3WQ4A

Crystal structure of beta-primeverosidase
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
475
structure length
475
Chain Sequence
SFNRTSFPDGFVFGAASSAYQFEGAAKEGGKGPNIWDTFTHEFPGKISNGSTGDVADDFYHRYKEDVKVLKFIGLDGFRMSISWARVLPRGKLSGGVNKEGIAFYNNVINDLLSKGIQPFITIFHWDLPQALEDEYGGFLSPHIVNDFRDFAELCFKEFGDRVKHWITMNEPWSYSYGGYDAGLLAPGRCSAFMAFCPKGNSGTEPYIVTHNLLLSHAAAVKLYKEKYQAYQKGQIGITLVTYWMIPYSNSKADKDAAQRALDFMYGWFIEPLSFGEYPKSMRRLVGKRLPRFTKEQAMLVKGSFDFLGLNYYIANYVLNVPTSNSVNLSYTTDSLSNQTAFRNGVAIGRPTGVPAFFMYPKGLKDLLVYTKEKYNDPVIYITENGMGDNNNVTTEEGIKDPQRVYFYNQHLLSLKNAIAAGVKVKGYFTWAFLDNFEWLSGYTQRFGIVYVDFKDGLKRYPKHSALWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of beta-primeverosidase in complex with disaccharide amidine inhibitors.
pubmed doi rcsb
source organism Camellia sinensis
molecule tags Hydrolase
molecule keywords Beta-primeverosidase
total genus 188
structure length 475
sequence length 475
chains with identical sequence B
ec nomenclature ec 3.2.1.149: Beta-primeverosidase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wq4A00
4JKKA 1M03A 3ARQA 1AQMA 4PCTA 2CBJA 2DDXA 3PZQA 3EMZA 4S3KA 3GH7A 1G0CA 4BQ2A 2EEXA 2ZXDA 1EOMA 3VDAA 2DH3A 1B30A 1MQRA 2CEQA 4EE9A 6A3HA 2G41A 5CZKA 4RL3A 4OIFA 3UEQA 5F7UA 3N11A 2OLHA 4H7VA 4W87A 3NYDA 3LPOA 1WKYA 4P7RA 3WNNA 1E73M 3WH6A 1JZ5A 2QF8A 1UYQA 1K6AA 1WPCA 4AD5A 1HVQA 1ESWA 2EPNA 5LYRA 1NWUA 2ZWZA 5DO8A 2F61A 3VDCA 4HPHA 3A47A 1W91A 2WB5A 3PZ9A 1VFUA 5EBAA 5DF0A 3MUAA 4HA4A 3IK2A 1J18A 1XSKA 2JIWA 3U57A 3ALGA 3QGVA 1E0WA 1HKIA 4JKLA 1RP8A 3VDBA 3VUPA 1Y7VA 4URIA 1XD1A 3PTKA 1UQYA 2E9BA 1DWJM 1E55A 2WVUA 3VIGA 3VPLA 3CHFA 3AIRA 4P7NA 2J79A 4HMDA 4QLKA 3AIWA 2V3EA 4FLOA 5CPQA 4M80A 3SCNA 1UH3A 4UZUA 2ZUNA 1V0KA 4KGJA 2XM2A 4DWSC 3SIMA 2J8GA 1KXQA 3BXWA 3NSNA 4W85A 4AYSA 5ABHA 1FHDA 4QLJA 1GQKA 4H8HA 4E2OA 1XH2A 3ECQA 5EB8A 3SEPA 2WWDA 5A6AA 5A2BA 3CMJA 4XUYA 4DM1A 2DT2A 4FLQA 3W26A 3ZOAA 2YBUA 2YL6A 2J78A 1HVXA 2XVGA 3WN6A 3MMWA 4AEFA 4F9DA 2XIBA 1E4MM 4DUWA 3T2QA 3CHCA 3F5JA 4HP5A 3WFZA 2VCAA 3UESA 1V6VA 3VIIA 2FGLA 1GOKA 6TAAA 1GVIA 2JFEX 1ODZA 1BTCA 1KBKA 4AIUA 3PZTA 4WSKA 4D71A 3VD7A 3OGVA 2WLYA 3GNOA 1YHTA 2UY5A 4D6GA 4JCMA 2GJXA 2JEPA 2YL9A 2E8ZA 3PHAA 4UQCA 2TAAA 4B3LA 2VVSA 4LYRA 3QOMA 1C8XA 5FCZA 4A3YA 2ZUSA 4TTUA 1UKTA 1QPKA 1E70M 2BV9A 1JDDA 4WF7A 1ZBKA 3ARZA 1SMAA 3AICA 4GIAA 1NARA 4LX4A 3EDJA 3RM9A 1ISYA 3VGGA 1H2JA 4CKQA 3ARWA 1GUVA 4PMOA 1V6WA 3WQ6A 3EYPA 4Z2LA 1J0IA 2XGBA 3U5YA 1M7XA 4W5UA 4Q7NA 1WZKA 1JZ7A 1JD9A 1GPFA 1MW0A 4UNIA 2WVSA 3TONA 2OWXA 4F66A 1Q6EA 2X8RA 1UKPA 1NWSA 4W88A 1WAWA 4OZOA 3AIEA 1XGZA 2GSJA 4LYQA 3WSUA 3VILA 4H41A 4M81A 3VO0A 3AIVA 5HPCA 1UOKA 4PMXA 3ZO9A 4BF7A 2VZUA 3DHPA 1BYBA 3ARTA 1CBGA 2WZHA 4JCLA 1GJWA 4AEEA 4NI3A 1NWTA 2CERA 1NOUA 4DWSB 3CBWA 4P7OA 3SUSA 3AZSA 4LQ1A 1E9LA 3MSGA 1AMYA 3GNPA 3SUWA 4H04A 3ZR5A 2J74A 3MU7A 3VD9A 1LQ0A 3BLKA 1B3ZA 4J3XA 4AD2A 1NOFA 5BXPA 1HT6A 3VOCA 4TX6A 1HL9A 3TTSA 1QNRA 3SCTA 4CCCA 3FW6A 1WNOA 2NT0A 1OD8A 4CCDA 2WKLA 4V2XA 4H8UA 5A8MA 3CUFA 2PBGA 3O9NA 1EGZA 1UWTA 3CTTA 3GM8A 4PMUA 3UERA 3FAWA 4AD3A 2VCBA 2O9RA 3AHXA 2WNWA 1SR0A 5FOOA 2A3CA 2ZIDA 1E3XA 1V03A 2CHNA 5DFAA 3WF4A 2VC9A 3EDKA 1K9FA 1UA3A 3BGAA 9CGTA 2WAGA 3W82A 4BQ3A 3WEZA 3IAPA 4DWSA 4CD8A 4DUVA 1O6IA 1HP5A 3FXYA 4MJ2A 3UG5A 1UD8A 4JKMA 3WELA 5JBEA 2CYGA 8CGTA 2WBKA 4MB3A 2VZSA 4AZGA 1HIZA 3CZEA 2DSWA 2BY0A 2JALA 3CMGA 1JL8A 4MAVA 2X05A 3WENA 1C3FA 3DECA 1GOOA 2PI6A 4QFUA 3OZOA 2VRJA 1ZL1A 2D23A 4TOQA 1Q6DA 3BAIA 4HA3A 3AQUA 2XVLA 4AD0A 1TUXA 2Y8KA 4HOZA 2ZUVA 1M04A 4NRSA 2X09A 3THDA 1E4LA 2BXZA 3T0DA 5DT7A 1CXEA 1G5AA 1UR4A 2DGAA 2WMIA 3PN8A 1VAHA 1G1YA 3II1A 1C8YA 2BVTA 1OB0A 2CKRA 2A3HA 2UY4A 5D4YA 1KR1A 4HU0A 4WKFA 1JZ6A 2BFGA 4EK7A 4AD4A 2WCAA 4YHEA 3SUUA 5ABGA 2W92A 4CN6A 4B16A 2DT1A 1QBAA 4WK9A 4P8UA 1X6NA 5M3WA 4UOQA 1EA9C 2V3DA 3UG4A 2VX7A 2XWEA 3SCVA 1WZMA 1W1VA 4GZIA 1ODUA 4JHOA 2BVYA 4CVWA 4DWSD 1O7AA 3WIJA 4PN2A 2VRQA 1UD6A 1CGVA 1UD4A 1HJQA 1WZLA 3KWXA 1H3GA 1JF6A 3FY1A 4HZ6A 1UWQA 1RH9A 4WKAA 4A3HA 3SCWA 4AZCB 3AYRA 5A3HA 5C71A 4ACZA 1NM9A 3RO8A 2J47A 4TUFA 5BRPA 2J25A 2WW5A 3IAQA 3OLIA 3AOFA 5CGMA 2WKGA 3AS1A 3LMYA 2XWDA 5GQBA 3WKZA 1CDGA 3D3AA 4MDOA 3L2MA 3WEMA 1TVPA 1GHSA 3WDHA 4M82A 2YA0A 1GOIA 3W6MA 4UFJA 3AMKA 3F5LA 1C8QA 3L4UA 3BAJA 1BGGA 5M03A 1V0MA 4TXEA 2YIHA 3ZJKA 1OGSA 1E15A 2D1ZA 2VQTA 2VZVA 1HP4A 3S6TA 3BAWA 4AXNA 5HXMA 5A6KA 1Q6CA 3T2PA 2WC4A 1TG7A 3K4DA 1EQPA 3TTYA 2OWWA 1RP9A 4RE2A 1QNPA 1VJZA 5I3DA 3AS3A 4D1IA 4AZCA 2CBUA 4NRRA 1V02E 4EKJA 1KR0A 2ZXQA 3VX0A 4F8XA 2OYLA 3NDYA 4CN1A 1HKMA 3MV11 1E6ZA 4Q22A 2J7EA 4H2CA 3WY1A 5FL0A 1CGTA 4OKDA 3JUGA 1H49A 4W89A 1W1TA 2ZX8A 2ZUUA 3ARXA 1KFWA 4W5ZA 3CHDA 4ML4A 1V3LA 4CU6A 5JIPA 3ZJ7A 1C93A 1R87A 1B3VA 4EAMA 4OOZA 2GK1A 1GOWA 2PWEA 1CENA 3VIFA 3DC0A 1R7AA 4E8CA 1S46A 2DPEA 2ZXAA 3N18A 1VF8A 3PZNA 3ZT5A 2WCSA 2JEQA 1UUQA 1UD5A 1QOXA 4KMQA 4ATDA 3PZMA 1HNYA 4CUCA 1H11A 2ZXBA 1MW1A 4X0NA 3GBDA 3PZGA 3G6MA 3VKKA 1HKKA 1E0XA 4ZXOA 2PBOA 1UD2A 1WDQA 2YDRA 3CZ8A 1NP2A 5D8ZA 1VENA 1HJXA 1VEMA 4CGTA 4V28A 5A6BA 4UQAA 1E5NA 1W9UA 2WK2A 2W63A 5E09A 4AZIA 2GJXB 3ARPA 1JZ3A 1CPUA 3IANA 3CH9A 1VFMA 1B31A 1SFSA 2ZICA 1PEZA 1V3HA 1OCQA 1OM0A 3U5UA 5E70A 3WMSA 1V6XA 5I78A 4D6DA 4JFWA 3MUZ1 1JAKA 1MFVA 4MNLA 1GJUA 2DSUA 3RMEA 1BF2A 2O9OA 2VCCA 3GYCA 2WMJA 3RCNA 1WB0A 1PX4A 1HKJA 1MXGA 4JFUA 3PZIA 1E3ZA 3K4AA 1W9BM 3AMGA 4AIOA 4QLLA 3AZTA 3SCSA 3VVGA 5D9PA 3CUIA 1GQLA 4Z2JA 2EQDA 3MV01 4PRWA 3G6LA 4PMVA 2XHYA 3PZUA 3AHVA 5FIPA 3N9KA 3W27A 1U30A 4UCFA 1UZ1A 3ZJ8A 1E43A 2FHFA 4AY1A 3VTRA 2HVMA 2E9MA 4KRTA 4M24A 2OSWA 5KEZA 1XYFA 4CD5A 3FHQA 1FH9A 3ZSTA 2WWCA 2VNCA 1K9TA 2QMJA 4GXPA 2VI0A 2VO5A 3SCQA 3GBEA 1H09A 5HPOA 2RGLA 2XUCA 3BAXA 1KBBA 1VB9A 1QI5A 3BLPX 5E0FA 2BY3A 4U31A 4D6CA 1PJ9A 5JUVA 4JHZA 2YDQA 3VD5A 3WNLA 2ZX6A 3K8MA 2J62A 2WLZA 4UQ9A 1LL7A 1MVYA 1J0JA 3L4VA 3KE0A 3QOKA 2E9LA 4BA0A 2OWCA 4W7VA 4LGXA 5HNNA 5A8QA 4PTMA 4B3KA 1ZJBA 3VGFA 4J3VA 2XSBA 4U33A 1NQ6A 2CPUA 1UQZA 2O92A 4Y7EA 1B9ZA 3WD4A 2VRKA 4MJ4A 2YDSA 1QHPA 4AMCA 2CBIA 1KQYA 5BWFA 2DT0A 1IZKA 2VVNA 2WHMA 1E71M 5AYIA 5E6ZA 2X2YA 2WSPA 2NSXA 3WD1A 2C0HA 1Q4NX 3WDIA 1TVNA 2VR4A 3ARRA 3WNMA 3U7BA 2E4TA 4FK9A 1H0GA 4AZHA 3WMBA 1J0HA 1CGYA 1QBBA 3WUFA 1XH1A 3PTMA 2VZTA 4W7UA 2E0PA 1R8LA 1XSJA 2PB1A 3KL3A 1GQJA 2VURA 3ZJ6A 1JI1A 2YLAA 1BG4A 2ZWYA 5JBFA 5D9OA 5A6BD 2PF0A 1JZ2A 7A3HA 3WQ5A 4UTFA 2CESA 3VGEA 1W32A 3AISA 2XGIA 1IV8A 1B3XA 1EO7A 1GOMA 3MMDA 3WNPA 2XG9A 2WVTA 1CXHA 1TZ7A 2ZUMA 4XB3A 5LA2A 3AIBA 5I5RA 1V3IA 1LG2A 2AAAA 2VJXA 1PIGA 4UFMA 3W0KA 4W8LA 1I1WA 2XYLA 3WF3A 1CGWA 1RD6A 3VINA 1FA2A 1E5JA 3CIVA 4W93A 2F8QA 1IZJA 4WLCA 1KB3A 2A3BA 2DSKA 3WNOA 1BQCA 4H8VA 1EHNA 1MW3A 2E40A 4XV0A 3BAYA 3B9DA 3N04A 2XFYA 4L4PA 4OJYA 4JIEA 4JAWA 3UCQA 1BG9A 1DWFM 1DWHM 3NUKA 1VFFA 3GH4A 1US3A 2QMKA 1FP9A 2WC7A 4V27A 1V02A 2UY2A 1WP6A 2JF7A 3ZM8A 1FFRA 4PYSA 4LPCA 2WMHA 1UWUA 2FGZA 4HTYA 3WF2A 1BYCA 2CBVA 2Y4SA 4UFKA 2D3NA 4E4PA 1NP0A 4ZFMA 3WH5A 3W38A 5CXPA 1R85A 4QCEA 1QHOA 1GVYA 5E9AA 3CGTA 3VGBA 4P8WA 1XD0A 3CUHA 1V3MA 4FLRA 5FKYA 3A4AA 4MB1A 3VM5A 3WDJA 1ITXA 1ZBVA 2J7FA 1BPLB 2J7GA 4U5IA 3BCFA 3T08A 3ALFA 3ARYA 5CG0A 1EHAA 4P7LA 4PSRA 5DEZA 2YL8A 3WEOA 3TOPA 2BVDA 1AQHA 5CGTA 1G94A 3MSDA 1HJSA 3VIKA 2DQXA 5DMYA 3NIYA 4AZBA 4UOZA 1QVBA 5I0DA 4ZE5A 1W9XA 2UY3A 2DEPA 3DYPA 4TVUA 2XFFA 4B15A 3GXFA 5IFTA 4MAZA 1QNSA 4KWUA 4PMYA 5ABFA 3CO4A 3AZRA 2DT3A 1HF6A 1KCKA 3GXMA 2YJQA 4X9YA 2C7FA 5JBDA 3IJ8A 3W6LA 4OBSA 4B9ZA 4OUEA 3LPPA 4D6FA 4AZ7A 1PZ2A 3HN3A 4K68A 1CXIA 5I2UA 2YBTA 3WUEA 2VR5A 4XX6A 1OIFA 2BS9A 1UA7A 1BVZA 1MXDA 1GONA 3EMCA 5A8OA 3VNYA 3WFLA 1I1XA 4CCEA 2IUZA 3A6OA 2WMFA 1PX3A 1V0NA 3AXHA 3CUGA 1UH4A 3WBEA 1DWAM 1E6SM 3WH9A 1C7SA 1JI2A 1DEDA 2ZX7A 1I75A 1UR1A 1F4HA 1W9DM 2CKSA 4GPNA 3PBGA 3L4XA 4BQ4A 2OSXA 1F4AA 2WBGA 2CETA 2J4GA 1BHGA 1W2VA 1BAGA 3F4VA 3MO4A 1NOWA 2QPSA 1XRVA 1FP8A 1QW8A 1CXFA 2WHJA 4LYPA 4D6IA 5BROA 1FOBA 2QV4A 3O6AA 3T0AA 2WCGA 3W4RA 1J10A 5EFDA 4UQBA 4IPLA 1GW1A 4PUDA 3N13A 1KXTA 3F5KA 2WHKA 3A3HA 5ABEA 3AHTA 2VT0A 3MMUA 1VEPA 3QHNA 4MB4A 4PCSA 4W84A 2HISA 4QDMA 3ARSA 4PTVA 3WL1A 2FDMA 4P8VA 3W29A 3ZT6A 2DIEA 4GO9A 2MANA 1UD3A 4PMRA 1DP0A 5LA1A 4MTVA 3CHEA 4J7RA 3SCOA 1TA3B 1ECEA 2EPLX 1CXLA 1Q6FA 1ZB5A 5CLTA 4ATLA 1JXJA 1KGUA 4JFSA 1PBGA 1UR0A 1G9HA 4MNJA 2AMGA 1WCGA 4GI6A 3DYOA 4GQQA 5ECUA 4MNKA 3HU7A 4BQ5A 5BRQA 1PIFA 7CGTA 2WMKA 2WVVA 4MPKA 3M6DA 5AYBA 4AD1A 2E3ZA 1QI4A 3VDHA 3OLEA 1WE5A 2BNJA 4JFTA 1FH8A 3FN9A 1EOKA 4QCFA 2X0YA 3M7SA 5E0CA 5I6SA 1VEOA 4KH2A 2CXGA 4CVUA 1QHZA 1OINA 2ZUWA 4KGLA 3D5HA 3WUBA 1JD7A 5M5DA 3VU2A 1W9PA 1WDPA 3E1F1 1UKSA 3NCOA 2W91A 1CWYA 4NZCA 2DH2A 4D6EA 1E0VA 2J7DA 3TTOA 4Z2HA 1KQZA 3CZLA 4UFIA 4PMNA 3VIHA 3AMLA 3AHYA 5A2CA 3WMCA 4ACYA 1LG1A 2W5FA 5M17A 1LJYA 3K8KA 2D24A 1KGXA 1E40A 2RGMA 2WYSA 5E6YA 3M07A 3VMNA 4MB5A 4OBRA 3RJXA 3WF1A 3W25A 4JFVA 1NH6A 2NT1A 3MANA 3L2LA 1DHKA 1KXHA 1EO5A 2JIEA 4HA1A 3MUIA 3RM8A 4XZWA 5D9MA 1W1YA 1BLIA 5HDRA 1CECA 2EO7A 1EDGA 2CHOA 2V5DA 1JFHA 4IM4A 1IT0A 2VTFA 1XSIA 3RIKA 3KZSA 1V0LA 4IPNB 3A4XA 1D2KA 2Q8XA 3IJ7A 4EANA 2V38A 4PMZA 4CD6A 4NSBA 1HJUA 2XIIA 1SMDA 1J0ZA 3PTQA 4GI8A 1KGWA 1JFXA 1DWGM 4C7DA 5FL1A 2V3FA 4YN5A 2VL4A 3B8SA 1OSEA 1KXVA 5D9NA 3L4ZA 3WD3A 1LF1A 1VBRA 1WDSA 1XHGA 2V5CA 2XPKA 3VNZA 3I3DA 3OG2A 2GDVA 8A3HA 2FH6A 2EJ1A 2XVNA 2XM1A 3VMPA 3K1DA 4TTGA 4JZ5A 4QP0A 3N15A 1E4NA 4D1JA 4PSPA 1GNXA 1Z32X 3WQ8A 5CQ1A 7TAAA 1KWKA 2YKKA 1VJSA 6CGTA 1QNOA 1JYXA 2W4XA 3WH7A 4UQDA 4J28A 3K46A 1E72M 4A4AA 4W7WA 1JF5A 1ISZA 4AISA 4UFHA 5CPSA 1W9VA 4F79A 3W28A 1UHVA 4D6JA 1LWHA 3AS0A 3K8LA 1W3KA 2G4FA 3AIUA 3L4TA 2X0HA 3RILA 4AZ6A 3ZQ9A 3AYSA 3ZT7A 5BXSA 4P8XA 1BVNP 3ZMRA 3PZVA 5I23A 1EH9A 3FNDA 1OT2A 3N1AA 1H1NA 1P6WA 4BZYA 4CU7A 1B2YA 5IHSA 3QR3A 1CEOA 3BMWA 2D22A 5BYWA 4CD4A 1JZ8A 2Z1SA 1KCLA 1PZ3A 1TFVA 1UWSA 3VIOA 3VX1A 2GJRA 2ZUTA 1BYAA 4RE4A 4FF5A 1UKOA 4YHGA 2VX4A 1VRXA 1MQPA 1BYDA 2VZOA 4HU8A 5CSUA 1X1NA 1CGUA 5GNXA 2D0HA 4C7GA 2WVVB 4F9JA 3UG3A 3VGHA 1H0IA 3WH8A 1EDQA 3MKKA 1MW2A 5D8WA 1J11A 3CZKA 3CLWA 3OIHA 3SUTA 3LPFA 1HX0A 1CTNA 2J75A 4AZ5A 5BXRA 5AY7A 1C92A 3POCA 4GINA 3T09A 4PBGA 2CNCA 1EDTA 1XCWA 1JIBA 4WIWA 5A6MA 4PTXA 1ISVA 4AC1X 3TTQA 2BHZA 3CZJA 4BCEA 2W66A 5LA0A 1E6QM 1GCYA 3TP4A 2B31A 1JDAA 2W62A 3NJ3A 1JG9A 2XVPA 2XVKA 4J3UA 5IXEA 3MS8A 2VQUA 3GNRA 4M56A 3AS2A 1HXJA 2VUYA 1VFOA 2FH8A 2FHBA 1AVAA 3WDQA 1A47A 1JNDA 3I3EA 3LPGA 3VIPA 3TA9A 2GUYA 1C7TA 1U2YA 2IXVA 4YPJA 5IDIA 4AW7A 1W1PA 1XH0A 2W67A 2YA1A 3WD0A 5AC5A 5ABFB 1M01A 4M1RA 5A6SA 4KRUA 3SUVA 1XV8A 1JZ4A 5GNYA 1E1EA 2DIJA 4N42A 4D72A 1W3HA 1GHRA 3OBAA 3RPMA 4TX8A 1QI0A 2ZX9A 5I24A 3EDDA 1GZJA 3WQWA 3GXIA 3AJ7A 4MDPA 1WZAA 1PAMA 1OIMA 3RDKA 1E6RA 1D3CA 2YLLA 4PTWA 2BHUA 4JL2A 4WSJA 1VBUA 1E6PA 4M29A 3N17A 1JYVA 1ZS2A 3VIJA 3WDPP 3GH5A 4L4OA 3S2CA 2ZX5A 2Y8VA 3FAXA 1FH7A 1UR8A 2XSAA 3MUY1 3VD4A 1QW9A 4UOJA 4J27A 1X6LA 1TR1A 1A3HA 1BFNA 1JYNA 3EDFA 4UFLA 4C7FA 2BY2A 1CLXA 2BXYA 1BSIA 4JL1A 3W37A 2VX6A 4U2ZA 5A95A 1CZ1A 4AIEA 3KL0A 1E6NA 1ZBCA 2V3GA 5A94A 2ZOXA 3DHUA 1XC6A 1ZBWA 3GDBA 3BSHA 1C90A 1E6XM 2PWGA 2D20A 3AHZA 4N0RA 4TVCA 1XYZA 2EPOA 1MYRA 1J01A 2D3LA 3AIQA 3B9AA 1GQIA 1US2A 1HN1A 2XFRA 3PZOA 5CPTA 1K9EA 1E1FA 2FHCA 1V6YA 3AMDA 5GNZA 2J7BA 3VMOA 1ZU8A 2WZEA 5HBFA 1CGXA 1B90A 1JYWA 4BS0A 4J3SA 4UZSA 3SCRA 4PMDA 2WM0A 3VIMA 4DM2A 3OGSA 1D7FA 2DSZA 2EXOA 2O9PA 4S3JA 3SCPA 3OA5A 2CITA 1TA3A 1ITCA 1U33A 1V3JA 1NWRA 1QI3A 1B3WA 4UR9A 3UR7A 5C8BB 4LXFA 1UZ4A 2D2OA 1FFQA 1UWIA 1JAEA 5IHRA 4GKLA 3B9EA 1TMQA 5KZ6A 4XZBA 2QPUA 1R7OA 5A6LA 2EPMX 3ZIZA 2PWHA 1MQQA 1BGAA 1UR2A 2WXDM 2EPKX 1HL8A 3WQVA 1EXPA 3BAKA 2UWFA 1CLVA 4NF7A 1B1YA 1JNEA 3UR8A 1XCXA 5AC4A 3POHA 3A4WA 2G8ZA 1LL4A 3RJYA 1V3KA 3THCA 2IXUA 3L4WA 4U3AA 1UKQA 4J3WA 2ESCA 3QHMA 2Y24A 3WL0A 3WBAA 4FLSA 3RM4A 5A6JA 2WC3A 2A3EA 5A1AA 1WO2A 3ARVA 3WNKA 3BSGA 5BCAA 5CJ5A 1LLOA 4HMEA 1FHLA 1OWQA 2ZE0A 3ZSSA 4J3TA 5A8PA 2QLYA 5I77A 4X0VA 4UQEA 4ACZB 1W3LA 3EMQA 5A8NA 2OSYA 3BC9A 4ZE4A 4HZ7A 1VIWA 3HMCA 3GZAA 2X1IA 5EFFA 4GZJA 3CUJA 1LWJA 4MADA 4ZEPA 2F2HA 1UH2A 5BXTA 1DTUA 2CIPA 3WDRA 1AQ0A 2WPGA 3WF0A 2VX5A 5I79A 2WSKA 2WZIA 2XTKA 3CZGA 1H4PA 2CCRA 4HMCA 1J12A 5HOSA 2J77A 3DYMA 2OYMA 2XJ7A 3UETA 4E8DA 4GI9A 3W81A 1C91A 2J7HA 3EDEA 1JXKA 5TD4A 3AI0A 1B0IA 1JGIA 1GORA 4DUXA 2JF6A 3GXDA 4PEEA 2Z1KA 3IJ9A 2C8NA 4GO8A 1KWGA 3J7HA 3KL5A 2J8FA 1Q6GA 4ZENA 3AFBA 4CN4A 1DWIM 1EQCA 5DT5A 2GJPA 2G3JA 3NSXA 4WKHA 1MWOA 2WHLA 1CNVA 2WMIB 3EBVA 1OBAA 3L4YA 4PMQA 3NDZA 5GPRA 4GZEA 2PWDA 2PC8A 1CIUA 4MNMA 1HJVA 3AXIA 4CD7A 4U5KA 4R27A 3AXXA 4IISA 2BY1A 3WUGA 3OGRA 1TE1A 1H41A 4OOUA 5C70A 2O9TA 1K9DA 1HJWA 3OB8A 1LL6A 1UR9A 1UG6A 2YA2A 2YL5A 4HPGA 3GTNA 2GK1B 4TVDA 5FD0A 3FHAA 1CYGA 3AROA 1RPKA 3VGDA 1L0PA 1L8NA 4R5EA 2GFTA 1J0KA 1ISXA 4P7QA 4Z2IA 3I3BA 1PX8A 5CLWA 3BMVA 2Y2WA 3ZR6A 1V6UA 2A3AA 3W53A 3SURA 4M8UA 1OGGA 3AMCA 3NSMA 1E56A 3APGA 3CPUA 2NW0A 3ARUA 4ATWA 1WDRA 1OD0A 5A69A 3OZPA 2G3IA 2QHAA 1QI2A 1J9YA 5EMYA 1J0YA 4D6HA 1ZJAA 4HZ8A 5JIWA 2WANA 4GQRA 4HOXA 2J7CA 1V08A 4HOWA 1G01A 4W86A 1TCMA 3WD2A 1QNQA 2D0FA 2EBNA 5IFPA 3QHOA 4Z2GA 1W3JA 4W8AA 2VOTA 2JE8A 1OT1A 4QAWA 3VM7A 1H5VA 4WJXA 2YOCA 2E8YA 3WQ4A 3T0BA 4PUEA 1EIBA 4Z2KA 4IUGA 1W2PA 3BCDA 3W24A 2AOSA 3U7VA 2GVYA 3SCUA 1OGBA 4W8BA 3OLGA 2OYKA 3KEHA 3OLDA 1B3YA 2BHYA 4FMVA 4CU8A 2D0GA 1SYTA 1JDCA 1YQ2A 3T2OA 1E4IA 4ZXLA 2Y5EA 3HJEA 1CXKA 3N12A 4RE3A 2GDUA 3VD3A 2G3NA 1MFUA 1ISWA 3BH4A 2PWFA 1GOQA 1PPIA 2DSVA 4U2YA 1N82A 4AWEA 5CSYA 2G3MA 4U3CA 2VMFA 1M53A 2W61A 5A2AA 2WMGA 4B9YA 1R86A 3M46A 1UWRA 3O2LA
chains in the Genus database with same CATH superfamily
1U1JA 1MRAA 4JKKA 3BJFA 3PZQA 1QT1A 3P8IA 5HK4A 3N3TA 3RMJA 1B30A 1IR1A 2QW5A 2ZRXA 5CZKA 2A5HA 2Q09A 2OLHA 4W87A 2PA6A 4XZNX 4GMEA 2J13A 2YGYA 3HB9A 4PTNA 1UYQA 4X2PA 5F4XA 1ESWA 3ITYA 4LAOA 1DJQA 3UZYA 1DOSA 4HPHA 3DGBA 1PDZA 1W91A 3V75A 2QIWA 3KVMA 5EBAA 5DF0A 1MZRA 2B4GA 4HA4A 3KFTA 2BODX 1XSKA 3QTPA 5LIXX 4QISA 5FJOA 3STGA 3MHUA 1E0WA 4IHCA 1SO4A 1ZJIA 2J9ZA 4QG9A 3PTKA 2E9BA 1TIMA 4KWWA 4P7NA 3E96A 4QLKA 3AIWA 1Y5XA 5CPQA 5REQA 4WEVX 5HNRA 3A12A 3QN3A 1V0KA 4DBDA 3LY0A 3SIMA 4UNKA 4D9PA 1MEHA 4AYSA 5ABHA 2NX1A 4H8HA 3GTFA 2VD9A 4O53A 4XD4A 2QKFA 4MGGA 3LCGA 1ZRQA 1Q45A 1KRAC 3KBJA 4XUYA 2Y7GA 3L5MA 3SFKA 4PULA 2YL6A 3HPAA 4HNTA 3R1ZA 3P81A 1HVXA 3PBUA 4NASA 2XVGA 4HKPA 3LM3A 1O68A 3OHIA 1THFD 2HMCA 4QJ3B 2ZE3A 1FKXA 4LT9A 2G37A 3JR2A 2E77A 2FGLA 3VA8A 1TPEA 1GVIA 4LEFA 1BTCA 3L5AA 1VD6A 4AIUA 3TQ0A 4WSKA 2PGFA 1ENUA 2I16A 4ZO6A 3GNOA 2GGJA 2UY5A 5ENLA 3DFSA 3N3MA 4Q4SA 1S2VA 2E8ZA 4BHYA 1KFBA 2TAAA 4Y96A 2CU0A 1JDDA 3L0KA 1FCQA 4A3UA 4UCGA 3REQB 3EDJA 3RLUA 1H2JA 2FFCA 3BVJA 1IHIA 2NQHA 1V6WA 3EYPA 3EXTA 4O4VA 1TV2A 3U5YA 5LZLA 4C91A 3CIXA 1WZKA 1XM3A 3O3RA 1GGOA 3RHGA 2PLMA 1UKPA 3DESA 3UWZA 4W88A 3GC2A 2GGIA 1XGZA 2BOGX 5LKYA 3L67A 3MDWA 4M6VA 4H41A 4MWAA 3LYEA 5HPCA 4PMXA 2VZUA 2FTWA 7PTDA 1CBGA 1JCTA 2WZHA 3W75A 3H2MA 3HQOA 1NWTA 2CERA 3CBWA 2CC0A 1DXEA 3AZSA 3QGKC 3L23A 3O07A 1P43A 3GNPA 3SUWA 1W1A1 4JN8A 5HWJA 3BLKA 4R85A 1B3ZA 1PCKA 2DVUA 5B7ZA 3UVAA 3TTSA 4EWND 3MA8A 1QNRA 4HPXA 1SFJA 1OD8A 4GQBA 3WQPA 2C15A 1KBJA 3LGEA 4C6QA 7ODCA 3UERA 3FAWA 4B4HA 4P5UA 3W1RA 3AHXA 3LRMA 2A3CA 1EUAA 2ZIDA 1E3XA 1QTWA 4HSNA 3EDKA 4CNOA 4I6VA 4JNYA 3VCCA 1UA3A 1GVQA 3W82A 3CV7A 2X7VA 3IAPA 4AFYA 4GXWA 1OCBA 4CD8A 1O6IA 1TTQA 6REQB 3S5ZA 3F4NA 4NXSA 3U4AA 1SJCA 4JDBA 3M5VA 2QCLA 3UJEA 2WBKA 4UTTC 2VZSA 4HK5A 3M16A 1A4MA 1G4PA 1DJNA 3CMGA 3HF3A 1JL8A 2AGTA 4HSOA 4MAVA 3W7QA 4EOUA 3DFTA 2EG8A 3LCIA 3E0LA 2VRJA 3OZOA 3N6HA 1QW7A 3AQUA 4HA3A 4O0KA 4UTHA 5J5DA 4AD0A 3QM3A 2BXZA 5DT7A 4V1YA 1BWKA 1G5AA 2WMIA 3NQVA 4HT3A 4RKAA 1BQGA 3MKVA 4D8AA 3G5EA 2W3ZA 5F1UA 5CSRA 5DMMA 2J9XA 1QBAA 4P8UA 4UOQA 4H4IA 1EA9C 3GW0A 3ABQA 1W1VA 1GT8A 3WIJA 4PEKA 1UD6A 2IQTA 4MKNA 1VBJA 1UD4A 4PUUA 1WZLA 3KWXA 1H3GA 2DIKA 1JF6A 3G1YA 3MT1A 4ACZA 1NM9A 1TMHA 2UV8G 2J47A 2KAUC 4B90A 5BRPA 2J25A 3NG3A 3QF0A 5CGMA 4JTJA 1XL9A 3DAQA 3AS1A 4HK6A 2XWDA 4NP7A 4AEOA 3D3AA 5DX7A 3GIQA 4UTMA 1T40A 4XZMX 3MY9A 1TPVA 1VYRA 2WJZA 4UFJA 4GE8A 4F0KA 3AMKA 4DY1A 4XD6A 4GGHA 5CKSA 3T81A 4GWEA 2DFAA 1JCJA 1TX0A 3UVIA 1OGSA 4BR1A 1E15A 1EPVA 1HO1A 3P82A 3TYEA 4LC6A 2WC4A 2FFIA 4LAZA 3TTYA 4HVXA 2FIQA 2ZRWA 1EBGA 4H7CA 5CBIA 1MUMA 4D1IA 4AZCA 4HMNA 4AMAA 4NRRA 5FEZA 1RSCA 1W5OA 3OHMB 3UF9A 2OYLA 1QPNA 4K1GA 4Q22A 4WY0F 4IFKB 5FL0A 1CGTA 1OEPA 4TIMA 4E2DA 3W1QA 1W1TA 2NQLA 2ZX8A 2ZUUA 1RY0A 3ARXA 3ME3A 2OB3A 4W5ZA 4ML4A 3PPCA 3HJZA 3SFWA 3ZJ7A 2X42A 2VGIA 1R5YA 4IF2A 1R87A 1XG3A 3WLMA 4ML9A 5EBUA 3BQ5A 3VIFA 3DC0A 1R7AA 3TFCA 1UOZA 3PZNA 3UNDA 3W1AA 2PCQA 3I7RA 5IBXA 5EPDA 1HNYA 1H11A 1OX4A 2ZXBA 3IJIA 3PC0A 4X0NA 4QX4A 4O57A 3VKKA 3EGJA 5MKGA 1HGYA 2RUSA 3DUGA 3CIWA 5IOBA 2YDRA 4XISA 4G5DA 4JOMA 3CZ8A 1RA5A 1HJXA 1VEMA 3VXGA 3TQKA 1EZ2A 4V28A 5A6BA 2Y62A 4GABA 1E5NA 1XF0A 2W63A 3EXSA 3GSMA 2CZDA 3KS5A 3B0UX 4ZR8A 5C9WA 3CH9A 3G1RA 4ROPA 1T7LA 5AB3A 2ZICA 2F6UA 1A5BA 4K38A 5L6UA 3S2MA 3WMSA 3GDTA 1WQ5A 3XIMA 1Z8AA 1P6BA 1SJBA 3B0XA 4JFWA 1YE6A 5ABTA 2WNNA 2H9AB 2O9OA 3KHDA 1WB0A 1PX4A 1P48A 1QASA 2P76A 1MXGA 4AY8A 2GSEA 3MCOA 3UXLA 3GAYA 1BEUA 4AIOA 2MNRA 3NEVA 2TYSA 3OYXA 4KIRA 3VVGA 5D9PA 4DYEA 1LOQA 3MCMA 4KW2A 3DERA 3AHVA 1KM3A 1U30A 1T0OA 3W84A 3H2OA 3VTRA 2WSQA 2E9MA 3UY7A 2FZMA 1J6OA 3PWIA 2QCGA 4WGXA 1MI3A 4C65A 5RUBA 4GJJA 3G1AA 2QDGA 2VNCA 1VHCA 1K9TA 1H09A 2XUCA 4F2TA 4WDWA 3LS9A 2BY3A 2YCKX 5AC7A 5IM51 2YDQA 3WG6A 3WNLA 2ZX6A 4YMZA 3MQTA 3NFUA 5KITA 2FZ9A 3LI0A 3MPGA 4UQ9A 1J0JA 3KE0A 3QOKA 1R3WA 4W7VA 4NL1A 1WOAA 5BWAA 3W3OA 1DPMA 4B3KA 3HGRA 2BMBA 4ZQPA 4AVOA 3TW9A 2PF8A 2VRKA 4H9XA 2YDSA 2VVNA 3TCSA 2C0HA 1Q4NX 3QV7A 4GJIA 4GNVA 3WZ0E 4L4MA 2MUCA 3B04A 4FK9A 3EA3A 1H0GA 4AZHA 1M1BA 1CCWB 2G3FA 3WMBA 1CGYA 1S2TA 2OEKA 4JN7A 3SJNA 5HJXA 1CB2A 2NQ9A 2PB1A 4WQ6A 3G1XA 4XAZA 2VURA 3QKEA 1JI1A 4FX8A 1YNYA 1Q8AA 1YX1A 1OCNA 2PF0A 4O0QA 7A3HA 3WQ5A 3VGEA 2ON3A 1W32A 4E4UA 3QMTA 4FNUA 1B4EA 4U4MA 2XG9A 1QR7A 1CXHA 3QQWA 4Q8VA 3G2GA 3AU6A 3AIBA 1V3IA 1H7OA 2VJXA 3PULA 4YS1A 4XVDA 1I1WA 1JUEA 4O12A 3O6DA 4W93A 3OQEA 2PLJA 4WLCA 1O95A 3WNOA 1BQCA 1XDJA 2RDWA 2G96A 1OC5A 3BPWA 4XV0A 4X60A 4FNQA 4L4PA 5FA5A 1GVEA 4JAWA 2GVGA 1BG9A 1DWFM 1DWHM 3NUKA 3GH4A 3V1PA 3C0QA 2QMKA 3FDGA 3O0FA 2ICSA 3B3DA 2QJJA 2WC7A 1V02A 1RJPA 2UY2A 4Q4QA 2JF7A 3CV2A 3N29A 1L6GA 4GG9A 2FGZA 2VXNA 1L2UA 1BYCA 2VP8A 4QE5A 2D3NA 3MB9A 4E4PA 3GD6A 1SJDA 1KCXA 2ONEA 1R85A 1GPWA 3B8UA 1QHOA 1GVYA 5E9AA 4JTUA 1F8IA 4KERA 1YBQB 4N02A 3B8TA 5FKYA 3B8IA 4HHLA 4AVNA 3LERA 3UWQA 3UYCA 4PL2A 4XTDA 3VM5A 1ITXA 1XLIA 1ZBVA 1UZDA 4LRTA 3A21A 4I7VA 5LIYX 3DH7A 4HN4A 2Z28A 4PSRA 4P7LA 5DEZA 3TOPA 2BVDA 1AQHA 1G94A 4HHPA 1KRCC 1FRBA 5LIUX 2DQXA 1QVBA 4OGZA 2W0UA 3NQ7A 4ZE5A 3FEQA 3CUXA 4TVUA 4I8DA 4AXKA 2XFFA 4B15A 1QOPA 1DJXA 4C6KA 6TIMA 5ABFA 5FACA 3PJWA 2FB3A 3CO4A 3AZRA 4ZOAA 1SSGA 2X1TA 3PK7A 2D2GA 5JBDA 4OBSA 2RJHA 4D6FA 1PZ2A 2IKJA 3HN3A 4K68A 3R2GA 2W6RA 1YRRA 3Q45A 4WCJA 4XX6A 4BFAA 4ERIA 2Z4GA 5K4XA 4ERGA 2QDHA 2HZGA 1P6CA 4RK8A 3VNYA 3S2NA 2ZRVA 3FEMA 2WMFA 2F38A 2ZQ0A 1DE6A 1PUDA 2V67A 3ITTA 2Z25A 1UH4A 2OLAA 4B5UA 4NQ1A 4CNNA 4KEMA 1DEDA 2HK1A 1GWJA 3ZLHA 1YNQA 4UWMA 4AU0A 3PFRA 1QNVA 2QPSA 1FP8A 1QW8A 2WHJA 4AHPA 3M0ZA 5BROA 1FOBA 3O6AA 2EPHA 4UQBA 2ADAA 3V1HA 3PG9A 3G3DA 1Z42A 5CZTA 3JRKA 4AF0B 2V0TA 3OVGA 1KXTA 3Q58A 5D30A 3A3HA 4C6BA 5ABEA 2FZBA 3WJSA 3H4XA 5K2ZA 4DIAA 4DF0A 3JVAA 4MB4A 4PCSA 3EWBX 3CL6A 4GVIA 3ARSA 4GBUA 4RNJA 3HOJA 1R2TA 4O14A 5LIWX 1ADDA 3GHTA 2MANA 1UD3A 4PMRA 3PWAA 2FB2A 3EOSA 3CHEA 4WUIA 3SCOA 1OJXA 1E9IA 1PKNA 1ECEA 1JPDX 3PPGA 1JCLA 1Q6FA 1ZB5A 5CLTA 3WCZA 4ATLA 2YB1A 3WQEA 4HNOA 4MNJA 3GHSA 4PRTA 1CT5A 2OPJA 3HU7A 5MKGB 4PMJA 1PIFA 3BLOA 3ONCA 2JGQA 3VDHA 4JFTA 4GUJA 1REQB 2PDQA 5E0KA 3M7SA 3E3HA 4KH2A 2CXGA 4CVUA 5DMNA 4Y9PA 4KGLA 3VU2A 2BGQA 3IIVA 4ENLA 3B8DA 3TSMA 1UKSA 1JPMA 4JTLA 4LBRA 3YPIA 2J7DA 1NDWA 3SGGA 3TTOA 3VIHA 4OUIA 5A2CA 5FF7A 1E0UA 4DXKA 2P53A 4ONVA 4Y8FA 3GFYA 2AKZA 4AVFA 1KGXA 2RGMA 2CLMA 2OQLA 1R46A 1EC8A 1W17A 4LBUA 1QO2A 2VEMA 3BOFA 2NT1A 3L2LA 4L5ZA 4TV6A 2FTYA 1QCWA 2GLKA 4L6OA 2EO7A 2XINA 4LV9A 1JFHA 4WOQA 2V82A 2VTFA 4DZHA 4KEUA 3RIKA 1JCNA 1D3HA 4G7EA 4AIBA 3VNLA 1HJUA 4N9BA 2XIIA 1XXXA 4YTTA 3CB8A 5I3GA 3OW1A 4YN5A 2AL1A 1HKVA 1OSEA 1H7XA 4YCPA 4Q3MA 3LENA 2Y8UA 3WD3A 1LF1A 1VBRA 2BSLA 1LORA 5EGRA 6XIAA 3I3DA 2BWGA 4X9SA 2FH6A 1BXCA 3NQMA 3W7EA 4AB4A 1JPHA 3BW2A 4PSPA 1GNXA 4EP8C 3SB0A 4HK7A 7TAAA 1JYXA 3WH7A 4UQDA 1J5TA 1HQTA 3M0LA 2EGZA 3A5FA 1ZLPA 3FJ4A 5HMDA 3STCA 2C14A 3C2EA 4UFHA 5LGXA 5CPSA 4N9DA 2J6VA 3W28A 3AS0A 4J9JA 4K6AA 2NVAA 4L6DA 4QS6A 4TX9A 4LVBA 1XIFA 4XAYA 3RILA 4UMBA 3ZQ9A 1GTHA 2REQA 4LAMA 3WQDA 4DAFA 3ZMRA 1UJQA 1TPB1 1QK0A 2C1GA 3QVQA 4GCXA 1VFHA 1ZTVA 3QR3A 4UBPC 1CEOA 2HWGA 3QGAC 5BYWA 4B5VA 1X39A 2V81A 2FTPA 3W73A 4DELA 3CV1A 4XUGA 1IE7C 4PGLA 1OX6A 4RE0A 4K8HA 1G7VA 4Q7IA 5CSUA 2QJNA 4JEJA 1X1NA 3LCXA 2D0HA 4C7GA 3LGDA 1WBJA 5BNKA 3VGHA 1H0IA 4Q6JA 5D8WA 1J11A 3CZKA 3GFXA 3WX7A 1HX0A 5F4SA 2HQAA 1PHQA 4AZ5A 3TV8A 3P2VA 3T09A 1C92A 3O15A 4GINA 5KTLA 4ERAA 4C6PA 5AHNA 2QEZA 1JIBA 5A6MA 1Z3NA 2CWNA 4N4PA 3UBPC 1EP2A 3RU8X 3CZJA 2ANUA 4BCEA 5CJMA 3EOEA 1E6QM 1NEYA 2W62A 5B80A 4KPLA 3RFAA 2PU1A 1FCVA 4KBXA 2VUYA 3VAVA 3WJWA 1EWDA 1AVAA 3PUDA 2YCIX 3WDQA 2WJFA 4Z0JA 3GVVA 1R3SA 1GEQA 3VC5A 3DU0A 4EXBA 3TA9A 2GUYA 3ZYZA 3VNMA 3H70A 1XH0A 3I4EA 2FPTA 2YA1A 3WD0A 1FWHC 1JGMA 1M01A 5SWUA 1XV8A 4TO8A 4K7VA 3R12A 3QMRA 3T44A 4KFPA 2VDHA 2ZX9A 3EDDA 3TROA 4IT1A 3BTNA 4EWJA 1FWNA 4QITA 1JRBA 1G67A 1PTAA 2YLLA 2XDFA 2BHUA 4JL2A 1BRLB 4M29A 1JYVA 1T41A 2XGZA 1A0CA 1UR8A 2I5GA 3OYZA 3VD4A 1RA0A 1X6LA 3GYEA 4UFLA 4ZB2A 2PRLA 3U9IA 4U2ZA 5A95A 3WLSA 6XIMA 4LUTA 4Z08A 1E6NA 3H2FA 1ZBCA 5C5YA 1XC6A 3EWUA 3BSHA 1R3RA 5XIAA 3H7UA 2D3LA 3AIQA 1UP0A 4F2BA 2XFRA 5CPTA 3KTSA 1XLFA 2IS7A 4NILA 2FHCA 4LTSA 3VMOA 4HJWA 5HBFA 2B7QA 3TVAA 1W8SA 3C5QA 5CZJA 3SECA 3GAKA 2XFWA 1JYWA 4J3SA 2PDWA 2NV2A 3S2JA 3PUOA 3VIMA 4DM2A 2DSZA 2EXOA 4S3JA 3G3MA 1G4EA 1ITCA 3Q37A 3M0HA 1NELA 4Q4PA 1UZ4A 1FFQA 1DJIA 1JAEA 3CC1A 4GKLA 5T8GA 3B9EA 2W9MA 2OMAA 5KZ6A 1W31A 1PZ0A 4BWLC 2QPUA 5TNVA 2EHHA 2PWHA 1MQQA 1TTJA 3N9SA 1DIOA 2ZYFA 4LFYA 3WQVA 1MUCA 3BAKA 4I7UA 2PODA 2Y63A 4NF7A 1JNEA 3A4WA 1LRNA 3AYVA 4TU1A 3LK6A 1UKQA 3LTYA 3XINA 1HFBA 1SM9A 2X40A 4DZAA 1NVMA 2ESCA 1T6MA 4NU7A 5A6JA 3RXZA 5HANA 3DC8A 5A1AA 2D73A 3ARVA 3EPOA 5CJ5A 4PUMA 3NQAA 2PS2A 1FHLA 3NQBA 2E5BA 3TKFA 3BJSA 3B8VA 1KM4A 1EYWA 4X0VA 3CM4A 4JN6A 3EMQA 2QAFA 9XIMA 3STPA 3WQFA 2PU0A 3KAOA 3HMCA 2A85A 3CUJA 2F2HA 3V7PA 3WDRA 3RLHA 2WPGA 2F9RA 3WF0A 1XC4A 4ZVJA 2WSKA 3I7SA 3FVDA 2WZIA 2QJIA 3QW4B 2XTKA 4LEQA 4BK9A 1FKWA 3BOLA 2XJ7A 3UETA 1U5HA 1VP5A 3EDEA 1XRTA 4X61A 1KM5A 1GORA 4DUXA 2C19A 3GXDA 1XIMA 1WX0A 4LVDA 1TKKA 3BWWA 4GO8A 3W02A 3M44A 3KL5A 4FOUA 2ODOA 1Q6GA 5T91A 4RNHA 2Q8ZA 1UIPA 1L9WA 4ZSTA 2GJPA 2NX3A 3GW3A 1S5WA 2PDBA 7XIMA 3LHZA 3KHJA 3PAJA 1CNVA 1XICA 3EBVA 2XZ9A 5CC6A 3OZMA 3V5OA 2WJDA 3AXIA 4R27A 4Y9NA 3P67A 4ROQA 4OOUA 5CC5A 2O9TA 1K9DA 4B92A 3I68A 5K9DA 2YL5A 1VQTA 3GTNA 3KLKA 1JUBA 3EWZA 1Q65A 3AROA 1EXBA 2GFTA 1J0KA 1BWVA 1ISXA 4P7QA 4Z2IA 3I3BA 5CLWA 4BI5A 1IWBA 2DP3A 1FXQA 2Y2WA 1CX9A 3ZR6A 4Q8QA 3THQA 3WQGA 2W27A 3ZS4A 3BURA 4IPPA 2DW6A 1EC7A 2NW0A 3ARUA 4ATWA 4QE4A 1F73A 2PTYA 1OD0A 1QPRA 3OZPA 4DRSA 2YZ5A 4DI8A 1PB0A 3L5LA 4LUJA 4E4FA 4ZGYA 2NQJA 1ML1A 1IEIA 1QJWA 4LCRA 4MY1A 4LAKA 1M7PA 3O06A 1F05A 1ZJAA 4HZ8A 3TE9A 1TPUA 1GKQA 1TCMA 2REQB 3EOUA 1QNQA 2D0FA 2E6FA 1YEYA 3N2BA 2E6AA 1XKYA 3KDNA 4DJDA 5D2XA 1OT1A 1XYLA 4DF2A 1K6WA 4UB9A 4R3UA 4XBSA 4PUEA 1Z48A 7TIMA 2V9DA 4GYPA 2VGGA 1QUMA 4I9TA 3EKZA 1X1OA 2GUUA 3NPWA 4HHHA 2NV9A 3U7VA 1XDLA 3NZ1A 3GUWA 2OODA 3GR7A 2DZUA 1UR3M 2X41A 3WQCA 4W8BA 3TMLA 3QYSA 5FF3A 3OLGA 3MVIA 1ADSA 5F2LA 1B3YA 2BHYA 1KFJA 3UXIA 2Y89A 3WFAA 3LEPA 1OYBA 2YR1A 4O28A 1E4IA 4NNCA 2Y5EA 2NXIA 1KTNA 4JQ2A 5H8MA 4MFEA 3QV8A 2BTMA 3M7WA 1C29A 5AFDA 3C2YA 2QCHA 4PODA 4IFRA 3BH4A 4KFNA 5KZDA 4LY4A 5DXXA 1Q7MA 3TYZA 4Z1AA 5CSYA 3TSBA 2VMFA 1K03A 6ALDA 2WMGA 3EWWA 3KM8A 1UMLA 4GC4A 4J35A 4YLWA 3ARQA 1A5OC 4IGMA 4PCTA 3M0XA 5IBXC 3ZVIA 2HS8A 5K7JA 4Q8WA 4DJEC 1SW0A 2EEXA 3VDAA 2DH3A 1MQRA 4N9CA 2ZTJA 6A3HA 3NO3A 4OIFA 1YTDA 4HU3A 1KLZA 5F7UA 5DBTA 1W1IE 2NWSA 3GTIA 4P7RA 3WNNA 1JZ5A 4HYVA 4JQ4A 3E2QA 1DJHA 1GOXA 5DRIA 1HVQA 2OVLA 2F2KA 4F0SA 4EACA 1S5TA 2XN0A 2F61A 4AQLA 5FF0A 3KCJA 2DY3A 3IK2A 4JIHA 4Q8TA 2JIWA 1LROA 3QGVA 1OFRA 1HKIA 3VDBA 5C0QA 3VUPA 1XD1A 1UQYA 2GGGA 3T40A 3E5PA 3FDKA 3MWAA 3KCOA 2WVUA 1EIXA 3H53A 4HHMA 2J79A 4HMDA 4FLOA 4MLRA 4DPPA 2YW4A 1M7JA 4JNMA 3LSBA 1G4TA 4KGJA 1OHLA 3CB3A 4DWSC 4MY9A 1A5NC 4W85A 1UPMB 3IIZA 1FHDA 4IMCA 5HMEA 1JEZA 4DUOA 2TPSA 1XH2A 8TIMA 1B5TA 3M1ZA 5TF0A 5DQPA 3SEPA 2WWDA 5A6AA 3CMJA 1XCFA 1UUOA 2DT2A 3GHRA 3W26A 3ZOAA 2AL2A 2D2HA 2I5QA 2CZVA 2J78A 2VC7A 2QVNA 3QQ0A 4ZTXA 3MMWA 3CEUA 5H91A 4AEFA 4F9DA 2XIBA 4YWSA 3G24A 3BG9A 3QYQA 4L1GA 3WLHA 3VIIA 3VOGA 4G9PA 4PUKA 1GOKA 5C54A 1QU4A 4O1EA 3T42A 1G6CA 5I3HA 4AHQA 1EYEA 4D71A 1MO0A 4H1ZA 2X1SA 4D6GA 4K1WA 3L65A 4IG2B 3S46A 2JEPA 3PHAA 2NUWA 2IQ0A 4YVVA 2EKGA 3QPEA 2ZUSA 4A3YA 1UKTA 1QPKA 3LRKA 3D6NA 3AICA 3UY8A 2WSYA 1JULA 1NARA 1ISYA 3BLFA 3VGGA 1O12A 3E2VA 1GUVA 4PMOA 1FX6A 1FWCC 5FJIA 1AW2A 2OGJA 3TJ4A 1J0IA 5I09A 3M5YA 3TA6A 5M1TA 4Q7NA 1JD9A 4F66A 3PR2A 1WAWA 1A4LA 3R8RA 4YWIA 3CNYA 1TJ1A 1E51A 3GIPA 3DG6A 1X7IA 3VILA 3VO0A 3AIVA 3BV7A 1TTPA 5CH9A 3ZO9A 2CLOA 4BF7A 2QCNA 4IIEA 3DHPA 4OWGA 3TFXA 4HNUA 4JCLA 4AEEA 5KMYA 4L9XA 3RGTA 4J3ZA 4P7OA 3S1VA 3LOTA 3SUSA 3N25A 4LQ1A 3MSGA 3OVQA 2J74A 3ATZA 3AXMA 3C8FA 3MU7A 4Z1DA 2X16A 1ZY9A 4WZHA 3VD9A 1FWJC 3PSVA 4AD2A 1NOFA 2P50A 3BANA 2WPBA 1EJWC 1PWMA 1HT6A 3VOCA 4TX6A 1HL9A 5DANA 1HUVA 1WNOA 1AH4A 1RCQA 3LD5A 4IP4A 4IWWA 4OTKA 3RPDA 3ES7A 4JTRA 1YXDA 2ISSA 5A8MA 1I60A 1DHPA 2PBGA 2FDSA 1RPXA 3O9NA 4XAFA 1EGZA 3B06A 4JTSA 3W1UA 4PMUA 2VCBA 4L80A 2O9RA 5REQB 5FOOA 4QJ4B 2BOFX 5DFAA 2VC9A 1Y65A 1K9FA 3VKJA 1JQVA 2OTDA 9CGTA 3MI6A 3ABXA 3WEZA 4H8NA 3HO8A 3M0MA 3NXLA 1OFBA 1AJZA 4GISA 2HDJA 3FXYA 3O7UA 3DFOA 2Z00A 1UMYA 1VZWA 3WELA 2CYGA 4MWAC 8CGTA 1U22A 4MB3A 1KO0A 2WQPA 3MBFA 4AZGA 2NVCA 1HIZA 2DSWA 3N34A 1F6PA 4WDTA 2BY0A 2CFFA 2X05A 5C9ZA 3S1UA 5AYZA 4PBEA 1DIEA 2XIMA 4IL2A 4WOZA 1UROA 1ZL1A 1SZGA 2GYIA 2ZFAA 1WAUA 2XVLA 4IZGA 3QV9A 4HOZA 4QGCA 2G50A 4B5XA 1M04A 1XLGA 1VAHA 5HULA 3II1A 4HCHA 3K30A 1KR1A 1JZ6A 4DHGA 4ZCWA 3EEGA 3L66A 1ZQ5A 4YHEA 5ABGA 4CQAA 2W92A 2RKXA 3K5XA 5I7GA 4CN6A 5JVLA 2DT1A 2HJPA 1XIIA 1W3NA 1DJZA 2QGHA 5M3WA 3CEPA 1X1ZA 2V3DA 3EKGA 3UG4A 3ANVA 3SCVA 4GZIA 5E5CA 2YDAA 4DWSD 4PN2A 2ALRA 2ACRA 3VOFA 2O7SA 3W1MA 4ALDA 4JEQA 2ZBTA 2Z26A 2J66A 4HZ6A 1RJRA 1VBHA 4IQLA 1RH9A 4WKAA 5A3HA 5C71A 3WJXA 3ZWSA 3Q4DA 5L9FA 3BZGA 3AOFA 1N2VA 3LMYA 3ZVHA 3D0CA 3WKZA 4MDOA 1TVPA 3CTLA 4AG0A 1W8GA 3TLLA 2KZHA 1VPQA 3KTCA 4GI4A 3W6MA 5AC8A 2PTWA 4R7WA 3FA3A 4AWTA 3TAOA 4XWUA 4ZTYA 1XBVA 1V0MA 3F4DA 2XH2A 3ZJKA 3VUSA 2INZA 4KCVA 4H7ZA 2D1ZA 2I57A 3W88A 1RV8A 3S6TA 4AXNA 5HXMA 4IIFA 3OODA 3TC7A 1DXFA 1TG7A 1NDYA 3K4DA 4NZ5A 3B0VC 2BX7A 1EGVA 1QNPA 3AXKA 1VJZA 3KOWA 3LGGA 3AS3A 3CASA 3LQGA 5LIKX 2V8ZA 1FWGC 2NLYA 3CAQA 3KLLA 2QQ6A 4E2BA 1XP3A 3PWGA 3WY1A 1SGJA 4OKDA 3JUGA 4WJEA 3RK8A 1H49A 4QG6A 1KBIA 2TODA 3FJLA 2XIJA 3NTYA 4TMBA 2QDEA 4L61A 4Z1YA 1KFWA 3CHDA 1ME9A 3TJLA 4CU6A 5JIPA 1X98A 1F3TA 4JPGA 3TUUA 2YCLA 4EPEC 3SY5A 3TYDA 4OOZA 5CJNA 2PWEA 1TR9A 3W1NA 4E8CA 2O56A 2H8XA 3UW6A 3N18A 2F84A 5BMWA 2JEQA 1UUQA 1UD5A 1QOXA 1QFEA 4CNTA 3GX9A 3W2KA 1DV7A 1SZRA 4CUCA 1A5UA 3PBYA 2NQZA 3SIZA 3PZGA 3QFWA 1HKKA 1TCDA 4GJ1A 1OCJA 3R89A 3VKDA 4OBTA 1UD2A 3ITVA 3C86A 4PR4A 1VENA 5HQLA 1ZCCA 1KFLA 3I6TA 4UQAA 3GY1A 2GJXB 3IANA 2C79A 1XIEA 2FJUB 5LXXA 4ICCX 2GQ3A 3I6EA 3S3GA 3GUGA 3BARA 3MYOA 1OM0A 1TJ2A 3U5UA 4D6DA 1OC6A 1JAKA 2AL2B 3XISA 3GYCA 3RCNA 3QY7A 1HKJA 3M47A 1VHNA 1ONEA 1E3ZA 1H7WA 3K4AA 4LAUA 1XLKA 1S2AA 4JXCA 3SCSA 4Z2JA 1GQLA 1JUKA 4XBKA 2OCZA 1RZMA 3W7GA 1GW9A 4IMDA 4UCFA 1VGAA 3AAMA 1UZ1A 3GC4A 3IRSA 4KRTA 4MKSA 4LH8A 1XYFA 3VNJA 4UR8A 4OECA 4DB7A 3MI2A 4HSHA 5G4EA 2VI0A 4RW3A 3SCQA 4Q33A 3WLTA 1DORA 1PL9A 1OG0A 1VB9A 1MEWA 4J5NA 1PJ9A 5JUVA 4JHZA 1EWEA 2E68A 3F03K 2PDKA 2F7FA 5CZSA 2J8TA 3L0NA 3WLLA 5DXYA 2Y85A 1LL7A 1MVYA 3H23A 3NGFA 2E9LA 2GGEA 1J2BA 3NA8A 1TREA 1DYSA 1PZ1A 3PPHA 4RDVA 1XFCA 2XSBA 2PDUA 3VE7A 4NZJA 4Y7EA 4R33A 4DBEA 3EX6A 4AMCA 5BWFA 1KQYA 4NX0A 3OVPA 2WHMA 1E71M 5E6ZA 4BI6A 2NSXA 2QUTA 3TN5A 4XD5A 4AC7C 1M41A 1TVNA 3ARRA 4C90A 3WNMA 3U7BA 4MSSA 1Z7AA 3A4JA 1SFLA 3U48A 1J0HA 4CEUC 1QBBA 1XH1A 1ICSA 3G1FA 4A6GA 4IGNA 3NOEA 4GXMA 3CLMA 3QRHA 2BGSA 5HMSA 4KS0A 3W70A 4ZQRA 5EU9A 1GQJA 3GB6A 1BG4A 2ZWYA 3G0SA 4D8LA 5JBFA 2NX9A 3DGRA 5D9OA 2RH9A 4ZA0A 3FYPA 4Z42C 4IQEA 4EXQA 2CESA 2XGIA 1IV8A 4OHQA 4E38A 1FCUA 1Z89A 4GQ0A 1EO7A 1GOMA 1H62A 4I9AA 4C6MA 2YSWA 4WRHA 1TZ7A 2ZUMA 1LQAA 4XB3A 3NZGA 3EKLA 5J8LA 1YDNA 2EJAA 4KFOA 1PIGA 2CLPA 4UFMA 2R1MA 3W0KA 4W8LA 3Q65A 2XYLA 2X1RA 1E5JA 3QZEA 3KRBA 2OT0A 2F8QA 1IZJA 1QRQA 2RDTA 3HIJA 1PO9A 1KB3A 2AQOA 4LWWA 3P74A 4JYEA 1XKJA 3S2LA 1MW3A 1RXOB 3GTXA 3F4CA 1MRQA 3R5EA 4DJFD 2H9AA 3UCQA 1US3A 3MWCA 4H6KA 3LN3A 3B9OA 3NPXA 4MWAD 5T26A 3ZM8A 1LLZA 2YBVA 4R7OA 3V3WA 1UWUA 4RDYA 4JQ3A 2Y4SA 3IV8A 2NXGA 3W38A 3UNTA 4YU1A 3JZEA 4LVGA 4QCEA 3CGTA 2GUBA 3V0TA 3VGBA 1XD0A 5AECA 3WJYA 2OOFA 1V3MA 4FLRA 4M5PA 4IX2A 3VFLA 3LCWA 1I2RA 1J8VA 2G4JA 4MB1A 4R88A 1MEIA 1BPLB 2J7GA 1L2QA 1QAPA 3B0PA 5AHLA 2GVEA 1R3YA 1V93A 2O4QA 3DXIA 3DKLA 4KEZA 3WEOA 3QR0A 5HWNA 3TZFA 3KOZA 4AZBA 1EA0A 3EAUA 4LBSA 1J5SA 1XLCA 5I3IA 1SQ7A 2I56A 1OFEA 3P5YA 8RUCA 3CAKA 1GVOA 2JKPA 3SM0A 1KCKA 3CQHA 4BEQA 2Z1BA 4X9YA 2C7FA 5HUPA 3IJ8A 3W6LA 4E8GA 3LPPA 2DZVA 2PZ0A 3KVJA 5I2UA 2GWGA 3SSJA 1A5SA 1OIFA 2BS9A 1TJRA 1UA7A 3TR2A 3LBOA 3NQCA 4DO4A 3Q94A 3WQOA 1MXDA 4BWLA 1R38A 1XBZA 1NJJA 3WFLA 1I1XA 2QJGA 3LU2A 1V0NA 2CW6A 3WBEA 1DWAM 4F2UA 5F1VA 3WH9A 1C7SA 4ES4A 3W7KA 2VD8A 3MVTA 1H7RA 2A7PA 3TC6A 1I75A 1UR1A 1F4HA 4NIRA 3LHUA 5EKYA 2VEFA 1IIHA 1F4AA 2CETA 1R30A 1BHGA 1BAGA 5DCBA 5G4HC 3RF9A 5I3JA 5LNRA 1CXFA 1GKPA 2QJMA 1VYPX 1Q3NA 4ZOCA 1F6YA 1DJGA 1FY6A 5U7SA 4PUDA 3R8GA 2WHKA 1JDFA 1BXNA 2Z29A 3NL3A 4CNUA 2PLKA 2PD9A 1SO6A 3IGSA 2O4MA 4ZSUA 4W84A 1HW6A 2V63A 1P0KA 2Z27A 4NY2A 2C0AA 2DIEA 4GO9A 4QHRA 3C0JA 1K02A 4J7RA 1IXOA 3G1HA 3UYIA 2GVLA 3S9ZA 4L9YA 2PLCA 3FGCB 3V18A 1UR0A 3ITOA 2HNEA 1RCOB 4Q8UA 1GZ1A 4M6QA 1WCGA 4GI6A 4NAFA 3DYOA 4GQQA 1MXSA 5BRQA 7CGTA 4MPKA 3C2VA 5AYBA 3OLEA 3VYLA 1FH8A 4QCFA 2X0YA 5E0CA 3M5XA 1QHZA 1OINA 1F07A 5M5DA 3UZXA 2V2DA 2Z2BA 1W9PA 1YDVA 4S3FA 1VPXA 2NSOA 3M5ZA 2Y7FA 2YCLB 4JHMA 4GY1A 4GBDA 4Z2HA 2VGBA 3DOPA 3AC0A 4PMNA 4FAMA 5BZAA 1TRIA 3AMLA 2QT3A 3WMCA 4ACYA 1LG1A 4X2RA 3W6YA 1RUSA 4JTEA 4E0CA 1K4GA 1H1ZA 3GVQA 3P61A 3IARA 3TMQA 4C6DA 1EO5A 1ZPTA 1BWLA 3MUIA 3W7DA 4I6KA 1X96A 4C1KA 3ZWTA 5D9MA 1W1YA 3UZ5A 3RCYA 1BLIA 3TW7A 1CLKA 1EDGA 2ZA2A 5CC3A 5GJPA 2VFIA 4IM4A 1XSIA 1NF0A 1V0LA 4IPNB 3A4XA 3QY6A 2V38A 4CD6A 4NSBA 4ZODA 3P14A 4JYDA 2PGEA 4F0RA 1SMDA 4DZ5A 1J0ZA 1OK6A 3W1LA 3BLDA 1R3TA 3NR0A 3UZJA 1YPFA 3G1VA 3IVUA 1XI3A 5LNSA 5H2ZA 3L4ZA 4QNWA 1VS1A 4N9EA 4B5TA 1XHGA 4WR3A 3DN5A 1YIXA 4H19A 1LYXA 4FIRA 2XVNA 1EUNA 3O6YX 3RAOA 5BU9A 4QP0A 3N15A 2VFGA 1S2WA 1E4NA 3S5OA 3WQ8A 4GIEA 5A5WA 2XISA 2YKKA 4RDZA 3FLUA 2BG5A 3STEA 3GVGA 3FA4A 3DBPA 3UXKA 2CLIA 3E0FA 4J28A 4C6NA 3K46A 4A4AA 4W7WA 4LUSB 4C6IA 1ISZA 1XBYA 3M0YA 1W9VA 5BRBA 1UHVA 3K8LA 2NZLA 3AIUA 4GYPC 2PURA 3GQYA 4GACA 4AZ6A 3AYSA 4NUWA 2GL5A 5BXSA 1BVNP 4GNJA 3PZVA 3HFTA 3ENLA 2HE8A 4BZYA 1B2YA 2NLIA 5CPOA 3KUMA 3CWOX 4YYCA 5I06A 2PCEA 4LU0A 3LBMA 4PCFA 3BMWA 1T96A 2C1HA 4CD4A 2AQVA 3QPYA 1PZ3A 2HPIA 3HV9A 1TFVA 1R6WA 1UWSA 2GJRA 4FF5A 4C6OA 3V0SA 3R25A 4NYYA 2GPTA 3BICA 4O18A 4HU8A 3BL3A 1ZAHA 1CGUA 3I6RA 2VWSA 3FIGA 3UJRA 3UG3A 1VR6A 4LSBA 2PP3A 3SUTA 3LPFA 1A3WA 4I3GA 1F6KA 1KNWA 4A3QA 5AY7A 1XUZA 3POCA 2CWXA 3DFYA 1DTNA 2CLLA 4F0HA 1XCWA 4WIWA 4EF8A 4ZB5A 3SY8A 2YX0A 2EAWA 4AC1X 5D03A 3UJSA 3QZ6A 1XLHA 4QRNA 4IICA 1FWFC 3N6JA 3HG5A 5LA0A 1XIHA 3TP4A 2DZXA 2B31A 4ICNA 1JDAA 3NJ3A 3O6CA 2XVPA 5CC7A 3BOXA 3SADA 3MS8A 5AVHA 4ZQOA 1RY8A 3CV6A 3AS2A 1NDVA 4JX6A 3E02A 1A47A 4ZB0A 4PB4A 3RUBL 4YVXA 3I3EA 3LPGA 4Z0SA 5C2GA 1C7TA 1UPPA 4JIRA 3DFHA 4AW7A 3PUEA 3IJQA 2PRHA 4IOTA 3HURA 4A8NA 1X38A 1TELA 4KRUA 2E5CA 2D69A 1W5QA 2DIJA 4N42A 4D72A 1W3HA 1GHRA 1LOSA 4FS9A 5CG7A 5AN7A 4IIDA 3RLVA 1XIGA 5CPLA 4KRZA 3U2ZA 2GWNA 4IQJA 3GXIA 4KKXA 2OJPA 3UWUA 3AJ7A 4MDPA 3GG0A 3AU2A 1W37A 1KRMA 1DQWA 1OIMA 1E6RA 4JY8A 1D3CA 3RR1A 4WSJA 3U4FA 4Q4KA 1ZS2A 3GH5A 3CQ0A 1R9ZA 2ZX5A 4RZBA 3VFCA 3AO0A 1FH7A 1EL3A 2XSAA 3FOKA 1QO5A 3UG8A 4UOJA 4ZBCA 1TR1A 4O19A 3R0KA 1LRTA 2OG9A 1I2OA 5HR6A 3ERPA 2FGBA 3MP3A 1GYNA 1ONRA 3F7JA 3QJAA 3W37A 2I7GA 4L9ZA 3L0GA 3KL0A 4W4QA 2DJLA 4NT0A 2ISWA 2QJHA 1BTMA 1P7TB 2V3GA 2V5BA 1ZBWA 3UCCA 3S1WA 5AHEA 4C6FA 1C90A 2QYGA 1E6XM 1WV2A 2NV1A 2PWGA 1AG1O 1XYZA 3T4CA 2EPOA 1KV8A 3GZ3A 1J01A 1MYRA 3B9AA 3R94A 1GQIA 1US2A 1HN1A 1TPDA 3LQLA 1RQHA 5ECVA 3PZOA 3H7VA 4ADUA 4XBJA 3EB4A 3F2CA 1K9EA 2E5DA 3H8AA 4O10A 1E1FA 5C7HA 3MUCA 1JVNA 3NYZA 4Q4OA 2WZEA 1BXBA 1B90A 3KBSA 1IF2A 2A7RA 2WM0A 1O5RA 3OGSA 1D7FA 4S3CA 4QQ3A 4O8AA 3SCPA 3FK4A 3GKAA 4NI8A 1K8XA 2TRSA 1U33A 1V3JA 1NWRA 1QI3A 4LXFA 3UGVA 3SO7A 3TLQA 3GDKA 3IUIA 4A8LA 1GEHA 3QQ1A 1OC7A 5FAGA 3CYVA 4E2VA 4MFDA 3K1GA 1RBAA 1R7OA 5CSSA 4I5UA 2EPMX 2QCMA 2WNQA 2DW7A 3AALA 3OOQA 4MWAB 2EPKX 3OP2A 1EXPA 1P0EA 1AD1A 1PE1A 2P0OA 1RVGA 5AC4A 5DCEA 1RK6A 1KBLA 5CGQA 1TO3A 4JIIX 4J3WA 3VOHA 1NF7A 2VFDA 3QHMA 4UMCA 3WL0A 3WBAA 1S39A 3MYPA 4FLSA 1WUEA 2V5LA 1IQ8A 3Q67A 2WC3A 2A3EA 2PPGA 5D33A 1B3OA 1EJRC 3WNKA 2DUAA 5BCAA 4Y8EA 4JX5A 3UZWA 4UIOA 4IXXA 4IH3A 4KWVA 1HKWA 3HV8A 4UQEA 3BG5A 4FX6M 3TNOA 4C1LA 1VIWA 3M0IA 3THAA 2G0WA 3E2RA 3HFYA 4ORMA 4H9YA 1VPYA 3LHTA 1KM0A 3SN0A 1C9DA 2WM1A 1AZ2A 2OOGA 1QPOA 4S3AA 2PTDA 2PGRA 1H4PA 4HMCA 5KZMA 3C61A 1J12A 5LXEA 1XYBA 4XO7A 3ORWA 4GI9A 3W81A 3C3UA 1C91A 3PUGA 3AI0A 1JGIA 1PS9A 3NO1A 5C9UA 2JF6A 3IS4A 4PEEA 1F7BA 3R58A 1K7FA 1J96A 3J7HA 5D02A 4HNNA 2FZDA 4OFCA 3NVDA 2Q02A 2QR6A 5I03A 5FJTA 1VJIA 2H3DA 3MKCA 2A21A 1GYMA 3FS2A 1PWLA 3WBWA 2CLFA 1CIUA 4MNMA 3MCNA 3RU6A 1R0MA 3AXXA 4IISA 3RNDA 2BY1A 2EG6A 3OGRA 1OYAA 5T9CE 5C70A 1HJWA 3FSTA 3W22A 3C2FA 1UG6A 1FWWA 5F2GA 3FJNA 3VC6A 4M51A 3CYJA 2XSXA 3MHFA 1I8JA 4DJDC 3F1QA 3O8AA 3DENA 1ZJHA 1PX8A 1S5MA 4PFMA 3O63A 2A3AA 3SURA 1XGDA 2D2JA 3W2LA 4Y2WA 1XS2A 3NSMA 5JH1A 1E56A 1UW9A 4ADTA 1WKDA 3VDGA 4HNVA 5C2XA 3LBCA 1WDRA 4RV8A 4MIMA 3CAVA 4N4QA 1Q4WA 2G3IA 7ENLA 2HE5A 2ACUA 3SRHA 1F5ZA 4JGDA 1QI2A 1J9YA 2Z6IA 4D6HA 1OFQA 2H90A 4GQRA 1ZGDA 3V36A 4HOWA 5BMXA 1O5KA 2EBNA 6REQA 3FVMA 3QHOA 5T9BG 4DJEA 4Z2GA 2JE8A 3VM7A 1H5VA 2YOCA 5FEXA 3W7MA 3VNIA 3V16A 1EIBA 1K7XA 5K9XA 4Z2KA 3GG7A 2QXWA 4G1KA 4XO6A 3H4WA 2PSNA 4V1XA 3BCDA 2BLEA 1YPXA 2AOSA 2NWRA 3EB2A 3GTHA 4FX7A 4DEFA 2Z2AA 3P7YA 1R47A 4UMAA 3HTWA 3S83A 3R11A 1X97A 4DZIA 3KEHA 3O1NA 3EA1A 4S1FA 3MZNA 1K8YA 5G2HA 1IGWA 3OU8A 4LUSA 3PJUA 1V6TA 4DBWA 1YQ2A 5IRPA 1V79A 2PDIA 3MI3A 3N12A 4RE3A 3LDVA 4ECLA 4H9VA 4O52A 2DJXA 2G3NA 1MFUA 2G5WA 4GFIA 1IWAA 2INFA 2PZNA 2PWFA 3GU2A 3QR1A 1AFSA 3CMFA 1N82A 1NQKA 3VNDA 4GX8A 4MF4A 3B4UA 1FWAC 4K36A 2HXUA 5LNVA 1M53A 2W61A 2GDQA 3QSRA 3UWWA 2OX4A 1R86A 1TWWA 3M46A 3T07A 3SRFA 3ITGA 3O2LA 1M03A 4MLJA 2CBJA 2OEJA 1G4SA 4S3KA 4BF9A 1A50A 4LF1A 1EGMA 2RAGA 1HL2A 2ZXDA 3PS7A 1POKA 3T0TA 3BLLA 2XZ7A 3UZZA 1JJKA 2CEQA 4L65A 1Y8BA 4QSHA 4EE9A 3A23A 2QCCA 4RL3A 1TPFA 1WKEA 3UEQA 4MKVA 3N11A 4IIHA 4H7VA 3HGOA 4CCZA 4DVOA 1WKYA 4ZQCA 2QF8A 4NHVA 4AD5A 3T8LA 2EPNA 2B7PA 1NWUA 2ZWZA 5DO8A 4HYWA 3A47A 3L7RA 1IEQA 2VOMA 9RUBA 4DXVA 4PE8A 1VFUA 1MZHA 4UTWA 3TR9A 3I10A 4NG3A 3U57A 1OFDA 4A35A 2PP1A 1RP8A 5MF5A 1Y7VA 4HIBA 2PGWA 2HCVA 4JY9A 3W1TA 2A3LA 3AUJA 3GRIA 3CHFA 3AIRA 3H54A 4RNFA 3NAVA 2VC5A 2A4AA 4PZVA 4A22A 3ELFA 4M80A 2I9UA 5CAHA 1UH3A 4UZUA 2ZUNA 3EWXA 2B0MA 2J8GA 4HPJA 4CQDA 1KXQA 3BXWA 3NSNA 4PUWA 4O0ZA 5AYXA 4MM1A 3GKFA 3HM7A 4LS2A 2R6OA 4B5SA 4PA8A 2JGYA 2DORA 3REQA 3R0DA 1QWGA 3UCDA 2VENA 5HINA 4FLQA 1IXNA 3W7OA 2QUNA 2HEJA 3ANUA 5KETA 3VKAA 4XQ6A 4Q4MA 3VOJA 4Y9OA 1E4MM 4YTQA 3TN3A 3WFZA 4UTUA 4C5YA 1H50A 4EPKA 3SQSA 2C13A 3P93A 4Q32A 1PVNA 1SUXA 6TAAA 2ZZ4A 3R8HA 2JFEX 1AH3A 1ODZA 4GUGA 4OVXA 1KA9F 1KBKA 4FNSA 3RR4A 2CLKA 3VD7A 2WLYA 4L6HA 4FEZA 1YHTA 4DJFC 3CQKA 3NZPA 1BF6A 3NL6A 5HATA 2YL9A 3BGGA 4Q8NA 4UQCA 2E67A 2VVSA 3L12A 3QOMA 1U5JA 5FCZA 1E70M 2BV9A 4WF7A 3ABOA 2IPFA 1ZBKA 3ARZA 4GD0A 4FXRA 4LX4A 3B4YA 4WY0A 3RM9A 4RDWA 4CKQA 3F2DA 3ARWA 3URQA 3TN6A 5FESA 3WQ6A 3K2GA 3QC0A 2H6RA 4Z2LA 1YW1A 3CHVA 1XIBA 1M7XA 1JZ7A 2KX9A 4UNIA 1Q6EA 1D7KA 4YJ5A 3M64A 3B8WA 4LYQA 3WSUA 1XBXA 4M81A 2O7QA 4B3ZA 1UOKA 5HQEA 3UA3A 4F3HA 3ABRA 1AK5A 1BYBA 3ARTA 2A1YA 3AWNA 3UD6A 3QW3A 4V15A 1M5WA 4DAIA 1QK2A 2GOUA 1JDEA 2HBXA 4DLMA 1E9LA 1NTHA 3ZR5A 7REQA 1LQ0A 4J3XA 3QLLA 5BXPA 1O5QA 2OKOA 3SCTA 4CCCA 3FW6A 2HSAA 2NT0A 5AOUA 3E0IA 4AX6A 4CCDA 1NU5A 3WMLA 3GU1A 4GHRA 5GVJA 4V2XA 1GQNA 3CUFA 4PFHA 1I2QA 3CTTA 3PAOA 1OFPA 1SR0A 1T8QA 3WK0A 4JICA 1V03A 3UJ2A 3EX2A 4MUPA 1K77A 3BGAA 3WLQA 2WAGA 2ZTKA 3EWDA 4H6RA 3UWYA 4DUVA 3NZQA 1UD8A 4JKMA 1RCXB 4G6CA 2PFHA 1EPXA 2DUZA 3CZEA 3TQVA 3DI0A 1W3TA 3SN1A 5I00A 3N2TA 5EYWA 4Q8OA 2I17A 1MNSA 3GNNA 1GG0A 2CHRA 1GOOA 3MSYA 3DDMA 1K4HA 4QFUA 1FUYA 2PI6A 2R1NA 3SGUA 4TOQA 1UWAA 1Q6DA 3BAIA 3TDFA 2Y8KA 3DCPA 2ZUVA 1F74A 4JTQA 3THDA 1E4LA 3G0UA 1A5LC 3T0DA 4N2YA 1CXEA 4E3VA 2DGAA 3PN8A 1G1YA 2ZZ5A 4K7YA 2FMOA 1C8YA 2BVTA 1EF3A 2CKRA 2A3HA 1D8CA 5D4YA 5CEWA 4WKFA 1LM1A 4EK7A 2GGHA 3SQLA 5G1MA 2NUYA 3S0CA 1RAKA 2Z0IA 4B16A 1TPWA 1XG4A 1X6NA 1OFAA 1CW2A 4LYKA 2VX7A 3H2CA 3MP5A 2Q01A 1LUCB 2XWEA 1WZMA 1GTEA 4CVWA 3RX2A 2ZZ3A 3UGRA 4TQTA 2BBFA 3PBVA 1VIZA 3EX1A 5FJJA 1UWQA 4DBSA 3BMXA 3SCWA 4AZCB 3AYRA 2PDMA 3RO8A 4TUFA 4NZ4A 4PCNA 2WW5A 3IAQA 3OLIA 4GVFA 3KCLA 5GQBA 3W71A 1XYAA 1TV8A 1CDGA 5FF2A 1FBAA 1W5PA 3P60A 2Q6ZA 4QR6A 1GHSA 5D38A 3WDHA 2HVNA 4M82A 1GOIA 1RHCA 1MDRA 4US5A 2QCFA 3F5LA 5H8PA 3E2SA 3L4UA 4WDUA 3BAJA 1R9YA 4XKYA 1V7YA 4Z1CA 1LTDA 4MJZA 2YIHA 3NGJA 3WLOA 4IUOA 1Z69A 2P88A 3TJIA 3BAWA 3UWEA 5A6KA 4I90A 4F40A 1XIJA 2OWWA 1RP9A 5I3DA 1R3VA 3R0UA 3LZ5A 5JH2A 2GQAA 2XIOA 4S38A 2POTA 4EKJA 4MUZA 1XWYA 3VX0A 2V5KA 4F8XA 1BKSA 4CN1A 1HKMA 1TX2A 3MV11 1E6ZA 3WLRA 1KFKA 4H2CA 4H9UA 5HA7A 2E7FA 4O17A 3GU9A 1TWIA 5EMMA 3MO7A 1AUSL 2Z2UA 3TSDA 1C93A 1FWIC 4EAMA 4QBXA 1CENA 2QCEA 3NVTA 3E49A 2DPEA 3C3NA 4PL1A 3ZT5A 1C8VA 4KWOA 2WCSA 4R34A 4INFA 4KMQA 5EY5A 1TWZA 4ATDA 3H2AA 1ZNNA 3QBUA 4FR6A 3TYUA 2DVTA 5AYYA 3G6MA 4HJFA 4JDYA 4JTGA 2PBOA 3DG7A 6PTDA 3OQ8A 4FNPA 2JQXA 3H12A 5D8ZA 4YTRA 4RR4A 3I4KA 4HD5A 3QV6A 3NQ2A 4G7EB 2WK2A 1UC5A 1ZHAA 4AZIA 3ARPA 3NQ6A 4B5NA 1SFSA 1PEZA 2P5NA 3UPWA 1OZQA 1V3HA 3RX4A 4CLMA 4HTBA 2ISFA 5I78A 3MUZ1 2XIQA 1MFVA 3SQMA 2HV5A 1GJUA 2DSUA 1SU5A 4OE7A 2VCCA 2WMJA 3QPZA 2R91A 2ALDA 4A8RA 3PZIA 4JTKA 1NY1A 1W9BM 2HBVA 1IEWA 2V69A 2VDIA 3AZTA 4X3ZA 4PMVA 2XHYA 3PZUA 2OKTA 3ZVHB 5FIPA 3QY8A 3N9KA 2PDCA 2EF9A 3W7CA 3ZJ8A 1E43A 1F9CA 4QG8A 5PTDA 4H9MA 5AVNA 1PSCA 4NJHA 2OSWA 5KEZA 3FHQA 1AL8A 2IPGA 3WO8A 3QKZA 3ZSTA 2P0IA 3LM7A 4GXPA 1W1ZA 3LMZA 2ACQA 3GBEA 5HPOA 3GS6A 3BAXA 5DY3A 3BLPX 5E0FA 4WY0B 4D6CA 2PTZA 4R9XA 2Q8LA 3CU2A 3K8MA 2OZ0A 2J62A 2HRWA 4BA0A 2OWCA 5HNNA 3FGCA 3KOXA 4PTMA 1PHWA 1UC4A 2FVMA 1F8MA 3U2CA 1EFZA 5GJMA 1AZ1A 4J3VA 4YL2A 4ZQMA 1NQ6A 2A0NA 2O92A 6ENLA 1B9ZA 3ID7A 3WD4A 4MJ4A 1H1YA 3NQDA 2FVKA 4I5XA 1QHPA 3BW3A 2X0SA 2DT0A 3IVTA 1IZKA 3GR8A 1A5CA 3MBDA 3MJMA 5AYIA 3W83A 2VR4A 4X22A 3NNTA 1IT7A 2CZEA 1RBOB 4XSLA 3W7JA 4QEHA 3IK4A 3WUFA 4K39A 3PTMA 4MJMA 5EMLA 2VZTA 4W7UA 2E0PA 1R8LA 1XSJA 4EPDC 3ZJ6A 2YLAA 4EX4A 3EA2A 5A6BD 2WO5A 1JZ2A 2ZA3A 1TZ9A 1Q85A 1NSJA 4UTFA 4QTGA 2VFHA 3SDOA 2VR2A 1E1CB 2P8BA 3IGXA 3MMDA 1QXLA 3WNPA 1PYFA 2WVTA 2P3ZA 4XZHA 5LA2A 4XVEA 5I5RA 3RITA 1LG2A 3UR2A 5BOFA 1J4EA 3WF3A 1RD6A 1FA2A 3V5CA 3ZFHA 2BB0A 2A3BA 2Y7EA 3PANA 2DSKA 1W1B1 2BXVA 5AZ1A 4UR7A 4JTFA 4OJYA 3FJ6A 4ICMA 1KTCA 3RRAA 1FP9A 3USBA 3LLDA 1WP6A 1E1CA 3UPBA 4PYSA 4LPCA 2WMHA 2Z24A 3O16A 1FWEC 1ZCOA 2CBVA 4I9MA 4ZFMA 3WH5A 2JKAA 5CXPA 1ZP3A 1L6FA 3TOYA 3CUHA 3PP7A 4WHBA 4O1FA 3VKBA 1ZUAX 3WBYA 3COTA 2VFFA 1DKWA 3WDJA 1SPQA 3R43A 2OQYA 3SRKA 4BEUA 1V8EA 3BCFA 3SZ8A 3WJZA 5CG0A 2OQHA 2YL8A 4C6CA 5CGTA 2ATMA 3MSDA 5AZ0A 1Z9AA 3NIYA 4UOZA 4L56A 3GDMA 1XUUA 2DEPA 3DYPA 3GXFA 5IFTA 1QNSA 1ONXA 2CZ5A 4PMYA 4Q8PA 3S1GA 3LHWA 4GC3A 1X8FA 2DT3A 1HF6A 3GXMA 4LS1A 1AJ2A 3V4BA 3B9NA 1EZWA 2YJQA 4JD4A 4NJJA 4O16A 1CXIA 2YBTA 3QXBA 3GFZA 4FSAA 3LX9A 3PY2A 3LNPA 4C6JA 1EJXC 1GONA 5A8OA 4CCEA 3A6OA 4NZ1A 4RPQA 1PX3A 3KP1A 3IIPA 3KBNA 1OFOA 4WJ8A 1JI2A 1WKFA 2YFNA 5FSEC 5C7VA 2DU2A 3OA3A 4LANA 2ZX7A 1W9DM 2PAJA 2CKSA 3PBGA 3ANYA 3L4XA 4Y90A 4BQ4A 3LLFA 1U1HA 5J5RA 1OF8A 3PSWA 1F2JA 1EP1A 2PWVA 3MO4A 1OX4B 2GOKA 3LHYA 4LYPA 3W7IA 2BOEX 2WCGA 4DI9A 3PF3A 1J10A 5EFDA 4YYFA 2A6LA 4IPLA 1AQFA 4ZZ9A 1GW1A 3N13A 1H7PA 1EKOA 3ONBA 1AODA 3D3FA 2QS8A 1O5XA 2VT0A 1PKMA 3MMUA 4P2VA 5E93A 4DO5A 1Y5VA 4YTSA 3QHNA 3SJ3A 4NAEA 3B0YA 4QDMA 3GXPA 3NURA 4PTVA 2AGKA