3WQ4A

Crystal structure of beta-primeverosidase
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
475
structure length
475
Chain Sequence
SFNRTSFPDGFVFGAASSAYQFEGAAKEGGKGPNIWDTFTHEFPGKISNGSTGDVADDFYHRYKEDVKVLKFIGLDGFRMSISWARVLPRGKLSGGVNKEGIAFYNNVINDLLSKGIQPFITIFHWDLPQALEDEYGGFLSPHIVNDFRDFAELCFKEFGDRVKHWITMNEPWSYSYGGYDAGLLAPGRCSAFMAFCPKGNSGTEPYIVTHNLLLSHAAAVKLYKEKYQAYQKGQIGITLVTYWMIPYSNSKADKDAAQRALDFMYGWFIEPLSFGEYPKSMRRLVGKRLPRFTKEQAMLVKGSFDFLGLNYYIANYVLNVPTSNSVNLSYTTDSLSNQTAFRNGVAIGRPTGVPAFFMYPKGLKDLLVYTKEKYNDPVIYITENGMGDNNNVTTEEGIKDPQRVYFYNQHLLSLKNAIAAGVKVKGYFTWAFLDNFEWLSGYTQRFGIVYVDFKDGLKRYPKHSALWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of beta-primeverosidase in complex with disaccharide amidine inhibitors.
pubmed doi rcsb
source organism Camellia sinensis
molecule tags Hydrolase
molecule keywords Beta-primeverosidase
total genus 188
structure length 475
sequence length 475
chains with identical sequence B
ec nomenclature ec 3.2.1.149: Beta-primeverosidase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wq4A00
1HJUA 4JCMA 4JKKA 2OYMA 5LYRA 1XD0A 3MANA 1S46A 1KQZA 1OT1A 4HU8A 2BFGA 4UFMA 4UQEA 3WBEA 3WEZA 3SCUA 1JYNA 2YIHA 3ZSSA 1N82A 3AS1A 3MSDA 3OZOA 4YHGA 2E40A 3GNPA 3VX1A 1I75A 3F4VA 3PZ9A 5A8PA 1GOWA 1D3CA 2WWCA 4HMDA 1ESWA 4ZFMA 4P8XA 3RILA 3AYSA 2WMIB 3WQ6A 3DYMA 4UFIA 4Z2GA 3W29A 1Q6EA 2A3BA 1J18A 1Q6FA 2D20A 1H11A 2FH8A 2VVNA 1E71M 2FGLA 4UNIA 1OIFA 1UWSA 1KGUA 1WKYA 3WQ5A 4HP5A 3MUAA 3WENA 2BXZA 4CU7A 2QLYA 1KQYA 3ZR5A 4LYRA 1RP8A 1JZ2A 2WWDA 3QHOA 2WZIA 1F4AA 1OGGA 4W89A 2D0HA 1PZ3A 4AEFA 4MJ4A 4JFSA 4AZHA 1UD5A 3PBGA 1XH2A 2O9PA 4AISA 4PBGA 1X1NA 3AHZA 2W67A 4UZUA 3PTKA 3VUPA 2CETA 1MXGA 1XSJA 4QCEA 1OD8A 5BXRA 1B1YA 1ZS2A 4ACZA 4X0NA 2W66A 2VT0A 2WANA 5C71A 2VZSA 2BHYA 1KCKA 2EPMX 3AIRA 3WDIA 1EXPA 1VF8A 4MDOA 1UKSA 4AZCA 3BH4A 2BY3A 3I3DA 3VD3A 5I6SA 4J3TA 2ZXAA 3NYDA 4EAMA 3DHUA 3O6AA 3SCRA 2ZUNA 3AXXA 1C92A 4KMQA 2X2YA 3W6LA 2OWXA 4FMVA 4ML4A 4N0RA 1BFNA 1QI4A 5FD0A 1EOKA 1FFQA 4M82A 3SCPA 5E9AA 2WKGA 1KXTA 3SCNA 3WUGA 3VDBA 3PTQA 2CCRA 1VJZA 5JBFA 1VRXA 3CZKA 3WELA 2ZWYA 3GBEA 4M81A 4UQBA 3VGHA 1GOQA 4J3WA 1XYZA 5EFDA 4JKMA 3AIBA 4OBSA 4JFUA 2WPGA 2DPEA 3MKKA 4MB3A 3A4WA 4P8VA 3K46A 1JFHA 4V28A 3ARVA 2D22A 1MW1A 4IM4A 3UR7A 1B3WA 1ISZA 4U33A 2YA1A 1O6IA 4D6FA 2VRQA 2XGIA 4Z2KA 3WF1A 4OKDA 4WK9A 1H41A 5AC4A 2Z1SA 3CUHA 3BLKA 4UR9A 4CCCA 5A6BA 5BXPA 2VZUA 4GXPA 1EDTA 3BC9A 3RMEA 2D0GA 1OT2A 4W7UA 2WC3A 1R86A 2DT2A 4ACYA 1BGAA 1ZBKA 2EJ1A 1E3ZA 4BA0A 2WCGA 2Y8VA 3EYPA 1PBGA 5HXMA 3L2LA 4P7QA 3ZQ9A 4QP0A 1UWTA 4Y7EA 1UR9A 1W9DM 3W81A 2DT3A 1ZU8A 2WC4A 1UHVA 2X09A 2ZOXA 4AWEA 3VIPA 5IHRA 2ZX5A 3HU7A 1G01A 2PB1A 2UWFA 3AQUA 4AD0A 3D5HA 4D71A 1RP9A 1K9DA 3CGTA 3PZNA 1AMYA 1CGTA 4MB5A 1W1PA 3TTYA 2E9LA 3BCDA 1HT6A 3ZM8A 4AYSA 1ZBCA 1QI2A 4D1JA 1E3XA 1CGWA 3WSUA 2E9MA 1ITXA 4UCFA 3MS8A 1E9LA 3POCA 3CMGA 2G4FA 2WMJA 4GINA 3VINA 4B9YA 1PEZA 1HJWA 4OIFA 4PTMA 5C70A 5DO8A 1ITCA 4JFVA 1UOKA 1LL4A 4B16A 2X1IA 4ZENA 1DWJM 4UZSA 4E2OA 1J0IA 3VILA 3ZJ8A 1G5AA 4UOQA 1LWJA 3ARPA 3CUGA 3FAXA 3ZSTA 4WF7A 1JZ4A 3M7SA 4AZ6A 1QBBA 3ECQA 4W8BA 1HXJA 3MMDA 3ZR6A 1E6PA 2QMJA 2XVPA 4QDMA 4AIOA 2WBGA 1V3LA 3GH5A 1QVBA 4CN6A 2J79A 5DFAA 4H8HA 2VTFA 1HF6A 2PWFA 3WDQA 3A3HA 3GXIA 4K68A 5IFTA 5EFFA 3TTSA 5E09A 3DYPA 4GI8A 4A3HA 4ZEPA 2DIEA 3WMBA 2DQXA 4DWSD 3VIHA 1TG7A 1W9VA 1H0GA 2VC9A 3BLPX 4P8WA 2PWDA 3AIWA 2WW5A 3AMCA 3SEPA 2CBJA 3A4AA 1A47A 1JXKA 3VIOA 1VENA 4PMYA 3AXHA 3GXDA 3W4RA 5LA2A 4RE3A 1HKJA 1GOKA 4LXFA 2WAGA 4CUCA 4PRWA 3ARZA 3OB8A 5F7UA 4HPHA 1Q4NX 1PPIA 3SCOA 5ABFA 4AD4A 2VURA 5D4YA 1WPCA 1XD1A 1UD3A 5BYWA 4PMNA 2WMGA 1GQIA 1R85A 4P7OA 1CIUA 1GQKA 4UTFA 3AFBA 1I1WA 4UFJA 4BCEA 3VDHA 1JYVA 4CD4A 5CGMA 1FA2A 1M7XA 1V3MA 5A6MA 4C7GA 3ALFA 2OYLA 2NT0A 1MFVA 3KL0A 5ABGA 3DC0A 4S3KA 2IXUA 2XVGA 5ABFB 1MXDA 2CBUA 3T0AA 1H2JA 2BVDA 4J7RA 1E0WA 2GFTA 2DT1A 2GK1B 4U5IA 3CIVA 4CCDA 1R87A 4LX4A 1EDQA 3POHA 4GZJA 1I1XA 5C8BB 2WHKA 3N18A 2WNWA 2JF7A 1ECEA 1EHNA 1BGGA 2JIEA 1TA3B 1QBAA 3W6MA 1UH4A 1ZB5A 1KWKA 2J78A 2J4GA 3GZAA 4S3JA 4TX8A 4XV0A 3WY1A 4PN2A 2J7FA 5E6ZA 4Z2JA 1KR0A 3IJ7A 2BNJA 2XVKA 1BSIA 1VIWA 4E4PA 3N13A 4FLRA 4BF7A 4MNLA 3UESA 1TUXA 2QMKA 2J77A 3DHPA 1KGWA 5BCAA 5EMYA 3K8KA 2WXDM 3FHQA 3VGFA 1QI5A 2J8GA 1D2KA 2XWEA 3U5UA 3NSXA 1TCMA 4WKHA 4JFTA 1DWFM 1ZJBA 2W4XA 3G6LA 3OIHA 4W8AA 3T2PA 2PWEA 3PZTA 2EPNA 2XG9A 2GJXB 1DWHM 2X05A 5CSYA 1PIFA 4NZCA 1MW0A 2CNCA 1HKIA 3VD4A 1W3HA 1VFUA 4KRUA 2G3NA 1ODUA 3VPLA 1FHLA 4UQDA 4LPCA 3KEHA 4HOWA 1UKQA 1E5JA 2EEXA 1DTUA 3THDA 4NRRA 3TOPA 3CHDA 4WIWA 2VX7A 3FXYA 1NQ6A 3WF4A 6TAAA 3VMNA 1JDCA 2O9TA 3FAWA 1EO7A 3BAJA 1DWAM 4WKFA 2CHNA 3EBVA 3WNPA 4UFKA 1ISYA 4H04A 1EQCA 3WD2A 1BTCA 2V3FA 5DF0A 3VU2A 4TVCA 4ZXLA 2V3EA 2PBOA 3EDKA 4MJ2A 3N04A 2JF6A 3RJXA 2YA0A 1HVQA 4QCFA 8CGTA 2DT0A 3L4TA 2ZX8A 4GQQA 4AC1X 2G8ZA 3WMSA 2UY5A 1RPKA 3ARQA 1CGXA 5M5DA 3WMCA 1UKOA 5I79A 5ECUA 5HDRA 1JI1A 2FHCA 3HJEA 1C3FA 5I3DA 3NSNA 3ZJKA 1G94A 2WZEA 1ZBWA 4MADA 5E0CA 3VGBA 4MB1A 4MDPA 5FKYA 2ZX9A 1AQ0A 4FK9A 4KGJA 5BXSA 1JAEA 2X0YA 4P7LA 5CPQA 3U5YA 1P6WA 1WDPA 1V0NA 1KCLA 4PEEA 1E6ZA 2RGMA 2CKRA 1OGSA 3AMDA 4MPKA 3NCOA 4WKAA 2HVMA 2DGAA 3EDFA 5GQBA 4F9JA 1GVYA 1UR2A 1JNEA 1GOOA 1GOMA 1WCGA 3FNDA 5KEZA 1US2A 2VCBA 2FHBA 3J7HA 1E4NA 3TTOA 3ALGA 1JL8A 2G41A 3VM5A 5A6SA 1W9PA 1BVZA 1CXLA 1KBKA 5I23A 2G3IA 4IPNB 4ACZB 4HPGA 1UR4A 4HZ7A 2J62A 1L8NA 3UG4A 2WLZA 1EIBA 2Z1KA 1HL9A 4OBRA 2XSAA 5AC5A 1UA7A 1XRVA 1ZBVA 1VBRA 4D6JA 3AXIA 2Y8KA 3VIKA 2V38A 1PJ9A 1EDGA 3AI0A 4CVUA 2C0HA 3VMPA 4HU0A 4MNJA 2VMFA 1VB9A 2OYKA 2D3LA 4PMDA 3THCA 4KGLA 4J27A 2WBKA 2XIBA 1DWIM 3GH4A 4AZBA 3AISA 1BYBA 4KH2A 2X8RA 4PMOA 3OG2A 2FHFA 4F79A 1H49A 1OBAA 4HA3A 3CUFA 4LYQA 1OSEA 4W85A 4AZ7A 3OLEA 1WNOA 2WVUA 3CH9A 3W25A 4HZ8A 1B0IA 1CGYA 1EHAA 1OD0A 3CZEA 3WH6A 4DUVA 1CXKA 4M24A 3AZRA 1CPUA 7TAAA 4C7FA 2CHOA 4W8LA 3ARWA 1QW9A 1C8XA 4ATDA 1GPFA 2JE8A 2C7FA 5CJ5A 3WUEA 1OM0A 2ZWZA 3CLWA 4KRTA 4TTGA 1UUQA 1E40A 2ZX7A 1V08A 1US3A 1JZ6A 1ISVA 1HNYA 3UR8A 4JL1A 4AXNA 4NRSA 1J0KA 2QPUA 4U3CA 2E3ZA 2RGLA 4EE9A 3RM4A 2ZUUA 4FLOA 3QHMA 2J7CA 2WMHA 1JF6A 2CERA 3IAQA 3NDYA 3IJ9A 5I2UA 3BCFA 4DWSC 3U57A 3L4VA 4GO9A 1IZKA 4AIEA 3T09A 1V6XA 4H41A 4GI6A 1UD6A 5AYBA 3M6DA 4A4AA 1J9YA 1HP5A 1B90A 2V3DA 5A6JA 2G3JA 1AQHA 3WNNA 1WP6A 1CEOA 3WH5A 1QNOA 2YDSA 3N11A 1UD2A 4GKLA 3AZSA 3BMWA 2IUZA 2YJQA 2VZOA 3GDBA 2WK2A 6A3HA 3KWXA 3WDJA 1LL6A 2J8FA 1J0JA 4URIA 1JDAA 2WSKA 4PMQA 5BRQA 4LQ1A 1HJQA 4E8CA 3CHEA 1NWTA 3AS3A 1G9HA 1ISXA 1UZ1A 2AOSA 5ABEA 3WQ8A 4W7WA 2PWGA 1SR0A 4TX6A 4CD6A 4JHOA 1CXIA 2E0PA 2XFFA 1PZ2A 2YL5A 1W3LA 3MUY1 2D23A 3ZJ6A 4BQ2A 5D8ZA 5A2AA 1R8LA 4W5ZA 4B15A 5A6KA 1TZ7A 5GPRA 1DP0A 1LLOA 1OGBA 4X0VA 4JFWA 3O2LA 1UWIA 3SUSA 5EB8A 5LA1A 1E55A 1MW2A 1CTNA 1IT0A 1E72M 4AD3A 1NM9A 1JZ3A 2GK1A 3RPMA 1H5VA 1LWHA 1CWYA 3K8LA 4MB4A 3PZMA 1VFFA 3EMZA 2DIJA 3PN8A 3L4UA 1B9ZA 1XSKA 1W2PA 3OGSA 1LG1A 1HJXA 4TVUA 1UKTA 1UKPA 2BY2A 1G0CA 4L4OA 1FP9A 2E9BA 3ARXA 3F5JA 4D72A 1GQJA 1XH0A 2GUYA 2XVLA 4CKQA 4OUEA 3AYRA 1KBBA 1QNRA 3VNZA 2DSWA 2VRJA 1V02A 4H7VA 1KR1A 2VCCA 3RM9A 2J7HA 4ATLA 2CITA 1W1VA 4F66A 2J47A 1GJUA 3WD0A 3AHTA 4DUXA 2CKSA 3WKZA 2Y24A 4Q7NA 5IFPA 3WNLA 3BAXA 4Z2HA 2EPLX 2JIWA 3AIVA 1BG9A 1CXEA 1QHZA 4N42A 3W26A 1Q6GA 4HOZA 2CBIA 3IANA 4PMZA 1FHDA 1KXHA 4AIUA 2GJRA 1VFMA 1Y7VA 1CZ1A 4H8VA 1E5NA 2XVNA 2OLHA 2YLAA 1LF1A 2UY2A 4BQ3A 1CGUA 4D1IA 5A94A 4XZBA 3WH9A 3I3EA 3VNYA 1B3VA 2XSBA 4FF5A 2HISA 1MQRA 1FFRA 3A47A 4M80A 3N15A 1ISWA 1QHOA 2ZIDA 1QNQA 4PUDA 1GVIA 1HKMA 3OGRA 3MUIA 1UA3A 1HX0A 3UG5A 2ZUVA 3CZGA 4Z2LA 1UYQA 1VFOA 1UR0A 3NSMA 2CEQA 2UY4A 3S6TA 2V5CA 1UG6A 1E15A 1GZJA 2OWWA 5CPTA 2AAAA 3WF3A 5CG0A 2YL6A 4PSRA 5CLTA 2E8YA 3MV11 2ZUMA 1KXQA 2PBGA 4HOXA 1DWGM 4M29A 2WHJA 2WC7A 5EBAA 1V6WA 3K4DA 1UD4A 4PUEA 3TONA 1V6YA 9CGTA 4HTYA 4U3AA 3NIYA 4OOZA 3MV01 2DH3A 4D6IA 1CENA 2BXYA 1HL8A 3BAYA 3SUVA 1E4LA 1KFWA 1V0LA 2WHMA 5JBDA 3BGAA 1FP8A 2G3MA 2O9RA 1LJYA 1TR1A 4Q22A 3O9NA 2EPOA 1H0IA 4E8DA 3QOMA 1WDRA 2Y5EA 2F61A 4CCEA 3FHAA 2ZICA 2ZX6A 2DDXA 2CPUA 3VO0A 5CQ1A 1UR8A 3M07A 4PCTA 3W24A 5A1AA 3AZTA 1IZJA 3A6OA 3W27A 1OB0A 3EDDA 1YQ2A 1PAMA 3T0BA 3WF0A 3ZJ7A 1JXJA 1PX3A 3AICA 1NP0A 3DECA 5FL1A 2Y2WA 3ZT5A 2D1ZA 3ZO9A 1QI3A 3W53A 2XUCA 3CUIA 4PYSA 1W2VA 3TP4A 3ARRA 3WQVA 3LMYA 3WFZA 3B9EA 5A8MA 2J7GA 3AOFA 3HN3A 2O9OA 1V3IA 1EGZA 1H1NA 4CD5A 3VGGA 5A95A 4J3XA 4J3VA 1NOFA 1ZJAA 2FDMA 1GCYA 4UQ9A 1HIZA 2EQDA 1UWQA 1MYRA 2ZUWA 2VR4A 1JZ7A 1JD7A 2W92A 5E70A 1EOMA 4YN5A 4DWSB 2J7EA 3WDHA 2WVVB 1VBUA 4W88A 4J3SA 5E6YA 4M8UA 2WMKA 3QOKA 2F8QA 2BY1A 2VZVA 1Z32X 2PWHA 4XZWA 2D0FA 5A6LA 2OSXA 1KWGA 1W3JA 1JDDA 2BVYA 1E6RA 2XIIA 4JZ5A 1WDSA 2OWCA 1NH6A 2WB5A 3N17A 3RCNA 1NARA 2E4TA 4GI9A 5I78A 3ZT7A 2A3HA 3AS0A 1C90A 1JYXA 1W3KA 3VOCA 4GPNA 1KGXA 2XPKA 1L0PA 5LA0A 5D9OA 4MTVA 3TTQA 3CZJA 4IISA 5BWFA 1TFVA 3HMCA 3K8MA 5JIWA 1NWUA 1UWUA 1EA9C 1SMAA 1VJSA 3E1F1 2VJXA 2FGZA 4CGTA 3MUZ1 3QR3A 5CSUA 1BAGA 2XJ7A 2Q8XA 1GW1A 2YL8A 1J0YA 4MAVA 3VVGA 3CO4A 3U7VA 2YDQA 1JGIA 1E6QM 1B30A 3EMQA 3VD7A 5HPCA 2JFEX 1VEPA 1W9BM 3B9AA 1KXVA 1E6XM 3AJ7A 3LPOA 5JUVA 3IAPA 5CZKA 2WVTA 4AMCA 5CLWA 1GHRA 5JIPA 1J01A 4WLCA 1V3KA 5D9NA 3S2CA 5I0DA 3K1DA 5BXTA 4R27A 2XWDA 2W63A 1GUVA 4F8XA 4AD5A 2ZUTA 2QPSA 4C7DA 3WNMA 5IHSA 1CDGA 1G1YA 1EH9A 1E43A 3KE0A 2WCAA 2ZXQA 5D9PA 3A4XA 4WSKA 2VO5A 1XCWA 2F2HA 1WO2A 2XM2A 2DSZA 4QFUA 5HPOA 4DM1A 5BROA 1K9EA 3CHCA 2YBUA 3WDPP 3EMCA 1GOIA 1HN1A 7A3HA 3WL0A 3MMUA 3MO4A 1YHTA 3U7BA 1E73M 5FOOA 1K6AA 3VIFA 1JF5A 1OINA 4A3YA 3B9DA 1E1FA 1TVPA 4ZE4A 1UH2A 4EANA 4AD1A 1TVNA 4TUFA 3FY1A 3N9KA 3WEMA 2C8NA 3WIJA 3OLDA 4CU8A 4D6HA 5BRPA 3WH7A 3FW6A 4W93A 3BMVA 1ODZA 3GM8A 1V03A 4QLLA 1J0ZA 3WQ4A 2NT1A 2Y4SA 1XYFA 1Q6CA 3EDEA 1B31A 2A3CA 1CXFA 1BG4A 1CXHA 2BY0A 1JFXA 1EO5A 1UQYA 2WVVA 1J10A 1B2YA 3VTRA 2GSJA 3QGVA 2XYLA 3UETA 4DWSA 3L4YA 3GYCA 4CD7A 3WN6A 2TAAA 3MMWA 1M53A 1GORA 4PSPA 2VX5A 3VGDA 1K9FA 2D24A 1MFUA 1PX4A 3CUJA 1QNSA 1WZAA 2ZXBA 3AIQA 4U2ZA 1Q6DA 1B3YA 2BVTA 2UY3A 2WCSA 2NSXA 3WDRA 2EPKX 3AIUA 1E0VA 1WZMA 3VM7A 3VIGA 4KWUA 3VIJA 1SFSA 1V6VA 4CN1A 2BV9A 1E0XA 3MU7A 1B3ZA 1U33A 1B3XA 3ARSA 4W5UA 1K9TA 4X9YA 4OOUA 1F4HA 4TVDA 1DEDA 4TTUA 1AVAA 2CXGA 5AY7A 2VZTA 3W37A 4ZE5A 5I77A 1WAWA 4P8UA 1SMDA 3AS2A 3PTMA 2GJPA 2VX6A 1W1TA 1HP4A 2W5FA 2XFRA 1V0KA 2V3GA 3SCWA 4H2CA 1JAKA 1M03A 4GIAA 2OSWA 4M56A 3ARYA 4HZ6A 1RH9A 1CLXA 3W0KA 4GQRA 3ARTA 4PMUA 1JYWA 4GO8A 3APGA 2XHYA 1PIGA 1MW3A 2DSVA 1OIMA 2EBNA 3JUGA 4WSJA 5IDIA 1C93A 3AROA 1OWQA 2ZE0A 1NOUA 3OGVA 1JNDA 3SIMA 3TA9A 5DT7A 2VVSA 1GQLA 5A6BD 5A3HA 5D8WA 1GHSA 3PZOA 5GNYA 2DSKA 3PZQA 5A69A 3RO8A 4MNMA 3VDAA 4H8UA 5CXPA 3VGEA 2JEPA 4TXEA 1QPKA 4CD8A 5A2BA 4BQ5A 4BZYA 5FIPA 3WEOA 3ZT6A 5ABHA 1XC6A 3UCQA 3NJ3A 1UR1A 2VNCA 1VAHA 2XM1A 4HA4A 3VIIA 3CZ8A 3L2MA 2J25A 3ARUA 1XH1A 3OBAA 3ZOAA 1VEMA 3KL3A 1RD6A 5TD4A 3VKKA 5D9MA 2VI0A 1M04A 2WLYA 4AZGA 4RE2A 5DEZA 1X6LA 2VRKA 5I5RA 4V2XA 1BF2A 1E1EA 3SCSA 3WFLA 2EXOA 1KB3A 3PZIA 4JL2A 2QV4A 4YHEA 5HOSA 2NW0A 4D6GA 1XGZA 3WD1A 4ATWA 3F5LA 1SYTA 1C7SA 2PC8A 1C7TA 3VX0A 2JALA 1W1YA 1CGVA 1M01A 3LPPA 2VOTA 3SCVA 1FH7A 1H09A 3PHAA 4F9DA 2W61A 1V0MA 1XV8A 4AY1A 1JIBA 1OCQA 2WSPA 4AZ5A 1W9UA 1BYAA 3AMLA 1D7FA 2QHAA 2GJXA 3WQWA 1PX8A 4DUWA 1MVYA 2CYGA 2XTKA 1CNVA 3SCTA 3ZMRA 5KZ6A 3WF2A 8A3HA 5A6AA 4PTVA 2VQUA 3NDZA 1E6NA 1WZKA 1NP2A 1IV8A 3GXMA 7CGTA 2GDUA 4PMXA 3OA5A 3CBWA 4B3LA 4XB3A 3FN9A 4BQ4A 1LL7A 1AQMA 4J28A 1JD9A 3IJ8A 3IK2A 4JCLA 1CYGA 2VCAA 5GNZA 3CHFA 3SUTA 2YLLA 2WZHA 1LG2A 1X6NA 1UH3A 1H4PA 2D2OA 4P7RA 2PI6A 1TA3A 1VEOA 5DMYA 4XX6A 1J11A 3WD3A 3AHYA 1GNXA 2V5DA 3W38A 1A3HA 1JG9A 5DT5A 4RE4A 4NI3A 3B8SA 4NF7A 3AMKA 4U31A 3N12A 1NOWA 3GNRA 1JZ5A 5FCZA 1QNPA 4M1RA 3MSGA 3OZPA 4U2YA 4Z2IA 3BAKA 2YKKA 2B31A 4B3KA 1O7AA 2QF8A 1LQ0A 3ZIZA 3T2OA 1XSIA 3D3AA 1BYCA 5M03A 2YBTA 2VX4A 3CPUA 4U5KA 3VD9A 3NUKA 3VDCA 3VMOA 3CZLA 4MNKA 3AHVA 3AHXA 1J0HA 3UEQA 2O92A 2VL4A 3WNOA 3F5KA 1C8YA 2AMGA 2BHUA 4PCSA 3UG3A 2VQTA 1FH9A 5A2CA 3OLGA 5GNXA 5JBEA 4V27A 4D6DA 1W32A 1BLIA 1C91A 4FLSA 4D6EA 5A8QA 3AIEA 5M3WA 1E4MM 1GJWA 4AD2A 1E56A 4QLJA 1V3JA 4AEEA 4UFHA 1UQZA 1HJVA 5IXEA 1XHGA 3L4XA 5CPSA 3II1A 4RL3A 1BHGA 1W91A 4JAWA 1QHPA 2BHZA 4CU6A 1QW8A 1MQPA 2YOCA 1FH8A 4EK7A 1ZL1A 4HA1A 1BVNP 1UZ4A 1FOBA 2XGBA 1WDQA 1BYDA 4P7NA 1BPLB 2X0HA 4HMCA 3GBDA 2WM0A 3GNOA 4W7VA 3PZVA 4IPLA 2FH6A 2MANA 2WMFA 3SCQA 3SUWA 5I24A 3EDJA 2D3NA 4JKLA 1HKKA 1J12A 2ESCA 5CGTA 3BAIA 4PTWA 4PMVA 4UOJA 2WMIA 3M46A 4QLKA 1R7OA 3BSHA 1XCXA 4XUYA 3RJYA 5M17A 4HMEA 2PF0A 2WHLA 3N1AA 2OSYA 3T2QA 1QOXA 5AYIA 3RIKA 4LYPA 4JIEA 1NWRA 1E70M 1V02E 2E8ZA 1NWSA 1CBGA 4LGXA 1JZ8A 1E6SM 3BSGA 3PZGA 3LPFA 4UQCA 4JHZA 3RDKA 4IUGA 2EO7A 5A8OA 4WJXA 3W82A 2A3AA 3WUFA 3W28A 4OZOA 3AMGA 5A8NA 1GONA 5HNNA 1V6UA 1JI2A 5HBFA 1HJSA 1H3GA 1WE5A 3WUBA 4UQAA 2WKLA 1CLVA 6CGTA 4AZIA 4EKJA 1C8QA 2ZUSA 3WH8A 3WNKA 4ZXOA 3WD4A 3CMJA 1UWRA 3K4AA 4W87A 1R7AA 1EQPA 1V3HA 2WYSA 1W9XA 4DM2A 2CBVA 3WL1A 3VD5A 4R5EA 4B9ZA 4W86A 1WZLA 4CN4A 4PMRA 1U2YA 1QI0A 2YDRA 1U30A 2A3EA 1UD8A 1CECA 3SUUA 2W91A 4GZIA 1E4IA 3QHNA 3T08A 2VR5A 3KL5A 3GH7A 2YA2A 3RM8A 3CTTA 2J7BA 1MWOA 2GVYA 3BXWA 2BS9A 4TOQA 3L4WA 2J7DA 4MAZA 1DHKA 2J74A 3L4ZA 3SURA 2ZXDA 2DEPA 4YPJA 3PZUA 4AZCB 4CVWA 2WVSA 3KZSA 2XFYA 3I3BA 4PTXA 3GXFA 2J75A 2JEQA 1TE1A 4D6CA 3GTNA 2IXVA 2W62A 1MQQA 3G6MA 2YL9A 4GZEA 4UFLA 2VUYA 3VIMA 2DH2A 3LPGA 4BS0A 4OJYA 4AW7A 2CIPA 4J3UA 2DSUA 4UOZA 3WBAA 4FLQA 3T0DA 1BQCA 2GDVA 1HVXA 5E0FA 1WB0A 3UERA 1TMQA 5FL0A 3DYOA 3OLIA 4QAWA 4W84A 4NSBA 3BAWA 4L4PA 2CESA
chains in the Genus database with same CATH superfamily
1HJUA 5LYRA 1JCJA 2GQ8A 1XD0A 3ME3A 1FWBC 2R82A 3O3RA 3MANA 2YB4A 4NAEA 1S46A 3QFEA 1R3WA 4GXMA 3OQ8A 2BFGA 3WBEA 3SCUA 3TFCA 5HMSA 1IEQA 3GNNA 1I75A 3PZ9A 3EXTA 1GOWA 4GCAA 3EKGA 4QG8A 4V1XA 4F0SA 2WMIB 4TV6A 3WQ6A 3DYMA 4UFIA 1JGMA 4RNFA 1Q6FA 1E71M 3VE7A 4AU0A 3PP7A 4TQTA 1UWSA 5T9BG 4UNLA 1FDYA 3EXRA 2NQ9A 2QLYA 3FLUA 3WCZA 3ICJA 3ZR5A 5CPLA 2R1LA 1UBPC 4W89A 2D0HA 3L66A 4HPJA 2FVKA 1AZ2A 4GY7A 2BTMA 2IKIA 4PH6A 1X1NA 3TW7A 4EF8A 3R89A 3W01A 4R88A 2PGWA 4NASA 4QM1A 1GEHA 2E1DA 2HJPA 2PTWA 2WANA 1A5MC 1Q63A 4DELA 4AZCA 1UKSA 4UWMA 3M0IA 4FPSA 3VD3A 2Y61A 3I4EA 3D0CA 3DHUA 3MUXA 3LLDA 3SCRA 5HR7A 3SY1A 3TWBA 1UOZA 2OX1A 2OWXA 3AALA 3EGJA 1KBLA 3NVTA 4FMVA 1QI4A 5FD0A 4KPLA 3MP4A 1SO5A 4LCRA 3B0YA 5TF0A 5HWMA 3R4IA 4P61A 1VJZA 1OZMA 4Z08A 2DP3A 1VRXA 5JXQA 3CZKA 4LB4A 4M81A 3MW7A 1GOQA 1XYZA 3M0LA 3V0UA 4JFUA 3MKKA 3L5MA 3W7KA 3A4WA 3LCHA 3GUGA 7REQB 3O1NA 2D22A 3GHRA 4O8RA 4WY0F 1K8YA 1TX0A 4O0KA 1OX5A 3F2CA 3STCA 4QDPA 5ENLA 1O6IA 1ZJIA 3CH0A 4M6QA 1XLCA 5KMYA 4FO4A 4D6FA 4OKDA 2QCDB 3G1RA 1KW1A 5FF3A 2G4JA 3BLKA 5BXPA 3LRKA 5E1QA 1IT7A 3OBKA 1SZEA 1TTIA 3H7VA 3RMEA 5CZSA 1OJXA 2DT2A 1I2NA 4ACYA 1BGAA 1ZBKA 1ZFJA 2EJ1A 4BA0A 2FZBA 5HXMA 2Y8VA 3D3FA 4ZB0A 4LALA 4FAMA 4QP0A 4X22A 4Y7EA 2OLSA 4AWEA 5IHRA 1H7RA 3T4CA 1ZCCA 1K9DA 5HNRA 1AMYA 1W1PA 3BCDA 3ZM8A 4JQ3A 3WSUA 2GVJA 5AN7A 2WMJA 4PMJA 2Y63A 4GVIA 3CLMA 1DE5A 2WNNA 3GVGA 1SU5A 4IH3A 4RZBA 1QOPA 5F4SA 3VK5A 2OKTA 1DWJM 3HQOA 1QOQA 3EA2A 5D38A 3VILA 4PL2A 5HQMA 4NJJA 1G5AA 1XIBA 4MZYA 3TFXA 1FWCC 1LWJA 3VDGA 1IF2A 3BUVA 1R47A 4WF7A 3M7SA 3MMDA 2QMJA 4LF2A 2XVPA 2YXGA 5DMMA 4AIOA 4NY2A 1FWRA 3PPGA 1QVBA 1O95A 4CN6A 2Q02A 4DHGA 4H8HA 2WV8A 2C18A 5DX7A 3GXIA 3JRKA 2AL2A 5LNRA 3TTSA 1HUVA 4P8WA 3BLPX 3KP1A 1N8WA 2ON3A 4WJ8A 3RITA 3SEPA 3RF9A 4A21A 4QG9A 1S2CA 1VENA 3AXHA 4RE3A 3W87A 3EWCA 1HKJA 3TVAA 3EWBX 1OG0A 1K4GA 2ALDA 1X96A 3E49A 1PHQA 3PPCA 4PRWA 4XO6A 4CUCA 1YPIA 4JTHA 1TVLA 1Y5XA 2QJNA 1WPCA 4NHVA 1UD3A 1SGJA 4OU1A 2YCLB 2G0WA 5AOUA 2E5BA 4YCPA 1GQIA 2ALRA 3R10A 2VD9A 1I1WA 4LS2A 1JQXA 3VDHA 5CGMA 4MF4A 1ITUA 4A8NA 1DORA 1LBFA 5ABGA 4IWWA 3ZVHB 1MXDA 3LSCA 3TCSA 4O18A 3DFPA 1AJ0A 3AU2A 3E2RA 3S6DA 3CIVA 1T5AA 3M0HA 3L2IA 4YWIA 1GZGA 4LX4A 5CBBA 1KBIA 1EDQA 3CV1A 5LHEA 1OK6A 3M4HA 3KZPA 2DFAA 3MBFA 1MRAA 3DFHA 3PSVA 4HCHA 5I06A 2FFCA 2WNWA 3BOFA 4YXGA 1ECEA 1TJ1A 1X7IA 2Z7KA 2V69A 1QASA 3HG2A 2J4GA 4S3JA 4TX8A 4JTFA 3WY1A 5HINA 1S5MA 3TR9A 4AHPA 3W70A 3BW3A 3HV9A 1VPXA 2XIJA 4JTAA 2ZFAA 4IIHA 3FA5A 4FLRA 3UESA 1FQ0A 3MCNA 3W7NA 4IFKB 3GWQA 1YADA 2WXDM 1IIGA 1D2KA 2NQZA 3NSXA 3WK0A 1OFAA 3G6LA 3G0SA 2J24A 3UG8A 2PWEA 1XGEA 3FGCA 3GAKA 3PZTA 4PB3A 3HQ1A 4H7ZA 2GJXB 1DWHM 1KM4A 4KRUA 3NXFA 3G5EA 1R9ZA 1TMHA 3SR7A 1CB2A 4DPPA 3MZ2A 4QISA 1TKKA 3QQWA 4UQDA 2YZRA 4DX3A 4LPCA 3KEHA 1M65A 1FX6A 1PDZA 2YYTA 4MJZA 4B5NA 4HOWA 5FEPA 1MDRA 4WIWA 3FXYA 4JYDA 1NQ6A 3WF4A 1TE6A 3ABXA 5HK4A 2VEFA 3FAWA 1AK5A 1EO7A 4QS6A 1PWMA 4WKFA 5G2HA 3DHDA 3WQCA 3NOEA 2CHNA 1XLLA 3BJSA 4I7VA 3GU1A 2A5HA 1F6KA 3WNPA 1F73A 4RXFA 1ISYA 2HNHA 1XRFA 1EQCA 2C71A 2V3FA 4MZ1A 1VFTA 2E7FA 2PBOA 4DJFC 3EDKA 4DLFA 3S2NA 5C2CA 2IKJA 5F2MA 3RJXA 1MEIA 2V9DA 1U5JA 2PDPA 4MHBA 3SIZA 4QE1A 2AQVA 2IPFA 2W6RA 2XSXA 4GQQA 1DJYA 3T9PA 3ARQA 3U2ZA 5ECUA 5HDRA 4O14A 1JI1A 2FHCA 3IVUA 3USBA 4C5YA 3SW6A 3VZZA 3WLOA 4KW2A 1B4EA 3VGBA 1DJQA 3QR0A 1LRNA 4LVGA 3VOIA 5FKYA 1AQ0A 1TYGA 4Z1AA 5BXSA 2ADAA 1JAEA 5CPQA 2JGQA 3U5YA 3V75A 1P6WA 2XFWA 3Q67A 1KCLA 4NXSA 4RDYA 2BX7A 4WSHA 1NF0A 1OGSA 5K4XA 2XISA 1KKRA 3W7CA 2PDJA 4GY0A 3EDFA 1DPMA 3CAVA 1GVYA 3N19B 3BDKA 1GOOA 1WCGA 4H4IA 1Z7AA 1GWJA 5CEWA 2VCBA 3GY1A 4NL1A 4ICNA 1JL8A 3GNDA 3VM5A 5A6SA 1GOXA 1W9PA 1CXLA 4LAKA 4HPGA 2PTYA 3LK6A 3PPFA 3IIXA 3N2CA 1UP2A 1UMYA 4WY0A 4IXHA 5AC5A 3VKDA 2GQ3A 1X39A 3N34A 2Y8KA 1VBGA 2VGBA 3TC6A 4MNJA 2VMFA 3C0LA 3GX9A 1JULA 3TAKA 3G1HA 3EPMA 4KH2A 2OGJA 4GJ1A 2RDTA 4LYQA 4BHYA 1OSEA 2WVUA 2O4QA 5LNSA 1JCNA 3KOFA 4HZ8A 5IOBA 1CGYA 1OD0A 4M51A 1TUFA 3EWXA 1LRQA 1R3RA 3NZRA 3M0KA 4LEFA 2QUTA 7TAAA 4C6PA 3UWWA 4W8LA 4TMCA 1FDZA 3UWZA 5CJ5A 4JQ1A 4S3GA 2PODA 1IXQA 4Q4PA 4J2MA 3CLWA 4KRTA 4GYPC 1F3TA 1E40A 3EX2A 3W85A 4MYAA 3BZJA 6ALDA 1US3A 1RVGA 4I8DA 1DXFA 3TSDA 3UR8A 2QPUA 4U3CA 3TJLA 1ZNNA 3W7EA 1ZUAX 2ZUUA 3PVFA 4LH8A 1ZALA 1RK5A 2HE8A 1GTHA 2CERA 3NEHA 4NU7A 1AH3A 1U5HA 4NAEB 2OG9A 3M5YA 1S2UA 4GNJA 1DQWA 3U57A 3L4VA 1KRBC 3PR2A 4JTRA 1A5NC 2IQDA 3QY6A 1V6XA 4AUBA 4H41A 1UD6A 4XAFA 1QPQA 1HP5A 2IMRA 1ADOA 2CZVA 2NX1A 5H8PA 4O11A 3QV8A 3AO0A 1UD2A 4H6QA 4GKLA 1EC9A 3UZYA 1TWWA 1G69A 2IUZA 2W0UA 4GOAA 1IXOA 3P93A 3LCLA 4HB7A 3RAOA 3DCPA 1AODA 2WK2A 3KWXA 1LL6A 1IWBA 2J8FA 1J0JA 3G1VA 1PV8A 4C1KA 3ES8A 2WSKA 1XIEA 4O54A 1IGSA 3TNBA 1HJQA 4LUIA 5MKGA 3OBEA 3AS3A 4H6EA 4NIRA 1QRQA 1D8WA 5CG7A 4CD6A 1CXIA 3CV2A 4YVPA 2PE4A 1B4KA 4QSHA 4ZQCA 3MUY1 2X30A 3EWUA 3CL7A 4BQ2A 4DZ5A 1LUCA 1R8LA 1OYAA 2H90A 1DP0A 4G6CA 4X0VA 1YTEA 1UWIA 5LA1A 3HQPA 4PCNA 5EB8A 4GGBA 3FVMA 3BLLA 3WBWA 3H2FA 3I65A 1NM9A 5IBXC 3GO2A 3DDMA 3B06A 4S2CA 2D2JA 4AX7A 1A80A 2KAUC 3QN3A 3F4WA 2DORA 1A5OC 1MUMA 3PZMA 3VFCA 2DIJA 3TZNA 3LV5A 3FVDA 4HT3A 4UMCA 1VPQA 1VHNA 1EB3A 4GXWA 3TMQA 2JBMA 1UKTA 1UKPA 2DUXA 1BKHA 2BY2A 1G0CA 3VNIA 4L4OA 2WJEA 2PFHA 2E9BA 3ARXA 3F5JA 3SFWA 3RNDA 5DCBA 1HFBA 1M7JA 3VNZA 2OGYA 4M6VA 3F4CA 4DNHA 3DC8A 3IS4A 2Z1WA 2Z00A 4ATLA 3R94A 1W1VA 1CB7B 1B54A 3UF9A 2J47A 3AHTA 4JICA 2VFGA 3TH6A 4Q7NA 1T8XA 3TYBA 3NAVA 2JIWA 3WJSA 1PYMA 5FJUA 4PL1A 3VOJA 1BG9A 1CXEA 1Q6GA 5HQEA 1FCQA 3UBPC 3UJFA 3N4FA 3QZ6A 3NL5A 3ANVA 2ODOA 4IP5A 1E5NA 3FX4A 2UY2A 3BMXA 3WLMA 3GTFA 1CGUA 5A94A 3FK4A 2PA6A 4I5XA 5JVLA 2XSBA 4JN6A 5CZTA 4BWLC 2EG6A 4M80A 3N15A 3QBUA 1QHOA 3E5BA 1QNQA 2OT1A 5EY5A 3PUOA 4A2SA 1Z89A 1GVIA 1HKMA 2XN2A 3B97A 3QW3A 1SSDA 3JU2A 1VCVA 3UG5A 2DZUA 4Z2LA 2H9AA 1UR0A 1EC7A 3S6TA 2UY4A 2V5CA 3M43A 1GZJA 3EWYA 2YL6A 3QKEA 2CZDA 4LAZA 1FKXA 3N6QA 4GVFA 3LXCA 2OX4A 4HOXA 4LBRA 4M29A 4NQ1A 3TQKA 1XI3A 4KT2A 2IW0A 4PUEA 2VGGA 1VIZA 2AGKA 1J6OA 5C9WA 2R1NA 3D6NA 1V79A 2P5NA 1VBHA 3GDMA 3JZUA 2OZTA 2WHMA 1FP8A 1LJYA 2H6RA 3NM1A 3F03K 4PFMA 1OK4A 1IYXA 1SJDA 2V0TA 4E8DA 4IMEA 2NVCA 2Y5EA 4CCEA 2ZICA 1CX9A 5CQ1A 5HJYA 4PCTA 3Q65A 1GYNA 1OB0A 1G4EA 5D32A 1PAMA 3ITGA 3M7WA 5MKGB 2D1ZA 4XBKA 3W53A 2ISDA 3WFZA 1Z44A 3LMYA 3IV8A 2ZBTA 3N3MA 1V3IA 4XKYB 3IIPA 3CL8A 1JCMP 5A95A 4N9CA 3IJQA 3C3NA 2YW3A 2ZUWA 3KAOA 3FXGA 4L6DA 3SSJA 4L5ZA 1E9IA 1JD7A 4QEEA 4Y6GA 1NAL1 5J5DA 1W0MA 5E70A 1SR9A 1W6TA 4E5TA 1XYAA 3CQKA 4YN5A 4B2DA 5C55A 2WVVB 3QPZA 1FWHC 2V5BA 4J3SA 3SJ3A 1TV5A 2QVNA 2B4GA 5EMMA 3QOKA 2PWHA 2A2IA 5A6LA 4E4FA 3HQNA 1W3JA 1JDDA 1E6RA 3U6WA 5DQPA 4CNUA 1V7YA 2VOMA 3N17A 4XBSA 2WPBA 3RCNA 4O1EA 4NXKA 1JPDX 2CZEA 5I78A 3ZT7A 3W02A 4Z1BA 1JYXA 3PUGA 1W3KA 4HK5A 1L0PA 2CXEA 4MTVA 4YVVA 3TTQA 4S3EA 4B3ZA 3HMCA 1XX1A 3PF3A 3SDOA 2EKCA 4HNVA 2HVOA 4OBTA 3I10A 2EKGA 3S3GA 2YL8A 1UPMB 2HVNA 2FPVA 1AMKA 3U7VA 4O0QA 1T6MA 3TIMA 3EMQA 2XGZA 1WKDA 1VEPA 4UTJA 4QHRA 3U0HA 1H5YA 3LPOA 3IAPA 5JIPA 4WLCA 1B3OA 2REQB 3S2CA 2HQAA 3LCFA 5I0DA 2P1FA 3K1DA 5HNTA 4AQLA 2QR6A 1N8FA 4F8XA 2QPSA 3QF0A 4LS0A 3P7YA 1R2RA 3AXKA 2Z6IA 1X8FA 3U3HA 1V7AA 2RAGA 3KE0A 1P0DA 4YIWA 2PDCA 3FGCB 4GUHA 3SZ8A 2XM2A 1XLBA 4QNWA 4QFUA 1TIMA 5BROA 1XINA 3CHCA 5AFDA 3WDPP 3PFMA 3EMCA 1XBXA 4LC6A 1A49A 2DJLA 5FOOA 3VIFA 4FXSA 1OINA 1U1HA 4ES4A 1R3TA 1G7UA 1UH2A 4EANA 3FY1A 2Z2BA 3UWQA 4L64A 3T42A 4ALDA 3GHUA 3MT1A 5BRPA 3GU2A 5HWJA 3WH7A 3C2FA 2NT1A 4E38A 1KRMA 5D04C 3GHTA 1B31A 1NIUA 2BY0A 2RH9A 1JFXA 3EWDA 3RN6A 3BLOA 2P50A 1EL3A 3GXPA 3BW2A 3VTRA 4YYCA 2VFFA 4DWSA 3GYCA 3VCRA 4CD7A 3EPOA 5D05A 2PDIA 3VGDA 1X8CA 5LSMA 4AY7A 1K9FA 3WQGA 1WZAA 2ZXBA 2CC0A 2UY3A 2YXOA 1EPVA 4C6IA 4P5UA 3DFYA 4MY1A 4X2PA 5IDZA 4DJEC 2XIQA 5J5RA 2O4MA 1V6VA 3OIXA 2GUBA 4R34A 3ARSA 4W5UA 1K9TA 5FSEC 3LXAA 2WJZA 3NM3A 4TTUA 4LS1A 1AVAA 2IKGA 1XLFA 2WNZA 2HK0A 4ZE5A 3S2JA 4P8UA 3AS2A 4KEUA 1W1TA 2W5FA 4AWUA 3ARYA 4HZ6A 1KM0A 3ARTA 1HKVA 2XHYA 4DZIA 1MW3A 5F2LA 4D8AA 2ZZ5A 3EXSA 5HAOA 2C13A 1B9BA 3PC0A 1EEPA 3NQDA 4WSJA 4Q4OA 1W1ZA 5CPNA 2LLEA 3OGVA 3T07A 3I7SA 3TOYA 1GKRA 1O4UA 2PMQA 5GNYA 3I68A 3LI0A 4LVDA 2DSKA 3PZQA 3RO8A 3HMJG 4QROA 1NF7A 3GC2A 3VGEA 4KEZA 1I2QA 1QPKA 4PEKA 3KRBA 4CD8A 4BQ5A 4PBFA 4BZYA 4GMEA 4X60A 3WEOA 5ABHA 1XC6A 3BJTA 4JDBA 5TQLA 1HL2A 2OEKA 3NQBA 3RXZA 3MC5A 2VNCA 3VIIA 2XM1A 3CZ8A 4NZ3A 3THUA 4YWSA 3T1GA 1XYMA 2Q09A 4J40A 3VKKA 2VI0A 4QJ1A 3RK8A 4R7WA 4UB9A 5I5RA 1E1EA 2W9MA 1BWKA 4GX9A 3S42A 3WFLA 3L21A 2JK2A 1W5OA 4JL2A 4FNUA 3QTPA 1XGZA 1QJWA 1GKQA 1SYTA 2A7PA 5FJJA 3VX0A 3LPPA 2VOTA 4N9EA 4ADSA 3PHAA 1V0MA 4IX2A 2DZAA 2C3ZA 4FNPA 4YTSA 2I1OA 2EF9A 4JTJA 1F07A 3RHGA 2CYGA 2XTKA 1T41A 1TTPA 1SFTA 4O1AA 2PDKA 3WF2A 5A6AA 3GDKA 3JZEA 2VQUA 1E6NA 2R24A 3AC0A 3GXMA 1LBLA 4H83A 1GGOA 5A8GA 4G5DA 4JCLA 4LY4A 4C1NB 1CYGA 2VCAA 1W5NA 1K4HA 4G2DA 2INEA 1VFLA 2KZHA 1X6NA 2WKJA 2D2OA 1FKWA 4P7RA 1GNXA 1DBTA 3S1GA 4RE4A 4S39A 4RUBA 1J4EA 3N12A 1I0BA 3LN3A 2GLKA 3GNRA 3S2MA 1QNPA 4M1RA 4PTNA 4U2YA 4OE7A 4Z2IA 1AH4A 1XIGA 2B31A 5HNUA 4B3KA 2ZCGA 1O1ZA 3T2OA 3HPZA 1JR1A 3DBNA 1VLWA 3V4BA 2FZ8A 4US5A 5XIMA 1XIMA 4IIDA 4F0RA 3NPVA 2VX4A 4YVXA 4G7EB 2WO5A 2NUWA 3IARA 3AHXA 2VL4A 3WNOA 3V5OA 1IXPA 1HZYA 2AMGA 3VAVA 1TTJA 2Z1XA 1EP2A 3OLGA 2V6AA 4V27A 4D6DA 4AWSA 1W32A 2VC7A 1F3WA 1Y65A 2P88A 2Y6ZA 3TQ0A 4CNPA 4NAFA 1GJWA 1DKWA 1V3JA 4J1OA 1B57A 2F2KA 4QXIA 3H2AA 1EKOA 3WLHA 4X63A 5CPSA 4RL3A 1BHGA 4JAWA 1QHPA 3DIPA 2VD8A 3D46A 3W7LA 2YOCA 4EK7A 4KFNA 5T9CE 1DOSA 4HA1A 2SFPA 1TPC1 4DJFA 4HYWA 1FOBA 3QR1A 4OFCA 3EOSA 2X0HA 3DN5A 4HMCA 3FOKA 4W7VA 3P80A 1TTQA 3KXQA 2FH6A 2MANA 1GYMA 1JPIA 2Z28A 1HKKA 2AL1A 2DUAA 2ZRVA 3BSHA 5M17A 3DG3A 4TO8A 2NQLA 1GTEA 2ZE3A 1RBOB 3DI0A 2VEMA 5FEZA 5AYIA 3E96A 3GC4A 3OG3A 2PDYA 3G22A 3NO1A 2B7QA 1WOAA 4LGXA 3BSGA 4JHZA 3O6DA 2CLEA 4H9VA 3PUEA 4DBEA 4OZOA 4HU3A 1HGWA 4Q8OA 1GONA 3C2OA 1JI2A 5HBFA 1ZP3A 3WUBA 1H1ZA 1CLVA 3M44A 1C8QA 2ZUSA 3CMFA 3WNKA 3WD4A 3GFZA 4W87A 1R7AA 1LYXA 4ZCWA 4FSAA 1WZLA 4CN4A 2V5LA 3ATYA 2P3ZA 3A4JA 1CECA 3SUUA 1KLZA 3SM0A 2QCFA 3PB2A 4MLJA 2VR5A 4HNLA 4ZSUA 1XCFA 3SSZA 2DVXA 1A5UA 2PC4A 3RCMA 3RM8A 4Y9OA 3DGRA 1Q7ZA 3S5NA 2AMXA 3TC7A 2F6UA 2GVYA 1YKWA 2O7SA 1DHKA 2J74A 3UJEA 3SAZA 3YPIA 4OWGA 2F9RA 5C7HA 3IJIA 3KZSA 5CBIA 3KOWA 2I14A 3GXFA 4HN8A 1TE1A 3UNTA 5B80A 2NUYA 2W62A 3EX3A 3ABZA 1MQQA 2E5DA 2XIMA 3LY0A 3PK7A 3TX9A 2YL9A 1M9HA 4YTTA 2DH2A 2E28A 1P1XA 2H3DA 1OFRA 4BS0A 4AW7A 4AVOA 1KM6A 2CIPA 2DSUA 3XISA 1BQCA 3CAQA 1PTDA 1F8IA 2NX3A 1H61A 3CNYA 1MXSA 4WGHA 2OYMA 3NQ8A 1JDEA 2CLPA 4GYPA 3MTWA 3N4AA 3G1AA 4UFMA 4EF9A 4CNTA 1OZQA 1SZNA 1HW6A 2ZA3A 3AS1A 1T8QA 3OZOA 3WLNA 2E40A 3E38A 4NZ1A 5A8PA 1TO3A 4ZFMA 4GH3A 4QE5A 3AYSA 1YTKA 4BI6A 1SW0A 2DIKA 3T0TA 4Z2GA 4OECA 2VR2A 2A3BA 1PIIA 3H26A 4ZSTA 1H11A 1FWWA 3SRFA 3UPBA 4YLWA 3DH7A 2ZC8A 2BXZA 4LC8A 1KQYA 1DJXA 4LYRA 4JTCA 3PJTA 4LWWA 1W3TA 1FXPA 2WZIA 4A3QA 4ZQNA 1BQGA 1PZ3A 4AZHA 2Q8ZA 4MWAD 4GQ0A 3DENA 2W67A 4UZUA 1Q65A 2W79A 3EX4A 1MXGA 1XYCA 3Q58A 2GL5A 4MPQA 1NEYA 2NLYA 3R0UA 3DXIA 4X0NA 2W66A 3MCOA 3PJWA 4HJFA 2VZSA 2BHYA 4LCQA 1G67A 3PBUA 2QDHA 3UWVA 2FZDA 2BY3A 2V2DA 4J3TA 4H9UA 3NYDA 2WQDA 4L65A 2R1MA 3SRDA 3O6AA 4IG2B 2ZUNA 4REQB 2WJDA 3AXXA 1V51A 6TIMA 4KMQA 2FQIA 4Q4QA 1EF3A 4HKPA 3M0ZA 2X7WA 2PDXA 4ML4A 4N0RA 4E3TA 2JQXA 3OHMB 3CM4A 3E9AA 3OVQA 3SCPA 5E9AA 2PU0A 4DAFA 2WKGA 4QGCA 3SCNA 3WUGA 2QCNA 4AH7A 5BRBA 5IBXA 5DY3A 1S2TA 2QQ6A 1K3UA 1ICQA 5DMNA 3VGHA 4J3WA 5EFDA 4JNZA 1NJJA 4ZOAA 4GJJA 1XWYA 2DPEA 2VENA 3WFAA 4S23A 3QMTA 3ARVA 3BLDA 1EUNA 4K1GA 1OHLA 4IM4A 2EGZA 1C9WA 2GGIA 2YA1A 3LTYA 5I00A 4IQJA 3ONBA 2O55A 1O5KA 5FF2A 1EIXA 1BD0A 2VRQA 1OCNA 4IJBA 1S38A 3CUHA 4O1FA 3LHVA 4N6FA 1EDTA 1ALDA 1GT8A 1YNPA 4FNRA 2X7VA 3OJGA 4ZODA 1S5TA 1A5BA 1RV8A 3L2LA 3RCYA 3GLCA 2YZ5A 2Q8LA 4XZNX 4TIMA 4DUOA 2ZX5A 3HU7A 1G01A 2PB1A 2UWFA 4AD0A 1O1HA 4LU0A 1RP9A 3PZNA 3UR5A 3TTYA 4ZQPA 1ZBCA 1AA1B 4IUOA 4D1JA 2E9MA 1ITXA 1E9LA 1AW1A 3ABQA 2G4FA 3GG8A 1XKJA 1G4PA 1TWDA 2QUVA 3VINA 4IQEA 2NVDA 4PTMA 3T8LA 5DO8A 4PR4A 6REQB 3NFUA 4B16A 2X1IA 1WUEA 4LAMA 3ZJ8A 5EPDA 2VEKA 3CUGA 3ZSTA 3U8GA 3H2MA 5EMJA 4AZ6A 4MUZA 1TJ2A 1H62A 1QCWA 3B0PA 4W8BA 1HXJA 1T99A 1E6PA 3MCMA 4QDMA 3MHFA 3HG4A 1XW8A 2Y7GA 2RUSA 3LHZA 4JIRA 3WDQA 4K68A 5IFTA 5EFFA 3S83A 1H1YA 3DYPA 3P62A 3WMBA 4OUIA 1W3IA 3CB3A 1X7FA 1EPXA 1THFD 2HXUA 4RLIA 2PWDA 4GIYA 3G0XA 1XLMA 3BLEA 3AMCA 3A4AA 3FJNA 4JBRA 1TPUA 3W4RA 3WBYA 4EPDC 3WJXA 2WSYA 2OZ0A 1XRSA 2PPGA 2XH4A 2HSAA 3ARZA 5F7UA 1MEHA 3E0VA 4LANA 4N02A 3SCOA 5ABFA 2VURA 5AKQA 2FPYA 2XN1A 1PTAA 3UZ5A 2WMGA 1R85A 2PDNA 2E09A 2F84A 4GISA 1CI1A 1U83A 3BWWA 3S1WA 4CD4A 1XPYA 1A5CA 4LUTB 1UR3M 1HG3A 1QWGA 2NT0A 3KL0A 4QNEA 4ZO6A 2IXUA 1MUCA 4MIMA 5I03A 2C1GA 3SGGA 4FOJA 2I9UA 3QH2A 3T0AA 1LTDA 2BVDA 2GFTA 4PUUA 3KTXA 3T7VA 2XH2A 3K13A 3HB9A 2DT1A 2GK1B 4H1ZA 4C6QA 1DQXA 4JIQA 2OODA 4O57A 1P48A 5G1MA 3RMJA 4V1YA 3BARA 1MNZA 4GZJA 2HWGA 5C8BB 3HBLA 3N18A 4XVDA 4BF9A 4DXKA 2PLJA 4Y96A 3BG3A 4HSOA 4Y9NA 1PXGA 1QBAA 1GZ1A 1ZCOA 4L9YA 3W6MA 1XG4A 4O52A 1KWKA 4XV0A 5CC3A 4KESA 1YXYA 3F1QA 1KR0A 2PF8A 1ZGDA 1TJ0A 1BSIA 1Z41A 4O0ZA 4E4PA 2X41A 4UR8A 1KTCA 2VP8A 3DKLA 3M0JA 4BF7A 4EXBA 2FJUB 3HZ3A 4MNLA 1Z48A 4G1NA 1Q7MA 1TUXA 2PCEA 1F74A 3HFTA 5EU9A 2ANUA 4ROQA 3DHPA 5BCAA 5EMYA 3K8KA 3FHQA 3TLQA 2Z2AA 1QI5A 2F6KA 3KX6A 3R2GA 1TCMA 3SN1A 2CLIA 4JFTA 4S3CA 1ZJBA 2W4XA 1GVOA 2A1YA 3C2EA 2Z27A 3KBSA 2DV0A 4NZFA 2X05A 1PIFA 1MW0A 3GVQA 1H7OA 2CNCA 3VD4A 1YE4A 2ASHA 1SFJA 5AHMA 4KETA 4EXQA 3O7UA 3N9RA 4Z0JA 2QJMA 1KV8A 2I5QA 1UKQA 3S5YA 1DTUA 4KIRA 2DY3A 3TOPA 3CHDA 1E1CB 2ZRZA 6TAAA 3VMNA 4FXRA 3NGJA 3QFWA 1UJPA 5C2GA 3FJLA 3UCCA 1I6NA 3G1YA 5FACA 4ROPA 4U10A 2BGSA 4RPPA 3SRKA 4K2SA 2R14A 3CV7A 3N04A 1REQA 2JF6A 2RFGA 4HA0A 3N6JA 1PKNA 3BGGA 3KRUA 2PZ0A 3H4XA 3L4TA 2ZX8A 9RUBA 2G8ZA 3LERA 4GVHA 4M7TA 1RA0A 3HJEA 1C3FA 1FCVA 1ONWA 3CEPA 2YDAA 3KW3A 1G94A 3TNOA 2NLIA 4MADA 1ZTVA 3EB3A 2QGYA 2Z1VA 4MDPA 4MB1A 5CGQA 4WQ6A 4FK9A 4AXKA 1XR2A 1ME9A 3F4NA 1H7NA 5G5IA 1YYAA 3B8TA 3DFOA 1E6ZA 1SJCA 2RGMA 4J9JA 3PJXA 1E9YB 2YPIA 3OQEA 1GVQA 4XAPA 4NX0A 4ZMGA 3GTXA 1UJQA 4NUWA 2PLMA 1UR2A 1BF6A 1GOMA 3NG3A 3TKFA 4EAYA 5KEZA 1EJTC 1US2A 2FHBA 4MWAC 4C6DA 2CW6A 3U9IA 2ONEA 3ORWA 3P5ZA 1DYSA 4K8EA 4DLMA 1QATA 2P8CA 3SGUA 1KBKA 2A6NA 5I23A 2NX9A 3FYYA 3Q2DA 2PWVA 4HZ7A 2WLZA 1EIBA 2DZXA 2Z1KA 3MUCA 4OBRA 5H8MA 1UA7A 1XRVA 1ZBVA 2DVTA 2BOGX 4I8YA 4D6JA 3VIKA 2V38A 3KBMA 1EDGA 3IIOA 5HR6A 2IQ0A 2C0HA 4Y9PA 4I5RA 4DJFD 2OFJA 1XLGA 2OYKA 3W1PA 2D3LA 3KVKA 2PDMA 5HMFA 4QE4A 4E2VA 3AISA 1BYBA 2X8RA 4PMOA 3O6YX 4IZGA 4GABA 5C6MA 2R91A 5FJRA 3OG2A 1TV2A 4F79A 3N2MA 4D8LA 1WNOA 3UXLA 1R30A 4GQBA 2ZRUA 1ONEA 1ZPTA 1RUSA 3KBVA 3W9ZA 2FVMA 4ZVJA 4C7FA 1K8CA 4XTDA 4XKMA 4IF2A 1FHUA 2I57A 3HM7A 1OM0A 3FA3A 5JMUA 3VKAA 3EAUA 3L7RA 3QM3A 3TXVA 1JZ6A 2QULA 4JL1A 4NRSA 1J0KA 1Y5WA 2E3ZA 2EJAA 2RGLA 4EE9A 1ZAIA 4K39A 1QU4A 2J7CA 2PRMA 3VZYA 3NDYA 4R3UA 4Q4SA 3IJ9A 1OFQA 1DJHA 2YCEA 3KDOA 3UR2A 3BCFA 4R7JA 3G18A 1TELA 3T09A 2YBVA 3VFLA 1SZFA 3M6DA 3KOZA 4A4AA 1J9YA 3E74A 2G3JA 4IPJA 3GRIA 3WNNA 1Z69A 1WP6A 5HJXA 5KSWA 1QNOA 3JW7A 4GLEA 1TPWA 3AZSA 2R94A 2YJQA 1QO2A 2QCGA 3EEGA 3E12A 3G1FA 1YDVA 3GDBA 3TCEA 3MVTA 4ZZ9A 3NGFA 3HPAA 4B91A 1YIXA 4PMQA 5BRQA 2NVAA 2C19A 4LBSA 4KFOA 4E8CA 4HNUA 1UB3A 2X40A 1DJNA 4LNYA 2POZA 4NJGA 4QJ3B 2IKHA 2AOSA 4O1DA 1YBQB 5ABEA 4IIEA 4TMBA 3B05A 5FAGA 2PWGA 5ABTA 5G4HC 4JHOA 5AVHA 3EB4A 3U2OA 1W56A 2E0PA 1MMFA 4YS1A 5AYXA 1L2QA 1W3LA 4KWVA 1RY0A 1QTWA 3URBA 4US6A 4DXVA 1KA9F 5D8ZA 2NXIA 4ZBCA 3L9CA 5D09A 2PS2A 5LIYX 1TZ7A 5GPRA 1LLOA 4NNAA 1M1BA 1OG6A 3O2LA 1ECQA 4JTEA 3EOLA 1Y5VA 1IT0A 4LEQA 4AD3A 2G3FA 1DJZA 5H8UA 4UTIA 3DI1A 3RPMA 5BOEA 3LDVA 3M5VA 3TK7A 1LWHA 5CPMA 1CWYA 3RU8X 3QGKC 3EMZA 3A64A 4GE8A 2PDWA 3FIGA 3PN8A 2Y5JA 4JNMA 3L4UA 3AUOA 1OX4A 1B9ZA 1GPWA 3N9SA 1H7XA 5K3VA 1W2PA 2GVEA 2BMBA 1HJXA 4IJRA 3KFTA 1IEIA 2XU2A 4F48A 4YTRA 4IQLA 3LHTA 1HKWA 1PB0A 4D72A 1TSIA 2GUYA 2XVLA 1EGMA 3AYRA 3U48A 1P7TA 1QNRA 3H2NA 3KS5A 2DSWA 2VRJA 5C9ZA 1V02A 3A21A 3B8UA 4LUTA 3R8RA 3RM9A 2QS8A 2QEZA 4O28A 3BURA 2QW5A 3Q4DA 3WD0A 4CQDA 3QXBA 3WKZA 2Y24A 2H9AB 3BAXA 5I3FA 3UXAA 3HFYA 1H50A 1QHZA 2HZGA 2YYUA 4ZFCA 4PMZA 5G1TA 1FHDA 3TJXA 3MB9A 3ERPA 2HK1A 3NO3A 2VGFA 3MJYA 3BO9A 3QSTA 1LF1A 3GDTA 3R5EA 5I3GA 1XUZA 2ABAA 3I3EA 2AL2B 3EOEA 1B3VA 1M3UA 3E0IA 3W7HA 4RNJA 3P8IA 4JX5A 3ZZ1A 1S39A 4YYFA 3UCDA 1PL9A 1UA3A 3U2EA 1HX0A 4PB4A 2ZUVA 5L9FA 1VFOA 3UD6A 2ZC1A 3KCJA 1Y8BA 3XINA 2G95A 1E15A 2OWWA 4PSRA 5CLTA 4K7VA 1XKYA 1NDZA 4F4RA 3UA4A 4JDYA 1YRRA 5K9XA 1FWGC 3I7RA 4D9PA 3W2KA 2ABBA 3RPTA 3ABRA 4U3AA 3NIYA 4ERIA 4GUFA 3TN5A 3W73A 3G8RA 1XGDA 2BXYA 1ML1A 1OFBA 3SUVA 1J2WA 1E4LA 1KFWA 5CJMA 1V0LA 1QUMA 3BGAA 2G3MA 3C61A 1Q45A 5J8LA 4Q22A 4NG3A 1N2VA 1D3GA 2QIWA 3SFKA 3CQJA 4M19A 3VO0A 1UR8A 3ITYA 3W24A 4DWDA 3AZTA 3A9BA 1IZJA 3A6OA 3UW6A 4DI8A 2VXNA 2A7NA 3STPA 1FWTA 4KERA 3W3OA 3EDDA 3VABA 3T0BA 3ZJ7A 3B3DA 3NA8A 1FUYA 5FL1A 3GKFA 4HGXA 1MO0A 1TV3A 2XUCA 3M1ZA 4WOZA 1WXYA 4PYSA 3B9EA 3AOFA 2O9OA 2A3LA 1P4CA 3TE9A 1U1JA 1S3HA 1H1NA 4CD5A 2BGQA 2MNRA 4AB4A 2BODX 3P84A 1GCYA 5IRPA 1UWQA 1MYRA 3UNDA 3AAMA 1JZ7A 3GB6A 2WNQA 4DWSB 3WDHA 2ZQ0A 3A5FA 5FJIA 1VBUA 4W88A 2C14A 4MKVA 4QITA 4H9MA 3KLLA 2BY1A 1KV5A 3NXLA 1C8VA 1GW9A 2D0FA 4B4FA 2VKZG 2GJNA 2OSXA 4FF7A 3SGZA 1KWGA 3BV4A 2YCJA 3NQGA 4F3HA 5H2ZA 3H6OA 4RV3A 4GYFA 4UTLA 2OWCA 3VXGA 2E4TA 1DJGA 2A3HA 1TV7A 3R25A 3QC3A 4N9DA 3V5FA 1C90A 2AQOA 1KGXA 5T26A 1J79A 1TWSA 5LA0A 1SQ7A 3W22A 1TFVA 4AVNA 1Z6KA 3CL6A 3P74A 1NWUA 1EA9C 1SMAA 4CGTA 3MUZ1 3QVQA 5CSUA 1BAGA 3WJWA 2Q8XA 1GW1A 5EL1A 2CLOA 3R1ZA 3VVGA 3CO4A 2YDQA 3RX2A 4UMBA 1E6QM 1B30A 1UZHA 3VD7A 4DJED 3B9AA 1YW1A 3W23A 5DMLA 4AMCA 3H4WA 2QNEA 3SY8A 2XINA 3L68A 2A85A 4JQ2A 5TIMA 5AHFA 2VELA 5IHSA 3UWEA 3AYVA 1EH9A 2R1PA 3NL6A 1BXNA 3E2VA 3GSMA 3A4XA 4IL0A 3TQPA 3O6CA 3LS9A 1JCYA 3UFYA 1W5QA 1WO2A 1RBAA 4HNTA 1JUBA 2Z29A 5HPOA 4DM1A 1VFHA 3G8EA 1M7PA 5G1YA 3XIMA 2YBUA 2QDEA 3BSMA 1HN1A 1O68A 1YHTA 4QBXA 3U7BA 1E73M 3T55A 3UJ2A 4OGZA 4WDUA 4A3YA 1Q8AA 1TVPA 1ZHAA 1TVNA 2C8NA 3WIJA 3LB0A 3P14A 3T4WA 4DQWA 1V4YA 4W93A 1YLVA 1DL3A 1XG3A 4RXGA 3WQ4A 3U4AA 3PULA 2ZTKA 1Q6CA 3EDEA 1Q2SA 2OTDA 1BG4A 1CXHA 3KTSA 1LBMA 1DE6A 1EO5A 1VFSA 2VDGA 4GRSA 2WVVA 1B2YA 1FRBA 2XYLA 3NTYA 2I17A 3SADA 3WN6A 1F6PA 1GORA 2VX5A 3RPDA 1OFOA 1MFUA 4U2ZA 1Q6DA 2BVTA 3WDRA 3F7JA 3AIUA 2FJKA 2WSQA 1E0VA 2AKMA 3FYOA 2BOEX 5LKYA 1GK8A 3FEQA 3VIGA 4KWUA 4BF5A 3LEPA 4XKYA 4CN1A 1B3ZA 1B3XA 1J2BA 4OOUA 4CQ8A 5M2FX 3BOXA 2CXGA 3LHWA 3TA6A 3WQDA 3LQLA 1SMDA 3PTMA 5EBUA 2VX6A 1LM1A 4FX7A 3U2CA 5AHEA 2VEGA 3C3UA 3KVLA 4M56A 1VCFA 4HHPA 1O66A 3NPUA 1OF8A 3PANA 3W0KA 3CQ0A 5EGRA 3DKJA 4GO8A 3APGA 2YCLA 1PIGA 3KP0A 4PGLA 3O05A 3O0FA 4HD5A 5D2TA 5IDIA 3AROA 1OWQA 4GYJA 3LM3A 1JNDA 5AHNA 2VVSA 4ZR8A 3OZMA 3MSRA 4I7WA 4HHHA 5D8WA 4PBEA 2PDQA 1W37A 4GG9A 5LNUA 4MNMA 4H8UA 4AYGA 5CXPA 2JEPA 2GWNA 5A2BA 4JX6A 4ASTA 1CW2A 3GFYA 5FIPA 1YNYA 1ELSA 3ITVA 3ZT6A 3UCQA 3NJ3A 1UR1A 4ZOCA 1CLKA 3O06A 3E02A 1XH1A 3LRMA 1VEMA 3KL3A 1YDNA 2PLKA 1RD6A 2G37A 4AZGA 4FEZA 1X6LA 2VRKA 1MRQA 4V2XA 1BF2A 2EXOA 2YCIX 3T40A 3G3MA 3B03A 3GYEA 1TPH1 1ZENA 4YHEA 3QV6A 2NW0A 2VDIA 1IWPA 4LVAA 3F5LA 3B04A 1ZAJA 1YDOA 6XIMA 1GVSA 2NWSA 4AMAA 1FH7A 1H09A 4F9DA 2W61A 1XV8A 4AY1A 1UCWA 1OCQA 2WSPA 4LNCA 4JR5A 4UC5A 4YMZA 1BVWA 3WQWA 3NVDA 2GVGA 3K1GA 1MVYA 2QCMA 1J5TA 4R9XA 1EJXC 1IXNA 2P76A 2BSLA 3WLQA 5KZ6A 1A50A 1QAPA 8A3HA 1KCXA 3ANUA 4PTVA 3NDZA 4DZHA 3PAOA 5G4EA 4A6GA 1WZKA 1IV8A 1XBZA 1YXDA 1TQJA 3CBWA 3PBWA 3L23A 3A23A 3FN9A 3RR4A 1LL7A 3D47A 3GHSA 4JN8A 4JPGA 2PDBA 1Q7QA 1F2JA 2I9EA 3CHFA 4DIAA 1I2RA 1P6CA 4JEQA 4FX6M 1LG2A 3LCWA 4JX4A 4XX6A 1J11A 3WD3A 3AHYA 2I56A 5KINA 3LM7A 2QCEA 4MOZA 4NI3A 1OADA 2YX0A 3CWHA 1Q85A 5CC7A 3TAOA 4GNKB 2ICSA 4NF7A 4S3FA 3PS7A 4LFYA 1NQKA 2INZA 3BCJA 1NOWA 5PTDA 1JZ5A 4AFYA 2YFNA 3WK2A 4HHMA 1Q2RA 3W1XA 4DYJA 4MWAB 1TWIA 1A0EA 1O7AA 1LQ0A 1XSIA 1J8VA 3A3XA 3E6EA 4PODA 1XJBA 3D3AA 4C1NA 4J5NA 3APYA 3W2UA 1VCGA 5ECVA 4GQGA 5K7JA 3LGDA 4U5KA 3NUKA 4CQCA 3VDCA 1VS1A 3CZLA 4K1WA 4KWSA 4AVFA 3NYZA 1C8YA 4H9TA 4ZL1A 3GUWA 2VQTA 5A2CA 5HMEA 4A05A 3S8HA 5JBEA 1RQEA 1Q3NA 3P2VA 4WEVX 3LG3A 3LNPA 3W84A 1C91A 1XQLA 3GKAA 5M3WA 1E4MM 2PURA 4AD2A 4QLJA 4A22A 1SSGA 4RR4A 4I9TA 2CLHA 1H63A 4Q4RA 1VLIA 1F5ZA 4H8NA 3C56A 5DXXA 4LUYA 2Y70A 4C1LA 4EWND 3L4XA 3MWCA 3II1A 1W91A 4CU6A 2INFA 5TAOA 4Q7BA 1MQPA 4C6JA 1EX5A 2P0OA 4H19A 3V3WA 4B2DD 3IIZA 1ZL1A 1UP3A 2HPIA 3P82A 1WDQA 2EHHA 3QPYA 4P7NA 3GNOA 1EZWA 3SCQA 4N7QA 5I24A 2QGHA 2D3NA 3UQNA 1J12A 3UPWA 1QR7A 1OVDA 3BAIA 4PTWA 4PMVA 3M46A 4XUYA 4HMEA 2PF0A 2ISVA 1E0TA 4I3GA 4GNVA 1KM3A 2FZNA 3CASA 2H8ZA 4YCOA 1QOXA 1PCWA 3FSUA 4DI9A 4LYPA 1PKLA 4GZ7A 4BEUA 5AZ0A 3OHIA 2OZ3A 1JQVA 2E8ZA 2VFHA 3S47A 1AH0A 1NWSA 4KQNA 1EXBA 4L6HA 1JZ8A 4H6KA 4HN4A 3AWNA 1OQFA 2HXTA 1KM5A 3HF3A 3LBOA 3M0XA 1LWIA 5A8NA 5HNNA 4EPKA 1NELA 7REQA 1H3GA 2CLLA 1SZGA 5E0KA 1LLWA 1BWLA 3VNKA 4AZIA 6CGTA 3H70A 3WH8A 4P2VA 1UWRA 5HA7A 1HO1A 3IUDA 4FALA 1V3HA 2WYSA 4DM2A 1W9XA 4ZA0A 3N2BA 4R5EA 4W86A 1RVKA 4ZB2A 1QI0A 2YDRA 3GR8A 1FWDC 4K8HA 2WZMA 3CEUA 3KL5A 3W1UA 3QZAA 3GH7A 3TMLA 3EPNA 1WDDA 2YA2A 3W88A 3CTTA 1KTBA 4E0CA 3IIVA 3BXWA 2V67A 1XIJA 3VNJA 4EOUA 2J7DA 3P6LA 3OYXA 4A8RA 2ZXDA 4YPJA 3PZUA 1XLIA 3UJSA 2WVSA 5KETA 3I3BA 1TPDA 4TV5A 3PUDA 4D6CA 3IEBA 4WHBA 3QYQA 3R8GA 5KITA 1VYPX 4GC4A 4IL2A 4J3ZA 1P43A 4GZEA 3W7PA 3VIMA 4DXXA 5KZDA 3H54A 3LPGA 4OJYA 2GGHA 3WBAA 4FLQA 2GDVA 4UXDA 4L9XA 1TMQA 5BZAA 3NQ2A 3OLIA 2ZZ1A 4QAWA 4ZOEA 2OT0A 5D2WA 4QR6A 1RCQA 3UY8A 2CFFA 4C6KA 1Q13A 1KKOA 4L4PA 2HTMA 4Q3MA 1TWZA 1ZAHA 3MDUA 4JCMA 3IUHA 4KCVA 4JTQA 1GVRA 5MF5A 4QAIA 1DVJA 1UIPA 4UQEA 1JYNA 1N82A 3C6CA 1GEQA 3GNPA 1Q4WA 1D8CA 1ZQ5A 3VX1A 3F4VA 4LY8A 4ZQMA 3UWYA 1ESWA 1P5BA 1NFBA 3QJAA 4P8XA 3VKJA 2DW6A 3RILA 2WJFA 3TZFA 4BEQA 2VFDA 1J6PA 1Q6EA 3TEVA 3Q37A 1EUAA 1RY8A 2FH8A 3VCCA 4UNIA 1OIFA 3T78A 1WKYA 3VNLA 3MUAA 4CU7A 3TJ4A 1NU5A 1LROA 1JZ2A 4HMNA 3LD5A 1RA5A 1F4AA 1KBJA 1OGGA 3TYAA 5I3IA 4MJ4A 3GS6A 4JFSA 3MP5A 2CU0A 3PBGA 3UXDA 1XH2A 2O9PA 3KRZA 3PM6A 4O17A 2GWGA 3PTKA 3WQPA 3FS2A 1VZWA 1XIFA 1XSJA 4B90A 5BXRA 3FYPA 4E2BA 1ZS2A 4HCLA 4ACZA 2VT0A 1KCKA 2EPMX 3AIRA 1Q6RA 3TC3A 2Q6ZA 4KCWA 2ZXAA 4XD5A 4ZO7A 2ZKMX 4DNMA 4B5XA 5CSSA 1C92A 5EMKA 4XZHA 2X2YA 1PS9A 3W6LA 4ADUA 3LHUA 5LIXX 3NZ1A 2BBFA 4MUPA 3ZWSA 1BFNA 3KRSA 2QIIA 1F9CA 1TPB1 4ORMA 3W1LA 1FFQA 5DANA 2VYOA 4NP7A 4PZVA 1VP5A 4M82A 3GG7A 4B5TA 1RQHA 4LV9A 3VDBA 4QS5A 1UP0A 5JBFA 1QK2A 3DOPA 3WELA 2ZWYA 2Q3OA 3GBEA 3SY5A 3FDKA 1W8GA 2HCVA 4JKMA 3CPGA 3AIBA 4POCA 3TYCA 1AUSL 3GXTA 3K46A 1JFHA 5IM51 4V28A 3TW9A 3OOQA 2TPSA 2IPJA 2J9YA 4U33A 1GG0A 3A22A 2XGIA 2GJLA 4Z2KA 3CQHA 3KS6A 4XWUA 1H41A 2Z1SA 5CCZA 3O15A 1I4NA 5A6BA 2CHRA 4DRSA 2OOFA 1A4LA 3W7GA 1ICSA 4W7UA 2WC3A 3GR4A 4CEXC 4M5PA 1E3ZA 4XTIA 3EYPA 4JHMA 2E1WA 1XQKA 4P7QA 1R0MA 1UWTA 4JYFA 1W9DM 2DT3A 2BWGA 1UHVA 3VIPA 1EJ7L 2A21A 1OABA 2DZVA 3AQUA 3D5HA 3TJIA 4D71A 1SW7A 3N2OA 1D7KA 1JVNA 3NOYA 3H7RA 4MB5A 1KCZA 1EFZA 2E9LA 4AYSA 3NNTA 3E0FA 3MYPA 4JTUA 2PDFA 2F7FA 1QI2A 2X42A 5BU9A 1E3XA 1F05A 3W00A 2B7OA 4O1CA 4UCFA 3MS8A 1LOQA 3POCA 3CMGA 4XSLA 4CQAA 2OXNA 4V33A 2NUXA 5LIUX 4UTMA 4OQVA 1PEZA 1HJWA 4CLMA 1RR2A 2QUMA 3BQ6A 1EBHA 1LL4A 5C5YA 1FWSA 4ZENA 4UZSA 1J0IA 2PCQA 3H23A 3F4DA 4H00A 1TPVA 1EJVC 3NQFA 2Y1HA 5HQLA 3ARPA 3FAXA 3BPWA 5GJNA 1JZ4A 2GPTA 4Q4KA 1BTMA 1QBBA 2VEPA 3QW4B 3GW3A 4DEFA 1XLDA 4GBUA 1E51A 4GACA 1VKFA 3TUUA 4AIBA 2J79A 5DFAA 3IGXA 5C9RA 3A3HA 4OTKA 2C1HA 2GGJA 4A3HA 3SECA 3L0GA 2L5HA 3EKZA 3I4KA 3VIHA 1TG7A 1W9VA 1XDLA 3W1RA 3NZPA 3OVPA 5AC8A 3AIWA 4GIEA 2WW5A 1U22A 1A47A 2GSEA 1JDFA 3VIOA 4PMYA 3N3TA 4DO6A 5LA2A 4H6RA 3MA8A 3MI2A 5C54A 2TMDA 3PSWA 3OB8A 4HPHA 2XZ9A 4XK2A 4DBWA 5A5WA 4AD4A 4XUGA 5D4YA 1XD1A 4N4QA 3CAWA 1OEPA 5H6HA 2Y88A 4P7OA 1CIUA 4XAGA 4BCEA 4RZ4A 1K7FA 4C65A 1JYVA 1WV2A 3C2YA 3LYEA 1FCBA 3ZVHA 2QKFA 1FA2A 1M7XA 1V3MA 5A6MA 3M5ZA 5I3HA 8RUCA 3WLTA 3VUSA 5ABFB 1VR6A 2CBUA 3TLLA 5FEWA 3TYDA 2E77A 4J7RA 1L9WA 1A5SA 1OFDA 4Q6JA 1P1MA 1R87A 1C29A 1A3XA 3W7MA 3OVRA 1XLKA 3EWZA 4WVXA 5FAJA 3POHA 3W7DA 3C5QA 3GD6A 3JS3A 4C6OA 3KVMA 4I5UA 3E5PA 2UZ9A 1BGGA 2ISWA 2JIEA 3LRLA 3QQ1A 4FNTA 2HPMA 1LRTA 3S6OA 4Y90A 2OLAA 1UH4A 1ZB5A 3W7QA 1JUEA 1Q6OA 3GZAA 1WKEA 4PN2A 4Z2JA 5DCDA 3IJ7A 4QQUA 1RHCA 4UTKA 1RD5A 3PG9A 1VIWA 4X61A 4ONVA 4IOTA 4DJDA 4REQA 3S0CA 2QMKA 5AZ1A 2J77A 3BZGA 1WAUA 2XWEA 1MSSA 3U5UA 5LHFA 1M41A 4WKHA 4QSFA 1DWFM 3OIHA 3T2PA 2W3ZA 2G96A 5U7SA 3EKLA 4O13A 3SBFA 2EPNA 2XG9A 4NT0A 4UTWA 2YR1A 1OFPA 3USZA 2G3NA 3N29A 5EA9A 3VPLA 4I9JA 4MFEA 1FWNA 3HV8A 1D9EA 4KEMA 1E5JA 2ZRYA 2OELA 4NRRA 3THDA 3UZJA 2JKEA 1XLJA 2QVHA 2O9TA 4NJHA 1KFKA 3UA3A 1NVMA 2QJIA 2J66A 1DQUA 3EBVA 4WGXA 2F38A 1NDVA 4CCZA 4H04A 4JQ4A 5FF7A 3LCGA 3DU0A 5DF0A 2V3EA 4YTQA 3EX6A 1ADSA 3S1VA 5RUBA 1S1PA 3QRHA 4PA8A 8XIAA 1XICA 2OZ8A 4JD4A 1WDWA 2UY5A 1RPKA 1XYBA 5M5DA 2ZA1A 3WMCA 5I79A 4L56A 1BXCA 3RX3A 5I3DA 3NSNA 3FJ6A 3GFXA 4WXYA 1F7BA 4N6EA 2WZEA 4HPNA 4LV4A 3W74A 5E0CA 4E2DA 4JYEA 1XYLA 2P0IA 5I02A 4N4PA 4IT1A 4GUGA 2ZX9A 4AY8A 2R6OA 4KGJA 3TN6A 4XQ6A 3EWWA 2J88A 4AG0A 4K38A 4PEEA 2CKRA 4FNSA 2Y7FA 1TJRA 1PHWA 2Z26A 2E6AA 5REQA 1G4TA 4MPKA 4IP4A 1R3SA 4WKAA 3H2CA 2DGAA 5DY2A 4M3PA 4MLRA 3FDGA 2GOKA 2A7RA 1MUWA 3TTOA 1FHVA 3T8QA 2HE5A 1ADDA 4ICMA 3H7UA 4LF1A 1LQAA 1BVZA 4IPNB 1UR4A 2J62A 3UG4A 1HL9A 2XSAA 1VBRA 4JXCA 5D2VA 3CB8A 5I3KA 3AI0A 4HU0A 1VB9A 4PMDA 4KGLA 2XIBA 2BB0A 2R9RA 1NDYA 3LENA 4NYUA 2FHFA 1H49A 4GC3A 4JGDA 3R6IA 4US5D 4AZ7A 3S1XA 1U5VA 3QLLA 2QAPA 3CH9A 3S9IA 3W25A 2NQJA 1EHAA 3CZEA 4NNBA 3T05A 1IR2A 1CXKA 2PGRA 3UXIA 3AZRA 4FB7A 3LZ5A 5DCEA 2GDQA 1Q5MA 3ARWA 1XP3A 1GPFA 2JE8A 2FYMA 3WUEA 4ZQOA 4LSBA 4LUSA 1UUQA 1ZP4A 2ZX7A 1V08A 1L6WA 4GK8A 3C4UA 4AXNA 4FZIA 3KTCA 4UNKA 4JTDA 4O50A 3REQB 3RM4A 4YNGA 3QHMA 2IPWA 1JF6A 4IQDA 2YB1A 3CC1A 1IZKA 4AIEA 4BWLA 3CJPA 3PTDA 2V81A 2RKXA 3GC5A 1AQHA 3UXKA 3VKCA 1CEOA 1SPQA 3WH5A 1BWVA 3N11A 3FKRA 2ZZ4A 2QYGA 2V30A 4Q8QA 2XDFA 2E25A 1J5SA 3OVGA 1KC7A 6A3HA 3MKVA 4S3DA 4URIA 1JDAA 1NTHA 3ZVIA 4L6OA 5BW6A 4ZO8A 3C0JA 4J2PA 3SN4A 5F2IA 1VBJA 4NZ5A 4C90A 1JCLA 1UW9A 2PUZA 1FXQA 4CNNA 3W72A 3WG6A 4RX0A 1OX6A 4DJDD 3FFSA 2XFFA 2D23A 2C79A 2PDLA 8XIMA 1BSLA 4A8IA 1OC7A 5A2AA 4AWTA 3CAKA 3DG6A 1SJAA 5A6KA 2I7GA 4MZ8A 4JFWA 3MBDA 2PGEA 1E55A 4MYXA 4IPIA 4BK9A 1JZ3A 1JCTA 1LCOA 3FA4A 2GK1A 1S1RA 4X2RA 2Y89A 4NVTA 4MB4A 1VFFA 3W2LA 3P60A 2XH0A 1TPFA 1P0BA 4IHCA 3UGRA 1YXCA 4I7UA 4HNCA 1A53A 3OGSA 1LG1A 4Z42C 5LGXA 4HJWA 4WR3A 2GYIA 3W7IA 3UVIA 3QV9A 4A8LA 1FP9A 3VOFA 1AD4A 1XH0A 1YTDA 3ITXA 1FWAC 3KBWA 2PRHA 4OUEA 1Z9AA 3OW1A 3HJZA 4H7VA 2VCCA 5CAHA 4F66A 1GJUA 3QQ0A 4DUXA 3E0WA 3LNMA 4LVFA 4HU4A 5IFPA 4Z2HA 3W76A 3QKZA 2V68A 2Z0IA 3URAA 1IEXA 3AIVA 1VRDA 3K2GA 4N42A 2Y7DA 4B5SA 5E93A 1KXHA 2OPJA 2B81A 1VFMA 1R5YA 4H8VA 2XVNA 3WLPA 3UP8A 1AW5A 1QT1A 3COTA 3BJFA 2XH7A 3DX5A 5B7ZA 4XZBA 1HTIA 3VNYA 3WH9A 2HV5A 1GYLA 4FF5A 2HISA 2PRLA 3MP3A 2KX9A 1FFRA 3QC0A 1ISWA 2ZIDA 3MO7A 3C2RA 2Z25A 2OEJA 3MUIA 4IMFA 1KFBA 5LIKX 2EG8A 3TSBA 3WX7A 3CZGA 1PCKA 1UYQA 2YSWA 4HYVA 1P0KA 1NY1A 1QK0A 3AXMA 3NSMA 3NZQA 3RLHA 4YJ5A 2TSYA 5CPTA 2AAAA 3WF3A 1X6UA 1P7TB 2E8YA 4DF2A 1KXQA 2PBGA 1LP6A 1POJA 3G3DA 2WHJA 3A5VA 3LCIA 4ML9A 5EBAA 4DAIA 3CQIA 3TN4A 2HNEA 9CGTA 4WDWA 1UASA 4HTYA 3S9ZA 3MV01 4OOZA 2DH3A 4D6IA 2A79A 3HTWA 1WXJA 5CBJA 1CENA 1HL8A 2EG7A 3GNXA 4FIQA 1KO0A 4KWWA 5JBDA 1FWIC 2ZRXA 3W6YA 4J35A 4QG6A 1NFPA 2GVLA