DUPA 2VQTA 4FOWA 4QHOA 1SBFA 5AVAA 1WLCA 1JBCA 1JZ6A 1Y43B 2XHNA 2RS13 2NMNA 4NIHA 2W47A 2Y6FA 3LKJA 1LESA 1RUH2 2R073 1QGLA 2W39A 4GJYA 5BUVA 1PGSA 3NNMA 4AK3A 3KV4A 2DBNA 5KBFA 4QPIA 4TXWA 3ZYHA 4EV0A 5A6QA 5J09A 2WS91 3PJQA 5HV0A 2WAOA 2JE9A 2BVBA 5FYBA 1I1EA 4P5YA 2DCZA 4Q4Y2 4YRDA 3LB9A 4AI3A 1NLRA 1XNBA 1UU4A 5LY1A 4QPGC 3I2GA 4AQSA 3MUZ1 5CEHA 3GJBA 2VQ0A 2Q8CA 1M06G 4X6QB 4ZU4A 3R0RA 3IM0A 4PDWB 3FL7A 3HBZA 1N3OA 2J42A 4IUGA 4AEJA 4BE3A 4GWIA 1IQDC 3WEZA 1HRI2 4CU8A 5F3IA 2LM3A 5I0TA 2FDGA 1UKGA 1TEIA 2BYVE 3MW4A 5EFUA 4RD7A 1XU2A 2PHXA 5LBFA 3FBYA 5A1FA 3UNPA 4QPIC 5GJ6A 3NW4A 1NZCA 1PO23 5C5TA 3KF5A 1J3QA 1UO9A 2WO2A 4XYXA 3WDYA 2Y6KA 1LGNA 1C5IA 3HR9A 4Q8LA 4QQHA 3IDEA 4RFT0 3PTRB 5I8TA 4LUMA 3GM8A 1EUUA 1ND2A 3AZZA 2HWC2 4PIZA 4XDOA 1JODA 3U37A 3VBUC 4AQ2A 5A70A 4RR3C 4UOJA 1XYNA 4XZUG 4CDXB 4QPYA 1CR7A 1KGYA 2VQAA 4AVSA 2X05A 3WNMA 3AMQA 4YM2A 2EAAA 3RWNA 3VZKA 2JDUA 2OXBA 2UU8A 4Q4V2 2HH9A 4GIQA 3VHOA 4CDQA 3AXDA 1MEC2 1O7FA 4XHBA 1C57A 3JBG2 2RM23 5ACA3 2PLV2 3DEMA 2BVVA 1L7RA 4HFSA 2FDIA 5JIAA 1JXNA 1EAH2 2W1WA 4XFBA 4F7ZA 1R1ZA 3E5UA 1QXJA 3OPWA 2WNVB 3J4UH 4I3PA 3NSTA 5FP3A 2UYBA 5J96B 1KJLA 1I5PA 1W90A 3A7QA 1PGW1 1YXWA 3H50A 1RUD3 3A0KA 3USUA 4CEYA 1PIV1 2E33A 2QUOA 5HCFA 1ND2C 3UYJA 1Q43A 1W8FA 3N7JA 1F2NA 4EN6B 2B9VA 1PO12 3ALQA 2K46A 3ZDVA 1STMA 5IJRA 2DYCA 3PDQA 4BLJA 2GDFA 3Q8BA 5FP9A 4C90A 2QZ3A 5BNNA 3W5MA 3A21A 4OVEA 4CDQC 5A3UA 5ABJA 3OUHA 1JYIA 2OQ6A 3VD5A 2WQ4A 3W58A 3MGUA 3BN6A 2GP3A 4E4SA 3D0SA 1X36A 4D7TA 1GLHA 1FNYA 3H7JA 3SMHA 1A78A 1F15A 4A2UA 2ZGTA 3CZJA 1LCLA 3ST7A 4CEYC 5JUVA 4QHBA 5FPBA 4D8MA 5SV8A 3FC0A 1VJ2A 4XUNA 4ZHNA 1UMHA 1RIRA 5GZCA 3H9AA 4AFBA 5LCWL 3LEMA 4JHTA 1HB2A 2XJRA 4CDWC 1OQDA 3LQCA 5C8CC 4YM0A 1PVC2 4CTEA 3NV3A 4OI2A 4FCAA 1UCXA 4XF0A 4CP2A 4HVRA 1VRBA 5K8SA 2VMHA 1CZSA 4IEUA 3CQOA 2VOTA 3LZZA 3ZXEA 4DXRA 2ZEWA 2BNOA 1ZBE1 2CGOA 1RMU3 2RDRA 3AMNA 2YGLA 1OA4A 1Q8QA 3IPVB 4NOTA 4PQ9A 1WBLA 1NQJA 4O61A 2WO3A 3BOWA 3CF6E 4N43C 4XTPA 1LNSA 1ZM1A 3AP4A 5FO7B 3S0MA 4LO5B 4L8QA 1KFXL 4XF9A 3UJQA 5LA1A 3V0AB 2JG8C 4YGEA 1RUE2 1SDWA 2VGDA 4FBFA 3ETQA 3RYRA 2O8QA 5D21A 1V6MA 2OPKA 3FHAA 4KG0A 5FYUA 5FZ1A 4LBJA 3ZYPA 4CU6A 2B45X 1GMMA 2VUCA 4G9SB 4H2AA 5CISA 1N1SA 2VOXA 2CY6A 3T2QA 1XQNA 1ZZ8A 2ZX4A 3WDWA 4HVQA 4FPKA 1JS9A 3VHNA 2DDUA 3JD71 5KHHA 4A44A 1RVF1 1CAVB 4AI1A 2ARBA 4ONUA 5FZ6A 3M2MA 2YZ4A 2C5DA 3AYAA 3R6SA 1X33A 4IETA 1IG0A 3PIGA 3WNOA 1IKPA 2XUEA 2HWF1 2YB7A 2UWCA 4QWNA 3WOGA 5JXHA 3CIHA 2OS2A 3N7MA 3WQ0A 5BXXA 4JRLA 3GHNA 3P6BA 4Q0SA 4QPGB 1OQEA 1RUJ2 5F39A 5JOXA 2VMEA 5FZOB 4BB3A 4QQOA 4XUTA 3KV9A 4R4XA 4YM1A 4AYUA 5EJ1B 1RJ8A 4DB5A 4GA9A 4V1PA 4EE2A 3ZKYA 1BMV1 2PYTA 1XNTA 5KXBA 1COV3 4M4PA 4B1MA 4LPLA 3OF1A 2RS11 3T1LA 4CUBA 1JZ5A 4OHWA 1LU2A 4QX5A 2IXLA 2JIGA 4IGOA 3ZSLA 1IQAA 1S0CA 4LE4A 2FMDA 3J26N 4CCDA 2BQPA 1QDCA 2VTXA 3AK0A 1O3SA 5I93A 1WD4A 4QPIB 1NLSA 4LE3A 3TWIA 3OSDA 4N7IA 1C1LA 4R9BA 1FT9A 1AR93 4K40A 3WDUA 2B4KA 3JXSA 1GNYA 4NAOA 5IHRA 2YC4A 5C4WA 2C0ZA 3TEYA 1AVBA 1H2NA 3LDKA 1QJY3 4XQ4A 1G9DA 5HXMA 2EALA 1VBE2 2VQUA 4BCUA 4YVSA 5IVBA 5FZCA 1VAKA 4JDOA 4PBOA 1WMEA 4HOOA 5A33A 3VBHA 4L92A 1OT5A 4YFWA 4BIOA 4D6SA 2QQLA 4COYA 2CAUA 1MZEA 1UYZA 4P02B 1UY3A 4Y5SA 5ERLA 4AQ6A 3ZXJA 4P5HA 4Q4W2 4B29A 3RZMA 3J7HA 1JZ8A 5T5PA 2VZPA 2BW8A 3VKFC 4BQ3A 2IXJA 2BERA 2WA3A 1LULA 4W6XA 4XBNA 4BQ4A 2Q1ZB 3ZXKA 1V6JA 3CHXA 1A8DA 4AFCA 1JOBA 4B7KA 4CE8A 2KR2A 3RVHA 2BBVA 4DXSA 3ILNA 3HAGA 2CHHA 1CZTA 2XJPA 4M3CA 4WVMA 2IZWA 3WF2A 1NQDA 3WP5A 5IWFA 1REEA 4H7LA 3VBSA 1ZZBA 1ND2B 3W20A 2XL7A 2PA7A 3VB9A 3VBHC 1LB2A 2WKKA 1OFSA 2RDQA 3RMYA 2XVGA 3WY6A 5L36A 3H3UA 3HBKA 1RUI3 3DPRC 5HV4A 4XF3A 5EYXA 5FWJA 1CAXA 2WZR2 1E5RA 2IXKA 3I4IA 2RM21 4O7XA 4Y20A 5FO9B 2TUNA 2EXHA 3I59A 3CO2A 4HKLA 4Y1VA 1BKZA 4CDQB 2NQYA 4URAA 1W04A 1GQGA 1UZ0A 1VPHA 2BNMA 2YYOA 1O3TA 1YQ8A 1Q5OA 1ZBA2 2PHLA 2LROA 2EIDA 2ZGRA 3I97A 3B3QE 4J6GA 3N4MA 1V00A 5AFEA 3OEBA 1RUD1 2R063 4JGYC 1W99A 1H2KA 1OMIA 2GNMA 1AF9A 1QQP2 2Z2SB 4JDNA 4XXAA 2GNDA 4JTOA 4YW5A 3IBMA 1R083 2HWB2 5J3UA 2DUQA 3USUB 1DG6A 3VBSC 4CEYB 5JWPA 1RUOA 2ATFA 4LO6B 1FAYA 4ZXEA 1UOFA 1XE7A 2OYZA 1A6CA 2XXZA 5FLJA 5CFDA 4Y4YA 1ZA4A 5KC6A 3GZTB 2FQPA 1OKOA 2QZ2A 2WLQA 5LWBA 5BNNB 2BZDA 2CTVA 4KBBA 3WD5A 1IGOA 2WZ8A 4YGDA 2Y33A 4FOQA 4PIYA 5A7SA 4CEWC 1IHMA 3LEGA 4FVVA 4UAPA 3TN93 5ABJB 2YBPA 4Y26A 2ZXQA 4LBQA 2P3YA 3VKOA 4CP1A 3WCRA 3DCQA 1GUIA 3WHTA 4QXHA 4CCMA 2D44A 1WA4A 5L9RA 3ATGA 4PBPA 2OX0A 1UKRA 3AC0A 1JTZX 3JU9A 4LKFA 4E8CA 1D7PM 2DTWA 2XL9A 4MVTA 2IXCA 4ZPIA 1W8TA 1Y9GA 5F37A 4CPBD 1FMD2 5K7PA 3MI8A 3BALA 1AYN1 2BDRA 5FYHA 5J37A 2ZMNA 5SV5A 1RUG2 1WA6X 5A7QA 3VDCA 5CFDC 4CUCA 3K46A 2Z42A 4CXXA 2WO7A 1YI7A 3IAQA 4XQDA 1ZRFA 2CV6A 2PHRA 3EO6A 1UNBA 2WIIB 1AJOA 1SLAA 5DUUA 3SISA 1RMU1 3M1HA 2H6BA 1JOPA 3WSOA 1HJFA 3NJZA 5C6CA 1AR83 4MV2A 3B9IA 1NCRC 3I2IA 1AR63 2AENA 4ZZ5A 1H2LA 3RJRA 2VUAA 2VZUA 1JYVA 1GKBA 4S2DA 2D40A 1CX1A 1T6GC 1JHNA 1DF0A 3QH7A 3JCIA 4XW3A 1R093 4BXSV 1NY71 1ND3A 3UJOA 2A6ZA 1BLZA 4OZOA 2ZX2A 1MZ5A 3K4AA 2HWD3 3PLQA 4NPRA 3VD4A 3SEPA 3HWJA 1B09A 3RPQA 1N47A 2VPVA 2IUWA 3EXUA 4M0NA 3V0BA 2WN3A 3K48A 4H14A 5LK5A 3BU7A 1SHWB 1Q56A 1TVGA 2KM2A 5DDJ3 3LSEA 4IGQA 4QD2A 4XUPA 4AVVA 4QU2A 1K42A 2H0BA 4EWAA 5F1RA 4IEVA 4YZ3A 4NVPA 1UXZA 4YG3A 2ARCA 2YPDA 5C8WA 3NAPA 2D98A 3LDRA 4RGKA 3OG2A 5FZDA 1WCKA 2VC9A 3FZ3A 5JDBA 4RS5A 1VIWB 1VRH3 4LIVA 2ADDA 2ZZQA 3PUSA 4YSFA 2YMZA 5FPVA 3MF9A 4N90A 4Y5Z0 2WYSA 1H1MA 3HT2A 4QHZA 3UKVA 5AC91 3PUAA 1COV1 1SLCA 3SH3A 4LTAA 4AVAA 4DMIA 4JGZA 3T30A 1KFUL 2VAUA 4BQXA 3E1F1 2D3RA 5JR7B 1KD7A 1KXGA 4IEYA 5FJHA 1DGLA 3W59A 5FV3A 1KEXA 3VZMA 1WZXA 2VOKA 3ROUA 1YFXA 1O4YA 3QOPA 1V6KA 4A3ZA 1POQA 1LTEA 2QQUA 3PVEA 5F9TA 2BGPA 5A3OA 1ULFA 1K5MB 1QWRA 1Z7S2 5E89A 3RMXA 2WN2A 3QCWA 2VU9A 4PT6A 4XF1A 3SKJE 1AR91 2FBEA 4NROA 4YW4A 1GWKA 1NLQA 1XOYA 3ACFA 3FUOA 3H7YA 2PTMA 3EQEA 2Q30A 2YU2A 1U12A 1QXRA 2A6VA 2D5HA 2A7AA 3F2ZA 1WWYA 3NRUA 2JD4A 3OUIA 4RS5C 5FCCA 3K75B 4CUAA 1PK6A 5C4WB 1A34A 4K8FA 5JMCA 1H1AA 1JHJA 1V0AA 2JX9A 2RS33 3KCYA 1REFA 4YVSB 3AZWA 2V09A 3VBHB 1S0FA 2XVKA 2WINB 1XU1A 2WSVA 3N36A 3VZNA 4BMEA 3TEXA 2GMMA 1ENRA 3IT8A 2RR13 1EV13 2WABA 2GN7A 4GWJA 4QX0A 1NKGA 3RRDA 4DUVA 5FDBA 4IERA 2OPWA 1AR72 2VZTA 5HBAA 1W9WA 4XAEA 1QOOA 2WFF2 3BOPA 3BTXA 4WV8A 4Q0PA 2AREA 2J1RA 4YWAA 1YIPA 3JUUA 4XC9A 3UKTA 1LOAA 1HV1A 1MPXA 1Q8SA 4PLNA 5EJ3A 4K6BA 2WS93 3MYXA 1VBB2 4AGRA 1ODMA 5CG8A 4MHUA 3KM5A 2YXSA 4WVMB 1BVP1 5CZKA 2YBKA 3NV4A 2WNUC 4N53C 5FLHA 1MACA 2P2KA 1W39A 4HK8A 3FMGA 3VBSB 2QQIA 1LEMA 1QDOA 1W05A 2I74A 3SQOA 3TB0A 1RUI1 4B4QA 3O12A 4KWKA 2HLEA 1GNZA 2ZGSA 5JSPA 2F4PA 1UZVA 5AVPA 1US2A 2FHRA 3PUIA 3KCXA 4QDQA 2JENA 3E6DA 3ZYGA 4BK5A 1CAXB 2WLPA 5A6YA 1W2AX 2PHFA 1FOD3 3C7EA 5DXDA 4Y20B 3AKRA 3AM2A 1MS1A 3I59B 4Y22A 5FZ9A 3DXTA 3WF0A 4FOYA 4YZ1A 5A1LA 5F7UA 1DGWA 3HN1A 2G4IA 3GCWA 3INAA 2R061 2DTYA 2D6MA 1G6NA 1DDLA 4GULA 4OMCA 1HN0A 4A3XA 1JZ7A 2CWMA 2X09A 1H9WA 4LLFA 3GBWA 4XUQA 4R4ZA 1R081 4Y24A 3ZX7A 3JB8A 4ES9A 1Z78A 4QQ2A 4MYEA 1D0GA 5I0RA 4IE4A 1QJY2 4BLIA 2XQRA 2OVUA 4AI0A 1R1A2 2IWGB 3J8F2 1ZZ7A 1PHMA 2R042 3KQRA 4AI8A 5L73A 4LHSA 4AEKA 5JZGA 2JG9C 2GP5A 3LE0A 1FATA 5CFDB 1QJFA 5T54A 5CKMA 2LS6A 4FP2A 4OQ8A 4UI9L 3TN91 4XEZA 2G9ZA 5F5AA 3GXUA 3A22A 3VDDA 2Q8OA 4HN0A 4FQ4A 2VMGA 4DO0A 1GOHA 4LBQB 2CU5A 4YZ2A 1WW7A 1OD3A 1X8EA 1W6OA 2YC0A 3MFCA 3POIA 2SBAA 5EIYB 1UN1A 1D2SA 1E5SA 1GQPA 1G9AA 3T0BA 2DWRA 3N9MA 4HZFA 1ENXA 5I8YA 3RZLA 1QJU1 1XNCA 2WWSA 3O14A 4P9WA 4YZ5A 3TEZA 3ZVXA 4ZY9A 4FPJA 2OZ6A 1ASJ2 3PUHA 3RZHA 3OEAA 5CU1A 1HDKA 4G3YC 2JDYA 4NPMA 4M00A 3WQ1A 3UKNA 5FZIA 2JECA 4JKMA 1GANA 1AR81 4FSJA 3I2DA 5IATA 5H9SA 1AR61 1YNAA 2ZOEB 2GALA 2R1BA 4Y5TA 2XJQA 4B8EA 3VDDC 3OD4A 4CU9A 1S0EA 1H30A 2HWE3 3KMHA 4KU8A 4AVBA 3M3EA 1UY2A 2A73B 4DINB 1QU0A 1R091 1ZA7A 2KD7A 5C9AA 2WUHA 3PURA 3I3MA 4FFIA 2WT2A 2D6OX 3MEPA 4XOGA 2HWD1 1C8NA 4I3GA 2XPJA 5FMBA 3VN4A 1ND3B 2FCUA 4D0QA 2VZSA 3UL2A 4KG8A 4WM8C 1W9TA 5FYZA 1W3VA 3O0WA 3RI9A 1GQHA 2BEOA 3CL1A 5DDJ1 2OUJA 3AL6A 3WP6A 4DNYA 4LA2A 4OI4A 4XFAA 1KDMA 5CKQA 5LZ6A 1H4GA 3EBRA 3VBRA 4FP3A 2WSUA 3O1MA 1AYM3 1RXGA 2ORZA 3H42B 1AL22 4CDUA 2A3YA 4YW2A 1OC1A 4UFJA 5FPAA 1E5IA 1MVEA 2ES3A 4Q4X2 4AHZA 1Y9QA 1OLRA 1ZBE3 3NAPB 1CAUA 2ZTNA 1AX1A 1NCQA 1HV0A 3OY8A 2RMU2 4RHV2 2W94A 3AVRA 1T6BX 4RS5B 2MHFA 5IVEA 5A6XA 1YQ2A 5FYYA 3ACGA 2B5HA 4BM8A 3M8LA 3K51A 1JZ3A 1UOJA 2WZEA 3FE5A 4JGZB 1BBT3 2V5DA 5DZFA 4BA6A 4MHRA 5FXWA 4LMFA 5DAQA 3AKPA 1DCSA 1PMHX 2EIBA 3E5QA 3GZUC 4CA9A 1HN1A 4E4ZA 4OUSA 3ES1A 3VBRC 4JVAA 4IE0A 4Q1RA 4LQRA 5FOJB 2E7AA 3JD73 1JYNA 1RVF3 4NRPA 3LD8A 4L9BA 5LASA 3TAYA 2NYYA 3ILFA 4XJAA 2WC2A 4YG0A 3C7GA 1I6XA 1ULDA 1WD3A 4AWDA 4TSVA 1YLLA 1HRV3 2E7QA 3VL9A 1NCQC 2C26A 3S5QA 4GZ9A 2RS31 4QAWA 4W65A 3U78A 1DGRA 1PK6B 4LBKA 2RDSA 3CLPA 1IZ3A 5T5JA 2D6KA 3LA3A 1IS5A 2VTXJ 5KHKA 3H1MA 1JZ4A 2RR11 1EV11 2KA3A 5FZ3A 3ZYBA 4R9AA 4UW5A 5JI9A 4DUXA 1L3JA 4W8JA 3W5NA 3S7EA 3ME2A 2E26A 1SLTA 1VLNA 2W9XA 1QMJA 1L7QA 3M3CA 4XTMA 5FY0A 3RG0A 3VKNA 5BV6A 3THDA 3MIBA 3IDCB 3AKSA 2FZ2A 3GHMA 3T1MA 2GZWA 1HIXA 4INDA 1UX6A 1LU1A 3SHRA 3PMEA 3R05A 1XC6A 3M3OA 3CNAA 2BRTA 1BCXA 1DQ1A 2X5IC 1SLBA 4IEOA 4MGIE 2ZGKA 2R6QA 1UZZA 1YQ6A 2D6NA 2V73A 5BNPC 2Y6JA 2PAEA 1O8SA 4AXOA 3L9JT 1JMUB 3BYWA 3VBUA 3E97A 3OGSA 3NL1A 2IC1A 5FMOS 5FQ0A 3JBG1 3P1IA 4LO4B 4RR3A 2PLV1 2VBBA 2ZGMA 4OZXA 4CCLA 4FPOB 1OPMA 5EYYA 3RZKA 3A0NA 1TZOA 2JICA 2AGSA 4BQ5A 3PL0A 5C70A 3LEKA 1BVVA 1VBA3 3Q8FA 1FOD1 3ZYJB 4HG6B 3PNAA 1C8M2 1YEWA 3R4DB 4YLZA 3LWCA 4ZU5A 1ZYBA 5LATA 4CVUA 3U0ZA 1Y9MA 4YFZA 4XVHA 3TYJA 4LHNA 2B46X 2Z4FA 3ZKUA 5BY5A 4ZS3A 4Y22B 1QNYA 5F2SA 3KSCA 4QKFA 4FPHA 4XFGA 1PO11 1QHDA 3UK9A 1LGCA 1UYPA 5LEKA 2VL4A 1SEFA 4YVWA 3ZYFA 4C0HA 1QJX3 2Q5TA 3DYPA 5CA6A 1R64A 1D4M3 5IAXA 1C28A 3HPNA 5A3TA 1AZDA 1PNGA 3J7LA 3PMSA 3UV9A 1MQTA 4LULA 3VGIA 1CONA 2LUWA 2G19A 2QQOA 5JZGB 3VD3A 1UY1A 4LXLA 4A7YA 4R9DA 1W6PA 4DQAA 5I91A 3NV1A 3FN9A 1I9RA 4XFCA 5GLTA 3FX3A 4XIOA 3ZXFA 5IK8A 1XRUA 5K4LA 5FTTC 1HXS3 1PX3A 1X50A 3ZFGC 1DQ2A 1HB1A 1W06A 5HI0A 4QB6A 3VDDB 1G9CA 5L9BA 1AHSA 3FUQA 1DQ6A 1W6OB 3ZIWA 4Q0VA 4QX1A 1VAMA 2DVFA 1PVC1 2P37A 2VMCA 3N35A 4LJHA 4YVWC 2FD8A 2PQSA 1CAWA 3PVNA 4B3NA 2PQQA 2WT1A 2W0XA 3T3YA 1O3RA 2VVEA 2DF7A 3KD4A 5EXOA 1MQTC 3WW4A 4NHLA 3GZEA 4CDWA 5LW9A 2JDZA 1SBEA 4XZPA 5C8CA 4EN8B 3RQ0A 5JPNB 1WCUA 3V64A 5KHIA 1FPN3 2FDJA 1EUTA 4H7MA 4ITCA 2PELA 3R4UA 4X6RB 4Z07A 5LY2A 5TSWA 4LKSA 5A3PA 4COUA 2HWE1 3IKWA 4ATFA 3DF0A 1S0DA 4DXZA 4NAMA 1F5FA 3LA2A 1S2KA 3X29B 4BU2A 2W91A 4GH4C 4BQ1A 4N43A 3AMHA 1XBFA 3H8OA 1WCSA 1CD3G 1HQWA 2VZQA 1JN2P 1H6XA 3N9OA 1HB3A 1YO8A 4RN5A 1C1FA 1RHI2 1YFYA 1YJKA 2JG8A 2Q4SA 2ZX0A 4OHXA 5C9AB 4TWTA 4GB33 3IIAA 3TNPB 2RDNA 4FPCA 2Y34A 4XHXA 5D8AC 1IKQA 5A80A 1Q8OA 4KI5M 2BGOA 2DU0A 3ZO0B 1SPPA 2P17A 5LEJA 1AXKA 2QJVA 1MZFA 2ZGPA 1VBD3 1AYM1 1AYN3 1EP0A 2G9GA 4FPFA 4MUVA 4IV1C 3ZN4A 1YYNA 1UZYA 3VBRB 4PLOA 1WMXA 1ULCA 2D6PA 5FYVA 3LPFA 2E63A 3ZDSA 3LIHA 4CDUB 5A7OA 2X10A 4P9LA 3IMMA 4UW3A 1J3PA 1LHWA 4DIQA 2OA2A 3B94A 3U4XA 4Y1ZA 3SEEA 3N7LA 3VUOA 3RNSA 4QU1A 3KV6A 3LDBA 3POBA 4IW3A 1CAUB 4FPYA 5KXCA 3AL5A 1NCQB 2B9UA 3WVJA 3OY8B 5D2AA 4WVWA 2EVXA 4M0HA 5FBZA 1BBT1 2WL1A 1US3A 2P1BA 3VBOA 4CCCA 3AP9A 4DY5A 1W0NA 2D93A 2VH9A 1MS8A 2Y60A 2Y26A 1UIJA 1I3HA 2WO1A 1PIV2 1ZZ9A 2DVAA 2B8MA 4FTBA 5CIRA 1LHNA 2Z69A 3QH6A 2VZ3A 5HCHA 1QH7A 3LEIA 1H9PA 1J83A 4N9IA 4Z8BA 1UX7A 2ZGUA 2V4VA 4JAAA 3SH4A 2R1DA 5IW0A 2ZZJA 2UURA 1O59A 5E1RA 2VMFA 3I2FA 1CVNA 4P08A 1OURA 2NN8A 1GOGA 3OTFA 1HRV1 2RS53 4YG6A 4L11A 2R0HA 4JCKA 4LUKA 5H9PA 5BNOC 1GR3A 4HANA 3POFA 5LBBA 1G7YA 2TNFA 3ZYIB 5A7PA 3NO8A 2RG4A 3IMNA 3OGVA 4JRAA 1CQ9A 1GSLA 4RFRB 3NV2A 2WRAA 2NLRA 2R16A 3LA7A 3MV11 4HSJA 3VBOC 5F2WA 5AC93 4UFHA 5D1IA 4WVZA 3ZXGA 2LRPA 3O1RA 4FFHA 3DUIA 1DBNA 1NX9A 1UMIA 1S0IA 3HNBM 1W6NA 2UWAA 2BOIA 2E32A 3M70A 1PX4A 5KHGA 5J36A 2YBSA 1XSRA 2J1EA 3OYWA 3OUJA 5DN2A 4NRQA 3KWVA 3SCHA 4I02A 3ZSJA 1TE1B 1TMF3 2ERFA 3ZOIA 1DGWX 3E6BA 3ZSEA 2XBO3 4AVCA 4YGBA 4ZXKA 5K9YA 1OUSA 2H0VA 3OGRA 4NIAA 2WZPP 5JAXA 1S0JA 4OHZA 3T4HB 4GJZA 5FPLA 5FUNA 5JR2A 1UF2C 2BFUL 2PXJA 4UF0A 2QQKA 3EHKA 2WZR1 4H3WA 4P9GA 2MEV3 5FYSA 4QXKA 2YY1A 3BB6A 4GQ7A 3PU3A 3KZ4C 1H0BA 2A3XA 2NM1A 3FLTA 4IV3C 3WG2A 3VKLA 3VBUB 5FQ0B 4RR3B 1BK1A 1FI2A 1FV2A 1RUF2 2JEMA 3DKQA 4MZUA 1VBA1 3VZOA 3MBWA 2WT0A 4CSWA 2QVSB 4DUWA 3DPRA 3ILRA 4IEQA 4IE7A 2R49A 2D3PA 5BNQA 1F4AA 1KS5A 4XJZA 3EJKA 4YNIA 4HKOA 4BYYA 1LECA 5F6KA 5BPXA 4M01A 4RYDA 2HWB1 2DCTA 3B69A 4KGQA 2FZ1A 1LHOA 1CJPA 3RZJA 2VOWA 3MPBA 4XAAA 4N8MA 5ANQA 5A7WA 4AGVA 2A1XA 1LENA 4LKDA 2P6HA 3ZPOA 2VM9A 4K7JA 4PI2A 5FZ0A 3NNJA 4JGYA 1UMZA 1RUNA 1QJX1 2PAMA 1D4M1 2WA4A 3QACA 2HWF2 3NNFA 4UFMA 5CVRA 4YVWB 1Y4WA 4R8HA 1X7NA 1LEDA 1GICA 3FBMA 3WW2A 3RJ2X 1CN1A 3H3ZA 3ACHA 3J7NA 5L7OC 3I3BA 1GP4A 2VZVA 1OD5A 2ZJCA 4D69A 2ZEZA 3WG4A 1MQTB 4F3JA 1TME3 1NA1C 3GBGA 3CJIA 1LOCA 5GM0A 4D94A 4YARA 1BMV2 1WGPA 3ZIXA 1ENSA 1W6PB 2ZGQA 3D3AA 4FPGA 2RS12 5FZ7A 4OI1A 3WNXA 1HXS1 4AI2A 4CEWA 2NP0A 2R072 5T5LA 5C3SA 4E27A 1MS5A 2JD9A 5GZFA 1VE0A 5HCBA 5CBLA 5L19A 1FMD1 4I09A 3EB7A 3DL3A 2QQPA 4IE6A 2XB6C 2ARXA 5CB7A 3UT0A 5KXDA 2DUOA 4AEDC 4JC1A 1VP6A 1QJZA 4TLFA 1GP5A 3SCGA 2J22A 4FFGA 3TBDA 3ZR6A 3T0AA 1CAWB 4QXBA 3ZMOA 2BGCA 1YUDA 3MIDA 3SLIA 4E9KA 2AYHA 2BOJA 1WLWA 3B5LB 1W2UA 3FHQA 4P14A 5FP7A 3U11A 5DUXA 2XJSA 2C24A 1FPN1 4CDWB 3BTZA 2QQMA 5C8CB 3CJIC 5IFPA 5EHDA 5H9RA 2VMIA 4NN0A 2CL2A 3K3OA 4MADA 3BKZA 4YW7A 5IAVA 4ARYA 2VXJA 1GNHA 3K3NA 5APAA 3L2YA 4Y33A 4AFAA 1V9U3 1NCRA 4B7EA 1DZTA 1L7LA 1PO22 4PCRA 3IN9A 5FYTA 3IDBB 1BEV3 4N43B 4MG2A 4X8PA 3TOJA 4G4FA 4GB31 4RA0A 2B42B 3U14A 5A33B 4TYSA 3P5BA 3AMMA 2JG8B 4FTSA 2ENRA 1SZBA 2VJXA 2VUJA 4Q0UA 1U5ZA 1S2EA 2A5ZA 1QJU3 2LW8A 2BTVC 1VBD1 1S0BA 1SPPB 2J7MA 3MDPA 5CNAA 4CUGA 4KBZA 1VB2A 4GAZA 4QQLA 1UOBA 4E2QA 1ZZ6A 1T2XA 1XYPA 3MLKA 1RUC3 5FZLA 4RSUA 1BXHA 3OOXA 5T5OA 2VZOA 2WAAA 3OBZA 3CJXA 1J3RA 5JCTA 1UYXA 2Q8EA 3I2OA 2Y0IA 4JHZA 5DG2A 2W92A 2RM22 5ACA2 1DYOA 3O0XA 4BK4A 3FLRA 4C1WA 1VBC1 4MOAA 4RL7A 1QJEA 1PMIA 4LK7A 4W6WA 4DPNA 1AXYA 2EXKA 1LOFA 3WG1A 5KXEA 1G9FA 4AFDA 4XIKA 2DU1A 4DFSA 1VB4A 2H6CA 4P9JA 2VCBA 1RUD2 3MF6A 4QB2A 4K21A 4WZCA 3VBOB 3P3PA 1ZVFA 4IQPA 3HOBA 3T2PA 3MIGA 1PGL1 1J1LA 3BIEA 1M4WA 4BWOA 2VNOA 1W0PA 2CDPA 3PU8A 5L9VA 4LITA 1XXNA 3WNNA 1OF3A 2J1AA 2RS51 3T4VA 2LTNA 2EXIA 3E5XA 1APNA 4YPJA 2R32A 1AL0G 3VZJA 5FY9A 1G86A 5KR7A 5A3WA 1RB8G 1LOFC 2O14A 3DYMA 4ISRA 4N7UA 3VBFC 5FXVA 3K4DA 3NQHA 5FZ4A 1S55A 1SLIA 3POGA 1RUH3 2RJ2A 3WR0A 3M7AA 3UGHA 3WG3A 5A1AA 1UAIA 2WFPA 5DMYA 4BZ4A 5IK4A 2ZCWA 4GKYA 1RYYA 4DY3A 1RL3A 2EA7A 2DVGA 2GMPA 1PZ9A 1DQ5A 1W6NB 3KQ4B 4Q4Y3 4FXKB 2PN5A 4DEQA 1TMF1 3AZYA 3POEA 3OYWB 4TLGA 4QKNA 3PVOA 2XBO1 5C5UA 5C3PA 3N9PA 1BK0A 4EROA 2R30A 3KVBA 2WNEA 2W3JA 4FPLA 1RMU2 4PQQA 2MEV1 4QPWA 4QX2A 4CXWA 4O9GA 1PMJX 2VW0A 5FY8A 2VVFA 2XLGA 3C3VA 4KL1A 4UF0B 1HRI3 1GV9A 2WNUA 4HETA 4N53A 1URXA 4DRVA 4LHLA 1YFWA 1OUXA 3U10A 2GMEA 3ZSKA 5JSOA 4LOTA 5A3MA 5FK7A 3WDXA 1S2BA 4ORFA 5LA9A 3ZYRA 3DPRB 5CAZA 2VG9A 3ON7A 4PF1A 4ZU7A 5FKCA 1OPOA 4ZS2A 4PF5A 5KC5A 2HEVF 1U5XA 1VMHA 4FOVA 4YYOA 2C1FA 3HEIA 5DZGA 3WINE 3I3QA 3U4SA 1ULGA 1POV3 1XE0A 4I0BA 2HWC3 3ZFEC 4E4HA 5A7WB 5B4XA 2ZABA 3AP5A 1OSGA 4OYUA 1OLQA 2ZAAA 4Q0QA 3VHPA 4JGYB 4OMDA 3WNKA 3RGBA 5ISLA 4XMIA 2XJTA 4QXCA 4O9EA 4RQPA 1V6IA 2V72A 2YDEA 3V56A 3KHCA 2CWSA 4Q4V3 1E5HA 1MEC3 1TME1 1WCQA 3JBG3 4AGGA 2JG9A 2PLV3 5T50A 1SCRA 1D0HA 1COV2 1EAH3 2EIEA 1REDA 2W08A 2YG0A 3CJIB 5E6HA 1CGPA 2AUYA 4I0WB 4JTNA 5I0DA 2QNKA 3WQBA 2VUDA 1YCIA 4CEWB 4ZONA 3C7FA 2ZPXA 1H6YA 1Z0HA 5FP4A 4I01A 4AE2A 1D2QA 3QLQA 1DIWA 5GLWA 3RI8A 3RYKA 4NWVA 5G04L 1PO13 1AR92 5FFOC 3LOIA 5FYCA 3ZM8A 4BOWA 3GNEA 2YPJA 4MGSA 4P9IA 3C7OA 5DAVA 3WP3A 4RQPC 1NOVA 1N1VA 1O5UA 1GZ9A 3JQWA 1OVSA 3LIGA 4JX0A 2BP6A 2ZGNA 2YC2A 1RGSA 4W50A 3OD0A 2OUHA 2FCTA 1J84A 2Y38A 1XE8A 4AHYA 1V9U1 1D4VB 1UXXX 3B00A 3LOBA 4GMP3 1W6QA 4AL9A 5GLUA 2RV9A 1BEV1 4YGCA 5F8PA 4AF9A 5GALA 1NCRB 4UFIA 4UT5A 2YGMA 5LBCA 1SFPA 2CGPA 1W03A 5FK8A 5FZ8A 3POSA 5EZWA 3MLLA 4AR2A 2Q1FA 2BPA2 2XUMA 3AYCA 4MSVA 1PVC3 3S5AA 4ES8A 3U07A 1JUIA 2WNOA 3L2HA 4WM8A 4C0BA 1CJDA 4A4AA 1W6MA 1LHVA 5F3EA 1KJRA 1CWPA 3KV5A 2GSYA 1RUC1 5DUWA 4DRRA 4LBQD 3E6CC 2XVLA 2C9KA 3MUY1 5JMOA 5IVCA 3LGRA 1RUI2 3DECA 2ZEXA 4NJ4A 1XNKA 4LO7A 3VZLA 2B7YA 2C9AA 4ASLA 1UIKA 3GZAA 4JQTA 5DAPA 2JJ6A 1GFF2 1WW6A 4W4ZA 3WV6A 2XG3A 5CYYA 1OHFA 1SFYA 2W1UA 1LOGA 4HONA 1W3XA 5FZKA 5JOZA 4QM8A 4XCAA 1GWMA 2BUKA 4Q26A 2MNGA 2R062 1OKQA 4EYUA 4N9HA 3MIEA 1NYWA 1BYHA 4A41A 3I8TA 3B93A 1R082 4CCEA 1PVXA 1X9PA 1ZX5A 3M3IA 5A7NA 1N1YA 3VV1A 3AYEA 1YHFA 1JU4A 3V0BB 2AH2A 1MVQA 4Q29A 4IEXA 5T52A 2WNVC 4GD4A 2XH6A 1RUJ3 3PIJA 5ANNA 3AVSA 1KS4A 1DYPA 2W95A 4B4PA 3GF6A 1W0OA 1DZRA 2DV9A 4QKBA 3TN92 4EJRA 5FY7A 5DABA 1QKQA 3G7DA 3SH5A 1KRIA 3DN7A 1UZWA 2QQWA 3WF3A 3SC7X 2JB8A 1UPIA 3B02A 3POYA 2DCJA 2NPIA 2PMWB 1CESA 1RUH1 3MPPG 4AVTA 4AG4A 4XPVA 2HBTA 1S4CA 3I2JA 2UY9A 1K3IA 1YJLA 1EPZA 2I45A 4XURA 2W5FA 2P4EA 4Q4Y1 1CIYA 1AXZA 4UW4A 2Q0AA 4MXWA 5IK7A 1BZWA 2DVBA 3AYDA 5J1XA 4Y1YA 4JKLA 2CYFA 5AFBA 2RHPA 1EPWA 3S7IA 4AW7A 3T08A 3KT7A 2ZKNA 3KGLA 1VBE3 1W8OA 2Q1MA 4MO3M 4NRMA 5FUIA 1AR82 4OFGA 4ET7A 1S1AA 1ZRRA 2A6WA 4Q1PA 2XJUA 1K45A 4HLTA 5H9QA 2W52A 1AR62 2X5IA 1HRI1 1OI6A 2PHDA 3CMGA 4QGNA 4QX7A 3H8UA 2ET7A 5BNPA 4P9YA 1OBNA 2VOVA 2VXRA 2WNUB 4N53B 4OHVA 4Q4W3 1OA3A 1Q8PA 2Y0OA 2ZHKA 1R092 2GC3A 2O8OA 2OQ7A 3KT1A 2JIJA 5F32A 2HWD2 5FZAA 4NIIA 3LFIA 4TTGA 1G9BA 4JZRA 4QB1A 5DDJ2 2UY8A 5IVFA 1UYYA 4PHZA 5CKNA 1POV1 4MGQA 5CADA 2P6CA 2HWC1 1E57A 2QDRA 1W8UA 2WQ8A 2X29A 3S6PA 5J48A 1QIQA 5IVYA 4OQ9A 1VAVA 3WDTA 5A6ZA 3O0VA 3CZUA 3HIFA 2ID4A 5C3OA 4E2SA 3AP6A 2JDNA 1ONAA 3OGGA 4Q4V1 4IESA 1VRH2 2FDFA 1X8MA 2WZR3 4D6RA 1MEC1 4RQPB 1U5YA 2BWCA 4GALA 3A4UA 2ZACA 2VY0A 5FY4A 1EAH1 1XNAA 3HJRA 1ULOA 4I30A 1FXZA 2XJVA 4Z2AA 2JG9B 4J1WA 4HBNA 4FAHA 5CFCA 1ZBA3 2C6SA 2GNTA 4IGPA 4TN7A 4AQTA 4CU7A 4MGKE 2QQNA 1F35A 1DQ0A 1F9KA 3C2UA 2J1SA 1QQP3 3ZFGA 3AB0A 2XOMA 4FTEA 4X8NA 1WW4A 2HWB3 3POJA 1F8VA 1GU3A 3F95A 2V5YA 5LRSA 3VL8A 1YI9A 1OOPA 2KXLA 4JDMA 4W6YA 3S57A 4SBVA 3NMBA 1JYTA 4MH0E 4FAGA 1O4ZA 1NT0A 2E31A 2J1VA 4ZZ8A 5IFTA 1FYUA 4L97A 5JPMB 5LA0A 1CX4A 4QM9A 2RS32 1ODNA 2F17A 5JVVA 2WDBA 1DZQA 4KWLA 1DQ4A 1EV12 2RR12 5CFCC 1HQLA 2QQJA 4GKXA 2TBVA 4V2VA 2IVIB 1RHI1 4LHKA 1X9TA 4GMP1 2O0OA 2XR4A 2IXIA 1RC6A 1WCDJ 5FYMA 3WW1A 5IYYA 1DU3D 4WM7A 1EYBA 3H1WA 1KQRA 1W6QB 2FDKA 4OHYA 3GJAA 1JI6A 4GH4A 5G05L 4KU7A 1FMD3 1GYKA 3ENRA 4AZZA 1LRHA 3HT1A 2GAUA 1OOPC 2WS92 3ACIA 5EPAA 3THPA 4E4DX 1RUG3 4MGTA 3UGGA 1J1TA 2OIIA 1SG3A 3ZFFA 5D8AA 3KB5A 3WW3A 3T2TA 5LB6A 3NKGA 3J7MA 4HT1T 4QDSA 3T09A 4EZ4A 2FCVA 3AZVA 1DLLA 5FMDA 1OFNA 4WM8B 4CRQA 1W6MB 4A7ZA 5FZMA 4BQWA 2OT7A 2HBUA 3N9QA 4IV1A 3LSDA 4EN9B 5J98B 2ZS6B 4CZSA 3WXPA 5FYIA 1W8NA 1RUE1 2O1QA 3HQRA 3NJYA 4TZDA 2FMYA 1FNZA 2IFWA 1FOD2 2B39A 3MIHA 3QD6A 3RS6A 1NXD1 2BV4A 4WM7C 3MIFA 2N7GA 2ZHMA 3GDBA 4QMAA 3O1VA 3V0AA 1O3QA 1UY4A 2E53A 1QOTA 3WUCA 3ZLIA 2XLAA 4IXLA 2VULA 3MHZA 2VTFA 3O7OA 4JV4A 3ZFFC 3HQXA 5LK7B 3B7MA 3FFQA 3GGLA 1OF4A 4MXVA 4LBLA 4CPBA 2ET1A 2WBKA 4QQPA 3Q9OA 1J58A 1Q8VA 4YZ4A 2ADEA 1RUJ1 3D8CA 3FFZA 2VZ1A 2CSGA 4ZKTB 3RZZA 1WMFA 4GXLA 4D7YA 5EWSA 5BNOA 3CU7A 3KLSA 3O1OA 3WCSA 3DYOA 3GBFA 2DCYA 3KVAA 3D4KA 4XCBA 3O5SA 1J59A 3PUQA 5EQUA 1GP6A 4Y4RA 1VBC3 1O8PA 4QGMA 1UOGA 3ZN6A 4ATEA 2QFEA 2QTWB 4XXPA 1DYKA 1ULPA 5FXXA 2VZRA 5KHJA 1JUHA 3VHRA 2JDHA 3T2OA 5F6LB 3EYPA 2JDAA 1BJQA 4UWDA 3UGFA 1Z7S3 3IWZA 1PGW2 1PZ7A 3MW3A 4O65A 5BNNC 5JSRA 2G1MA 5FP8A 4L2NA 1N3PA 1C4RA 5ABJC 2GH8A 3BTAA 4LBNA 4NR1A 2XHKA 1SMVA 3T0DA 5KWRA 1W9SA 4MXWB 2YV8A 2GU9A 1VBE1 1N3QA 2ORXA 2XGXA 1ZZCA 3ASIA 1RUF1 4FO9A 3BU0A 4BH9A 2HWE2 1IPJA 1LHUA 1Y7BA 2SLIA 2V4AA 2ZGOA 4NMIA 1K12A 1GZWA 2X5IB 4KWJA 4NWWA 1GZCA 4Q4W1 1IS6A 4RGAA 2AACA 1CPMA 5BNPB 2LALA 1Q3EA 1DLCA 2E7TA 4IV3A 5K0UA 1AR73 2ZBJA 5DQ0A 3U75A 2WFF3 5LRRA 1W2TA 4OULA 2VECA 1LOBA 4HL0A 4M4RA 5JLVA 1OXCA 1RITA 2K0GA 3Q8CA 4LK6A 4BQ2A 3MZHA 4P00B 4Q2FA 1SLLA 4D3WA 1BHGA 3H3LA 5FREA 4XFIA 2JDKA 4XMAA 2HEWF 4XJ8A 4L99A 4NPLA 1VBB3 5JXIA 1JU3A 3SXWA 2DVDA 4LNVA 2XKOA 4MX3A 1AYM2 3K77A 5FBJA 1V6LA 2XKPA 4QX8A 3A23A 1WW5A 5FRAA 4IDZA 4OLLA 2JKXA 4HVOA 2WQZC 2XQXA 2UYAA 4ASMB 3D0JA 1ZBE2 1HQNA 4BHPA 4KMQA 2ARAA 4D7SA 3CKHA 4XJWA 2NMOA 4CCNA 5K0UC 5L7OA 2R071 2I07B 1SBDA 3LFMA 2YUEA 1K5MA 5FPZA 3IB3A 5FXZA 1ZBA1 1XPWA 1BBT2 1NA1A 3SCFA 2PFWA 3BPZA 3MW2A 1V6NA 4M3CF 5FZFA 2QE3A 4GWNA 5CFCB 4UW6A 1QQP1 2VW1A 5GZDA 2AR6A 4B1LA 2W68A 1SQ4A 3WNPA 2JXAA 2J1UA 3LF7A 3JD72 3TNQA 3ZFGB 3WZ1A 1RVF2 1O91A 3CBNA 5IT6A 1R1A3 4HN1A 4UFKA 3J8F3 1QF3A 2DURA 4YW3A 4ASKA 1YQCA 4Y3OA 5FLIA 4AEDA 2R043 2YROA 1JH5A 1OOPB 1MZ6A 3H0OA 1HRV2 3IZOA 4HSLA 4BQYA 2VCMA 1TG7A 1EY2A 4J25A 4DZGA 3BUCA 3AFGA 4EN0A 4U36A 2VCAA 3W9AA 1UU5A 3HNYM 3DV8A 4LKEA 3WNLA 1K5MC 1PO21 2DCKA 3FWEA 4BIFA 2GC2A 2HEYF 4QT6A 4K20A 1PM4A 4A45A 2MPFA 1WMDA 5F5CA 4UFLA 4EZHA 1F31A 5C7GA 3HVDA 1PM7A 3C7HA 1W28A 2VCCA 4WM7B 4YM3A 3RFRA 4KGGA 5C4WC 1GZTA 2RVAA 4K1YA 4GH4B 1V70A 5FOBB 3H1YA 1RUG1 1ASJ3 4YVSC 5FMCA 3OJBA 1W8WA 2D97A 3FJSA 5DG1A 4CP9A 1LGBA 3KS7A 5C3RA 2BWAA 3M3QA 5FZHA 1I5ZA 2A70A 3NJXA 4PIXA 1ZRIA 3ZFFB 5D8AB 2J1TA 1W8HA 2A75A 1QEXA 4FFFA 4LO8A 1LJ7A 1G8WA 3SNMA 5ACA1 3D5OA 2XWBB 1UU6A 3U1XA 4MGYE 3N3HA 4M3CE 1GWLA 2L9LA 4FPEA 1OLME 4NUBA 1VBA2 4IV1B 3ZXLA 1QH6A 3HMYA 4A6OA 5T3NA 3HN3A 1H8TA 3B01A 3DKWA 4CCKA 3JB4C 4U2AA 4K9SA 1NE4A 1OQ1A 2DFCA 3KF3A 4NHKA 5HPOA 2NZ9A 5FY1A 1OA2A 3BPSA 1LODA 1MS0A 1RTVA 3THTA 3NKTA 2PAKA 2EF6A 3I2HA 5IUQA 3RSJA 5JXJA 4I2OA 3MLJA 1VMJA 3IAPA 4JQRA 4IEWA 4F8AA 3BODA 1LKNA 1H2MA 1OH4A 1UD1A 1QJX2 1W8ZA 2A6XA 3PJYA 3JZVA 1D4M2 5GZEA 1OLMA 3O1UA 1AL23 1W9FA 1UWWA 4CCOA 4Q8KA 1O6UA 2VNGA 5F5QA 2GC0A 4Q4X3 3VKMA 4A42A 3OPTA 1GOFA 1FV3A 3DGTA 2VR4A 3RYPA 1CIWA 4C8DA 4NIDA 3AP7A 1MS9A 2RMU3 3J9SA 1IPKA 1IS3A 4RHV3 1H8TC 2AZ5A 1F4HA 1GBGA 2OZJA 4NIGA 3PTYA 1HXS2 1HW5A 5BNOB 2HYXA 4R9CA 4E8DA 3AZXA 1YQ5A 2YU1A 4AOCA 5E16A 3I2KA 4LIUA 3VD7A 3M4FA 4J1XA 3VBFA 4AAPA 1JZ2A 2D6LX 1V6OA 1NUKA 1Z7S1 3KT4A 3ZN6B 2JDMA 2P3IA 2VVDA 2Y6GA 3DXUA 3WUDA 1SACA 1NAEA 3P3NA 4LBMA 1WLDA 2AEZA 3NNLA 2GH2A 5EV7A 3S30A 5FPUA 5F5IA 3AXEA 2I2SA 2ZGLA 4LEJA 1U0AA 1IS4A 4DS0A 2XMLA 3I49A 2EIGA 2WWJA 3O1TA 1CZVA 1FPN2 2D5FA 3WHUA 1MR5A 1AX2A 1VR3A 2ZX3A 5F3GA 5A32A 1BQPA 2WYFA 3ZR5A 2R0FA 4NO4A 4NHYA 5DPNA 3SITA 2GC1A 5CG9A 4HPKA 2ZAHA 4HK9A 1RINA 4QDRA 4XABA 3ZN5A 1CPNA 2BFUS 1XNDA 3ZSMA 1YIFA 1UW8A 1AR71 1B35A 1GZWB 3CEWA 4YW1A 1DFQA 2WFF1 4QGLA 2CNAA 4FT8A 4XUOA 4IV3B 2EXJA 2DBIA 2D43A 4GB32 5K0UB 4H55A 4XILA 1XB9A 2VW2A 2WR9A 3TEWA 3LPGA 4LA3A 5FKBA 4XFFA 1AUYA 4Z1VA 1VBB1 5DAXA 1VBD2 4E2GA 1AYN2 3RDIA 2VNVA 1H8VA 2QBXA 2ZMKA 3BCWA 4Q27A 2IXHA 5FY5A 3WDVA 4WVVA 2W46A 4L0PA 4MLOA 2JKBA 3ITQA 3URFA 1HLCA 3ZFEA 3ZMNA 4CCJA 2UWBA 3W21A 3WF4A 5M0TA 2EAKA 1HX6A 1N1TA 1VMFA 1ND3C 1DHKB 3H8XA 1YFUA 3BI3A 2XWJB 1DP0A 4LR4A 4F83A 3NWKA 3UESA 1B35C 1XYOA 2PHUA 4HKWA 1VBC2 3ZXAC 2RJKA 2E51A 1C8M3 3VD9A 1ZREA 1WUVA 1AJKA 5L7OB 3IIIA 2JDPA 2VE1A 2YFUA 3HD8B 1AX0A 1ZNPA 2QDNA 4NE9A 4XDPA 3GYDA 1NY72 3HNMA 3G6JB 2R7EB 1NA1B 2WJSA 2TEPA 3OPZA 4UBHA 4WBBA 4EQVA 4XBLA 2Y6HA 4AHWA 1MS4A 1NG0A 1YRZA 3ECQA 3V65A 4IEPA 3NAPC 4DXTA 2JE8A 5I0SA 1PGL2 1QJY1 3GCXA 2ZMLA 4XF4A 1R1A1 2P3JA 5GZGA 3J8F1 4AFMA 2A3WA 2AEYA 5B4NA 2CDOA 2R041 5JOWA 2E9QA 2RS52 4LORA 4D6QA 4FXGB 3PHMA 1WLTA 5FUPA 2EICA 4JGZC 5DZEA 4AEDB 4S2HA 5J7MA 1Y3TA 3EMRA 5FR3A 4XACA 4PLMA 2Q8DA 5C33A 1KITA 3GALA 3UETA 1U5IA 4EWDA 4DOUA 3N9NA 3THCA 5T55A 2VO5A 3OCPA 1TNRA
chains in the Genus database with same CATH topology
5AC92 1HKDA 4AHXA 2ILMA 1RJ7A 4XDQA 4XJ9A 2PHWA 1S0GA 3ZPYA 4UXAA 3WQ7A 3AKTA 2ZA9A 3OBRA 1TMF2 3R4SA 1ASJ1 2RE9A 1PK6C 1QOSA 2XBO2 2RJLA 4PDWA 3WT3A 4HMZA 1DGRN 3WLUA 4KQ7A 3WP4A 5JIUA 2MEV2 1WBFA 3NVCA 3AFKA 4LLOA 1JOJA 4KNCA 3AKQA 3TRSB 1LOEA 3OBTA 4P9XA 1PZ8A 3I54A 2IFRA 4IL7A 3USSA 5IK5A 4CP0A 2HJIA 4S2FA 1RHI3 1H8TB 4COZA 1H4HA 4BPZA 5GLVA 1SFNA 4IEZA 3OGJA 3FLPA 5FMOL 1C3HA 4PDWC 4XE9A 5GKAC 1A8MA 3WX5A 4GWMA 3LCPA 4CDXA 4K3UA 5HXVA 4OUMA 1AL21 1UPSA 4M3CB 4EWEA 1POV0 4Q4X1 2X8KA 2BNNA 1ULEA 5FPXA 3PVBB 5E88A 4EN7B 3ACLA 1TME2 4XJUA 2RMU1 2WNVA 4RHV1 4Z2WA 3KCCA 5DUVA 3AX4A 4WZFA 3N7KA 3B9CA 3BIWE 1RUE3 3D6EA 2ETEA 2X53S 4META 1QNWA 3JQXA 4URTA 4XBQA 4NHMA 1TQ5A 2P34A 3POWA 4KH9A 2K9ZA 1PIV3 4AEMA 2ZKLA 3VBFB 4CDXC 4CYDA 5JZGC 2K2SA 5B2GB 4PJYA 4XETA 4XQWA 2D7FA 4I0AA 2D3SA 2GNBA 2HYKA 4LT5A 3KGZA 4A7KA 2VNRA 3AJYA 1LR5A 3MICA 4C1XA 3APBA 1PNFA 2ZX1A 4R52A 1YWKA 3MFAA 5FAXA 1SCSA 4LBOA 4Y1UA 1QY4A 2CAVA 2PHTA 5HCAA 4OI0A 1V9U2 5A32B 4BMBA 2E6VA 3D82A 4HPKB 5I0UA 2XLFA 2YHJA 1BEV2 1NE6A 1IOAA 1B35B 1ALYA 1UL9A 4MGZE 2HKXA 4RGGA 2Z5WA 3AMPA 4GMP0 4ISQA 5GLZA 4B4RA 4COWA 2DFBA 1QJU2 1FX5A 4XFHA 1C5HA 2GN3A 1JYCA 1O4TA 2A71A 2JE7A 3IPVA 4Z92B 2A6YA 4Y1XA 1RUC2 1ZRCA 4UBGA 1VRH1 1TNFA 4K1ZA 4SLIA 4Z82A 3VLBB 3V0AA 1O5LA 5C9AC 1VALA 3ELNA 3FHIB 3QBQA 1ZRDA 4FQZA 2ZHNA 3ZFEB 5BYNA 5E8AA 5FO8B 5I8SA 1RUF3 1F5JA 3I7DA 3ES4A 5A3LA 1ENQA 1C8M1 1JW6A 2Z79A 5JI7A 1NXMA 3AJZA 5JOYA 1CAVA 1H1IA 2OW4A 1MS3A 2G9FA 2F6BA 4CDUC 1KDKA 4C91A 3ZXDA 2P3KA 2QKDA 3LAGA 1A3KA 1QXPA 2QCSB 2HWF3 4QPGA 2CGNA 2ZHLA 4S2GA 1X82A 2DUPA 4FOWA 1SBFA 5AVAA 1WLCA 1JBCA 1Y43B 2RS13 2NMNA 3LKJA 1LESA 1RUH2 2R073 1QGLA 2W39A 5BUVA 1PGSA 4AK3A 5KBFA 4QPIA 4EV0A 5J09A 2WS91 3PJQA 2JE9A 2BVBA 1I1EA 2DCZA 4Q4Y2 4YRDA 3LB9A 4AI3A 1NLRA 1XNBA 1UU4A 4QPGC 4AQSA 2VQ0A 1M06G 4X6QB 4ZU4A 3R0RA 3IM0A 4PDWB 3HBZA 1N3OA 4AEJA 4BE3A 1HRI2 2LM3A 5I0TA 1UKGA 1TEIA 2BYVE 3MW4A 5EFUA 4RD7A 1XU2A 2PHXA 3FBYA 4QPIC 5GJ6A 3NW4A 1NZCA 1PO23 1J3QA 4XYXA 3WDYA 1LGNA 1C5IA 3HR9A 4Q8LA 4QQHA 3IDEA 4RFT0 5I8TA 4LUMA 1ND2A 3AZZA 2HWC2 4PIZA 3VBUC 4AQ2A 4RR3C 1XYNA 4CDXB 4QPYA 1CR7A 2VQAA 4AVSA 3AMQA 4YM2A 2EAAA 3RWNA 3VZKA 2UU8A 4Q4V2 4GIQA 3VHOA 4CDQA 3AXDA 1MEC2 1O7FA 4XHBA 1C57A 3JBG2 2RM23 5ACA3 2PLV2 2BVVA 4HFSA 5JIAA 1JXNA 1EAH2 4XFBA 4F7ZA 1R1ZA 3E5UA 1QXJA 2WNVB 3J4UH 4I3PA 3NSTA 2UYBA 5J96B 1KJLA 1PGW1 1YXWA 3H50A 1RUD3 3A0KA 3USUA 4CEYA 1PIV1 2QUOA 5HCFA 1ND2C 1Q43A 3N7JA 1F2NA 4EN6B 1PO12 3ALQA 2DYCA 4BLJA 2GDFA 4C90A 2QZ3A 5BNNA 4OVEA 4CDQC 5ABJA 1JYIA 2WQ4A 3W58A 3MGUA 4E4SA 3D0SA 1X36A 4D7TA 1GLHA 1FNYA 3H7JA 3SMHA 1A78A 4A2UA 2ZGTA 1LCLA 3ST7A 4CEYC 4QHBA 5SV8A 3FC0A 1VJ2A 1RIRA 5GZCA 3H9AA 4AFBA 2XJRA 4CDWC 1OQDA 5C8CC 4YM0A 1PVC2 4CTEA 3NV3A 4OI2A 4FCAA 1UCXA 4XF0A 4CP2A 4HVRA 5K8SA 2VMHA 4IEUA 3LZZA 3ZXEA 2BNOA 1ZBE1 2CGOA 1RMU3 3AMNA 2YGLA 1OA4A 1Q8QA 3IPVB 4NOTA 4PQ9A 1WBLA 1NQJA 3BOWA 3CF6E 4N43C 4XTPA 1ZM1A 3AP4A 5FO7B 3S0MA 4LO5B 4L8QA 1KFXL 4XF9A 3UJQA 3V0AB 2JG8C 4YGEA 1RUE2 1SDWA 2VGDA 4FBFA 3ETQA 3RYRA 2O8QA 1V6MA 2OPKA 4KG0A 3ZYPA 4LBJA 2B45X 4G9SB 1N1SA 2VOXA 2CY6A 1XQNA 1ZZ8A 2ZX4A 3WDWA 4HVQA 4FPKA 3VHNA 3JD71 5KHHA 1RVF1 1CAVB 4AI1A 2ARBA 4ONUA 3M2MA 2YZ4A 2C5DA 3AYAA 3R6SA 1X33A 4IETA 1IKPA 2HWF1 2UWCA 3WOGA 3N7MA 3WQ0A 5BXXA 4JRLA 3GHNA 4Q0SA 4QPGB 1OQEA 1RUJ2 5JOXA 4QQOA 4YM1A 4R4XA 4AYUA 4DB5A 1RJ8A 4GA9A 4V1PA 1BMV1 2PYTA 5KXBA 1COV3 3OF1A 2RS11 3T1LA 4OHWA 1LU2A 4QX5A 2IXLA 3ZSLA 1IQAA 1S0CA 4LE4A 2FMDA 3J26N 2BQPA 1QDCA 3AK0A 1O3SA 5I93A 1WD4A 4QPIB 1NLSA 4LE3A 3TWIA 4N7IA 1C1LA 4R9BA 1FT9A 1AR93 4K40A 3WDUA 5C4WA 2C0ZA 1AVBA 1H2NA 1QJY3 4XQ4A 1G9DA 2EALA 1VBE2 4BCUA 4YVSA 1VAKA 4JDOA 4PBOA 1WMEA 5A33A 3VBHA 4L92A 4YFWA 4BIOA 4COYA 2CAUA 1MZEA 4AQ6A 3ZXJA 4P5HA 4Q4W2 4B29A 5T5PA 2BW8A 3VKFC 2IXJA 4XBNA 2WA3A 1LULA 4W6XA 2Q1ZB 3ZXKA 1V6JA 1A8DA 4AFCA 4B7KA 2BBVA 3ILNA 3HAGA 2XJPA 4WVMA 2IZWA 1NQDA 3WP5A 1REEA 4H7LA 3VBSA 1ZZBA 1ND2B 2XL7A 2PA7A 3VBHC 1LB2A 2WKKA 1OFSA 3WY6A 3RMYA 2XVGA 5L36A 3H3UA 1RUI3 3DPRC 4XF3A 5EYXA 1CAXA 2WZR2 2IXKA 3I4IA 2RM21 5FO9B 4Y20A 2TUNA 2EXHA 3I59A 3CO2A 4HKLA 4Y1VA 1BKZA 4CDQB 2NQYA 1GQGA 2BNMA 2YYOA 1O3TA 1Q5OA 1ZBA2 2PHLA 2ZGRA 3B3QE 4J6GA 3N4MA 1V00A 5AFEA 2R063 1RUD1 4JGYC 1H2KA 2GNMA 1OMIA 1AF9A 1QQP2 2Z2SB 4JDNA 4XXAA 2GNDA 4JTOA 4YW5A 3IBMA 1R083 2HWB2 5J3UA 2DUQA 3USUB 1DG6A 3VBSC 4CEYB 5JWPA 1RUOA 2ATFA 4LO6B 1FAYA 2OYZA 1XE7A 1A6CA 5FLJA 5CFDA 4Y4YA 1ZA4A 5KC6A 3GZTB 2FQPA 2QZ2A 2WLQA 5BNNB 2CTVA 4KBBA 3WD5A 1IGOA 4YGDA 4PIYA 4FOQA 4CEWC 1IHMA 4FVVA 3TN93 5ABJB 4Y26A 4LBQA 3VKOA 4CP1A 3WCRA 3WHTA 2D44A 1WA4A 3ATGA 4PBPA 1UKRA 1JTZX 3JU9A 2XL9A 2DTWA 4MVTA 2IXCA 1FMD2 5K7PA 3MI8A 3BALA 1AYN1 5J37A 2ZMNA 5SV5A 1RUG2 5CFDC 2Z42A 1YI7A 4XQDA 1ZRFA 2CV6A 2PHRA 3EO6A 2WIIB 1AJOA 1SLAA 5DUUA 3SISA 1RMU1 3M1HA 2H6BA 3NJZA 5C6CA 1AR83 4MV2A 3B9IA 1NCRC 1AR63 2AENA 1H2LA 3RJRA 2VUAA 1GKBA 4S2DA 2D40A 1T6GC 1JHNA 1DF0A 3QH7A 3JCIA 4XW3A 1R093 1NY71 1ND3A 3UJOA 2A6ZA 2ZX2A 1MZ5A 3PLQA 2HWD3 4NPRA 3HWJA 1B09A 3RPQA 1N47A 2VPVA 3EXUA 4M0NA 3V0BA 3K48A 4H14A 5LK5A 3BU7A 2KM2A 1Q56A 5DDJ3 3LSEA 4QD2A 4AVVA 4QU2A 2H0BA 4EWAA 5F1RA 4IEVA 4YZ3A 4NVPA 4YG3A 5C8WA 3NAPA 2D98A 1WCKA 3FZ3A 5JDBA 4RS5A 1VIWB 1VRH3 2ZZQA 4YSFA 2YMZA 3MF9A 4N90A 4Y5Z0 3UKVA 1H1MA 3HT2A 5AC91 1COV1 1SLCA 3SH3A 4LTAA 4AVAA 4DMIA 4JGZA 1KFUL 2D3RA 5JR7B 1KD7A 1KXGA 4IEYA 3W59A 1DGLA 3VZMA 2VOKA 3ROUA 1YFXA 1O4YA 3QOPA 1V6KA 1LTEA 5F9TA 3PVEA 1ULFA 1K5MB 1QWRA 1Z7S2 5E89A 3RMXA 3QCWA 2VU9A 4XF1A 1AR91 2FBEA 4YW4A 3H7YA 3FUOA 2PTMA 3EQEA 2Q30A 1U12A 1QXRA 2A6VA 2A7AA 2D5HA 4RS5C 2JD4A 5FCCA 5C4WB 1PK6A 4K8FA 5JMCA 1H1AA 2RS33 2JX9A 3KCYA 4YVSB 1REFA 3AZWA 2V09A 3VBHB 1S0FA 2XVKA 2WINB 1XU1A 2WSVA 3N36A 3VZNA 4BMEA 2GMMA 1ENRA 3IT8A 2RR13 1EV13 3RRDA 2GN7A 5FDBA 4IERA 5HBAA 1AR72 1QOOA 2WFF2 3BOPA 4WV8A 4Q0PA 2AREA 3UKTA 1YIPA 3JUUA 1LOAA 1HV1A 1Q8SA 4PLNA 5EJ3A 4K6BA 2WS93 3MYXA 1VBB2 4AGRA 5CG8A 3KM5A 2YXSA 4WVMB 1BVP1 3NV4A 2WNUC 4N53C 5FLHA 1MACA 2P2KA 1W39A 4HK8A 3FMGA 3VBSB 1LEMA 1QDOA 2I74A 3TB0A 1RUI1 4B4QA 3O12A 4KWKA 5JSPA 1GNZA 2ZGSA 2F4PA 5AVPA 2FHRA 3KCXA 2JENA 3E6DA 3ZYGA 1CAXB 2WLPA 2PHFA 1FOD3 5DXDA 4Y20B 3AKRA 3AM2A 1MS1A 3I59B 4Y22A 4FOYA 4YZ1A 1DGWA 3HN1A 2G4IA 3INAA 2R061 2DTYA 2D6MA 1G6NA 1DDLA 4GULA 4A3XA 2CWMA 1H9WA 4LLFA 3GBWA 4Y24A 4R4ZA 1R081 3ZX7A 3JB8A 4ES9A 1Z78A 4QQ2A 4MYEA 1D0GA 5I0RA 1QJY2 4BLIA 2OVUA 4AI0A 1R1A2 2IWGB 3J8F2 1ZZ7A 1PHMA 2R042 3KQRA 4AI8A 5L73A 4AEKA 5JZGA 2JG9C 5CFDB 1FATA 5T54A 4FP2A 3TN91 4XEZA 3VDDA 2Q8OA 4HN0A 4FQ4A 2VMGA 4LBQB 4YZ2A 1WW7A 2YC0A 1X8EA 1W6OA 3MFCA 2SBAA 1UN1A 1D2SA 1G9AA 2DWRA 4HZFA 1ENXA 5I8YA 1QJU1 1XNCA 2WWSA 3O14A 4P9WA 4YZ5A 3ZVXA 4FPJA 2OZ6A 1ASJ2 5CU1A 1HDKA 4G3YC 3WQ1A 4M00A 3UKNA 2JECA 1GANA 1AR81 4FSJA 3I2DA 5H9SA 1AR61 1YNAA 2ZOEB 2GALA 2R1BA 4B8EA 2XJQA 3VDDC 3OD4A 1S0EA 1H30A 2HWE3 3KMHA 4KU8A 4AVBA 3M3EA 2A73B 4DINB 1QU0A 1R091 5C9AA 2WT2A 2D6OX 3MEPA 4XOGA 2HWD1 1C8NA 4I3GA 2XPJA 3VN4A 1ND3B 3UL2A 4KG8A 4WM8C 3O0WA 3RI9A 1GQHA 2BEOA 3CL1A 5DDJ1 2OUJA 3WP6A 4DNYA 4LA2A 4OI4A 4XFAA 1KDMA 1H4GA 3EBRA 3VBRA 4FP3A 2WSUA 1AYM3 1AL22 4CDUA 2A3YA 4YW2A 1MVEA 2ES3A 4Q4X2 4AHZA 1Y9QA 1OLRA 1ZBE3 3NAPB 1CAUA 2ZTNA 1AX1A 1NCQA 1HV0A 3OY8A 2RMU2 4RHV2 4RS5B 2MHFA 2B5HA 4BM8A 3M8LA 3K51A 3FE5A 4JGZB 1BBT3 5DZFA 4BA6A 3AKPA 3E5QA 3GZUC 4E4ZA 4OUSA 3ES1A 3VBRC 4JVAA 4Q1RA 5FOJB 2E7AA 3JD73 1RVF3 3TAYA 4L9BA 2NYYA 3ILFA 4XJAA 2WC2A 4YG0A 1I6XA 1ULDA 1WD3A 4AWDA 4TSVA 1YLLA 1HRV3 2E7QA 3VL9A 1NCQC 2RS31 4W65A 1DGRA 1PK6B 4LBKA 3CLPA 1IZ3A 5T5JA 2D6KA 3LA3A 1IS5A 5KHKA 3H1MA 2RR11 1EV11 2KA3A 4R9AA 4UW5A 5JI9A 1L3JA 3S7EA 3ME2A 1SLTA 1VLNA 3M3CA 1QMJA 3RG0A 4XTMA 3VKNA 5BV6A 3MIBA 3IDCB 3AKSA 2FZ2A 3GHMA 3T1MA 2GZWA 1HIXA 4INDA 1UX6A 1LU1A 3SHRA 3PMEA 3R05A 3M3OA 3CNAA 1BCXA 1DQ1A 2X5IC 1SLBA 4IEOA 4MGIE 2ZGKA 2R6QA 1UZZA 2D6NA 2V73A 5BNPC 2PAEA 4AXOA 3L9JT 3VBUA 3E97A 5FMOS 3NL1A 2IC1A 5FQ0A 3JBG1 4LO4B 4RR3A 2PLV1 2ZGMA 4OZXA 4FPOB 1OPMA 5EYYA 3A0NA 2JICA 2AGSA 1BVVA 1VBA3 1FOD1 3ZYJB 3U4XA 3PNAA 1C8M2 3R4DB 4YLZA 3LWCA 4ZU5A 1ZYBA 3U0ZA 4YFZA 3TYJA 4LHNA 2B46X 5BY5A 4Y22B 1QNYA 3KSCA 4FPHA 4XFGA 1PO11 1QHDA 3UK9A 1LGCA 5LEKA 1SEFA 4YVWA 4C0HA 1QJX3 2Q5TA 5CA6A 1D4M3 1C28A 1AZDA 1PNGA 3PMSA 3UV9A 1MQTA 4LULA 3VGIA 1CONA 2LUWA 5JZGB 4A7YA 4R9DA 1W6PA 4DQAA 5I91A 3NV1A 1I9RA 4XFCA 5GLTA 3FX3A 4XIOA 3ZXFA 5IK8A 1XRUA 5FTTC 1HXS3 3ZFGC 1X50A 1DQ2A 5HI0A 3VDDB 1G9CA 1AHSA 3FUQA 1DQ6A 1W6OB 3ZIWA 4Q0VA 1VAMA 2DVFA 1PVC1 2P37A 3N35A 4YVWC 1CAWA 3PVNA 4B3NA 2PQQA 2WT1A 2W0XA 1O3RA 2VVEA 2DF7A 3KD4A 5EXOA 1MQTC 3WW4A 4NHLA 4CDWA 2JDZA 1SBEA 4XZPA 5C8CA 4EN8B 3RQ0A 5JPNB 3V64A 5KHIA 1FPN3 4H7MA 4ITCA 2PELA 3R4UA 4X6RB 4Z07A 5TSWA 4COUA 2HWE1 3IKWA 4ATFA 3DF0A 1S0DA 4DXZA 3X29B 1F5FA 3LA2A 1S2KA 4BQ1A 4GH4C 4N43A 3AMHA 1WCSA 1CD3G 1HQWA 1JN2P 1YO8A 1C1FA 1RHI2 1YFYA 1YJKA 2JG8A 2Q4SA 2ZX0A 4OHXA 5C9AB 4TWTA 4GB33 3IIAA 3TNPB 4FPCA 4XHXA 5D8AC 1IKQA 1Q8OA 3ZO0B 2DU0A 2P17A 5LEJA 1AXKA 2QJVA 1MZFA 2ZGPA 1VBD3 1AYM1 1AYN3 1EP0A 2G9GA 4FPFA 4MUVA 4IV1C 3ZN4A 1YYNA 1UZYA 3VBRB 4PLOA 1ULCA 2D6PA 2E63A 3ZDSA 4CDUB 4P9LA 4UW3A 1J3PA 1LHWA 2OA2A 3B94A 4Y1ZA 3N7LA 3VUOA 3RNSA 5KXCA 1CAUB 4FPYA 1NCQB 2B9UA 3WVJA 3OY8B 4WVWA 2EVXA 4M0HA 5FBZA 1BBT1 2WL1A 3VBOA 3AP9A 4DY5A 2D93A 2VH9A 1MS8A 2Y26A 1UIJA 1I3HA 1PIV2 1ZZ9A 2DVAA 2B8MA 4FTBA 5CIRA 1LHNA 2Z69A 3QH6A 1QH7A 4N9IA 1H9PA 4Z8BA 2ZGUA 4JAAA 3SH4A 2R1DA 2ZZJA 2UURA 5E1RA 1CVNA 2NN8A 3OTFA 1HRV1 2RS53 4YG6A 4L11A 2R0HA 4JCKA 4LUKA 5H9PA 5BNOC 1GR3A 4HANA 1G7YA 2TNFA 3ZYIB 3NO8A 3IMNA 4JRAA 1CQ9A 1GSLA 3NV2A 3LA7A 2NLRA 2R16A 4HSJA 3VBOC 2CGPA 5AC93 5D1IA 4WVZA 3ZXGA 3DUIA 1DBNA 1S0IA 1W6NA 2UWAA 3M70A 5KHGA 5J36A 3OYWA 3SCHA 4I02A 3ZSJA 1TE1B 1TMF3 2ERFA 1DGWX 3E6BA 3ZSEA 2XBO3 4AVCA 4YGBA 4ZXKA 5K9YA 2H0VA 2WZPP 5JAXA 1S0JA 4OHZA 1UF2C 2BFUL 4COVA 3EHKA 2WZR1 4H3WA 4P9GA 2MEV3 4QXKA 2YY1A 3BB6A 4GQ7A 3KZ4C 1H0BA 2A3XA 2NM1A 3FLTA 4IV3C 3WG2A 3VKLA 3VBUB 5FQ0B 4RR3B 1BK1A 1FI2A 1FV2A 1RUF2 2JEMA 4MZUA 3VZOA 1VBA1 2WT0A 2QVSB 3DPRA 3ILRA 4IEQA 2R49A 2D3PA 5BNQA 1KS5A 4XJZA 3EJKA 4YNIA 4HKOA 4BYYA 1LECA 5F6KA 5BPXA 4M01A 2HWB1 2DCTA 3B69A 4KGQA 2FZ1A 1LHOA 1CJPA 2VOWA 3MPBA 4AGVA 1LENA 4K7JA 4JGYA 1UMZA 1RUNA 1QJX1 2PAMA 1D4M1 2WA4A 3QACA 2HWF2 5CVRA 4YVWB 4R8HA 1X7NA 1LEDA 1GICA 3FBMA 3WW2A 3RJ2X 1CN1A 3H3ZA 5L7OC 1OD5A 2ZJCA 4D69A 3WG4A 1MQTB 4F3JA 1TME3 1NA1C 3GBGA 3CJIA 1LOCA 5GM0A 4D94A 4YARA 1BMV2 1WGPA 3ZIXA 1ENSA 1W6PB 2ZGQA 4FPGA 4OI1A 2RS12 3WNXA 1HXS1 4AI2A 4CEWA 2NP0A 2R072 5T5LA 4E27A 1MS5A 5CBLA 5GZFA 5HCBA 5L19A 1FMD1 4I09A 3DL3A 2XB6C 2ARXA 5CB7A 5KXDA 2DUOA 4AEDC 4JC1A 1VP6A 1QJZA 4TLFA 3SCGA 3TBDA 1CAWB 3ZMOA 2BGCA 1YUDA 3MIDA 3SLIA 4E9KA 2AYHA 1WLWA 3B5LB 1W2UA 3U11A 4P14A 5DUXA 2XJSA 1FPN1 4CDWB 5C8CB 3CJIC 5H9RA 2VMIA 4NN0A 2CL2A 1GNHA 3L2YA 4AFAA 1V9U3 1NCRA 4B7EA 1DZTA 1PO22 4PCRA 3IN9A 3IDBB 1BEV3 4N43B 4X8PA 3TOJA 4G4FA 4GB31 4RA0A 2B42B 5A33B 4TYSA 3AMMA 2JG8B 4FTSA 2ENRA 4Q0UA 2VUJA 1U5ZA 2A5ZA 1QJU3 2BTVC 1VBD1 1S0BA 3MDPA 5CNAA 1VB2A 4QQLA 4E2QA 1ZZ6A 1XYPA 3MLKA 1RUC3 4RSUA 1BXHA 5T5OA 3CJXA 1J3RA 5JCTA 2Y0IA 5DG2A 2RM22 5ACA2 3O0XA 3FLRA 4C1WA 1VBC1 4RL7A 4W6WA 1PMIA 4DPNA 1AXYA 2EXKA 1LOFA 3WG1A 5KXEA 1G9FA 4AFDA 4XIKA 2DU1A 4DFSA 1VB4A 2H6CA 4P9JA 1RUD2 3MF6A 4K21A 4WZCA 3VBOB 3P3PA 1ZVFA 4IQPA 3MIGA 1PGL1 1J1LA 1M4WA 4BWOA 2VNOA 1W0PA 1XXNA 2RS51 2LTNA 2EXIA 3E5XA 1APNA 2R32A 1AL0G 3VZJA 1G86A 1RB8G 1LOFC 4N7UA 3VBFC 4ISRA 1S55A 1SLIA 1RUH3 3WR0A 3M7AA 3WG3A 1UAIA 2WFPA 4BZ4A 5IK4A 2ZCWA 4GKYA 4DY3A 1RL3A 2EA7A 2DVGA 2GMPA 1PZ9A 1DQ5A 1W6NB 4Q4Y3 4FXKB 2PN5A 1TMF1 3AZYA 3OYWB 3PVOA 2XBO1 4EROA 2R30A 2WNEA 4FPLA 1RMU2 2MEV1 4O9GA 2VW0A 2VVFA 2XLGA 3C3VA 4KL1A 5JVVA 1GV9A 1HRI3 2WNUA 4HETA 4N53A 1URXA 4DRVA 4LHLA 1YFWA 3U10A 2GMEA 3ZSKA 5JSOA 5A3MA 3WDXA 1S2BA 4ORFA 3ZYRA 3DPRB 5CAZA 2VG9A 4ZU7A 1OPOA 4PF5A 5KC5A 2HEVF 1U5XA 4FOVA 4YYOA 2C1FA 5DZGA 3WINE 1ULGA 1POV3 4I0BA 2HWC3 3ZFEC 2ZABA 3AP5A 1OSGA 3VHPA 1OLQA 2ZAAA 4Q0QA 4JGYB 4XMIA 2XJTA 4O9EA 4RQPA 1V6IA 2YDEA 3V56A 2CWSA 4Q4V3 1MEC3 1TME1 4AGGA 3JBG3 2JG9A 2PLV3 5T50A 1SCRA 1D0HA 1COV2 1EAH3 1REDA 2W08A 3CJIB 1CGPA 2AUYA 4I0WB 4JTNA 2QNKA 1YCIA 4CEWB 2ZPXA 1Z0HA 4I01A 4AE2A 1D2QA 3QLQA 1DIWA 5GLWA 3RI8A 3RYKA 4NWVA 1PO13 1AR92 5FFOC 3LOIA 4BOWA 3GNEA 2YPJA 4P9IA 3WP3A 4RQPC 1NOVA 1N1VA 1O5UA 1GZ9A 3JQWA 2ZGNA 1RGSA 3OD0A 2OUHA 2Y38A 1XE8A 4AHYA 1V9U1 1D4VB 3B00A 3LOBA 4GMP3 1W6QA 5GLUA 1BEV1 4YGCA 4AF9A 5GALA 1NCRB 2YGMA 3POSA 5EZWA 3MLLA 2BPA2 2XUMA 3AYCA 4MSVA 1PVC3 4ES8A 3U07A 1JUIA 4WM8A 3L2HA 4C0BA 1CJDA 1W6MA 1LHVA 1KJRA 2GSYA 1RUC1 5DUWA 4DRRA 4LBQD 3E6CC 2XVLA 3LGRA 1RUI2 1XNKA 4LO7A 3VZLA 2B7YA 2C9AA 4ASLA 1UIKA 3GZAA 2JJ6A 1GFF2 1WW6A 3WV6A 2XG3A 1OHFA 1SFYA 1LOGA 5JOZA 4QM8A 2BUKA 4Q26A 2MNGA 2R062 1OKQA 4N9HA 3MIEA 1NYWA 1BYHA 3I8TA 3B93A 1R082 1PVXA 3M3IA