3WQ4A

Crystal structure of beta-primeverosidase
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
475
structure length
475
Chain Sequence
SFNRTSFPDGFVFGAASSAYQFEGAAKEGGKGPNIWDTFTHEFPGKISNGSTGDVADDFYHRYKEDVKVLKFIGLDGFRMSISWARVLPRGKLSGGVNKEGIAFYNNVINDLLSKGIQPFITIFHWDLPQALEDEYGGFLSPHIVNDFRDFAELCFKEFGDRVKHWITMNEPWSYSYGGYDAGLLAPGRCSAFMAFCPKGNSGTEPYIVTHNLLLSHAAAVKLYKEKYQAYQKGQIGITLVTYWMIPYSNSKADKDAAQRALDFMYGWFIEPLSFGEYPKSMRRLVGKRLPRFTKEQAMLVKGSFDFLGLNYYIANYVLNVPTSNSVNLSYTTDSLSNQTAFRNGVAIGRPTGVPAFFMYPKGLKDLLVYTKEKYNDPVIYITENGMGDNNNVTTEEGIKDPQRVYFYNQHLLSLKNAIAAGVKVKGYFTWAFLDNFEWLSGYTQRFGIVYVDFKDGLKRYPKHSALWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-primeverosidase
publication title Crystal structures of beta-primeverosidase in complex with disaccharide amidine inhibitors.
pubmed doi rcsb
source organism Camellia sinensis
molecule tags Hydrolase
total genus 188
structure length 475
sequence length 475
chains with identical sequence B
ec nomenclature ec 3.2.1.149: Beta-primeverosidase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wq4A00
2GUYA 4K68A 4NF7A 4JFWA 2WHJA 2J75A 1V6YA 1B31A 3OZOA 3U7VA 3PZUA 4N0RA 1CYGA 1CXEA 5EBAA 3W26A 1B2YA 5E9AA 5A2BA 3CUGA 1PAMA 1EQCA 2YBTA 2EJ1A 2D3LA 1Q6FA 1XSJA 3BAYA 5E6ZA 1M01A 3AOFA 1CBGA 3NYDA 2YDSA 2ZUMA 3ZO9A 1DHKA 1MW0A 5LA0A 5FCZA 2GK1B 3TONA 1FH9A 3PBGA 2NT0A 4AMCA 1ESWA 3ZMRA 1LJYA 2D1ZA 2XVNA 2VOTA 3UG3A 2DSZA 2E9MA 3VIFA 3VNYA 4PBGA 4M1RA 1FH8A 1EA9C 3WMCA 3UG5A 1W3LA 4CD8A 4JFTA 4ATDA 1CDGA 3AXHA 4JIEA 3IAQA 5DMYA 2BFGA 2XVLA 5BYWA 1WE5A 1TMQA 5CPTA 2TAAA 3UERA 3WY1A 4CUCA 1U33A 1C7TA 1C8YA 1DWJM 3AZRA 4EKJA 4RE3A 1HJQA 2D2OA 4W7UA 1V0KA 1GHRA 4WSJA 1FA2A 4BQ3A 3L4XA 1E40A 4OOUA 2VVNA 2XWEA 4BQ4A 2XUCA 3T09A 1E70M 3ALGA 4AZ6A 4RE4A 1OCQA 3FAWA 3PZQA 3GXMA 1D3CA 1HKJA 2EO7A 3AHYA 1ZJBA 2HVMA 3CTTA 1LL4A 2ZUWA 2XTKA 1UD5A 1V3KA 4PSPA 1E9LA 3VKKA 2GJRA 1XYFA 3WNLA 3KL3A 5D8WA 4D6GA 5IFTA 4FF5A 3WEOA 1UR4A 1J0HA 3IJ9A 3AYRA 2PF0A 5LA1A 1TVNA 5I5RA 4M8UA 3CZ8A 1WDRA 4PUDA 5EFFA 4ACZA 5A6MA 1FFRA 2JEQA 5BROA 3VX0A 5CSYA 1R87A 4HOZA 1QNRA 1BYCA 4C7DA 5A6JA 1Y7VA 4JFSA 5D9MA 1DWAM 2FGZA 4UQDA 3MUY1 3VPLA 4ZE4A 2YJQA 4FK9A 4IPNB 3ZIZA 3CUFA 1IV8A 4B15A 4D71A 1KXTA 1VEMA 3VDHA 3W4RA 5D8ZA 4MADA 3AI0A 3IJ7A 4P7LA 1VFFA 2O9PA 2QF8A 3AS0A 5A6LA 5ABGA 1CXHA 4MJ2A 1E6SM 3MV11 4LXFA 3OB8A 4B9YA 2OSYA 5D9OA 2CEQA 5LA2A 4JFUA 1VEOA 1JYVA 2VCAA 3AMCA 5IFPA 3VDAA 1UH4A 3MS8A 1BSIA 3DYPA 3CHCA 5A6AA 1GVYA 3VIPA 3FXYA 5M3WA 5CJ5A 2Y8KA 2VL4A 2XGBA 4F9DA 1NP2A 2Z1KA 4QP0A 3WD3A 4NI3A 1V0MA 4PTVA 1CZ1A 1R8LA 4Q7NA 3UR7A 3VIMA 1GUVA 2IXUA 1V0NA 3ZOAA 4W89A 1VB9A 4P8UA 1E6NA 1E0VA 2OSXA 2VX6A 5FOOA 1BAGA 2G41A 3ARPA 4AZGA 1TR1A 3VGBA 2CKSA 1PJ9A 5A6SA 4H8VA 2W61A 1E72M 3WQ5A 4HTYA 2WB5A 3SCPA 2J62A 1WCGA 2VJXA 4H8UA 1SYTA 1TUXA 2VO5A 1FP8A 4W93A 1MFUA 4TOQA 1KWGA 1DEDA 2EQDA 1V3IA 2IXVA 1BYBA 5CGMA 4CKQA 2G3MA 3DYMA 2XSAA 3KL0A 3VINA 1IZJA 4YHEA 4GI9A 5CQ1A 1JYWA 4PUEA 3L4TA 3PZTA 4CN1A 1QNPA 3WH8A 3WD4A 4M80A 2WHMA 3AXXA 3GXFA 2Y4SA 3NIYA 1UWSA 3D5HA 2ZUNA 1JZ8A 1WKYA 1ZBVA 4LPCA 4W84A 1MFVA 2WCGA 3AHVA 4C7GA 3JUGA 3WF4A 1UWTA 4AEEA 4X0VA 1PZ2A 5E70A 3TTSA 1W9DM 5KEZA 1ZB5A 1PIFA 6A3HA 1V6XA 3T2QA 3W29A 4ML4A 3UESA 4WF7A 1C8QA 1UD8A 5BXTA 1FHDA 2YBUA 3VD7A 3AIEA 5I23A 4AIUA 3AFBA 2YOCA 3CO4A 2G8ZA 4AZCB 1B0IA 4KH2A 2FHCA 3PZVA 2E3ZA 1GJWA 2XJ7A 4YN5A 1UD2A 5ABFB 4PTWA 1E4LA 1H5VA 1FHLA 2OWXA 5ECUA 1XGZA 4WK9A 1QI3A 4CN4A 1Q6CA 1VFMA 2D20A 3BSGA 4AEFA 3RDKA 2GVYA 3AIBA 1QHPA 3QOKA 4W86A 1BTCA 4JL1A 3WQ4A 1UZ1A 1E55A 4P7QA 3FHAA 4XX6A 2WVSA 5E09A 2PWDA 1ISXA 5I77A 2CHNA 1LL7A 1Q6EA 3BMVA 2OSWA 4H04A 3AMKA 3EDEA 2CBUA 1S46A 3THCA 1GNXA 1CECA 1J0JA 3GNOA 5JBDA 1G9HA 3UETA 2E9BA 5BXPA 3L2LA 1ZBCA 1E6XM 2WLZA 4ZFMA 1NWSA 2YA0A 4MAZA 5BWFA 2GDUA 4D6IA 5HBFA 1CENA 3MU7A 3QHMA 4RL3A 1VJSA 2XVPA 3AMLA 3HU7A 3ZT6A 1NWUA 1BLIA 3L4UA 4J3WA 4TVUA 4AD0A 2BNJA 2WM0A 2CNCA 1Z32X 2WYSA 1W9UA 2VTFA 2B31A 3RJXA 1G94A 5I78A 4PCTA 2JIWA 2XYLA 2WCAA 3DECA 3RIKA 2ZX9A 2EBNA 3PZMA 1LQ0A 3AXIA 4HP5A 2EXOA 1HJVA 2DIEA 3A3HA 4UZSA 2OLHA 2E8YA 5JIPA 3ZR6A 1ZJAA 3EMZA 4P7OA 4W8LA 1VBRA 3QGVA 5I24A 1W9XA 2JE8A 3IANA 1E6RA 1J01A 4MNLA 2WCSA 2E9LA 2XIIA 1XCWA 3F4VA 3G6MA 2CITA 2QPUA 2FDMA 4J3UA 3GH4A 1NQ6A 2XM2A 4QFUA 3WFZA 2QLYA 1W3HA 2V5CA 3M46A 3ARRA 4PMVA 1OSEA 3VU2A 1CGYA 2PC8A 3SCRA 3WH9A 1WAWA 3KWXA 3PTKA 1GQJA 2YA1A 3UCQA 2V3DA 1CXKA 3GZAA 3WDIA 1E56A 1V03A 4AIOA 4JAWA 4EAMA 1B3WA 3WBAA 1K9FA 4NSBA 4UCFA 1DWGM 5A1AA 2WC3A 3CGTA 5A8NA 3F5LA 3OA5A 2DIJA 1PX3A 1C8XA 3RCNA 4CD4A 3VOCA 3NUKA 3K4DA 2W62A 1GZJA 2UY5A 3PHAA 4QLKA 4FLOA 3A4WA 1VAHA 2ZIDA 4MNJA 2VR5A 3IAPA 2NSXA 3SEPA 1HP5A 1H0GA 1JL8A 1W9PA 2W63A 5ABFA 3DHPA 5ABHA 3ARTA 3I3DA 1I1XA 4PCSA 1QNSA 4HU8A 3ZQ9A 4MNMA 2J7DA 2GJXB 3VMPA 2WNWA 3N1AA 1KBBA 2VX4A 4AZIA 5A8MA 1E4IA 5ABEA 4TTGA 3AICA 5FKYA 1H1NA 1HJWA 1GOIA 4AD3A 3POCA 2NW0A 1QOXA 1OGGA 2OYLA 3OGVA 4ZXLA 2EPKX 1UR1A 3VO0A 1B3YA 5IDIA 3SUSA 1JFXA 1MQQA 3RM8A 4CD6A 4ACZB 1SMDA 1ODUA 1V02A 4DWSA 2VQUA 1TVPA 2DSWA 3KEHA 4ZENA 1GQIA 3OLGA 3RJYA 3VMOA 3BH4A 1B3XA 1GORA 1HN1A 1C90A 1TG7A 2BY1A 4PN2A 3GNPA 3WNPA 3BLKA 3TTQA 1OD8A 2XFFA 1TCMA 2VUYA 2QHAA 1GQKA 3CHDA 1TE1A 1ISYA 1DP0A 4IUGA 2VZTA 4E8CA 3O2LA 4CU7A 4DUVA 1VENA 3A4XA 5E0CA 4PTXA 2VVSA 4B16A 3WNOA 2WXDM 3ZJ6A 1UWUA 4MTVA 1UH2A 2YL9A 3K1DA 4C7FA 1JNDA 2GSJA 1SMAA 1BG9A 2BY3A 2VC9A 4MB4A 2DH3A 4OJYA 1BGAA 1CGVA 4HA1A 3WUBA 2WMFA 3CZLA 3SCTA 3QR3A 1CEOA 1EQPA 3IJ8A 3WMSA 3CMGA 2AAAA 1EOKA 3HJEA 1EO5A 3S2CA 5FIPA 2WSKA 3ARXA 4BQ5A 1EXPA 3OLDA 4HU0A 4TXEA 3N12A 4X9YA 1MW1A 3B9EA 2XFRA 1E71M 3WQWA 1KGWA 3SCQA 4S3JA 1RD6A 4W88A 4W8BA 2J78A 1DTUA 2UY4A 5HPOA 2J74A 3AIUA 2W5FA 1QBAA 2BHZA 5GNYA 4AC1X 4QDMA 1OINA 3CUIA 4WIWA 1B90A 2CCRA 5DT5A 3SUUA 1EDTA 2Y5EA 2VX7A 4PMUA 5LYRA 2D23A 2ZXBA 3WNMA 3CZGA 4IPLA 1UD4A 1WPCA 3MMWA 3VX1A 3BLPX 4DUXA 4GI8A 4FLQA 1E1EA 3L4YA 1H3GA 1UQZA 4AW7A 2X2YA 1AMYA 4AY1A 4AZBA 3K8KA 5BXSA 1XYZA 1JAKA 3SCUA 3VVGA 4WLCA 4PEEA 2VZOA 2D0GA 2YA2A 4PMZA 3VD4A 3II1A 2VNCA 3W6LA 1UR8A 3W0KA 2A3CA 4YPJA 5TD4A 4UOZA 1RP9A 1E15A 1RP8A 3FHQA 4UQAA 2GJXA 4HPGA 3U7BA 1MYRA 1IT0A 1WZAA 4LYQA 3F5JA 3M07A 1W91A 5JBEA 2YDRA 1C92A 5DFAA 3GBDA 4NRRA 4MAVA 2X0HA 2A3BA 2W92A 3L2MA 2DH2A 1JZ4A 1B3ZA 3ZT5A 3K46A 1IZKA 3VD3A 1W32A 3LPOA 1GPFA 1J9YA 1XH1A 3O9NA 4OBSA 2ZXDA 1HIZA 2J4GA 1H11A 2CIPA 4D6JA 2VZUA 2CBVA 2YL8A 3ECQA 2WWDA 3L4VA 3W28A 2WVVA 3SCNA 2XM1A 1GONA 3BC9A 3CUHA 4TUFA 1QI4A 3NDZA 2CKRA 2ZUVA 5IHRA 2WC4A 1C3FA 1KGXA 5DEZA 2JFEX 1GJUA 2WMKA 9CGTA 1VIWA 3THDA 4LGXA 1J12A 2YL5A 4P8VA 1FP9A 1BPLB 1PPIA 1FOBA 5D4YA 1EGZA 1E4NA 4AISA 1WZLA 2DEPA 4CVUA 3GM8A 1D7FA 1B30A 4ZXOA 1HT6A 1MW3A 1JIBA 4M56A 1WZKA 4CCEA 3RO8A 4AZHA 2G3NA 2O9TA 3GH5A 3LPPA 2CHOA 3VUPA 3PZOA 1H41A 4D6EA 5D9NA 2GJPA 1O7AA 1AQMA 4PSRA 2RGMA 3N13A 4EE9A 4H7VA 2WKLA 4QLLA 5I0DA 4AD1A 2WZHA 1TFVA 1QNQA 1XH0A 1HVQA 3MANA 3IK2A 5BRPA 4MJ4A 1NOUA 4D1JA 3T0AA 2Z1SA 1QW8A 3W37A 3GDBA 5AYBA 3WUGA 4CU6A 4XB3A 1UHVA 1OB0A 1W1PA 3WH6A 1I1WA 1MVYA 1DWFM 2CPUA 1NP0A 3WDJA 4ATWA 5I3DA 3NCOA 2WMHA 3SCOA 1L8NA 3FAXA 4J28A 1V6VA 1ITCA 1OGSA 3UG4A 1C91A 2VQTA 2VR4A 3WENA 1M04A 2JF6A 1UKOA 5A8PA 3OBAA 4BA0A 1OBAA 3VGFA 4WKFA 2PWEA 4IISA 1VBUA 3MSGA 4H8HA 1R85A 1MWOA 4DUWA 1NWRA 3MSDA 4GPNA 4GQRA 3CPUA 1OIFA 5CXPA 1BYAA 5IXEA 1UZ4A 1R7OA 3CLWA 1L0PA 4KGJA 1K9TA 2XPKA 4D72A 4GO8A 1J0KA 4LYRA 1UKTA 5DO8A 2WBKA 4PTMA 4URIA 3ZM8A 4WJXA 1JZ2A 2ZUSA 5GPRA 2J7BA 1J11A 3WDPP 1M53A 4V28A 1KXHA 2BVYA 3W25A 1KBKA 4KRUA 2QV4A 2W91A 4OOZA 1G01A 3WIJA 1HJXA 3MUAA 3VM7A 3G6LA 5A3HA 3W27A 2YL6A 4AWEA 3ALFA 1UR2A 2DT3A 3WF0A 2OYMA 1GCYA 2XHYA 3RMEA 4PMXA 4D6DA 1US3A 1QW9A 1W1VA 4E2OA 1B3VA 5EMYA 3PZ9A 4UQ9A 5HNNA 3K4AA 3SCSA 2CESA 1V3HA 2FHBA 4M24A 1NOFA 3BAXA 4UFJA 5BCAA 4UOQA 1PEZA 2ZE0A 3AYSA 4Z2LA 1ISZA 3UEQA 2DPEA 4N42A 2BVTA 4DWSB 2EPLX 4UFKA 2JEPA 1NM9A 1UG6A 4M81A 1ZU8A 4HMEA 2OWCA 4W5ZA 1R7AA 2WAGA 3B9AA 2CERA 4GZIA 1JDAA 1GVIA 2XG9A 1HKMA 5HDRA 5A8OA 3KE0A 3WL0A 2VZSA 5BRQA 2AOSA 2AMGA 4JKLA 2BHYA 2JIEA 3I3EA 5AY7A 2Y24A 3BCDA 2O9OA 5CZKA 4P8WA 1J0ZA 3ARUA 4W87A 3AIRA 3QHNA 2J25A 1G1YA 1EIBA 1QI2A 2ZX7A 4Y7EA 2YLAA 4UFMA 3NSMA 4YHGA 1JXJA 2J7HA 2D0HA 2F2HA 1KB3A 4GINA 1PX8A 1E0WA 1D2KA 2VRJA 2ZX5A 2DSUA 2WSPA 2HISA 2E8ZA 2UY2A 1PIGA 4CGTA 2CYGA 2PBGA 5M5DA 2G3JA 5CLTA 5FL0A 1KCLA 1X6LA 4QAWA 3ZSSA 1W1TA 3PZNA 3CHFA 2D22A 4HA4A 2Q8XA 3TP4A 4W5UA 1LLOA 2EPMX 3WF2A 2DSVA 3VIOA 1CIUA 4A4AA 3SUVA 1BVZA 1CNVA 3RPMA 1WB0A 5A94A 1O6IA 3WEMA 1NH6A 3AISA 4D6FA 2BHUA 3SUWA 2G3IA 2CBIA 4AIEA 3WD2A 2C0HA 2FH6A 4TX6A 2XVGA 4F79A 3OG2A 1CXFA 2BXYA 4D6HA 1E3XA 2E40A 4CN6A 1TA3B 1GW1A 4LX4A 3VNZA 1A47A 3W53A 2DQXA 2YKKA 2VURA 1SFSA 2V5DA 4E8DA 4QCFA 3LPFA 2V3GA 1LG1A 1UWQA 4JHZA 1BVNP 5JIWA 1HXJA 1JYNA 3AMDA 3EDDA 4V2XA 4Z2KA 1US2A 2WANA 2QMJA 3MUZ1 1BGGA 4JCLA 1WDPA 3VD5A 3TA9A 2QPSA 3VM5A 5CG0A 4TX8A 1JF6A 2ZUUA 4X0NA 1HJUA 4PMDA 2NT1A 2BY0A 1CXLA 4PMOA 3HN3A 2X1IA 1OT1A 1VJZA 4DWSD 4UQBA 4QLJA 1M7XA 3ARSA 4LYPA 3RILA 3U5UA 2F8QA 2VMFA 2FH8A 2ZX8A 4U3CA 4H41A 3W38A 1UWRA 1E6ZA 3AS1A 3WQ8A 2VI0A 3WD0A 2A3EA 3WUEA 3SCVA 1CGTA 4A3YA 1V3JA 4CCDA 3A4AA 2DGAA 2PWHA 2YLLA 2XGIA 2ZICA 1Q4NX 1LF1A 4HPHA 3VILA 2G4FA 5CSUA 4JL2A 2D0FA 1UKQA 2XSBA 3VGHA 5E0FA 3BXWA 2WVVB 1JAEA 2ZWYA 1EDQA 3F5KA 4WKAA 1OWQA 3LMYA 1QHZA 3AHZA 4BS0A 2E4TA 1UA3A 2FGLA 4XZBA 1J0IA 3AHTA 3VD9A 3GBEA 2O9RA 2Y2WA 2PWGA 4CU8A 4U5KA 4OZOA 1EOMA 2A3AA 4E4PA 4B9ZA 1V02E 1AQHA 2WK2A 3GH7A 1VFUA 4HZ7A 1LG2A 4A3HA 5AC4A 2W66A 2WVUA 1XSIA 1QHOA 4BQ2A 1E6QM 2UWFA 1J0YA 1W9BM 4XUYA 1UYQA 1I75A 2D24A 4TTUA 3FY1A 4AYSA 1QI5A 2WBGA 1W9VA 4U2YA 1JZ5A 2EPNA 1XHGA 2VCBA 1QPKA 1DWIM 2CETA 3WEZA 1UKSA 4GQQA 1UD6A 1UQYA 3OGSA 1KGUA 4MDPA 3WMBA 3B8SA 4KWUA 2EEXA 1KXVA 1UR0A 1AQ0A 2V3FA 2D3NA 2ZXQA 3VIIA 3FN9A 2UY3A 5AYIA 1FH7A 4J3VA 1NARA 2WWCA 1N82A 5FD0A 3LPGA 4JZ5A 4OBRA 3VIJA 1HL9A 1XRVA 4UR9A 4PMRA 1ODZA 7TAAA 1WO2A 1E0XA 1XD0A 5GQBA 3AIQA 3S6TA 1TA3A 3ZT7A 2W4XA 5GNXA 5JBFA 1BQCA 5KZ6A 4M29A 1BFNA 2WKGA 1GQLA 1Q6GA 3AS2A 3ZR5A 3D3AA 7A3HA 1UKPA 2CXGA 3WBEA 3VMNA 2W67A 3NSXA 3W24A 4MB5A 1CLXA 5A69A 5EFDA 4UZUA 1CWYA 1KCKA 1X1NA 3W81A 3NSNA 4PMYA 1CGXA 3M6DA 4Z2IA 1XV8A 4P8XA 5EB8A 1JYXA 2BS9A 2VX5A 2BV9A 1E3ZA 4CVWA 4QCEA 2J7EA 2WPGA 5C70A 1B1YA 3CZJA 3AZSA 1BF2A 1GOOA 1H09A 2DT0A 4BCEA 3AHXA 4PRWA 3DYOA 1LL6A 5I79A 1M03A 3WSUA 1ZS2A 2ZX6A 2ZWZA 3T0BA 5JUVA 1RH9A 4MNKA 1SR0A 1JDCA 3NJ3A 2OWWA 3WH5A 4KMQA 1EDGA 1JFHA 1MW2A 3N18A 3CUJA 3TTYA 1UD3A 2WMIA 4TVDA 4J27A 4JFVA 3MUIA 1UOKA 4LQ1A 1JD9A 4S3KA 5D9PA 5CLWA 3SUTA 2JF7A 5HPCA 3BAKA 1OIMA 4ZEPA 3ZJKA 5A6BD 4W8AA 4M82A 5DT7A 2WMGA 4L4OA 4GKLA 4H2CA 2V3EA 2OYKA 2C7FA 2YDQA 2VT0A 1P6WA 2DT2A 1JD7A 4J7RA 2Y8VA 1R86A 1RPKA 1UWIA 4HZ6A 1LWJA 4HZ8A 1KWKA 3A47A 1EH9A 1PBGA 3E1F1 3N9KA 1B9ZA 4BZYA 5M03A 3WD1A 2J77A 3BCFA 4UNIA 5A6BA 4D6CA 4OIFA 3U57A 5M17A 3BMWA 1J10A 2VZVA 4GZEA 3VDCA 3AZTA 1ITXA 3SCWA 3AQUA 3EYPA 5E6YA 3OGRA 3EMCA 1WDSA 1HKIA 3ARQA 4V27A 4F9JA 4B3KA 5IHSA 3RM4A 2WC7A 2GDVA 2ZXAA 3KZSA 1VRXA 3BAIA 3ARVA 3VGGA 4MB3A 3QOMA 1JDDA 2GK1A 4PMQA 4HOWA 3W82A 1ISVA 1XCXA 3AIVA 3EBVA 3WF3A 3WQ6A 4NZCA 2BY2A 3N17A 3AROA 3ARYA 3BAJA 5A2CA 3MO4A 2ZOXA 1JI2A 1V3LA 2WHLA 3GXIA 1ZBWA 3DHUA 1EHAA 3PTQA 5A2AA 5F7UA 2X05A 1E73M 4AXNA 1DWHM 2VRKA 4WKHA 1OGBA 1MXDA 1JF5A 1OM0A 1WP6A 3TOPA 5A95A 3VGEA 4U2ZA 4AD5A 3U5YA 1K9EA 6CGTA 3WKZA 2VCCA 3PZGA 4W7VA 1GOMA 4UOJA 3SURA 2BVDA 3VTRA 1UR9A 4Q22A 2WVTA 2XFYA 3ZSTA 3AMGA 1OT2A 1EO7A 2C8NA 5BXRA 3DC0A 1V3MA 3MMDA 1ECEA 1ISWA 3PTMA 4CCCA 1KQYA 1FFQA 1VF8A 3CIVA 4UFHA 1JZ6A 2WHKA 1F4AA 4KGLA 4Z2HA 1BYDA 3CZEA 1W1YA 1CGWA 1JXKA 2CBJA 3PZIA 1H4PA 1V6UA 2J8GA 2YIHA 1PX4A 4MB1A 1HNYA 2J79A 1NWTA 2QMKA 4UFLA 1H49A 1U30A 3EDKA 4JHOA 3EDJA 1W3JA 1F4HA 1Q6DA 4U5IA 4R5EA 3T08A 1CGUA 7CGTA 3ZJ8A 1QI0A 3GNRA 1HP4A 3K8LA 8CGTA 5AC5A 4U3AA 3APGA 1VFOA 1GOQA 4J3SA 5A8QA 4JCMA 1E6PA 1K9DA 3AJ7A 3MMUA 3PN8A 3WL1A 4BF7A 4ZE5A 1G0CA 3WQVA 3L4ZA 3WNKA 3CHEA 3VIKA 2PBOA 3WF1A 4AD4A 2DT1A 1JZ7A 1V08A 4CD7A 4JKMA 3WN6A 1E1FA 1WNOA 3WUFA 1BHGA 4UQCA 5C8BB 2RGLA 1GOWA 1CXIA 1C7SA 3CMJA 5HOSA 2DDXA 3W6MA 4ATLA 4GO9A 3WDRA 1UA7A 1KXQA 5DF0A 4AZ5A 3NDYA 1KR0A 4R27A 4GZJA 2DSKA 3KL5A 1UH3A 2BXZA 3A6OA 4HMDA 4P7RA 3T2PA 3WELA 3N11A 1KQZA 3VDBA 4WSKA 4MDOA 1A3HA 1WZMA 3MV01 1QNOA 1MQRA 4UFIA 3UR8A 1AVAA 4W85A 4FMVA 2J7GA 2J7FA 2VRQA 4F66A 3VGDA 2A3HA 1J18A 1W2PA 4KRTA 1XH2A 3WDQA 5C71A 2J8FA 3OLIA 1CLVA 3CBWA 1W3KA 4L4PA 3WDHA 2E0PA 3OLEA 1E5JA 5GNZA 1HL8A 4D1IA 1E5NA 3M7SA 3ARWA 6TAAA 4DM1A 4GIAA 4JKKA 4HMCA 2XWDA 2GFTA 2XIBA 1HF6A 2FHFA 2EPOA 1WDQA 5A6KA 2PWFA 2WLYA 1X6NA 1HX0A 1VEPA 3BGAA 4GI6A 1HVXA 3RM9A 1U2YA 3CZKA 3GXDA 1JI1A 1E43A 2MANA 3FNDA 2XVKA 3WH7A 2WZIA 3TTOA 3OIHA 1MXGA 3J7HA 1CTNA 8A3HA 1ZL1A 4FLSA 1V6WA 1CPUA 1KFWA 3SIMA 3CH9A 4FLRA 1YHTA 1W2VA 4NRSA 4IM4A 3L4WA 3T0DA 1LWHA 3WFLA 5CGTA 1TZ7A 2ZUTA 1JG9A 3N04A 4PMNA 4XZWA 2IUZA 2X09A 1MQPA 1H0IA 1QVBA 4ACYA 2ESCA 1V0LA 1G5AA 3POHA 4HA3A 4XV0A 4DWSC 3MKKA 3EDFA 1C93A 4J3XA 3VIHA 4PYSA 3EMQA 4UQEA 4U31A 3VIGA 1JGIA 4AZCA 3HMCA 4AD2A 3ARZA 4OUEA 5FL1A 4MPKA 1GOKA 2JALA 1ZBKA 3AIWA 4TVCA 3T2OA 4B3LA 4EANA 5HXMA 1EHNA 2PI6A 1HJSA 3K8MA 4U33A 1XD1A 1HKKA 1QBBA 1GHSA 4CD5A 1JNEA 1OD0A 5CPQA 3B9DA 5CPSA 4UTFA 4P7NA 2WW5A 4Z2GA 4W7WA 3GTNA 3N15A 1PZ3A 2V38A 3GYCA 1UUQA 2WMJA 2WMIB 4HOXA 2O92A 2WZEA 2J7CA 4AZ7A 1XSKA 1JZ3A 4F8XA 1H2JA 1YQ2A 5I6SA 2J47A 3FW6A 2X0YA 3ZJ7A 1KR1A 4GXPA 3BSHA 5I2UA 1K6AA 1BG4A 2PB1A 3OZPA 4Z2JA 3BAWA 4RE2A 3QHOA 4DM2A 3O6AA 2F61A 4EK7A 1NOWA 3I3BA 4J3TA 1E4MM 3AS3A 1XC6A 3WNNA 2X8RA 4OKDA
chains in the Genus database with same CATH superfamily
1EC9A 4H7CA 1W1ZA 4IIEA 5DLCA 4JFWA 4Z42C 2WHJA 5FJTA 1P1XA 3MPGA 1V6YA 1EUAA 2HEJA 3GVQA 1KFEA 1YNQA 5EBAA 1RHCA 1B2YA 5A2BA 3G5EA 1EQCA 1V4YA 5D33A 5CAKA 5E6ZA 4LV4A 3H8AA 1O1ZA 1YADA 1DHKA 1MW0A 5LA0A 1IEWA 3GTFA 1XI3A 1N8IA 1DIKA 3SECA 3HQOA 3C2VA 4AMCA 1ESWA 1LJYA 1PO9A 3TC3A 4QISA 5EU9A 4AAJA 4ECLA 1KRBC 4KWVA 4KETA 2DSZA 2E9MA 3VIFA 3GNXA 1FH8A 1EA9C 3H6OA 3Q4DA 4CD8A 1YYAA 3PG9A 4IFKA 4ATDA 4JIEA 3HGSA 1WKFA 3LX9A 2XVLA 3QZ6A 2CFFA 4RDWA 5BYWA 3TIMA 3W84A 1TMQA 1GYMA 3O15A 3LM7A 3EA1A 1VLWA 1BXCA 1C9DA 1JPKA 4JHMA 3GW0A 4EKJA 4K39A 2W0UA 4ZQMA 4M0XA 1SW3A 1HJQA 2P53A 2D2OA 4W7UA 1GHRA 1ONEA 2GZXA 3IGHX 4GUGA 4BQ3A 4OOUA 1Z44A 4LUYA 3G3DA 3U4AA 3F4DA 1NAL1 4DO6A 3HA1A 2X2GA 3I10A 4YTQA 5TQLA 3T1GA 4RNFA 3ALGA 4DZAA 5HUPA 3IUIA 3GVWA 3GXMA 3PZQA 4O10A 1D3CA 4R53A 3ITYA 2ZUWA 4A8RA 2XTKA 3S5YA 3NA8A 4C6CA 2IPGA 3E0LA 1F61A 1PWLA 3NQBA 3IEBA 3NQCA 3ITCA 4PCNA 4G7EA 2IKHA 3KBVA 3NOEA 3OPSA 3P14A 1TWIA 1UR4A 2OXNA 1XIFA 5HMEA 1J0HA 3IJ9A 3AYRA 1TVNA 2GPTA 3CZ8A 2J27A 3E9AA 2KZHA 1Z7AA 1FFRA 5BROA 5CSYA 4O28A 1R87A 4ICMA 4DVOA 4D9PA 5HNTA 5FJJA 4RNHA 3MW7A 4LRTA 4UQDA 3MUY1 1ME8A 3G0SA 2J24A 2PFHA 3GTXA 2P1FA 5D32A 4A29A 3AWNA 3CUFA 4PH6A 1TRDA 3PJTA 1VEMA 3GNNA 3VDHA 3GG1A 1FBAA 3AS0A 5A6LA 4I5XA 4E4UA 4B9YA 3OB8A 1UMLA 4LUTB 2CU0A 4JFUA 1VEOA 5I3FA 4DI8A 4C6BA 1UB3A 2RAGA 1I2RA 1D3GA 3AWOA 4A22A 1BSIA 3DYPA 3C0LA 4EOUA 2ZTJA 4DJED 5CJ5A 2Y8KA 1Q6OA 5JU6A 1ME7A 3R0DA 2OFJA 3ABRA 4PTVA 1CZ1A 4FNRA 2AL2B 4PFMA 3DFYA 2DZBA 1V0NA 4O0KA 3OTRA 1XLEA 2C3ZA 3NQ7A 3MBDA 2HQAA 4UTLA 4ADTA 1X96A 2G41A 1YDVA 2VEGA 2CKSA 2GYIA 4H8VA 2OO0A 3RFAA 4HTYA 2J62A 1JUKA 2VJXA 2YGYA 3FA3A 1SYTA 4W93A 2EQDA 2IXVA 4S38A 1UZDA 4CKQA 3DYMA 4WVXA 2XSAA 1EL3A 3VINA 3PJXA 1Y5XA 2QCGA 1PIIA 4YHEA 3L5AA 1FUYA 3QEZA 4PUEA 2HTMA 3PZTA 1UP0A 2WV8A 4KT2A 5CZSA 3AXXA 3LCHA 2Y4SA 1N8FA 3V35A 4LPCA 4W84A 3AHVA 1UC5A 3BANA 3JUGA 3WF4A 3IIZA 3CASA 2NUXA 2VELA 5T26A 3K5XA 1QFEA 4QG8A 3N9SA 3ZVIA 1XX1A 3QN3A 1YE6A 4H83A 4Q4MA 5FF2A 5BXTA 1S1RA 1XYCA 2CZEA 5LIXX 4Q8VA 3KRZA 3AFBA 3TAKA 3W7RA 1EJUC 3HQPA 2E3ZA 1ZAJA 3GR8A 4YWSA 4B5TA 1H5VA 1FHLA 4LY4A 2QR6A 2OWXA 1XGZA 3DENA 1VFMA 3G1FA 3C0QA 4DAIA 3M43A 2Z1XA 4JN8A 2BTMA 4GVIA 4HCDA 4F48A 1US0A 4XX6A 4GMEA 3RF9A 3L0KA 3REQB 1ISXA 2CHNA 2PTDA 1KTNA 3ELFA 1VS1A 2V69A 5LNSA 5BWAA 2CBUA 1B5TA 3DU0A 4LUTA 1CECA 1A0DA 1OCNA 5JBDA 1G9HA 3L2LA 4M6UA 3ISIX 3AU6A 1XLMA 5I3HA 3TCSA 2WLZA 4ZFMA 1BXBA 2R1NA 5HNRA 4D6IA 1CENA 1VJSA 2E5CA 3AMLA 1LM1A 2WPBA 2QS8A 2A7NA 3UZZA 4TVUA 4FIRA 1I0DA 4KFOA 2BNJA 2WM0A 2CNCA 5G4WA 3LZ5A 4PR4A 5HJLA 2JIWA 5C7HA 1F3XA 1VP5A 4CNPA 2WCAA 1VPXA 3ANUA 4GXWA 3LCLA 1R2TA 1X38A 2P10A 5JIPA 2E6AA 3FVDA 4PBFA 3CYVA 5I24A 3IANA 1J01A 2WCSA 2XIIA 1RK6A 3B9NA 2CITA 4H6QA 2QPUA 3EOSA 1NQ6A 2GGGA 5LXXA 3L5LA 3C2EA 2OKOA 1FCQA 4O4VA 1XPYA 2V5CA 3GTIA 3Q65A 4XD4A 2DZWA 1S2AA 3WMLA 3KHDA 1CGYA 4CQDA 2PC8A 3MB9A 3SCRA 1YNYA 3CC1A 1IHIA 3KWXA 1GQJA 2YA1A 3TMQA 1Q2SA 3WLQA 4JAWA 4EAMA 1BWKA 1FCUA 3CWOX 3FEQA 3KM8A 3HPSA 5A1AA 2GWNA 3CGTA 3GVGA 3W2UA 1DIDA 3OA5A 4M51A 4I7UA 3MI6A 3LSBA 3PWIA 4V1YA 3VOCA 4AVOA 1DIOA 1EJRC 1PXGA 1TQJA 1OYCA 4BF5A 1Y5WA 1SO4A 4FNQA 4CCZA 2ZIDA 2CZ5A 2FPTA 4GWEA 5DY2A 3IAPA 3SEPA 4WY0B 1KM4A 3PS7A 1W9PA 4FNUA 2NZLA 3DHPA 5ABHA 1F05A 1M68A 1XBYA 3ARTA 1I1XA 4J3ZA 4UTKA 1EC7A 2V82A 3W83A 1PB0A 4KQNA 2A5HA 5J8LA 1E4IA 5ABEA 3QSRA 1TSIA 4NT0A 1W5OA 4GGHA 1GOIA 4KEUA 3IJIA 4AD3A 3POCA 2NW0A 3OGVA 4MG4A 3VO0A 4FX8A 1JFXA 4F3HA 1SMDA 2H9AA 1M7OA 1OADA 1J5SA 4DWSA 3WLOA 5T8GA 1TVPA 2DSWA 3DFHA 1M9HA 3VZXA 3KEHA 1EUNA 1U5VA 1QWKA 5D2YA 4OGZA 3NQVA 3VMOA 1SFJA 3EX4A 1B3XA 1TG7A 2BY1A 3GNPA 4WZHA 4I90A 3L2IA 1TPDA 5EA9A 3TTQA 2OZ0A 1OD8A 2AMXA 1XKJA 4H9VA 1EP3A 1TJ0A 1TE1A 3M16A 3O2LA 4CU7A 3N3MA 3BMXA 5AOUA 5L6UA 1YKWA 1YXDA 5E0CA 4PTXA 1HZYA 3OZYA 3WNOA 3S83A 2WXDM 2D2JA 5K3VA 4J40A 2YL9A 1PCWA 4QQUA 4C7FA 4PTDA 4Q8QA 3VOGA 5HWMA 1SMAA 4LT9A 4GA8A 2VC9A 4ES4A 3UJRA 1CGVA 2WMFA 3CZLA 4R34A 1C9WA 1EQPA 3WMSA 4L65A 3TAOA 1EOKA 1EO5A 2GGJA 2X42A 4DXKA 2WSKA 1XYMA 4BQ5A 3OLDA 4TXEA 4EPKA 4I9JA 2C15A 1X7FA 3VKAA 4E8GA 3WQWA 1L6FA 3BG3A 1IQ8A 1LT7A 1OG0A 2UY4A 1WV2A 1W17A 2DVTA 2G0WA 1SO6A 2J74A 5CCZA 2BHZA 2OO6A 4O1FA 1XBVA 1IR2A 4WIWA 1B90A 2CCRA 3JRKA 3BG5A 4TR9A 2AGTA 4HKPA 5IRPA 4AF0A 1LDCA 3C2OA 2ZXBA 4PZVA 3CZGA 3MHGA 1J2WA 2G4JA 5EGRA 2A6NA 4GI8A 3L4YA 3MBFA 4UR8A 1FRBA 5EYWA 3GKAA 4L9XA 2BSLA 4PEEA 4GOAA 2VZOA 2YA2A 3EB4A 1EB3A 5CSRA 2FTYA 3LBMA 1E15A 1W1A1 1YNPA 4IMDA 4P2VA 2DZTA 1UMYA 3FHQA 4UQAA 1MYRA 1AMKA 3FA4A 3QV9A 5A6TC 5JBEA 5G1TA 1E0UA 2P76A 2ZC1A 2ALDA 2OQYA 3L2MA 2DH2A 4FI4A 3ZT5A 4DJFC 4UCGA 1IZKA 3VE9A 2ZA2A 3VD3A 5C0QA 2O4MA 2QCDB 5HANA 4GBDA 1GPFA 4IX0A 2FTPA 1LORA 1XH1A 3KCLA 2ZXDA 4LVAA 3TK7A 2ZZ6A 2J4GA 2HE8A 3V3WA 3NAVA 3KBNA 1OF6A 2QUVA 2JK2A 3ECQA 3N14A 2WVVA 3H24A 2YPIA 4TUFA 4N6EA 2CKRA 1KGXA 2JFEX 2GVJA 3BLFA 1AJ0A 4EVZA 4UUIA 5AHEA 5E93A 3H12A 4JICA 2R1PA 1KRCC 2YL5A 5BU6A 1FP9A 3CV2A 3C6CA 3WLRA 3G0UA 1ONXA 1E4NA 2XISA 1VH7A 3KVLA 4PCPA 4ZXOA 3EWZA 2XN2A 2JQXA 1WZKA 5CG7A 2ZA1A 3RO8A 2CHOA 1RV8A 4D6EA 1WDWA 1MO0A 4PSRA 4S2CA 4J1OA 2Z6JA 2Y61A 1RY8A 2QEZA 3S1XA 4A21A 1NFPA 1P0BA 2WZHA 1XH0A 3L21A 3IK2A 3MANA 5BRPA 1B3OA 4MJ4A 4YLWA 1K7FA 1NOUA 3VC6A 3T0AA 4C6EA 3W37A 4C1NB 3WH6A 3UW6A 4X61A 3WDJA 4ATWA 3T8LA 2FZMA 2WMHA 3D47A 3SCOA 1UUMA 1UUOA 3GHSA 1MSSA 1ITCA 4GISA 2VQTA 4L6DA 2VC6A 1DVJA 1FWAC 1XP3A 3V5FA 2PWEA 1VBUA 1J96A 1R85A 2PCEA 1IWPA 1NWRA 3MSDA 1R3RA 5BMXA 4GPNA 3FSTA 3H2AA 3Q2DA 4GFSA 2QJGA 2HNEA 3GNDA 4FSAA 4GYPC 3TFCA 2NQHA 1JDFA 3GAKA 5C5YA 3KLKA 4LYRA 5DO8A 2FFCA 1L6SA 1JZ2A 2J7BA 3VAVA 3WDPP 3N2MA 4V28A 4J2PA 2HDJA 1KBKA 4F4RA 2QV4A 4WGHA 1O66A 1PZ0A 2W79A 2W91A 1VHCA 4BHYA 3WIJA 4ZO9A 1HJXA 3MUAA 2Z24A 3G6LA 4JQ4A 2VR2A 1S2WA 3W27A 2QUUA 4AWEA 3QY8A 1UR2A 3EWCA 3CEUA 3M4HA 4IXHA 3MZ2A 4PUUA 4X2PA 1X39A 4DI9A 3W7CA 2QCMA 2Z2UA 2BGNE 4KFPA 3M6YA 1W1VA 5HQMA 4C6JA 5EMYA 2HV5A 3HQ1A 1XDJA 4UQ9A 3BAXA 5BCAA 5LIYX 2ZE0A 3GHUA 4JIQA 1AW5A 4Y6GA 1VKFA 3E96A 4UFKA 1AA1B 1XLJA 4BF9A 4M81A 3CUZA 2A7PA 4CNUA 3UXIA 2WAGA 4GZIA 1GVIA 4IIGA 1NQKA 2DW6A 4DZ5A 1NSJA 3H7RA 3T55A 4QDPA 3IV8A 1PTAA 4FP1A 5AY7A 4HU3A 4W87A 3QHNA 4QE5A 3TDFA 2J25A 5LZLA 2FJUB 3NSMA 4Q8WA 1JXJA 1QASA 2D0HA 1A5NC 3U4FA 3MYOA 4I9TA 5GJNA 4BK9A 4GINA 1ZAIA 3KOZA 1XRTA 3W1XA 2OT0A 2WSPA 2GOUA 2QT3A 4PFHA 4QAWA 3FIGA 4DF0A 2D22A 4HA4A 1Y8BA 3LYEA 4B5UA 3WQEA 4W5UA 3M0IA 4QDWA 3WF2A 3VIOA 3BZJA 3EXTA 4WHBA 3DOPA 1PKYA 1XINA 3H7VA 1TPFA 3LUTA 3WEMA 5J04A 3AISA 4M7SA 3M5XA 3C2FA 4HHMA 4F79A 2DJLA 1CXFA 3P8IA 2E40A 1ZP3A 5FF0A 1RY0A 3W53A 3NEHA 1QNVA 4E8DA 2V3GA 1LG1A 1UWQA 4E0CA 1RALA 3EDDA 3AU2A 4QROA 3P62A 4NILA 1S38A 2H3DA 1BGGA 3TA9A 4JTIA 3H7UA 4TX8A 2QCCA 2ZUUA 3TVAA 5RUBA 2ZFAA 3N73A 1PS9A 2NT1A 4Q8OA 2BY0A 1Q7ZA 1CXLA 4PMOA 2X1IA 3W1LA 4DWSD 4UQBA 3HQNA 1XS2A 4RW5A 3MWAA 1M7XA 4RE0A 3W23A 3RK8A 5IBXC 4MIMA 2GSHA 1W3IA 2R8WA 1E6ZA 3N4AA 3AS1A 3EWDA 4HD5A 3Q58A 1Z6KA 4K8HA 3WD0A 4M7TA 2A3EA 3WUEA 3SJ3A 2VUNA 4WXYA 1GVEA 1H50A 4NZ1A 1V3JA 1XLCA 5LNUA 3MO7A 2G4FA 5EY5A 4DXXA 1CB7B 4GIEA 2XSBA 1XIGA 5E0FA 3I7RA 3F5KA 5H2ZA 4O17A 3S1UA 1OWQA 3LMYA 2OQLA 3AHZA 4OUIA 3KRUA 2HXTA 2FGLA 2Q02A 1O5KA 4NXKA 1J0IA 1MEIA 2DZXA 4UTWC 3QXBA 2PWGA 4XZNX 4CU8A 1TV2A 4ZL1A 3T0TA 2WK2A 2OEMA 3QVQA 5I3GA 4YXGA 2O56A 4JQ1A 3C8NA 1QPNA 3BVJA 1A5BA 1EJWC 4QEEA 4XUYA 1UYQA 1EJXC 4IP7A 5AECA 4TTUA 1KBLA 2BOGX 1QI5A 3O6DA 3TZFA 4U2YA 5F2GA 2A1YA 1XLAA 3LNPA 1KGUA 3WMBA 1DL3A 3PBMA 1QMLA 3M0LA 3UWVA 2UY3A 1ME9A 1RA5A 3TSBA 1P0EA 1FX6A 2X1SA 4NQ1A 3W2JA 4O50A 1ODZA 4YVPA 1XJBA 1RQEA 1SQ7A 5JBFA 1BQCA 1EIXA 1F8IA 1VPQA 3OG3A 3W01A 4S2BA 1IGWA 1R9ZA 3NPWA 3NYZA 2CXGA 3PY2A 2NLIA 4HQVA 2A79A 4OHQA 5I00A 3U2ZA 2W67A 3ZFHA 4PODA 4DX3A 4E38A 2DZUA 2F6KA 3M64A 3HPXA 5K2ZA 1X1NA 4LEQA 2VEPA 3NSNA 1CGXA 4Z2IA 3SFKA 4P8XA 1A49A 1TV4A 4K37A 2CLEA 2VX5A 3WLTA 4CVWA 4N6FA 3LCGA 4I7WA 1U1UA 1E1CB 1GOOA 3EOOA 3A3XA 4PRWA 3HIJA 3CK5A 2BWGA 2YX0A 1CB2A 5H6HA 1O5RA 1FDJA 1ZS2A 1NDZA 3S5SA 3PUGA 1RVKA 1RH9A 2XIQA 2NUWA 1SR0A 1JQVA 2RH9A 1EDGA 3GWQA 1KRAC 3OU8A 8XIMA 3TTYA 3C61A 2OODA 2Q3RA 4FF7A 4CEUC 2FPVA 4S3KA 4CNOA 5CLWA 3CV7A 1L6GA 3M41A 4PA8A 3HMJG 2FVKA 2W3ZA 3BAKA 1AQFA 5A6BD 4W8AA 6XIMA 4DUOA 4H2CA 4NJJA 2Y7DA 2FZBA 2C7FA 2YDQA 4AB4A 2DIKA 1JD7A 2ZBTA 3LEPA 4FX7A 1ZQ5A 4HZ6A 1LWJA 1KWKA 4IPPA 2A85A 3UPMA 2W9MA 3BICA 1PBGA 4IPJA 3L23A 3WD1A 2J77A 4UNIA 3QYSA 2R1LA 3CQIA 1J10A 2PLCA 5AHMA 2DW7A 3SCWA 2ISSA 3AQUA 2AQWA 5E6YA 4QBXA 4J4KA 3EMCA 1E9YB 1WDSA 3ARQA 1XYLA 3EB2A 4B3KA 5M1TA 2WC7A 1FHVA 1SSGA 1VRXA 3G2GA 3U0HA 1JCYA 4JDYA 4WDTA 3S0CA 4MB3A 3BO9A 4MFDA 2PDHA 1A5AA 3LLDA 3PJUA 4ALDA 1F3WA 2OQHA 1YBQB 1UPMB 4HPNA 1J4EA 2V9DA 3EBVA 3PSVA 1TTIA 1YDNA 1H7NA 3AROA 2WJZA 3ARYA 3UYCA 1V79A 2FYMA 2ZOXA 3PPFA 5HR7A 1ALDA 3CQKA 3DHUA 3PTQA 4AXNA 4WKHA 4PCFA 1OM0A 5MKGA 3Q37A 4U2ZA 2IPFA 3U5YA 2PPGA 1UOZA 5FJOA 4W7VA 1GOMA 2BVDA 4JQ2A 1HO4A 1W56A 2R94A 1D8CA 2HWGA 1WXYA 2L5HA 1MI3A 3MDWA 4YTTA 1BRLB 2QUNA 1TJ2A 4KGLA 3H2FA 2V8ZA 3CZEA 5E5CA 4QR6A 3G77A 4C6LA 3SN4A 1I0BA 3NQGA 3BV7A 3VXGA 2J8GA 2QMKA 4JHOA 4NAEA 3UWZA 1W3JA 2I5QA 4U5IA 4R5EA 3SQMA 1QI0A 2NQ5A 3NQEA 3GNRA 4GFIA 3BJFA 1UIPA 1FTXA 2BX7A 5H8UA 1RCOB 1QT1A 3UWQA 1GOQA 1LT8A 5A8QA 1WQ5A 3C0JA 3KVMA 4UTTC 1TQXA 3BUVA 1K9DA 3MMUA 2E25A 3T40A 5D09A 4E3VA 3L4ZA 3LOTA 3SRHA 3PFMA 1H1YA 1JZ7A 3FYYA 1L9WA 4JKMA 3F2DA 3LLXA 2PDJA 3WN6A 1DBTA 4GCXA 4MGGA 3T4WA 4JTCA 4HVXA 4AVFA 5IOBA 1NF0A 3S2NA 4CQBA 1VBGA 4V15A 3KBSA 3ZVHB 3V1HA 4DF2A 4DBSA 4N7QA 2DDXA 3W6MA 4ATLA 1YPIA 5LXEA 4E2DA 1ZALA 2YXXA 3WK3A 5EPDA 4GZJA 3KL5A 3MKCA 3V4BA 1J5TA 2BXZA 1R3WA 4XBKA 3VDBA 3OVGA 4WSKA 4P5UA 2J9YA 1W31A 1MQRA 2PP0A 3UR8A 3L7RA 3EEGA 4A8IA 2VRQA 4Q8NA 3OVRA 4UC5A 3WDQA 3VABA 3DERA 3EWWA 1W3KA 3WDHA 3GIPA 3GSMA 1HL8A 4LANA 4D1IA 2PTXA 1E5NA 4X3ZA 4O4WA 4ZB0A 3M7SA 2B0MA 2R14A 4H7ZA 1NJJA 3PF3A 3GAYA 3N6JA 2FHFA 4IQEA 3K13A 4MKVA 4F0MA 1U1JA 3LB0A 1WDQA 1SUXA 4Q4QA 4GI6A 1KM5A 4DYJA 1VCVA 4Z0SA 3OVPA 4IP5A 4GHRA 5CJMA 3H2MA 3T07A 4C90A 5KTLA 1BRLA 4LAOA 2QXWA 3OIHA 1MXGA 3NXFA 1R5YA 3J7HA 1CTNA 3ZWTA 1ZL1A 3MP5A 4D8LA 3CH9A 4DLFA 3PBWA 1YHTA 3T0DA 1LWHA 4IGNA 4NX5A 2X09A 1MQPA 3PBUA 3QR0A 3POHA 2DP3A 4JTSA 1KFJA 2VGGA 4GNKB 4XV0A 3HJZA 3MKKA 3EDFA 4PEKA 1C93A 2BOFX 4PYSA 4HZMA 6REQB 4LYKA 3BTNA 4U31A 3U9IA 1YPFA 4AD2A 2G37A 3DN5A 5FL1A 1KBIA 4K8EA 1UC4A 3KBWA 4EANA 6ALDA 4U33A 4FXRA 2E6FA 1GHSA 3B40A 3R12A 1JNEA 4KW2A 4DQWA 4IPIA 1QPRA 4V33A 5I3JA 4UTFA 4Z2GA 4W7WA 5HAOA 4BWLC 3GTNA 3MJMA 1PZ3A 3ZVHA 5F2MA 4FALA 1N8WA 2WMIB 3NL3A 2TYSA 3AJXA 4HOXA 2BMBA 4Z1CA 3R58A 1H2JA 4XSLA 2J9XA 3EX1A 3H53A 3HPAA 4NIRA 4RK8A 3DGRA 1TUFA 4C6KA 3ZJ7A 3CQHA 4GIRA 3GZ3A 3LCFA 4S3EA 1LOSA 4TV5A 3OQ8A 1SO5A 9XIAA 1ZJIA 1XL9A 3FJLA 4RE2A 1IXOA 3NZ1A 4WY0F 4GUJA 3URAA 4V1XA 4EK7A 1NOWA 3I3BA 4AU0A 4GZ7A 2X0SA 1LRQA 2X8RA 2YYUA 2Y1HA 1BKSA 4W9TA 1T5AA 1MEHA 3EKZA 2R91A 5C2XA 4S3GA 3IVSA 4ERGA 3OZOA 4BKNA 3GXPA 4N0RA 5LIKX 3W26A 2C79A 4Q33A 1QRQA 4J5NA 1YIXA 1GPWA 1GKQA 2D3LA 1Q6FA 1XSJA 3OOQA 3S2JA 3AOFA 3G1HA 1AW1A 1YTDA 3DESA 2EPHA 3STPA 2ZUMA 2PRHA 1FXPA 5JH1A 3VCRA 2GK1B 3TONA 3LGEA 4A35A 2CWNA 2YCEA 4DHGA 6TIMA 2DZAA 3RG6A 2NT0A 3E02A 4OFCA 2D1ZA 2VOTA 3KW3A 3SRFA 1SSDA 3O3RA 3UG3A 3USBA 4PBGA 1UWAA 3UG5A 5CBBA 2E6DA 5C55A 3D6NA 3E2QA 1CDGA 1IXNA 1LBMA 3TC7A 3P61A 4FS9A 4XZ9A 5CPTA 3E0IA 3FKRA 3GS6A 4WCJA 3P8JA 4K7VA 4OTKA 4WUIA 4RE3A 3RCMA 2INZA 1JPMA 3OYZA 4WSJA 4IXXA 1XYAA 3L66A 3L4XA 3SRKA 6REQA 1E40A 2VVNA 1WOBA 1ZZMA 3WJWA 1E70M 4WRHA 4RE4A 3VFLA 1ZGDA 8TIMA 1HKJA 2EO7A 3AHYA 3UYIA 1UD5A 4IOTA 4PSPA 4KRZA 4IZGA 3QV7A 5GVJA 3M1ZA 7ENLA 3R10A 1TV3A 3NZQA 3KL3A 3EKLA 3NQ6A 3NPUA 5IFTA 2CLFA 5HMSA 3UJSA 2HJPA 2PF0A 5FJRA 4UR7A 5LA1A 5I5RA 4M8UA 3PFRA 2Y6ZA 1WDRA 5EFFA 3ITTA 3N25A 2WQPA 2YB4A 1SPQA 4ADUA 3U2EA 3ZS4A 4O1DA 4HOZA 5FEXA 4NVTA 4Z1BA 5BMWA 1DWAM 2FGZA 3O0KA 5GJPA 5JMUA 4LVFA 3EPNA 4FK9A 1LWIA 1K6WA 1IV8A 4B15A 3TW7A 2XH2A 3MT1A 4MADA 1T99A 2I1OA 3FJNA 5ABGA 1CXHA 2A2IA 4MJ2A 2H3BA 4MJMA 3LTSA 4L80A 2XFWA 4DJFA 1AG1O 4HHHA 2CEQA 4IG2B 3TQ0A 1JYVA 1XLHA 4H01A 3AMCA 3VDAA 3MS8A 1QOPA 5A6AA 5M3WA 3EXRA 2XGBA 4NXSA 3G1YA 4LUSA 1EWDA 1NP2A 2Z1KA 4QP0A 3W7HA 3WD3A 1TPB1 1GUVA 4M3PA 4WR3A 6XIAA 2DJXA 3WJSA 1Q6QA 4P8UA 2FB3A 1BAGA 4C6OA 4AZGA 2VKZG 4GYJA 1FVPA 2ZC8A 2J13A 3WLHA 3NL2A 4O57A 2BB0A 1WCGA 4H8UA 3ABXA 5CGQA 4XWUA 1IEQA 1TUXA 1FP8A 1KTBA 2NSOA 3FXGA 4LS1A 3GU1A 3P74A 3W2NA 3KL0A 5ABTA 1IZJA 4GI9A 4BY3A 3E38A 4XD5A 4KIEA 1S3HA 3WD4A 3NQMA 1W1B1 1PDZA 1FWEC 3NIYA 3D5HA 1TPEA 2A21A 4NU7A 5F2LA 1MFVA 3TQVA 4C7GA 3P0XA 4GYFA 3EOUA 3SAZA 4DBWA 4XZIA 5KEZA 1ZB5A 3URNA 5D2XA 1V6XA 3VKDA 3W7PA 4DJDA 1NFBA 3UY8A 3UESA 4Q6JA 3AIEA 1I45A 5I23A 2YOCA 3CO4A 2G8ZA 2Z7GA 4KH2A 3PZVA 1GJWA 5DMMA 4JQ3A 1UD2A 4GABA 4MWAC 3XIMA 3MHFA 1NELA 2OCZA 5ECUA 4AQLA 1QI3A 4CN4A 1HUVA 2DV0A 4AEFA 4WJEA 1TPH1 4LAMA 1QHPA 5I06A 4H6EA 3ZZ1A 4W86A 1BTCA 4JL1A 4GYPA 1X1OA 5CPOA 4ZOCA 4Q4SA 3W1AA 6PTDA 1FWIC 5E09A 2PDKA 5I77A 2EF9A 3S1GA 1Q6EA 5D2TA 3TYCA 4H04A 1AJZA 3AMKA 2ABBA 4LV9A 2OTDA 1J0JA 4ILSA 4IG2A 4RUBA 5I7GA 1ZBCA 3IJQA 4HNUA 3BGGA 4BR1A 5BWFA 4IUOA 1NTHA 5C54A 5FI8A 5HBFA 3QHMA 4KERA 2PTYA 1Q4WA 3G1XA 3W71A 4PMJA 2ZA3A 1BLIA 2HRWA 1JCXA 1J93A 1K8YA 4AD0A 3F03K 3BQ5A 3XINA 1XGDA 2E5BA 1Z32X 2WYSA 3RJXA 3EKGA 1ZCOA 2XH4A 5G2WA 7PTDA 1FCVA 3RIKA 2ZX9A 1OCBA 1FY6A 1LQ0A 5T9BG 3AXIA 1HJVA 4UZSA 2PD9A 2OLHA 2E8YA 3EMZA 3KXQA 4W8LA 3V7PA 4B5VA 4CQ8A 3NWRA 3WJZA 1W9XA 4UTMA 3DIPA 3GU2A 2PLKA 3EAUA 3R8GA 4HPJA 4LOCA 2FDMA 4J3UA 4Z17A 1AUSL 2V5KA 3WFZA 3QQWA 3LS9A 4QXIA 1W3HA 4NI8A 1TZ9A 4GY7A 1OSEA 4DNMA 3VU2A 2WZMA 5FAGA 4Q8TA 2QDDA 1V5XA 2V3DA 1CXKA 1E56A 1V03A 4A3RA 1ICPA 4R85A 4GACA 4DO4A 4KEVA 1PKMA 4UCFA 1FWRA 1S2CA 1XM3A 4ASTA 3NZGA 2UZ9A 1GVFA 4JS3A 3WBYA 2DIJA 3RCNA 2HROA 3UBPC 1RAKA 3K4DA 1PCKA 3ATZA 3QC3A 2RFGA 1GZJA 3E0FA 1JPIA 4H9XA 5AN7A 2RJHA 3GDKA 2UY5A 4EIVA 2R1KA 4QLKA 1FWBC 1PHQA 2ZDRA 4FLOA 4CNNA 3GX9A 4QJ5B 3PBVA 3D46A 4MNJA 2VR5A 4F0SA 5K9XA 2NSXA 1HP5A 2W63A 5E0KA 4TMBA 2ZZ3A 1EP1A 2KX9A 3M44A 3M0VA 4PCSA 4LUIA 3I6RA 1TX0A 4PBEA 1QNSA 3ZQ9A 1TYGA 5G2IA 3QY7A 4XAYA 3VMPA 4JYEA 4GUHA 5A8MA 4TTGA 3AICA 2TRSA 4KWSA 3OJGA 3BV4A 2OYLA 5TIMA 5MF5A 1UR1A 1I8JA 3RM8A 3NL6A 4ACZB 2VD9A 3W2MA 3HG4A 3NO5A 4QM1A 4JD4A 4LBSA 2XZ7A 4F40A 3DC8A 1KM3A 1Q6RA 1HN1A 3R0KA 3W7IA 4Q7BA 3BLKA 1XRFA 4RXGA 5IDZA 2XFFA 2VUYA 3U2CA 1GQKA 3TMLA 1DP0A 3MUXA 2VZTA 3GK0A 1EP2A 1VENA 3PB0A 3ZLGA 2VVSA 4UTIA 4LFYA 1UH2A 2VHLA 3K1DA 3MTWA 4BI5A 3GG0A 2GSJA 4H1ZA 1DJXA 5FSEC 1BG9A 2BY3A 1Z9AA 4ZO6A 4OJYA 3WUBA 3IJ8A 4M5PA 4ZVJA 2ZRWA 2AAAA 2INEA 1NFGA 1M1BA 1PWMA 1GVOA 3OBEA 2QGHA 5FIPA 2Z27A 2ODOA 2QCLA 4CNSA 1H60A 4X9YA 1MW1A 3MKVA 2XFRA 4UTWA 1P6CA 4HBKA 2F38A 1AH3A 2ONEA 5EMUA 1IYXA 2NWRA 3N4EA 4PUKA 1T41A 5HPOA 3AIUA 2P50A 1QBAA 5GNYA 3W07A 3QW4B 3CUIA 1ZSXA 3SUUA 1EDTA 2Y5EA 3MSYA 1DORA 2IS7A 3K30A 5LYRA 2D23A 3TXZA 3WNMA 4IPLA 5EMKA 3VX1A 3G1VA 4AC7C 4PUWA 4FLQA 3L0NA 4DWDA 1H3GA 4NY2A 1PUDA 3WJXA 4NZJA 3GR4A 2E6YA 3B4YA 4K2SA 1OFPA 1QXLA 3K8KA 1P48A 4GY1A 1Y65A 3SCUA 3VVGA 4DYEA 4IGHA 2DY3A 2O4QA 2XIOA 1A3XA 3W6LA 5HR6A 1UR8A 3W0KA 3V18A 3MC5A 1W6TA 4ZO7A 1F9CA 4L61A 1KW1A 1MUMA 3LNMA 4Z08A 4PUNA 3U7BA 4LYQA 3JW7A 2XH7A 1EGMA 1H61A 4S3FA 1W91A 2YDRA 3GC2A 4LJ3A 3W7MA 2QV5A 2X0HA 3VFCA 2QQ6A 2W92A 1B3ZA 3K46A 3W1PA 4WGXA 3QTGA 1OFAA 2JGQA 1IXQA 4MY8A 1V93A 4UNLA 1RCQA 3RX2A 1XYBA 3EOLA 2CIPA 4DBUA 4NKCA 4HA0A 1POKA 1TB3A 3LQGA 2CBVA 1IZCA 1MEWA 3B03A 2XM1A 3BC9A 3EA3A 3NDZA 2AKZA 5IHRA 4WX2A 2WC4A 5DEZA 1H7RA 3FDKA 3SDOA 9CGTA 1VIWA 4FAMA 4DF1A 3ES8A 3WQFA 4DJEC 3UJFA 1BPLB 5D4YA 4TV6A 1IT7A 3SW6A 2Y63A 1D7FA 4G5DA 1I6NA 1B30A 2CLHA 2E67A 3WX7A 1GVRA 1JIBA 1H1ZA 4M56A 3U3HA 2O9TA 1OY0A 3LPPA 3VUPA 1H41A 2GJPA 1O7AA 2ZRYA 3N19B 5AKQA 1X98A 3VNKA 3A13A 2RGMA 5JXQA 3N13A 4K7YA 2GQ9A 7XIMA 2WKLA 2C18A 2I17A 3VI2A 1S3TC 4I8YA 1XUZA 3T42A 2ZZ1A 1GYLA 4D1JA 2Z1SA 2CZFA 2OX4A 4XB3A 1UHVA 4GY0A 4JIHA 1H63A 3SY8A 1LQ2A 2PDWA 2W27A 4FOKA 1GGOA 3W00A 2DU2A 3W86A 1L8NA 3FAXA 4XO6A 2QPXA 3UG4A 1C91A 2VR4A 3WENA 1M04A 1V8EA 2VYOA 3CAQA 3PULA 4DJDD 2JF6A 3A12A 4BA0A 1G4EA 1S5TA 3PAOA 3E74A 3RHGA 1RSCA 3DFPA 4WKFA 2OOFA 2FVLA 2F84A 4HN8A 3FEMA 2X7WA 4GQRA 4RDVA 2WNNA 1BYAA 5IXEA 5DBTA 1O94A 3KWSA 1I2OA 2XSXA 2XPKA 4YCOA 1H62A 1E9IA 5BOEA 5G4EA 3CWNA 4RV3A 3VZYA 4IMFA 2HE5A 3OHIA 3CUXA 4QJ4B 3TYEA 4HSNA 4WJXA 2ZUSA 1J11A 3QLDA 4O0ZA 3QPYA 4KRUA 4Q3MA 2OB3A 4OOZA 4IJRA 4RNJA 3E0VA 4DN1A 3VM7A 3CB8A 5A3HA 1SJDA 3GRIA 3ALFA 3RITA 1X1ZA 3SGUA 3S6OA 2WJFA 4KF1A 4IQDA 3GU9A 5C9XA 5CEWA 1GCYA 4X60A 3WBXA 3SGZA 2ACSA 1AK5A 1US3A 1QW9A 1YX1A 1A5SA 4GIYA 4WOZA 2OKTA 5REQA 2DQWA 1AZ2A 5MHBA 1V3HA 2FHBA 4UOQA 4QGCA 1PEZA 1SO3A 1ISZA 1KRMA 2DPEA 3ITGA 2GGEA 4KCUA 1NM9A 4L6OA 4WXZA 3GO2A 5DMNA 2PDUA 4PL2A 2HPIA 1QK2A 1XIMA 1CLKA 3LXCA 1JDAA 5A8OA 4UTTA 3WL0A 2VZSA 5BRQA 4HN4A 1Z8AA 3WQPA 1K8ZA 3I3EA 3BCDA 2O9OA 4MHBA 5B7ZA 4K1GA 4J9JA 3PJWA 1ONRA 1QI2A 4UFMA 2D2GA 3F2CA 3R94A 3L68A 4NASA 4YTSA 2J7HA 1DJZA 2REQB 4MZ8A 3P67A 1E0WA 3RU6A 2YCKX 4KEMA 2UY2A 4CGTA 1PIGA 1ZFJA 2G3JA 5FL0A 1X6LA 3ZSSA 1W1TA 3PZNA 1CCWB 1D3HA 1RZMA 1J6PA 4XAFA 3LERA 4QE1A 1KM6A 1J8VA 1CNVA 3M0HA 3FYPA 4L56A 4OWGA 3SUWA 4AIEA 2G3IA 4B5SA 1R38A 4OVXA 2XVGA 4MKSA 4G1KA 2A7RA 4TQTA 4CN6A 1M65A 1GW1A 4N02A 1M5WA 2O7QA 1ADOA 3FV9A 2YKKA 1YTEA 3PSWA 4JDBA 3THAA 3NQ8A 1K03A 2RDUA 3TQPA 3WO8A 1UCWA 4HHLA 4L7ZA 1JYNA 1Z42A 3BDKA 1WBHA 3GLCA 2FJKA 2OG9A 2QMJA 3UCDA 1K1DA 3GIQA 3VM5A 1KFLA 5CG0A 1HJUA 5LHEA 4M19A 4O54A 3CV1A 2QCEA 1S1PA 3IRSA 1OT1A 3HPFA 3BL3A 1RUSA 2GDQA 3ARSA 4LYPA 3T05A 4Q8PA 2F8QA 4B92A 1GWJA 2PTZA 3NQAA 4EAYA 1UWRA 1AL7A 3DI1A 1FWHC 2PCQA 3C0SA 2VEKA 3B8TA 3E3HA 3KOYA 4A3YA 3UD6A 1OX4B 4ZQCA 4CCDA 3A4AA 1SFTA 1A5CA 3QGAC 1XLGA 2CLIA 3VILA 1BWLA 1UW9A 5CSUA 4C1KA 1UKQA 1QPQA 1EKOA 3VGHA 2GWGA 1EBHA 1FWSA 2PC4A 5F1VA 4WKAA 3H2EA 3N6QA 2E4TA 2DUAA 4XZBA 1WXJA 8RUCA 2AQVA 3FYOA 4U5KA 4OZOA 1TPC1 4B9ZA 1XPGA 1VFUA 4G1NA 4M1BA 2Z4GA 1LG2A 1P5BA 3KBMA 1SZRA 2HNHA 5AC4A 1XSIA 1OYBA 3BG9A 2E28A 2UWFA 3GDMA 1W9BM 4ERIA 4WOQA 3HOJA 2OOGA 3LHYA 4AYSA 1MDRA 2VWSA 5BOFA 1SW0A 1JZ5A 3NO3A 2YZRA 1QPKA 1PE1A 5KMYA 1PYFA 2CETA 3WEZA 5D02A 1UKSA 2HBXA 3CB3A 4O11A 3STFA 4Y90A 1UQYA 4KWUA 2ZE3A 1Z89A 3BW2A 2D3NA 2ZXQA 2Z00A 3FN9A 1FH7A 3NURA 4J3VA 3WLMA 2WWCA 1FDYA 3G24A 1XG3A 3SN1A 1FWTA 3OODA 1WO2A 2D69A 3UR5A 3TKFA 2RHGA 3S6TA 1XG4A 4MOZA 3ZT7A 3TXVA 1UP3A 2RJGA 2CZDA 4NZ4A 4CLMA 1BFNA 2WKGA 1Q6GA 2ABAA 3O0FA 3UQNA 3D3AA 7A3HA 4ZSTA 1UKPA 1ZNNA 3WBEA 3I6EA 4H9TA 3XISA 2R1MA 1K4HA 3NSXA 3CTLA 3W24A 5EFDA 1A5KC 3FK4A 4UZUA 2I9EA 3R89A 5AVNA 3W81A 2NQ9A 3P7YA 2YZ5A 1VFTA 3HV8A 1Z41A 1OHLA 1Y5VA 4A6GA 2BV9A 1UJQA 4QCEA 3ABZA 2C1HA 5C70A 3WK0A 5BRBA 3CZJA 3S5ZA 2G96A 4BCEA 4HNLA 3HPZA 3COTA 3I7QA 3R6IA 5HUOA 3WSUA 4C60A 4MVAA 1Q3NA 5J5RA 1MW2A 1FWWA 3CUJA 3R79A 1UD3A 4TVDA 3A3WA 3I6TA 1OK4A 1QTWA 3CWHA 4N4QA 1FCBA 5HPCA 1KKOA 3KAOA 1J79A 1OIMA 5DRIA 5CBIA 3ZJKA 3W22A 4IMEA 5IM51 1F07A 5HQEA 5AYYA 4AY7A 1MRQA 2VT0A 1DJGA 5C2CA 3BLLA 1KV8A 2NQLA 2IKIA 3G1SA 3TFXA 3IRDA 1RLCL 4GQ0A 2E7FA 3MCMA 3E1F1 3N9KA 4BZYA 3H2OA 3BCFA 2BOEX 3AAMA 1PHWA 3U57A 1GJPA 3BMWA 1X7IA 3AZTA 1ITXA 1HKWA 3PK7A 4ZQPA 3EYPA 3KLLA 3NNTA 4MWAB 4TMCA 5LNRA 3KTXA 4V27A 2DUZA 4F9JA 1KM0A 1WX0A 1EX1A 4N2YA 1U22A 3ARVA 3VGGA 1TV5A 1R6WA 1JDDA 3DKJA 2VGIA 4U10A 1ISVA 1XLDA 2BZNA 3LGDA 3AALA 2DUXA 1P4CA 1XCXA 3WQ6A 4NZCA 2BY2A 1FXQA 3MO4A 1A5UA 1P0KA 3GXIA 4Q8UA 1ZBWA 2FZNA 5U4NA 5F7UA 1FHUA 1DWHM 3C2RA 3TOPA 2F9RA 5A95A 4Y9PA 3LCXA 1ELSA 2I16A 1EC8A 1KA9F 1O5QA 4BFAA 4UOJA 3NXLA 2WVTA 3NGJA 3ZSTA 4I7VA 3GVRA 3B0YA 3L5MA 4R9XA 2E5DA 3DC0A 3MMDA 2C6QA 1U83A 3G1AA 4EF9A 3CHVA 5T9CE 1GYNA 2GVGA 4UFHA 4I6KA 1G7VA 1BYDA 5HJXA 1D9EA 1W1YA 4ZOEA 2H8XA 4UMBA 2CBJA 2JKAA 1H4PA 2I7GA 3CS2A 2YIHA 1PX4A 1NWTA 4DO7A 4JX6A 1UZHA 2AL1A 4GJIA 1O68A 1KFKA 8CGTA 3IVTA 4BJHA 1X6UA 2P5NA 1TE6A 1GQNA 2FQIA 3CMFA 4J3SA 1W3NA 4JCMA 4IGSA 5PTDA 1ZLPA 3AJ7A 1GW9A 3WL1A 3DBPA 1G0CA 2P0OA 3CHEA 3VIKA 2DT1A 1E1FA 1RR2A 4UQCA 2XINA 4U28A 1OFBA 4KWWA 4JTUA 2RGLA 1A80A 1GOWA 1C7SA 4HNVA 5HOSA 4AUBA 3K4WA 4GO9A 3WDRA 4NJIA 1KXQA 5DF0A 3DDMA 4K36A 4US6A 3S1WA 2DSKA 3DZ1A 3IGSA 4HMDA 4P7RA 4UXDA 3MZNA 4MWAA 4F2TA 2Q8ZA 1PDYA 1WZMA 3F1QA 3MV01 3BLEA 4HB7A 2MUCA 1OF8A 2PZ0A 2I5GA 2WJDA 4W85A 4FMVA 3RLHA 3W7QA 1YMYA 4GJJA 2VDHA 2QUTA 1J18A 3TTEA 4FIQA 5C71A 1B4KA 2J8FA 3OLIA 3PUEA 2AL2A 5LGXA 3CBWA 3HV9A 4EWJA 3EX6A 3HTWA 4L4PA 2V5BA 3OLEA 5L9FA 3Q45A 2ZRXA 1FKXA 2J9ZA 4C6NA 4JTKA 4R33A 6TAAA 3ARWA 4DM1A 3QKEA 4GIAA 2HMCA 5K9CA 1TTJA 3SM0A 5CBJA 1QDSA 2XWDA 3VNJA 3SQSA 4MFEA 4JX5A 4QX4A 1PL9A 5A6KA 3V5CA 1TELA 2JBMA 3FX4A 2ZRZA 1X6NA 1F7BA 2PDLA 3QGKC 1XICA 1O12A 1U2YA 3W7EA 1XGEA 3GXDA 2YCLB 2MANA 3V16A 3E2SA 4QS6A 3GDRA 4WD0A 2CLKA 3TTOA 3GG8A 1Q2RA 3DGBA 3HURA 3FJ4A 1V6WA 1CPUA 5AC7A 4FLRA 3KTSA 1JCLA 2ASHA 3L4WA 5CGTA 1TZ7A 4QE4A 3N04A 1XLIA 2ZYFA 3U2OA 1LLWA 3KFTA 1H7OA 4KFNA 3WZ0E 3UWEA 1V0LA 4D2JA 3NO1A 1OCJA 4DWSC 1H5YA 2CLLA 2XGZA 1K8XA 3EMQA 3ZXWA 4LUJA 4EPEC 4YMZA 1Q8AA 3EGJA 4OUEA 3RNDA 4MPKA 1GOKA 2JALA 3UU0A 2C13A 3T2OA 4TVCA 1EHNA 1NF7A 1Y0EA 3WLNA 3K8MA 1JCJA 1XD1A 1TR9A 3IIPA 3AO0A 3CYJA 3O6YX 4CD5A 5CPQA 3NEVA 2WW5A 4OBTA 4US5D 4DBEA 5C6MA 1XISA 3DAQA 1VFHA 2WMJA 3LRMA 4IH3A 1JZ3A 5AZ0A 3BE7A 3REQA 1YQ2A 5FA5A 1RQBA 2X0YA 4HIBA 3UZ5A 4GXPA 3PP7A 3FKKA 2B7PA 2PB1A 3EWXA 2ZRVA 1ECQA 1GEHA 3TOYA 3QHOA 2PRMA 3IUDA 3LCWA 3MWCA 2F61A 3PAJA 2QJIA 4NF7A 3A64A 4RXFA 4UTHA 7REQB 3RR4A 2ZADA 4HCHA 3LK6A 3B8UA 4B3ZA 4BI7A 4LAUA 1B31A 4XTDA 1WA3A 4GUFA 1CYGA 1O5XA 1CXEA 4E2BA 1ENUA 3V1PA 1EF3A 3CUGA 2G5WA 2EJ1A 5BU9A 4G2DA 4N9CA 1CBGA 1XIHA 5LNVA 1A5LC 4QAIA 3W1RA 3LHTA 2Z25A 1ZY9A 1JUBA 1M6JA 3PBGA 4DNHA 3ZMRA 2YCLA 1BF6A 2I56A 2Y5JA 1TPWA 1TCDA 3NPXA 4M1RA 1LP6A 4ZQOA 4I3GA 4G56A 2C14A 1W3LA 1RXOB 3S5OA 3AXHA 3IAQA 5DMYA 1O1HA 2BFGA 1SJAA 1WAUA 4LBRA 2X1TA 1T96A 2TAAA 3TNBA 1U33A 4REQB 1E9ZB 1DWJM 4NJKA 1TIWA 3AUJA 1HTIA 3LMZA 2TMDA 4JY9A 1XDLA 5SWUA 2Y0FA 1FA2A 1BVWA 1UJPA 2Y7EA 1IWAA 4HYVA 2PUZA 2QF7A 3UGVA 2XUCA 2HBVA 3VZZA 4H2HA 4WY0A 4AZ6A 3FAWA 4LSBA 1ZJBA 2HVMA 3CTTA 4HJFA 3N6HA 1E9LA 3VKKA 1G6CA 2GJRA 2VFEA 1I2PA 1DXEA 3WNLA 3H26A 4D6GA 3M0YA 3UNTA 3OHMB 3N4FA 2NLYA 1MDLA 2W6RA 1RBAA 1POJA 1OABA 5A6MA 3EPMA 3BCJA 3WLLA 2OPJA 3HM7A 1ONWA 3GFZA 4ZB5A 1QNRA 1G69A 3R8HA 4Y9MA 4C7DA 5A6JA 1Y7VA 4JFSA 4EXAA 5HMDA 3F7JA 2Q6ZA 3BWWA 3VPLA 4C6DA 4C6PA 4ZE4A 4C6FA 2YJQA 3DFTA 2I5IA 4IPNB 4IWWA 2WO5A 3NTYA 7REQA 3HFTA 1W37A 2PDPA 4ZOBA 1A0EA 3IJ7A 2V63A 4KWOA 2NXIA 2O9PA 1JRBA 5DCEA 3OP2A 1E6SM 1O60A 3QQ1A 2OSYA 1U5JA 5D9OA 4IX2A 4B2DA 2GOKA 3CHCA 3DG7A 3FXYA 3IK4A 1QU4A 1BKHA 1T8XA 4NUWA 1CW2A 4AMAA 2CW6A 3CPRA 1TREA 3UR7A 5K4XA 3VIMA 3MCOA 3LI1A 4PTNA 5LIWX 4W89A 1VB9A 2F7FA 3MVTA 3WQCA 2OSXA 1M3UA 4LNCA 3ARPA 4DJEA 1TR1A 2BODX 3VGBA 1Q8JA 5HWJA 2W61A 2PLJA 5AHFA 1E72M 3DH7A 4OU1A 3WQ5A 2WB5A 3RMJA 4H00A 3H2NA 4NHVA 1RJQA 2H6RA 3TSMA 2VO5A 3RXZA 1MFUA 1DEDA 1ZRQA 2FTWA 5ECVA 3MSRA 1MRAA 4NZFA 4K1WA 2OT1A 4O8AA 4ZA0A 1JYWA 2PDMA 5J5DA 1QNPA 2ZZ2A 4YVVA 4M80A 3CPGA 5BOOA 3GXFA 1WOAA 3JR2A 1KBJA 1JZ8A 1WKYA 4MLJA 3CO8A 2WNQA 1UWTA 3TUUA 3DI0A 4AEEA 1OFRA 4X0VA 1PZ2A 4YIWA 3TTSA 1W9DM 3EB3A 1PIFA 6A3HA 1JR1A 3Q67A 4PRRA 4ML4A 4WF7A 1C8QA 3C86A 1KNWA 1YTKA 3F4NA 2YBUA 1DE5A 1CX9A 2NWSA 4XBSA 2GLKA 4AZCB 1B0IA 3FJ6A 4AWSA 4YN5A 4ZOAA 4YNGA 3LCIA 2QCDA 1E4LA 1P0DA 2QAPA 4DBDA 4WK9A 1YEYA 2YW3A 3T0CA 1Q6CA 1RBLA 4QG6A 2D20A 3BSGA 3RDKA 3QYQA 3QOKA 4UWMA 1OJXA 2ZTKA 2VM8A 1GG0A 4P7QA 3FHAA 5JH2A 2B81A 4EP8C 5AC6A 2PWDA 1LL7A 1S5NA 3BMVA 2LLEA 3P0WA 4EPDC 1S46A 2VC7A 4L4MA 1R2RA 1ZUAX 3UWWA 3GNOA 4LTSA 1DYSA 2E9BA 4I5UA 5BXPA 5CSSA 1E6XM 3OO2A 5C9RA 1AL8A 4MAZA 4KCVA 2DORA 3LBCA 2PP3A 3MU7A 2GJLA 4RL3A 3LTPA 5AYXA 4LAZA 3ZT6A 1NWUA 1OZMA 2Z26A 5CJNA 3RLUA 1W9UA 1QOQA 2EG8A 2B31A 1G94A 5I78A 3TR2A 2EBNA 1GTEA 4AWUA 3QH2A 2FB2A 2EXOA 2DIEA 4ZFCA 3OQEA 4AX6A 2O7SA 5A5WA 3ZR6A 4P7OA 5AYZA 3TW6A 4FPSA 2JE8A 3S2MA 1E6RA 2J6VA 4MNLA 3F4VA 3G6MA 2Z7KA 3V5OA 3W70A 4C1NA 4X2RA 3R2GA 4F0KA 3A24A 4Q4PA 3K2GA 4GGBA 1MUCA 3UXKA 1LZOA 3TYUA 2QLYA 3BPWA 3M46A 3ARRA 3WG6A 3QM3A 2PDIA 2ZZ5A 4PMVA 4GX8A 2GL5A 2HK0A 3TQKA 3VKCA 3ONCA 3ENLA 2YCJA 3WH9A 4IFKB 3CH0A 3JS3A 4H9UA 1GOXA 1TO3A 4Y8EA 2Z1WA 4HU4A 1MXSA 5C9ZA 3GZAA 3WDIA 3TLLA 2NV2A 1K9FA 4MMWA 3JZUA 3O6CA 1PTGA 2WC3A 1LUCB 4ZBCA 1KCZA 4IIFA 3GC4A 2ACRA 3NUKA 1YXYA 1B4EA 1OFEA 3H22A 3SB0A 2GVLA 5TBOA 1XBZA 4IJCA 1Q66A 1V7AA 1VAHA 2WSYA 4LS0A 4P61A 4G7FA 8XIAA 1XDMA 1H0GA 1JL8A 3I3DA 2ATSA 3VKBA 3N29A 4MNMA 3TN6A 1NIUA 1WDDA 2GJXB 5CAHA 1KBBA 4B5WA 4XVEA 4Y2WA 3JU2A 4G6CA 4G7EB 4LCRA 5FKYA 3FLUA 3ICJA 1H1NA 2OJPA 3M9YA 3GKFA 1WUFA 1XRSA 3IJLA 1QOXA 3IGXA 5XINA 2EPKX 5IDIA 3SUSA 1MQQA 4CD6A 3P3BA 1ODUA 5G5IA 1V02A 3RRXA 3ZLHA 2VQUA 3QFEA 4ZENA 4CNTA 3OLGA 3RJYA 3V75A 1C8VA 1Q5MA 3BH4A 1GORA 3TN3A 1DJWA 3QJAA 1C90A 4RDZA 1DXFA 3ES7A 4JY8A 4LH8A 1B9BA 1DV7A 4XD3A 1F3TA 1TCMA 3O63A 4H6RA 2QHAA 3M0XA 1FWFC 4DUVA 3PNUA 5D30A 1LBLA 1FWCC 4B16A 3C52A 4PGLA 3P81A 4IIDA 2AKMA 3M47A 5CH9A 2GQAA 3YPIA 1JNDA 4HK7A 3QZEA 1QAPA 3CEPA 1FWDC 3BJSA 6ENLA 3T9PA 1NDWA 1BGAA 4MSSA 2JKEA 2CWXA 3SCTA 3QR3A 3F4WA 4FXJA 2HSAA 3S2CA 5CZ0A 2QULA 1TMLA 3ARXA 4JTFA 4HU0A 3NL5A 3DG3A 3IARA 3R1ZA 4LNYA 1E71M 3W1MA 1W8GA 3SCQA 3R4IA 1I4NA 4E6MA 3I4KA 3G1DA 4W88A 4W8BA 1EEXA 3LY0A 2J78A 3W6YA 4QQ3A 5HMFA 2W5FA 5D03A 3WLSA 4QDMA 5DT5A 1DJIA 1X97A 1UIOA 3KCJA 2SFPA 1LUCA 1XFBA 4N9DA 3ITOA 1V6TA 3CQJA 3NM3A 1KTCA 2VX7A 1EEPA 1VBHA 3BOFA 3VNDA 2QZRA 1WPCA 4S23A 1IGSA 3MMWA 3BLPX 2NV9A 1E1EA 2E68A 4JBRA 3ITVA 4BEUA 1L2UA 1OFDA 1UBSA 2PTWA 1RCXB 3QSTA 1OFOA 4RCXA 4AY1A 4AZBA 5BXSA 1JAKA 3S9ZA 4I6VA 2WSRA 3PR2A 4HNCA 4O13A 2D0GA 3B4UA 4PMZA 1UROA 3TYDA 5DRCA 1XIJA 5C9WA 2A3CA 5TD4A 4UOZA 1RP9A 4Q7IA 2ACUA 1RP8A 2EG7A 1DTNA 3PWAA 3VE7A 3ATYA 2ATMA 2GJXA 3P5YA 3F5JA 3M07A 5DFAA 3GBDA 1XLFA 3LU2A 3VYLA 1REQB 3S6DA 2QJJA 2CC0A 4MAVA 1LRTA 3WYZA 1JZ4A 1L8PA 4I5RA 2OEKA 2ZQ0A 3SSZA 3LPOA 3TYAA 1GVSA 4H9ZA 4WDWA 3E6EA 1IEXA 4B2DD 2VZUA 3K1GA 3S3GA 3L4VA 1JCNA 3W28A 2Z2AA 2RKXA 3TH6A 1G67A 1GONA 3CUHA 1QI4A 3RX3A 2OZ8A 4NL1A 4YCPA 1OQFA 3KVJA 2WMKA 4ENLA 2QYGA 4NNAA 4P8VA 1SJBA 1GKPA 5A8GA 5HNUA 4AISA 2DEPA 2V30A 1VZWA 3GM8A 1HKVA 1A4MA 4HSOA 4MY9A 2HS6A 3L67A 2G3NA 3GH5A 3FA5A 3P80A 5D9NA 1KC7A 2P8CA 3V0UA 3P2VA 5AHLA 4QHRA 4H7VA 1KKRA 5I0DA 5D2WA 3BARA 1AJ2A 3KOXA 9RUBA 3OA3A 2OZ3A 1YDOA 4C91A 1M7PA 3W1TA 2X40A 7ODCA 3WUGA 1A53A 3TNOA 2IPJA 1XFCA 1OB0A 3SI9A 3BOLA 1DWFM 1B54A 4J28A 3VDGA 1V6VA 1OGSA 3NQFA 4XZMX 3RPTA 2H8ZA 1UKOA 4M6PA 2CLMA 1OBAA 3NM1A 4RPPA 3VGFA 2HXUA 3N34A 2ADAA 4DUWA 4RZBA 4RZ4A 4ADSA 1RPXA 2Y62A 3W74A 5KZDA 3CPUA 5DY3A 2NX1A 1R7OA 3QKZA 5I02A 3MY9A 3R0UA 4GVGA 1L0PA 4NAFB 4LVDA 1K9TA 1AH0A 3PPGA 2WZTA 1E1CA 3KOFA 4D72A 1NDVA 1N55A 2P0IA 1UKTA 4IICA 3DFOA 2WBKA 4PB3A 1ZJHA 1REQA 3ZM8A 1AODA 5GPRA 3KDNA 4O1BA 1RJRA 1M53A 1KXHA 3W25A 2WKJA 1OC7A 4M6VA 1G01A 5EBUA 5F4SA 3TA6A 4LVGA 2I14A 4PL1A 4JR5A 2RDWA 3GTHA 4RDYA 2YL6A 3TJ4A 4O1CA 3HB9A 3B3DA 4O14A 2R6OA 4PMXA 1LOQA 3LSCA 1EPVA 4E4FA 1B3VA 2P3EA 3KBJA 1QJWA 1EZ2A 3K4AA 2CESA 5GJMA 4UFJA 1F76A 3AYSA 2H9AB 3O07A 2BVTA 4DWSB 2EPLX 3W7NA 2JEPA 2RUSA 4UMAA 4POCA 1ZU8A 4GNJA 4HMEA 4JIIX 2OWCA 1PYMA 2QJHA 3IUHA 3NGFA 4KIRA 4W5ZA 1R7AA 3B9AA 1SR9A 2CERA 1LCOA 3QV8A 4FOJA 1HKMA 3KE0A 3INPA 2AOSA 4RZ6A 2NUYA 2BHYA 3IIOA 1C29A 2JIEA 1A3WA 3LM3A 2PGWA 3GB6A 4P8WA 3ARUA 3H55A 4JTAA 3AIRA 3GHTA 5K4ZA 4JYFA 1EIBA 4Y7EA 5EMMA 4YHGA 2IPWA