3WP8A

Acinetobacter sp. tol 5 ataa c-terminal ylhead fused to gcn4 adaptors (chead)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
317
Chain Sequence
KIEEILSKIYHIENEIARIKKLIAVITSNITEVVDGNGNKVNIIDQVVNTKPDNKNQDSLFLTYDKQGQETTDRLTIGQTVQKMNTDGIKFFHTNADTSKGDLGTTNDSSAGGLNSTAIGVNAIVANGADSSVALGHNTKVNGKQSIAIGSGAEALGNQSISIGTGNKVTGDHSGAIGDGTIVNGANSYSVGNNNQVLTDDTFVLGNNVTKTIAGSVVLGNGSAATTGAGEAGYALSVATNADKAAITKTTSSTGAVAVGDASSGIYRQITGVAAGSVDSDAVNVAQMKQIEDKIEEILSKIYHIENEIARIKKLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trimeric autotransporter adhesin
publication title Structural Basis for Toughness and Flexibility in the C-terminal Passenger Domain of an Acinetobacter Trimeric Autotransporter Adhesin
doi rcsb
source organism Acinetobacter
molecule tags Cell adhesion
total genus 109
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3wp8A02
1OMJA 5CXLA 2ZJ7A 1K7QA 3WP8A 1K7GA 1K7IA 2YO1A 1AKLA 1SRPA 3A70A 2ZVDA 2ML2A 3HDAP 1OM7A 1O0TA 1KAPP 3HBVP 2XQHA 3HBUP 2QUAA 1JIWP 1AF0A 3A6ZA 1GO7P 3HB2P 3LA9A 1P9HA 1O0QA 2ZJ6A 2YO0A 1SATA 2QUBA 2AGMA 1SMPA 5CVWA 3ULTA 3S6LA 5D7WA 4I35A 1OM6A 1GO8P 2Z8ZA 2Z8XA 1OM8A 3LAAA 1G9KA 1H71P 3NTNA 3U1RA 3VI1A
chains in the Genus database with same CATH superfamily
1OMJA 5CXLA 2ZJ7A 1K7QA 3WP8A 1K7GA 1K7IA 2YO1A 1AKLA 1SRPA 3A70A 2ZVDA 2ML2A 3HDAP 1OM7A 1O0TA 4DT5A 1KAPP 3HBVP 2XQHA 3HBUP 2QUAA 1JIWP 1AF0A 3A6ZA 1GO7P 3HB2P 3LA9A 1P9HA 1O0QA 2ZJ6A 2YO0A 1SATA 2QUBA 2AGMA 1SMPA 5CVWA 3ULTA 3S6LA 5D7WA 4I35A 1OM6A 1GO8P 2Z8ZA 2Z8XA 1OM8A 3LAAA 1G9KA 1H71P 3NTNA 3U1RA 3VI1A
chains in the Genus database with same CATH topology
1OMJA 5CXLA 2ZJ7A 1K7QA 3WP8A 1K7GA 1K7IA 2YO1A 1AKLA 1SRPA 3A70A 2ZVDA 2ML2A 3HDAP 1OM7A 1O0TA 1KAPP 3HBVP 2XQHA 3HBUP 2QUAA 1JIWP 1AF0A 3A6ZA 1GO7P 3HB2P 3LA9A 1P9HA 1O0QA 2ZJ6A 2YO0A 1SATA 2QUBA 2AGMA 1SMPA 5CVWA 3ULTA 3S6LA 5D7WA 4I35A 1OM6A 1GO8P 2Z8ZA 2Z8XA 1OM8A 3LAAA 1G9KA 1H71P 3NTNA 3U1RA 3VI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMJ A;  5CXL A;  2ZJ7 A;  1K7Q A;  3WP8 A;  1K7G A;  1K7I A;  2YO1 A;  1AKL A;  1SRP A;  3A70 A;  2ZVD A;  2ML2 A;  3HDA P;  1OM7 A;  1O0T A;  1KAP P;  3HBV P;  2XQH A;  3HBU P;  2QUA A;  1JIW P;  1AF0 A;  3A6Z A;  1GO7 P;  3HB2 P;  3LA9 A;  1P9H A;  1O0Q A;  2ZJ6 A;  2YO0 A;  1SAT A;  2QUB A;  2AGM A;  1SMP A;  5CVW A;  3ULT A;  3S6L A;  5D7W A;  4I35 A;  1OM6 A;  1GO8 P;  2Z8Z A;  2Z8X A;  1OM8 A;  3LAA A;  1G9K A;  1H71 P;  3NTN A;  3U1R A;  3VI1 A; 
#chains in the Genus database with same CATH topology
 1OMJ A;  5CXL A;  2ZJ7 A;  1K7Q A;  3WP8 A;  1K7G A;  1K7I A;  2YO1 A;  1AKL A;  1SRP A;  3A70 A;  2ZVD A;  2ML2 A;  3HDA P;  1OM7 A;  1O0T A;  4DT5 A;  1KAP P;  3HBV P;  2XQH A;  3HBU P;  2QUA A;  1JIW P;  1AF0 A;  3A6Z A;  1GO7 P;  3HB2 P;  3LA9 A;  1P9H A;  1O0Q A;  2ZJ6 A;  2YO0 A;  1SAT A;  2QUB A;  2AGM A;  1SMP A;  5CVW A;  3ULT A;  3S6L A;  5D7W A;  4I35 A;  1OM6 A;  1GO8 P;  2Z8Z A;  2Z8X A;  1OM8 A;  3LAA A;  1G9K A;  1H71 P;  3NTN A;  3U1R A;  3VI1 A; 
#chains in the Genus database with same CATH homology
 1OMJ A;  5CXL A;  2ZJ7 A;  1K7Q A;  3WP8 A;  1K7G A;  1K7I A;  2YO1 A;  1AKL A;  1SRP A;  3A70 A;  2ZVD A;  2ML2 A;  3HDA P;  1OM7 A;  1O0T A;  1KAP P;  3HBV P;  2XQH A;  3HBU P;  2QUA A;  1JIW P;  1AF0 A;  3A6Z A;  1GO7 P;  3HB2 P;  3LA9 A;  1P9H A;  1O0Q A;  2ZJ6 A;  2YO0 A;  1SAT A;  2QUB A;  2AGM A;  1SMP A;  5CVW A;  3ULT A;  3S6L A;  5D7W A;  4I35 A;  1OM6 A;  1GO8 P;  2Z8Z A;  2Z8X A;  1OM8 A;  3LAA A;  1G9K A;  1H71 P;  3NTN A;  3U1R A;  3VI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...