3WP8A

Acinetobacter sp. tol 5 ataa c-terminal ylhead fused to gcn4 adaptors (chead)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
KIEEILSKIYHIENEIARIKKLIAVITSNITEVVDGNGNKVNIIDQVVNTKPDNKNQDSLFLTYDKQGQETTDRLTIGQTVQKMNTDGIKFFHTNADTSKGDLGTTNDSSAGGLNSTAIGVNAIVANGADSSVALGHNTKVNGKQSIAIGSGAEALGNQSISIGTGNKVTGDHSGAIGDGTIVNGANSYSVGNNNQVLTDDTFVLGNNVTKTIAGSVVLGNGSAATTGAGEAGYALSVATNADKAAITKTTSSTGAVAVGDASSGIYRQITGVAAGSVDSDAVNVAQMKQIEDKIEEILSKIYHIENEIARIKKLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Toughness and Flexibility in the C-terminal Passenger Domain of an Acinetobacter Trimeric Autotransporter Adhesin
doi rcsb
source organism Acinetobacter
molecule tags Cell adhesion
molecule keywords Trimeric autotransporter adhesin
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3wp8A02
2ML2A 4I35A 1JIWP 3LAAA 2ZVDA 3A6ZA 5CXLA 1OM6A 2YO0A 1AKLA 3LA9A 1O0QA 2Z8ZA 3HDAP 2ZJ6A 1SATA 2QUAA 1SRPA 2AGMA 1KAPP 3S6LA 1GO7P 1P9HA 1K7IA 1OM8A 3A70A 3VI1A 1K7GA 1K7QA 3WP8A 2YO1A 5CVWA 3NTNA 1SMPA 5D7WA 2XQHA 2Z8XA 2QUBA 3HBVP 3U1RA 1O0TA 3HBUP 1AF0A 1G9KA 3HB2P 1OM7A 1OMJA 1GO8P 1H71P 2ZJ7A 3ULTA
chains in the Genus database with same CATH superfamily
2ML2A 4I35A 1JIWP 3LAAA 2ZVDA 3A6ZA 5CXLA 1OM6A 2YO0A 1AKLA 3LA9A 1O0QA 2Z8ZA 3HDAP 2ZJ6A 1SATA 2QUAA 1SRPA 2AGMA 1KAPP 3S6LA 1GO7P 1P9HA 1K7IA 1OM8A 3A70A 3VI1A 1K7GA 1K7QA 3WP8A 2YO1A 5CVWA 3NTNA 1SMPA 5D7WA 2XQHA 4DT5A 2Z8XA 2QUBA 3HBVP 3U1RA 1O0TA 3HBUP 1AF0A 1G9KA 3HB2P 1OM7A 1OMJA 1GO8P 1H71P 2ZJ7A 3ULTA
chains in the Genus database with same CATH topology
2ML2A 4I35A 1JIWP 3LAAA 2ZVDA 3A6ZA 5CXLA 1OM6A 2YO0A 1AKLA 3LA9A 1O0QA 2Z8ZA 3HDAP 2ZJ6A 1SATA 2QUAA 1SRPA 2AGMA 1KAPP 3S6LA 1GO7P 1P9HA 1K7IA 1OM8A 3A70A 3VI1A 1K7GA 1K7QA 3WP8A 2YO1A 5CVWA 3NTNA 1SMPA 5D7WA 2XQHA 2Z8XA 2QUBA 3HBVP 3U1RA 1O0TA 3HBUP 1AF0A 1G9KA 3HB2P 1OM7A 1OMJA 1GO8P 1H71P 2ZJ7A 3ULTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML2 A;  4I35 A;  1JIW P;  3LAA A;  2ZVD A;  3A6Z A;  5CXL A;  1OM6 A;  2YO0 A;  1AKL A;  3LA9 A;  1O0Q A;  2Z8Z A;  3HDA P;  2ZJ6 A;  1SAT A;  2QUA A;  1SRP A;  2AGM A;  1KAP P;  3S6L A;  1GO7 P;  1P9H A;  1K7I A;  1OM8 A;  3A70 A;  3VI1 A;  1K7G A;  1K7Q A;  3WP8 A;  2YO1 A;  5CVW A;  3NTN A;  1SMP A;  5D7W A;  2XQH A;  2Z8X A;  2QUB A;  3HBV P;  3U1R A;  1O0T A;  3HBU P;  1AF0 A;  1G9K A;  3HB2 P;  1OM7 A;  1OMJ A;  1GO8 P;  1H71 P;  2ZJ7 A;  3ULT A; 
#chains in the Genus database with same CATH topology
 2ML2 A;  4I35 A;  1JIW P;  3LAA A;  2ZVD A;  3A6Z A;  5CXL A;  1OM6 A;  2YO0 A;  1AKL A;  3LA9 A;  1O0Q A;  2Z8Z A;  3HDA P;  2ZJ6 A;  1SAT A;  2QUA A;  1SRP A;  2AGM A;  1KAP P;  3S6L A;  1GO7 P;  1P9H A;  1K7I A;  1OM8 A;  3A70 A;  3VI1 A;  1K7G A;  1K7Q A;  3WP8 A;  2YO1 A;  5CVW A;  3NTN A;  1SMP A;  5D7W A;  2XQH A;  4DT5 A;  2Z8X A;  2QUB A;  3HBV P;  3U1R A;  1O0T A;  3HBU P;  1AF0 A;  1G9K A;  3HB2 P;  1OM7 A;  1OMJ A;  1GO8 P;  1H71 P;  2ZJ7 A;  3ULT A; 
#chains in the Genus database with same CATH homology
 2ML2 A;  4I35 A;  1JIW P;  3LAA A;  2ZVD A;  3A6Z A;  5CXL A;  1OM6 A;  2YO0 A;  1AKL A;  3LA9 A;  1O0Q A;  2Z8Z A;  3HDA P;  2ZJ6 A;  1SAT A;  2QUA A;  1SRP A;  2AGM A;  1KAP P;  3S6L A;  1GO7 P;  1P9H A;  1K7I A;  1OM8 A;  3A70 A;  3VI1 A;  1K7G A;  1K7Q A;  3WP8 A;  2YO1 A;  5CVW A;  3NTN A;  1SMP A;  5D7W A;  2XQH A;  2Z8X A;  2QUB A;  3HBV P;  3U1R A;  1O0T A;  3HBU P;  1AF0 A;  1G9K A;  3HB2 P;  1OM7 A;  1OMJ A;  1GO8 P;  1H71 P;  2ZJ7 A;  3ULT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...