3WQ4A

Crystal structure of beta-primeverosidase
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
475
structure length
475
Chain Sequence
b'SFNRTSFPDGFVFGAASSAYQFEGAAKEGGKGPNIWDTFTHEFPGKISNGSTGDVADDFYHRYKEDVKVLKFIGLDGFRMSISWARVLPRGKLSGGVNKEGIAFYNNVINDLLSKGIQPFITIFHWDLPQALEDEYGGFLSPHIVNDFRDFAELCFKEFGDRVKHWITMNEPWSYSYGGYDAGLLAPGRCSAFMAFCPKGNSGTEPYIVTHNLLLSHAAAVKLYKEKYQAYQKGQIGITLVTYWMIPYSNSKADKDAAQRALDFMYGWFIEPLSFGEYPKSMRRLVGKRLPRFTKEQAMLVKGSFDFLGLNYYIANYVLNVPTSNSVNLSYTTDSLSNQTAFRNGVAIGRPTGVPAFFMYPKGLKDLLVYTKEKYNDPVIYITENGMGDNNNVTTEEGIKDPQRVYFYNQHLLSLKNAIAAGVKVKGYFTWAFLDNFEWLSGYTQRFGIVYVDFKDGLKRYPKHSALWFKKFLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-primeverosidase
publication title Crystal structures of beta-primeverosidase in complex with disaccharide amidine inhibitors.
pubmed doi rcsb
source organism Camellia sinensis
molecule tags Hydrolase
total genus 188
structure length 475
sequence length 475
chains with identical sequence B
ec nomenclature ec 3.2.1.149: Beta-primeverosidase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wq4A00
1HXJA 1W3HA 1VB9A 1QNOA 1UZ1A 1JYVA 3AIUA 1B90A 1US3A 2VJXA 4U3CA 3T08A 5EMYA 1HL8A 1E5JA 4GQQA 2J78A 4JFUA 4UCFA 1J0IA 1ZL1A 2Y5EA 3W28A 2W4XA 2WMHA 2ZXBA 2DT0A 5IFTA 3VM5A 2YOCA 1FH9A 2ESCA 2CETA 1V6VA 3PZVA 4AZCA 1J9YA 2PWGA 3W6MA 3LMYA 1XSJA 1V3IA 1ESWA 2J7CA 2WNWA 1PZ3A 1RH9A 3AXXA 1GQIA 2ZWYA 2WHMA 1EOMA 3SEPA 3U5YA 1UR9A 3D5HA 3VNYA 3SCOA 1L0PA 3N13A 3DC0A 3PZMA 2E40A 2W67A 3UESA 3PTQA 3THDA 3W82A 3K4DA 3RM8A 4CUCA 4CD5A 4BQ2A 4D72A 3CZLA 4DUXA 2EQDA 2YKKA 4X9YA 5ABFA 5FOOA 3AS3A 1UH4A 4Z2JA 3GH7A 1BYDA 3CHFA 4C7DA 1UH3A 2J7EA 4JHOA 5FKYA 3VD7A 5A3HA 3CUIA 4PMOA 1KCLA 2C0HA 1QBAA 1B2YA 2NSXA 2ZE0A 3ZQ9A 4L4OA 1QNQA 1UR4A 2VRKA 4PTVA 4UOZA 4W7WA 2V38A 3WDJA 3WL0A 2W61A 4J27A 4JFTA 2XM1A 5ABEA 3AMLA 1JZ2A 4D6IA 1UWIA 4HOWA 1E0XA 4UZUA 5DFAA 1EHAA 1QI0A 1W9XA 3AISA 5AYBA 1XH1A 4XV0A 4UOQA 4AY1A 2EPNA 1WZLA 2JALA 4GXPA 1EDGA 3QGVA 1W3KA 1GQKA 3AICA 3M6DA 4S3KA 2DSWA 2IXUA 4JCMA 4OZOA 1C90A 2ZXQA 5A1AA 3GYCA 1BVNP 5FL1A 4HZ8A 4WK9A 4TXEA 5CXPA 4MDPA 3WH6A 3QOKA 1V3HA 4B15A 2J4GA 3WH9A 1V6UA 3BAIA 1FHDA 1E4IA 1E5NA 3A4AA 1QI3A 5I6SA 4AZ6A 1H4PA 2VTFA 3BLKA 3VX1A 3OBAA 1J11A 2G3MA 3UG4A 4RE2A 2NT1A 1ZJBA 4XUYA 3CO4A 1QPKA 1PEZA 2CKRA 3AZRA 5CSUA 2VQTA 1KQZA 1V3KA 5HDRA 8CGTA 1R85A 2Q8XA 3VO0A 5LYRA 3N11A 1J0HA 1G0CA 1JZ8A 4MJ2A 1DWJM 5D9MA 3KWXA 3ECQA 3W0KA 2WCAA 4PBGA 2WW5A 3AHVA 3SCPA 1QNSA 4KMQA 3EMQA 3S2CA 4DWSC 4AISA 3PTKA 2W62A 1JYNA 4HPGA 3KE0A 3RILA 1UWUA 4WJXA 1HJUA 2A3EA 3WNPA 4MDOA 4IPLA 3BMWA 2WMIA 3KL3A 4B3LA 4PMXA 1FP8A 4TVDA 3RM9A 2CBJA 5A6KA 5C71A 3WN6A 2G3JA 5IFPA 1RP9A 5AY7A 1TE1A 1E40A 1NWSA 4ZE5A 3OGVA 5BROA 1X1NA 1GPFA 5A2CA 1H5VA 4GI9A 1BTCA 4UQBA 4H8UA 1L8NA 1HT6A 2XSAA 4OOZA 2ZUNA 1H11A 2WK2A 2GJXB 3ZM8A 4OBSA 1G1YA 3CUHA 1VF8A 5JBDA 4Q7NA 3WD3A 3BXWA 1EA9C 1EDTA 2XGIA 1CIUA 1AQMA 4D6FA 1US2A 4ZE4A 1UD6A 1MFUA 3VILA 2E3ZA 4CVWA 3ALFA 3HN3A 4UQ9A 1JZ6A 2PF0A 1V6YA 3ZJ6A 2J7BA 2WVVA 4M56A 3MKKA 2YDSA 2VZVA 3ARUA 1UWSA 2WKLA 1OB0A 1LF1A 3PZUA 5E0FA 4WF7A 3OLEA 1LQ0A 1HNYA 2QHAA 1C93A 3N15A 2W63A 2EXOA 1E0WA 5GNZA 1XYFA 1MVYA 4AZ5A 2QPUA 1UKPA 1HVXA 4P7LA 3OLGA 5JIPA 3VGEA 4AEEA 5BXRA 3T2PA 3WFZA 1V0KA 1OD0A 5A2BA 1ISZA 4GI8A 3WDPP 1B3XA 4TX8A 1BG4A 2GFTA 2J79A 4CU8A 4EAMA 4D1JA 3NJ3A 4UQCA 5JBFA 4MAZA 3W26A 2WHJA 3VVGA 3ZO9A 1XYZA 4HA1A 2VUYA 1UWRA 2O9OA 3K8MA 3GDBA 5I23A 2JIEA 3AMCA 1UUQA 1D3CA 4PCTA 1EGZA 2J8FA 2CHNA 3BSHA 4PTMA 3TTYA 2WANA 1VJZA 1GW1A 3GZAA 5A8NA 5BRQA 2BVYA 3MO4A 2FH8A 1PZ2A 5DO8A 2WZEA 1PBGA 4XZBA 4U3AA 4CN6A 5GNYA 5CPQA 2EEXA 1F4AA 2GSJA 2ZX8A 4W87A 2WSPA 3D3AA 1C91A 2Z1SA 5A8QA 3WNMA 1JZ3A 2RGMA 3VTRA 3I3BA 4PSPA 1XC6A 1OT2A 3T0BA 1GOKA 1H41A 5A6AA 3NUKA 1MYRA 4W86A 1VFFA 1CGWA 3GNRA 3EDEA 1CXHA 4HP5A 1GHRA 2CEQA 3BCFA 2XM2A 3CUJA 3WBEA 1W3JA 1PPIA 2FHBA 5JUVA 2GDVA 2WVTA 4HMDA 4W84A 3RMEA 6TAAA 3PZTA 2WVVB 3T0DA 3WNOA 1AVAA 2G41A 4D6JA 1V3LA 3VDAA 5HPCA 4MTVA 3WQ5A 1LWHA 1IV8A 2XVPA 4R27A 1ODZA 3CZ8A 4EANA 4LYQA 3VM7A 4LGXA 2GK1B 4A3HA 3PBGA 3WQWA 3MUAA 3DHUA 2V5CA 3GBEA 1GONA 1UOKA 2VZSA 3MUIA 3ZT6A 1EOKA 4P8XA 4CCCA 4CU6A 3VGHA 3UG5A 3EDJA 4GIAA 1GJUA 1BF2A 5DT5A 3VU2A 4J3XA 2WC7A 1J10A 4QDMA 3FN9A 2CIPA 3QR3A 4DUVA 2J7GA 5I77A 4GZJA 4CCDA 3WF0A 3W81A 2DSUA 2VX6A 5EBAA 2WZHA 4TVCA 5A8MA 3KZSA 1CDGA 1ZBCA 4RL3A 3T2QA 4WLCA 1V6XA 4W89A 2BHZA 4M24A 3RO8A 1ITXA 3WIJA 2DT3A 1AQ0A 1IZKA 2VX4A 2Z1KA 1WE5A 2CBUA 2CCRA 2WC4A 1QHOA 3SCSA 2UY3A 5E6ZA 2O92A 4AYSA 2EPMX 3VX0A 3W24A 4E8CA 5I78A 3IANA 5F7UA 2AMGA 3IK2A 1E56A 2XVNA 2XFRA 4AZ7A 1UKTA 4WSKA 4H04A 1JF6A 3VD4A 1NP2A 3WDQA 3POHA 1G01A 3MU7A 4P7RA 2D24A 2BS9A 3TOPA 4GO8A 1HVQA 1UWTA 3U5UA 3RCNA 1MQQA 1UH2A 2CERA 1HX0A 4W85A 2UY4A 3WMCA 2CKSA 4PMRA 1EO7A 1V03A 1GHSA 1DWAM 5CQ1A 2WM0A 1JZ5A 5I0DA 3NSXA 4W88A 3MUY1 1OCQA 5C70A 1VEMA 5KEZA 3W37A 4H8HA 2OSWA 1E1FA 3AZTA 4QLJA 3WQ8A 3SIMA 3AIVA 5D9PA 2ZX5A 2V5DA 3THCA 5A6LA 1CENA 4KRTA 2XWDA 4OUEA 1R86A 5A6MA 2BHYA 1SMDA 3SCWA 3VD3A 1LL7A 4CVUA 1KXHA 1W1VA 4MADA 2NT0A 3GNPA 1CGXA 1CGUA 4J3SA 4M1RA 5A95A 4AD5A 5ECUA 1KWGA 1KB3A 3AZSA 4IISA 1J0JA 2D0GA 4IM4A 4MNMA 4MB3A 2VX7A 5D9OA 1UR2A 3CHEA 5D8ZA 2Y4SA 3T0AA 1M53A 1UQYA 1VBRA 2BY1A 1CGVA 3VGFA 2WMFA 1B3YA 4MNJA 1WNOA 2D23A 1CEOA 1VFMA 2XUCA 1EO5A 3AI0A 2XGBA 1SMAA 1E6XM 1EQCA 3GXDA 4YN5A 1TG7A 1YHTA 5DEZA 2E0PA 1A3HA 1JD7A 3VNZA 2MANA 1OGBA 1DTUA 3B9EA 1XGZA 3AIWA 1TZ7A 1ZS2A 4KGLA 1EH9A 4YHGA 3CMJA 1MW3A 2DH2A 2EO7A 2XFFA 4AZHA 1Z32X 5A94A 1HJVA 3MMWA 3ZR5A 3ARPA 1M04A 4N0RA 2VR4A 1K9DA 3F5LA 3W6LA 5BXPA 3WEOA 1K9EA 3CBWA 1PIFA 4QAWA 1BYCA 5ABGA 1V08A 4D6DA 1WZKA 4PRWA 3VIIA 3M46A 2X2YA 1MW0A 4D1IA 2X0HA 2XTKA 3QOMA 1PIGA 3VPLA 3ZSTA 1V0NA 1GOMA 2A3AA 2BV9A 4JFWA 1E4NA 1W9VA 2VMFA 4UR9A 1E55A 1XSKA 1MQPA 2A3CA 3VIGA 3A4WA 3GXMA 4UTFA 1W9PA 3B8SA 3VINA 2CNCA 1BGAA 3N17A 1KGXA 1OIMA 2JEPA 5C8BB 1ISWA 2BFGA 1CXIA 1DHKA 1LL6A 1KXQA 1MQRA 4U2ZA 2WVUA 4W7UA 2WPGA 2ZOXA 4CD4A 3UEQA 2QV4A 1JFXA 1WB0A 2E8YA 1JI1A 3JUGA 2W66A 1WO2A 1G9HA 3AQUA 3MMDA 2VZUA 4PTWA 1VENA 5A8PA 4ACZA 2OYMA 3KL0A 3O2LA 4RE3A 4W93A 2WC3A 1IT0A 3WH8A 4P7OA 2Y8KA 1OM0A 4PMDA 1JYXA 5CPTA 2DSVA 1NP0A 1V02A 1I75A 3U57A 3VIKA 3HU7A 2J25A 1KWKA 1JAEA 1CPUA 1LLOA 3LPOA 4BA0A 2VVSA 5TD4A 4PTXA 1JNDA 1VBUA 3AFBA 3PZNA 3J7HA 1WDRA 2ZX6A 2W5FA 2UWFA 1BVZA 4AMCA 4AZIA 3BSGA 4UOJA 1WDPA 1B1YA 1UKOA 1JF5A 1I1XA 2E9LA 3FW6A 4AZCB 5A6SA 1VEOA 1HKIA 3AOFA 6A3HA 3SCNA 5KZ6A 2FGZA 2HISA 1DWHM 5A8OA 8A3HA 3TONA 3DECA 2PB1A 1UKQA 1OBAA 2WBGA 2JF7A 2JFEX 2VR5A 4U33A 1SR0A 2EPKX 3ZJ8A 5D4YA 3AS0A 3CZGA 1R8LA 4PN2A 1E71M 4GINA 4AD0A 4XB3A 3ALGA 3N12A 3AYSA 3SUUA 3BAKA 1BLIA 5ABFB 3MV11 1QNPA 4PMUA 4C7GA 4WSJA 1PX3A 1NOWA 2VC9A 4J3VA 4BZYA 2V3DA 4X0NA 3SUWA 2JIWA 3WNNA 2VI0A 2CBVA 1JDAA 2V3GA 4JCLA 1KXTA 4JL1A 1W9UA 3MS8A 3OZOA 2V3FA 1UD5A 2E9MA 2ZIDA 3SUSA 4Z2KA 5CJ5A 4ZFMA 1NOUA 5IHSA 2J7FA 2F2HA 2WWDA 4W5ZA 1CXFA 3G6LA 4UQEA 1JL8A 3ARRA 3GTNA 3SUVA 4FLOA 5GQBA 3L4WA 4JKLA 1CZ1A 5LA2A 2YLAA 2UY2A 3N18A 1RPKA 2J74A 1CXLA 2ZUMA 1CWYA 3BMVA 5BXSA 3WD1A 5AC5A 3BAYA 2WMKA 2J62A 4D6CA 1BAGA 2ZUWA 2QMJA 3ARQA 3RJYA 4M8UA 4H7VA 4AC1X 3FY1A 1B31A 1MWOA 4MNLA 3WMBA 4QP0A 5AYIA 1W3LA 1VFUA 3TTQA 3SCTA 1B30A 4OBRA 2BY2A 4H41A 3SCQA 4TTUA 3ZSSA 2VO5A 2BNJA 1FOBA 1TVNA 4L4PA 3MSDA 3CZJA 1TVPA 3AS1A 3OIHA 2OLHA 1UD2A 4DM2A 4MAVA 4UNIA 4OIFA 4AIUA 2YDQA 2WB5A 4HU8A 3HMCA 3UERA 1XCXA 3AXHA 4NF7A 1KBKA 3N1AA 3NDZA 1HL9A 4FLRA 2WLYA 1JFHA 4WKAA 2W92A 5M17A 5A69A 4OKDA 1O6IA 1X6NA 3II1A 1B3ZA 3SCUA 1HJSA 2JEQA 2OSXA 2WLZA 3FNDA 4AD1A 2D0HA 1MXGA 2YDRA 2D22A 1CGYA 4E8DA 4LPCA 2WBKA 7TAAA 4GO9A 2WZIA 1B3VA 4NRSA 4F79A 2WMIB 1GORA 5DF0A 1CTNA 3WNKA 3VGBA 4AW7A 1H0IA 3S6TA 1FFRA 4JL2A 3ZOAA 1QI2A 2BY3A 4J7RA 2OYKA 3KL5A 2PBGA 4PMYA 4B9YA 3OLDA 2DSZA 3O9NA 2YA0A 1CLXA 1JIBA 1W1YA 3IAQA 1GNXA 2OWCA 3K46A 4LXFA 4HU0A 2JF6A 1E6SM 1E72M 4FF5A 1E6NA 4B16A 1K9FA 1BSIA 3WF4A 4DWSA 3MUZ1 3GXIA 2WHLA 7A3HA 1E73M 3RM4A 1K9TA 2O9TA 1W2PA 5M5DA 4LX4A 1KGWA 3MSGA 2XSBA 1RP8A 2C8NA 1V02E 1R7AA 3VKKA 2XPKA 2WMGA 2X8RA 5I2UA 1I1WA 3WY1A 1HJXA 2BXZA 2WCSA 1W91A 4CGTA 1KQYA 4JKMA 1TR1A 2BHUA 3W38A 1H1NA 1TA3A 4NZCA 2YIHA 1D2KA 1NM9A 2FDMA 3B9DA 1J12A 4ZXOA 1LJYA 2ZUTA 3PZQA 4A4AA 1EQPA 4UQAA 5A6BA 2XVLA 3W29A 1FHLA 1P6WA 1UWQA 1YQ2A 3FAXA 1ODUA 2D0FA 1JXKA 2D20A 2FGLA 3AYRA 4KWUA 2PI6A 1V0MA 4V2XA 3KEHA 2XVGA 5FL0A 1MW1A 3WDHA 4AD3A 2ZXDA 1SYTA 1LL4A 1XD0A 1Q6EA 1SFSA 1K6AA 3GBDA 5E0CA 5HXMA 3VIJA 5M3WA 5CGMA 2X0YA 1W9BM 4R5EA 1S46A 1E6QM 2WAGA 2PWEA 2WXDM 3U7BA 4C7FA 3OGSA 3ZT7A 1NARA 4HZ7A 1ISVA 1HKKA 1ECEA 1WZAA 3VMNA 4UFHA 1E15A 2VRQA 3L4VA 4JIEA 1BQCA 2WCGA 3ARYA 2X05A 5IDIA 4AWEA 3WELA 1XRVA 4CCEA 3PN8A 3AHTA 4W8AA 1BYBA 1XD1A 4W5UA 4Z2GA 4LYPA 1UG6A 3FXYA 4A3YA 2Y2WA 1J0ZA 1VJSA 4P7NA 1M7XA 3ARWA 5I24A 1WDSA 4DM1A 2UY5A 1JNEA 1PJ9A 3AMGA 1JZ4A 4EE9A 3AIBA 1E4LA 4EK7A 1QOXA 4KGJA 5IHRA 5D8WA 2XIIA 3ZJ7A 4AD2A 2YBTA 3PTMA 4UFIA 4YPJA 3A47A 2WYSA 1W1TA 3GM8A 1QVBA 1UR0A 2XYLA 5IXEA 2F8QA 3PZOA 5I3DA 3AIQA 1H09A 5E9AA 3NIYA 4ML4A 4V28A 1O7AA 5EFDA 1JDCA 2A3HA 1JXJA 3QHOA 4D71A 1QBBA 3WNLA 1FH7A 1V0LA 4M82A 3L4XA 3POCA 3B9AA 1KR0A 5CPSA 3BAJA 4UFLA 2BVDA 3WUEA 4OJYA 1AMYA 1EXPA 4TTGA 2QLYA 3SUTA 4HMEA 3WF1A 1XH0A 1NOFA 3AS2A 3VGGA 2CPUA 3WQVA 3UCQA 1ZB5A 1JD9A 2PWHA 4JZ5A 3ZR6A 2EJ1A 1XHGA 5DMYA 2Y24A 1NWTA 2VVNA 4W7VA 1GVYA 3O6AA 2OSYA 3ARSA 1E6PA 2DQXA 9CGTA 4Z2LA 2V3EA 1UD8A 2ZXAA 3PZIA 3W25A 4CD8A 3WH5A 2WVSA 4D6EA 1C92A 3HJEA 5BRPA 2DGAA 3WEMA 3AHYA 3ZIZA 1FA2A 3SCVA 2DH3A 3RIKA 2IXVA 3CHCA 3IJ8A 3TTOA 1E4MM 2GDUA 3FAWA 1B9ZA 3L2MA 4QCEA 2YA2A 1QHZA 3BGAA 4AEFA 5EB8A 3WQ6A 4LYRA 3IJ9A 3VIOA 1KCKA 2XHYA 3L4YA 3SCRA 3WL1A 5HPOA 1BYAA 1HN1A 2DT2A 2YLLA 4GZEA 4H2CA 1OINA 4QCFA 1E1EA 1GQJA 2DT1A 5A2AA 1DEDA 1CECA 1GCYA 4BQ4A 2O9RA 3M07A 3FHQA 1GOQA 4D6GA 1U30A 5D9NA 4J3TA 3IAPA 1CLVA 1J18A 3MV01 4Y7EA 3BH4A 1VIWA 3PHAA 1F4HA 2J7HA 4WKFA 1FH8A 3T09A 2AAAA 3CZEA 1W9DM 3VIFA 4HA3A 2F61A 3WEZA 4M29A 1LWJA 5CSYA 2CYGA 5CLTA 1W32A 1R7OA 5HBFA 1E3ZA 1UA3A 3UR8A 1OGGA 4BCEA 3VD9A 3OGRA 4JAWA 4JKKA 4PUEA 1ISYA 1UKSA 4X0VA 2CXGA 1FFQA 3WMSA 3WUBA 2ZX9A 1HF6A 4FMVA 2VL4A 4N42A 2GVYA 2G3NA 2GJXA 1E70M 3LPPA 1CXEA 2ZUSA 2DPEA 4BF7A 2PWDA 3AIEA 3DYMA 3VOCA 1BGGA 5GPRA 3WUFA 4GI6A 3F5KA 3DHPA 4PMQA 3VIHA 3UR7A 2G3IA 4UZSA 3W4RA 5FIPA 1WP6A 1BPLB 3CH9A 3EMZA 4GPNA 4FLQA 1OSEA 2B31A 1MXDA 1GJWA 2QMKA 4HOZA 1UD3A 2A3BA 2EPOA 2ZUUA 4GZIA 5E6YA 3WQ4A 4QLKA 2JE8A 4DWSD 3L2LA 1A47A 3W27A 3CTTA 4XX6A 2TAAA 1ZU8A 4PMVA 3T2OA 4NRRA 4WIWA 2WMJA 1DP0A 1GOWA 1ZBKA 3M7SA 3CLWA 3QHNA 3TA9A 5BWFA 3CPUA 1PX4A 1BG9A 2ZX7A 5BYWA 1E6RA 1UQZA 4K68A 1CBGA 2EBNA 2YJQA 3UETA 1DWIM 3WFLA 4GKLA 3ZT5A 2XFYA 4F9DA 2X09A 1HJWA 4GQRA 4LQ1A 1KFWA 2VX5A 2WHKA 4Q22A 1HP5A 1VEPA 1WCGA 1DWFM 1ISXA 1JGIA 5A6BD 1GQLA 1JYWA 3CHDA 2E8ZA 1EIBA 3VGDA 3L4UA 2WKGA 1GVIA 1C8XA 2FHCA 4J3WA 2QF8A 2J77A 2VURA 4J28A 1ITCA 1H3GA 3WKZA 3WUGA 3MMUA 3LPFA 4ATWA 1HKJA 4NSBA 1NQ6A 2XG9A 4MB4A 3NDYA 2Y8VA 1E6ZA 4J3UA 1PX8A 1XCWA 4HA4A 3BLPX 3TTSA 5HOSA 3BCDA 2NW0A 4ACZB 1NH6A 2IUZA 3L4ZA 3VDCA 5M03A 1VAHA 5E09A 3OB8A 3RJXA 5LA0A 1CNVA 1EDQA 1KR1A 3CIVA 1W1PA 3E1F1 1UHVA 2XIBA 1HKMA 1JAKA 4NI3A 3NCOA 4F8XA 1AQHA 1OT1A 2VT0A 4XZWA 3WBAA 3K1DA 1Q6GA 4BQ3A 4UFJA 1OD8A 4U31A 5CZKA 4U2YA 1M03A 3CZKA 1NWUA 4AIEA 1V3MA 2OWXA 2W91A 1DWGM 1WZMA 3A4XA 4MB5A 1X6LA 4HOXA 1NWRA 3K8LA 2AOSA 3AROA 3U7VA 1GZJA 4W8BA 3GH5A 3I3DA 5ABHA 3OA5A 2BXYA 1E43A 3TP4A 3ARVA 2WWCA 4WKHA 1MW2A 1V6WA 4CN1A 4V27A 3G6MA 2GK1A 2EPLX 2X1IA 1ZBWA 4IPNB 2DDXA 3VD5A 3N9KA 4TVUA 3AIRA 2CESA 1KXVA 4U5KA 1WPCA 2XVKA 1U33A 2VOTA 3CUFA 1D7FA 1HIZA 3EYPA 2J7DA 4CD7A 1KBBA 2O9PA 2DIEA 2J75A 3A6OA 4AIOA 3AXIA 4UFKA 4AD4A 1XV8A 2D2OA 3APGA 1OWQA 4TX6A 4QLLA 7CGTA 2BVTA 4PCSA 3CUGA 4BQ5A 3BAWA 2GJRA 1ZJAA 1LG1A 2BY0A 2FH6A 3VMOA 5CG0A 3WDRA 1GOOA 5AC4A 4AXNA 4MNKA 4MPKA 2J47A 2CHOA 3GNOA 2G8ZA 4KH2A 4D6HA 5I79A 4JFVA 3ARTA 1M01A 4W8LA 2OYLA 1QNRA 4B3KA 1EHNA 1KGUA 2YA1A 3EDFA 3VIMA 5GNXA 5FD0A 3VDHA 4QFUA 3ARZA 1XH2A 1OGSA 4M80A 3BC9A 2VCBA 3WDIA 5A6JA 5FCZA 1J01A 1PAMA 2YL9A 1B0IA 1CYGA 2WSKA 2E4TA 4F66A 3W53A 4MB1A 4URIA 2CITA 5EFFA 3AJ7A 1ZBVA 4UQDA 2OWWA 4E2OA 1IZJA 2PWFA 4OOUA 1TMQA 3NSNA 4IUGA 3EDDA 3F4VA 1GUVA 4HPHA 1TFVA 1H2JA 4ZENA 2YL5A 4AZBA 1Q4NX 1C7SA 1CGTA 3OLIA 4KRUA 2PC8A 2G4FA 3L4TA 4P8UA 1C8YA 4CD6A 5LA1A 1C8QA 1H0GA 2C7FA 4PUDA 3LPGA 5BCAA 4M81A 3NSMA 1UA7A 1Y7VA 2QPSA 5BXTA 3GXFA 4B9ZA 1C7TA 1Q6CA 4DUWA 2DSKA 1WDQA 3BAXA 3PZGA 1R87A 4EKJA 4HZ6A 4JHZA 2ZICA 1HP4A 4JFSA 5JIWA 2VZTA 3WD0A 3AHZA 2VRJA 3WH7A 3QHMA 3AHXA 3N04A 4P8WA 5DT7A 1QW9A 1E9LA 4P8VA 2GUYA 2HVMA 1WAWA 3UG3A 3EDKA 4AZGA 1JZ7A 3EBVA 1UR8A 1UZ4A 3VDBA 4MJ4A 5CGTA 4FK9A 4HMCA 5I5RA 4U5IA 3ARXA 4PMNA 3ZMRA 4ZXLA 3K4AA 3WD2A 1MFVA 4P7QA 2ZWZA 2VCCA 2YL6A 4H8VA 4CN4A 5CLWA 3WF3A 1Q6FA 2D3LA 3WF2A 3NYDA 5HNNA 3K8KA 3ZJKA 3PZ9A 4DWSB 1UYQA 2YL8A 2RGLA 1VRXA 4PEEA 2DIJA 3MANA 1UD4A 4PSRA 3RPMA 3RDKA 4ATLA 1G5AA 3EMCA 1RD6A 4BS0A 1Q6DA 2GJPA 2PBOA 1CXKA 1E3XA 2D1ZA 1XSIA 1G94A 3GH4A 3VMPA 1N82A 1WKYA 1HJQA 1BHGA 4TUFA 3CMGA 4ACYA 4ATDA 5JBEA 3WD4A 1OIFA 1TA3B 2XJ7A 1FP9A 4S3JA 3OG2A 1UR1A 3AMKA 1E0VA 1QW8A 1JDDA 2VNCA 3WENA 1TCMA 4Z2IA 1U2YA 2E9BA 4F9JA 1QI5A 1V3JA 1B3WA 2DEPA 1C3FA 4TOQA 4CU7A 4UFMA 3CGTA 4FLSA 1H49A 3DYPA 2FHFA 1GOIA 3F5JA 2ZUVA 1LG2A 4Z2HA 4ZEPA 1JG9A 2XWEA 4CKQA 5E70A 1JI2A 2VCAA 2VZOA 3IJ7A 1VFOA 1W2VA 3FHAA 2VQUA 3AMDA 2D3NA 3VUPA 6CGTA 2YBUA 1QHPA 3SURA 3OZPA 1QI4A 4PYSA 4YHEA 1TUXA 2J8GA 3DYOA 3WSUA 1BFNA 4HTYA 4PMZA 1J0KA 3A3HA 4E4PA 3VIPA 4RE4A 3I3EA 1J0YA 2CBIA
chains in the Genus database with same CATH superfamily
4LVBA 3NEVA 4H6RA 4MFDA 4KCTA 3NQ8A 2DZPA 3AIUA 2HNEA 3T08A 3GDRA 5EMYA 1E5JA 5ABTA 1DIDA 2J78A 3TDFA 1J0IA 1ZL1A 3W01A 2F84A 1SO6A 2Y5EA 2WMHA 3W28A 2PTDA 2CLPA 2ZXBA 3FFSA 3VM5A 2QUUA 2CETA 3EWUA 1J9YA 3CQKA 3LMYA 3ITOA 1XSJA 1V3IA 1ESWA 2WNWA 1RH9A 1GQIA 3SN0A 3GVRA 4CNNA 4M6UA 1B57A 2WHMA 1EOMA 4H6KA 3SEPA 3D5HA 3SCOA 3N13A 3HGJA 3DC0A 4D8LA 3LS9A 2J66A 3THDA 1QFEA 4I6VA 4BWLA 4A29A 4CUCA 2EQDA 5ABFA 3L5LA 3P82A 3HPZA 1KFKA 1UH4A 3L7RA 4Z2JA 3GH7A 2PURA 3CHFA 1X7IA 4XKYA 1IEVA 1QBAA 5XIMA 2NSXA 2ZE0A 3S9IA 3S2JA 2V5KA 1XLGA 4L4OA 1KFEA 4JFTA 1JZ2A 1YW1A 3P2VA 2X1RA 3ZS4A 1H1ZA 4UZUA 3PUDA 4MYAA 1W9XA 1HGWA 4UTIA 1XH1A 1RJRA 2GOUA 2GJLA 2JALA 5G2HA 5EY5A 2ZC1A 4A8NA 3M6DA 3M0VA 1C90A 2ZXQA 1GVOA 3GYCA 4JXCA 1BVNP 3GW0A 3UT0A 3L0NA 4WK9A 4MDPA 2TYSA 4LAKA 4PUKA 4BI6A 4CCZA 4AQLA 4B15A 3BAIA 1F61A 3A4AA 2OZTA 3OBAA 2G3MA 3C86A 3UG4A 4R7WA 5C7VA 1GPWA 3CO4A 3WJSA 3AZRA 2VQTA 4HT3A 1KQZA 4U10A 5HDRA 1N2VA 1FWFC 1R85A 2YXXA 4H7ZA 3W00A 1BXCA 4LBSA 3EWZA 1JZ8A 1J2BA 5D9MA 3ECQA 3QYQA 1WXZA 4PBGA 3SCPA 4K7YA 3EMQA 1Q6LA 2YCJA 4DWSC 3GTHA 1OG6A 5HR7A 4IFKA 1UWUA 1NFBA 4WJXA 3RILA 3WNPA 3BMWA 2WMIA 2QCLA 3W70A 3AU6A 4HNVA 3P81A 2CBJA 1ZJIA 5A6KA 3TR9A 5C71A 3WN6A 5IFPA 1RP9A 3CL7A 4H3DA 1NWSA 3KRBA 4ZE5A 1Q65A 3N6JA 2QJHA 1YTDA 1H5VA 2A7RA 5EPDA 4US6A 3C56A 1BWVA 2CWNA 3VCCA 2ZQ0A 4Y9AA 4CQCA 1H11A 3ZM8A 1SZEA 4HNOA 1DHPA 4ES4A 1FWGC 4HHMA 3LHTA 2REQA 2E6DA 2WZTA 2OU4A 4S3CA 4XSMA 1CIUA 3GR4A 3HG4A 1AQMA 3W02A 1MFUA 3VILA 4CVWA 1WUEA 2PF0A 4N4PA 4IG2B 1QO5A 3M6YA 5BNKA 2YDSA 5H1WA 1T96A 3W1RA 3DXIA 2GGEA 3P74A 1EYEA 3BARA 2OOGA 3NQEA 4LV4A 2QHAA 2W63A 1LRTA 4C90A 2VD9A 1THFD 5EMUA 2QPUA 3GU9A 3GG7A 1MEIA 3L0KA 3FYYA 4QXIA 3UF9A 2DQWA 2NVCA 4MLJA 4B2DD 3R0UA 1G4PA 1KRAC 1ZCOA 2C16A 1OD0A 4DZHA 4GI8A 1XC4A 2E5CA 1B3XA 4M51A 3OBEA 1XDMA 4YTQA 3NJ3A 2I5IA 5JXQA 4MAZA 3W26A 4B92A 1FCUA 2X1SA 3S1XA 3EX4A 4WJ8A 1SUXA 1XIHA 1T8QA 4CNUA 4NAFA 4JTIA 2VUYA 2NV2A 3GIQA 4TQTA 3GDBA 4NKCA 4GKTA 4ZOEA 3WLKX 1Z69A 2JIEA 3DI0A 2ACRA 1JR1A 5JQ9A 5CSRA 2CHNA 3FJNA 3C6CA 1VJZA 1GW1A 3GZAA 1HTIA 3KVJA 3QW4B 5A8NA 3MO4A 3SZ8A 3MSYA 2D2HA 3NXFA 4UNLA 2CHRA 4U3AA 2GSJA 3KTCA 1KLYA 4U28A 3JZUA 1C91A 2OTDA 2RGMA 4CQ9A 3PFMA 4WSHA 1DJHA 3T0BA 3GFXA 1LUCA 3JVAA 1VFFA 1ML1A 3CB8A 5BMXA 4Q8PA 3GNRA 2XIJA 3V3WA 3ZVIA 1VPYA 4I9MA 2NX9A 3RUBL 1XPYA 2A7PA 2QULA 3WBEA 1PTAA 1W3JA 1L6GA 5JUVA 2GDVA 3O05A 3MZNA 1JCXA 6TAAA 3QEZA 4JIQA 4D6JA 1V3LA 3VDAA 1B3OA 1K4HA 3RCMA 4MTVA 3WQ5A 1IV8A 1N8WA 4R27A 1L9WA 1ODZA 5D02A 4GD0A 3QN3A 2PRMA 1EJRC 1SU5A 3MUAA 4GBDA 3WQWA 3N2CA 3RPTA 3DHUA 2V5CA 3H55A 2VFEA 1GONA 4DNMA 3MUIA 2GVGA 1EOKA 5DY2A 4QX4A 4P8XA 2ISWA 3M44A 3O16A 4NZ1A 3UG5A 4GIAA 2WPBA 4J3XA 2F6UA 3FN9A 3LHWA 4DUVA 4HPJA 3OODA 4CCDA 3V18A 2NXHA 1QPRA 3W81A 3PWIA 5FJRA 4NAFB 1CDGA 4H8NA 3H2NA 1TTQA 2F9RA 3E2VA 4W89A 2BHZA 3LA4A 2YB1A 1ITXA 1Q8AA 1YIXA 4FOKA 2Z1KA 2WC4A 4E4FA 1TWZA 2Y62A 3TQKA 4AMAA 4AYSA 1DYSA 1K7EA 4E8CA 3FKKA 2AMGA 2XFRA 4HYRA 3Q2DA 4H04A 3KVMA 3VD4A 5LSMA 1NP2A 1VFTA 4XZHA 4PB5A 2OCZA 1G01A 3RITA 3G8RA 4H4IA 2PMQA 4MUZA 4LVFA 3VE7A 3TC6A 2CERA 3NR0A 4W85A 1GHSA 3B04A 3MUY1 1OCQA 2A6LA 4JN7A 1VEMA 3WMLA 3DAQA 3BJTA 3GR8A 3URNA 2OSWA 3DN5A 4JYFA 3NO3A 3SIMA 5L9FA 2ZX5A 2V5DA 4LRTA 1CENA 4KRTA 2KZHA 2BHYA 4HBKA 3P8JA 1SMDA 3B8IA 3VD3A 3F2CA 5EL1A 1W1VA 5TF0A 4DBWA 1TTIA 1NELA 3H26A 2PEVA 5A95A 2CLFA 4P5UA 1T7LA 4IISA 5I3KA 4HB7A 3QTPA 3W1NA 2J8TA 1EBHA 4MB3A 5D9OA 1UR2A 2BWGA 3CHEA 1D8WA 3GDTA 5D8ZA 3T4WA 3JS3A 3SFKA 4AHOA 4MNJA 2FVLA 3MW7A 3RLUA 1CEOA 1J6OA 5FSEC 3DG3A 1E6XM 4NY2A 1QU4A 1YHTA 1V51A 4O15A 2EGZA 2E0PA 3OVPA 5HMFA 1V5XA 4IL0A 2NXGA 1OGBA 4FHAA 4IMEA 2G96A 2OOFA 1ZS2A 2YGYA 4KGLA 1ALDA 4YHGA 3IGSA 5K4XA 3N73A 1Z32X 1S2TA 4Q7IA 3DOPA 2YX0A 3DFYA 1M04A 2VR4A 2PUZA 3KOZA 3W6LA 1XF0A 1W56A 3WEOA 2XIMA 1BYCA 4D6DA 4FR6A 1A5AA 3ANVA 3NQDA 2DJXA 3AWNA 3OZYA 1XM3A 1IQ8A 2VEFA 3L5AA 3ZSTA 4F2TA 3NVTA 4F3HA 5J8LA 1I0BA 4UR9A 3THUA 1XSKA 2CZEA 4GWEA 1MQPA 2A3CA 4US5A 4GI4A 3VINA 2CNCA 1K03A 3DIPA 2OGYA 1AZ1A 3H54A 1OIMA 3LCWA 2Q02A 3TYZA 3BW3A 2BFGA 1W5PA 3LK6A 1DHKA 1LL6A 1KXQA 2YDAA 3N2MA 3UWUA 3WG6A 5I06A 1NFGA 2RDXA 3G77A 4D8ZA 2ZOXA 1FVPA 4LVAA 5I02A 4Z1BA 3JUGA 5BMWA 4DYKA 4LC8A 1WO2A 1LT7A 3MMDA 5A8PA 2OYMA 1XRSA 3MI2A 2V6AA 1GG1A 1VZWA 4MWAD 1QOQA 3WH8A 3B05A 1OM0A 3TMQA 3KDNA 1VR6A 2RJGA 2DSVA 1Q63A 1SZNA 1V02A 1H61A 3M0YA 2DZUA 3HU7A 1T5AA 5I3JA 4C6PA 1I2PA 2PTXA 2XH2A 1WKEA 3LPOA 5TD4A 5CJMA 1SZGA 3JU2A 3NVDA 1W6TA 3PZNA 4KWOA 2W5FA 4NYUA 3GU2A 2UWFA 3EB2A 3BSGA 3P0XA 4I9AA 3UZWA 1KBLA 1B1YA 3LTYA 1KBJA 1VLWA 4WCJA 1RQEA 3C5QA 3MVTA 4WY0B 3H22A 1JF5A 1I1XA 4X2RA 4AZCB 2AKMA 4RX0A 6A3HA 1PKNA 2HISA 8A3HA 3TONA 3Q94A 3DECA 3NPVA 3W1UA 1UKQA 1OBAA 2WBGA 1JCNA 1RD5A 1MI3A 4R9XA 1SR0A 3Q67A 4JY9A 3AS0A 1L8PA 3QGKC 4PN2A 3R89A 3C2EA 4NZ3A 4KIRA 3FEQA 3BAKA 4C6JA 1AK5A 3B03A 3VAVA 3TYCA 2VD8A 1ADSA 1NOWA 4C5YA 4J3VA 4AF0B 2V3DA 4X0NA 4U4MA 5G1YA 4RPPA 2JIWA 3GNDA 4NJHA 3WNNA 1F05A 2ZDRA 2V3GA 4DELA 4IMCA 1KXTA 5DBTA 3UFYA 3VA8A 3CUZA 5CJ5A 4Z2KA 1OFEA 2AL1A 1NOUA 3WLSA 4LS2A 2FLIA 5A8GA 5C2GA 1CXFA 4GOAA 4OT7A 4UQEA 1HUVA 4HVXA 2HMCA 2OEKA 5GQBA 1CZ1A 3TW7A 4FO4A 2UY2A 4JOMA 2ZUMA 3EKLA 3TYAA 1RA0A 3W2UA 4LVDA 3WD1A 5AC5A 3I6RA 4D6CA 2V30A 1JDEA 1A3XA 4AC1X 3FY1A 3WMBA 3P62A 2YCIX 4HCDA 1XLIA 1RXOB 4DXKA 3FDGA 4GUJA 3D6NA 1NJJA 3CZJA 3AS1A 2H9AA 3QMRA 3GVGA 4S3DA 3HA1A 4HU8A 3AXHA 3BG9A 1TE6A 1KBKA 4TR9A 1HL9A 4IOTA 1JFHA 2Y85A 5C9UA 2QDHA 1Q5MA 5AHNA 4FR1A 1B3ZA 3KVKA 4WJEA 2VUNA 4PFHA 2INEA 3LM3A 4A21A 3VC5A 3TZFA 4DEFA 1UWAA 1NY1A 2FZ9A 1OYAA 4LPCA 2EHHA 4F79A 1GORA 1UP0A 5FJPA 1H0IA 2JKEA 5HULA 5AECA 4J7RA 3OLDA 3LHUA 3USBA 3WLLA 2YA0A 3C2RA 1KCXA 1E6SM 4FF5A 1E6NA 3NTYA 1XBYA 3PJWA 1LP6A 2PDUA 3GXIA 2XIQA 4H9VA 1G4TA 1K9TA 4LX4A 1VPQA 1KGWA 5JVLA 3E0VA 4XZNX 2A21A 1FWDC 2XSBA 4R53A 1FWEC 3M5VA 3FJ6A 3MKVA 1H7OA 1R7AA 3VKKA 2XPKA 2X8RA 5I2UA 2HPIA 5CAHA 1MMFA 3QV7A 3E6EA 4O1BA 5BW6A 5AVHA 4CGTA 3GXPA 2HCVA 1ICSA 1TPFA 2C71A 2C0AA 4A4AA 5A6BA 4UQAA 2VYOA 4ZR8A 1P43A 1Z6KA 2P53A 4O1EA 3U6WA 1YQ2A 1UWQA 2V5LA 1ODUA 4X3ZA 1K8CA 1F3WA 1JXKA 2YCLA 2D20A 2P0IA 2FGLA 4QRNA 5LNSA 1LOLA 1FWTA 4ML9A 5FL0A 4AD3A 2ZXDA 1J96A 1XD0A 3I6TA 1SFSA 1Y5WA 3MDWA 5GVJA 3B8WA 5M3WA 2AQVA 2X0YA 1W9BM 1UROA 4R5EA 1EYWA 1EC7A 4XO7A 3OGSA 4JX6A 3ZT7A 4XBSA 2QPXA 3ITGA 4O54A 4RK8A 1HKKA 3FXGA 3UWVA 3AUJA 2ATMA 5AZ0A 3SRKA 3H7RA 4PUWA 1E15A 4FB7A 3G1AA 4L6DA 1XRVA 5G1MA 2VELA 3PN8A 1I2RA 2QGHA 4LVGA 4W8AA 4HNLA 3K1GA 3WLQA 3W9ZA 1AZ2A 4RW3A 4W5UA 1RALA 2NV9A 3WLPA 2I56A 1WV2A 3FXYA 3T7VA 2JKPA 4A3YA 1S5MA 3QV6A 2P3ZA 1J0ZA 3A13A 4P7NA 2QCNA 4S3EA 1JCJA 4NIRA 4IGSA 1JZ4A 4EE9A 1Y0EA 3WK1A 4KGJA 3O07A 5D8WA 1MDRA 4Q4SA 2XIIA 1R38A 4YWSA 3NPUA 1QVBA 1LTDA 1LT8A 4DN1A 4LWWA 3ISIX 4C5ZA 1S5WA 1H09A 1X39A 2OX1A 3NIYA 1E0TA 1MNZA 3I7QA 4QIUA 4HNTA 1O7AA 4ROPA 3SR7A 2A3HA 4DI8A 3GG8A 1V0LA 3PK7A 3POCA 3B9AA 1N8IA 4DWDA 1KR0A 3LEPA 5CPSA 3BAJA 4RNHA 3MCNA 1IWBA 2BVDA 4Y90A 1PCKA 5AOUA 4OJYA 3FA5A 1AMYA 3HBLA 3SRDA 1EXPA 4XZLX 2OMAA 3SUTA 4QG6A 4O18A 3AS2A 1EZWA 4ZB2A 4MJZA 2VDHA 2CPUA 1JD9A 3PS7A 2YW3A 4L6OA 1W0MA 5DMYA 2Y24A 2GQ8A 4RDWA 1LBFA 4DNHA 4CNPA 9CGTA 3FJLA 4QNWA 2OG9A 5DN1A 1SR9A 3SJNA 1F7BA 2DGAA 1FA2A 4KF1A 2OZ8A 3QJAA 3WK0A 4B5XA 3M7WA 4QCEA 4DO6A 3PBYA 3TSBA 2OT1A 4LYRA 4LT9A 3IJ9A 3WL1A 2QUVA 3ERPA 2DT2A 2UV8G 4GZEA 3EX6A 4H2CA 2ACSA 3A23A 4QCFA 1E1EA 4ZQPA 5C54A 3H53A 3LOTA 4IIBA 3FHQA 1GOQA 4D6GA 1XLKA 3SBFA 3BL3A 4UNKA 3IAPA 3UU0A 3U4FA 3MV01 4K2SA 4M6VA 4HCLA 1VIWA 4BF9A 3U2EA 2J7HA 1TIMA 3HPAA 4ZCWA 2OKOA 1SFJA 1IIGA 1W9DM 2OVLA 3KLKA 3VIFA 4HA3A 3OVRA 5AB3A 2F61A 4JX4A 4M29A 1EJVC 1LWJA 4G1NA 2PZ0A 3KTSA 3NZRA 5CSYA 2CYGA 5CLTA 1W32A 4Q4QA 1XLFA 3PNZA 4ZQRA 2X7WA 1B4KA 1E3ZA 5T8GA 3V75A 3EXTA 3VD9A 1KV8A 4JAWA 1UJPA 4JTGA 1UOZA 1FFQA 3LNPA 3NM1A 3WMSA 1VHNA 4W4QA 4N42A 2GVYA 2G3NA 3L12A 4KEMA 3DBNA 1XWYA 3OU8A 3GAKA 4NNAA 4BF7A 2BP1A 3B0YA 3WLJA 2YR1A 2PDMA 4NUWA 4UZSA 1L2QA 3W4RA 4MGGA 3CQ0A 1WP6A 4DAFA 1KTBA 3GE7A 2QMKA 3UR2A 2ZUUA 4GZIA 4QLKA 2JE8A 4L9ZA 1I4NA 3CTTA 1ZU8A 4WIWA 4P2VA 3IJDA 2PS2A 1QO2A 4XAYA 3M0HA 3TA9A 4ZB5A 5DELA 3CPUA 5JU6A 1JVNA 4IICA 1BG9A 5HMDA 4AFYA 3T8QA 2X30A 1FWHC 1F3EA 3WFLA 1X8FA 1VFSA 2VX5A 2WHKA 1FWRA 1HP5A 1UZHA 3IUIA 4QJ5B 3WLHA 3UXLA 1JULA 3DX5A 3BW4A 4XBJA 1JYWA 2E8ZA 2QEZA 2ZADA 2WKGA 2FHCA 1H7PA 2J77A 3P3BA 5KZDA 4A8IA 4ZODA 2Y7DA 1E9IA 1ITCA 1H3GA 4JTFA 4LS1A 1GVEA 4ATWA 1Q13A 2P88A 4NSBA 3AC0A 2Y8VA 4NNCA 5DQPA 1R5YA 6REQA 5MKGB 4J3UA 3EPMA 1XCWA 4FALA 3PVFA 3EB4A 3HFTA 1ZSXA 3B40A 1EBGA 1BSLA 3G1VA 1UCWA 5HOSA 2NW0A 5LHEA 2Q3OA 4DPQA 3OB8A 3RJXA 5LA0A 1V79A 3CIVA 2Z2UA 3D0CA 2XIBA 4ZOBA 3NCOA 1T41A 4XZWA 3K1DA 1Q45A 2YFOA 1OD8A 4U31A 4U2YA 2BODX 1UUOA 3OP2A 3VFCA 1M03A 3PB0A 2NX3A 2QAFA 3CZKA 1HGYA 4IWWA 1V3MA 4RDZA 5BRBA 2OELA 3A4XA 2VGBA 1NWRA 4GXWA 3TYEA 1H60A 3AROA 3U7VA 3GTFA 5HNRA 3GH5A 3WLRA 8XIAA 3N2XA 2TODA 4FOJA 2BXYA 2X41A 3UVAA 2C1HA 1YE6A 2DZWA 2A6NA 2E6FA 3CEPA 4BF5A 3EWDA 2WZMA 5DXYA 3ZVHA 4V27A 2DZXA 2RAGA 3H2OA 3N9KA 4MMWA 1JCLA 1WPCA 3LHVA 3CAKA 3IVUA 1U33A 1X38A 4GY1A 1BWLA 1CW2A 1TV7A 4GH3A 1EWDA 2O9PA 2DIEA 1XP3A 3LSCA 3OPSA 1C9DA 4AIOA 2NVAA 4UFKA 3S47A 2PDIA 2XU2A 5DY3A 3W07A 4GK8A 2HE5A 3DH7A 2PDJA 1E0UA 3RRXA 3WDRA 1XIEA 4GGHA 5AC4A 3TC7A 2J47A 1Z3NA 3ARTA 2OYLA 3R8HA 1QNRA 3STFA 3R8RA 1KGUA 5CZSA 5HWNA 3KOXA 2E09A 3T40A 4QFUA 3B0XA 1GOXA 3TNBA 5A6JA 5KZMA 1PAMA 2FFCA 4G8TA 1EUNA 1Q6OA 2E4TA 4F66A 3W53A 1R3QA 6ENLA 1IXOA 5I09A 1L6FA 2OWWA 1MXSA 4PGLA 5D09A 1XICA 1US0A 4OOUA 3DFOA 3PNUA 4ENLA 4PMJA 3OOQA 4ZENA 3MUCA 1GWJA 4DUOA 1C7SA 2VEKA 4GLEA 3TROA 4ECLA 4Q6XA 3ELFA 5I3GA 2FZBA 1X97A 2CZFA 4P8UA 3SY5A 2VENA 1C8QA 3LPGA 5BCAA 3TXVA 3NPWA 2X42A 4IP7A 4JTTA 3GXFA 3CH0A 1RVGA 4B9ZA 3LENA 3ZVHB 1XIIA 4FZIA 1C7TA 2GQ3A 3CUXA 3BAXA 1R87A 4PE8A 4HZ6A 4JHZA 5JIWA 4JFSA 1K6WA 1XBVA 3AHZA 2VRJA 5CC6A 1Z48A 3AHXA 5I00A 4FPSA 4I7VA 3D47A 4XQ6A 3W7IA 3UG3A 3EDKA 4AZGA 1H51A 3EBVA 2PDQA 3AXMA 2CLMA 3N4AA 4KIEA 4U5IA 3ARXA 1PYFA 2QR6A 2HBVA 2F2KA 3ZMRA 4AIBA 1DQUA 3K4AA 2VFIA 2GL5A 3SAZA 4B90A 5C0QA 1MFVA 4PRRA 4P7QA 3B8DA 4PL2A 2WM1A 3W2JA 2B7NA 1Q6FA 3LGDA 2YBVA 3W74A 2ODOA 3PZ9A 4DWSB 3CT2A 1PZ0A 4C6DA 4ZMGA 3ZLGA 1E1CA 1M7PA 2FMOA 1YDNA 2WSYA 1GTHA 1ECQA 3RG6A 1G5AA 3LRKA 3EMCA 1RD6A 3LGGA 4HHHA 2WJEA 4QAIA 1CXKA 1L6WA 4HMNA 4JX5A 4NXKA 5AN7A 3IJ6A 5LIUX 3C4UA 2NZLA 3T6CA 1DJZA 3VMPA 2C19A 2XH4A 1J5TA 1NEYA 4GE8A 4PBFA 5AHIA 5LNWA 1TA3B 3CAWA 3T07A 2PGWA 3QPEA 5BU6A 3TW9A 1D9EA 5JH1A 1UR1A 2DZAA 1E0VA 2G97A 3EA1A 1GJPA 4WGHA 3LBMA 4Q8TA 3DGBA 1EGVA 3EOOA 1IXPA 4K3ZA 1MRQA 3G22A 1V3JA 1B3WA 3CNYA 4ONVA 4HN4A 2DEPA 1C3FA 2DUXA 4M3PA 3CGTA 3DCPA 1NQKA 2V2HA 2TPSA 1H49A 3TU9A 1GOIA 3KWSA 2ZUVA 4ZEPA 2XWEA 4CKQA 4IPJA 1OC6A 2VZOA 1KFBA 3EXSA 2VQUA 5CZTA 1LWIA 4NQ1A 1R3SA 5B7ZA 4JIPA 3VFLA 3E0WA 1EF3A 3SURA 3V1HA 1PDZA 4Q8OA 2R9RA 1S2CA 3WSUA 4HTYA 2R1PA 4F40A 3E9AA 2VFHA 3AXKA 3WLNA 1LBLA 2V0TA 2B7QA 1J0KA 2ASHA 2Z1VA 3A3HA 1E9YB 4RE4A 3HTWA 3I3EA 2DIKA 3MZ2A 4L9XA 5TQLA 2FKPA 1W3HA 3UGRA 5CC5A 1QNOA 5SWUA 3C2YA 1UZ1A 1JYVA 5J5RA 4EPBC 4KERA 2JK2A 4QE1A 2PDKA 5AYXA 1R9XA 2Z29A 4J2MA 3VC6A 1DIEA 1HL8A 4JFUA 4UCFA 4LF2A 2C79A 3C2OA 3GC4A 1VBJA 2DT0A 1KRCC 3EPOA 1FH9A 1X96A 2Y5SA 3CIWA 3PZVA 2PWGA 2FJKA 3MQTA 4NJKA 1PZ3A 3L0GA 2GVLA 3AXXA 1RPXA 1EA0A 3C0SA 1YBQA 4GRSA 3TH6A 5LGZA 2GVEA 1NU5A 4NYYA 4I7UA 3W82A 1MUWA 3K4DA 2FTYA 4CD5A 2B81A 1WXYA 4D72A 2YKKA 4YVVA 4X9YA 5FOOA 3AS3A 1EZ2A 1L6SA 4NX0A 1OVDA 1HKWA 1SVDA 1BYDA 4C7DA 4JHOA 5FKYA 4GUHA 1P5BA 1B2YA 3GQYA 4GY0A 2J27A 3ZQ9A 3T42A 3T44A 1P0KA 2OLAA 3C0LA 2QCDA 4FNRA 4B5TA 2V9DA 2W61A 4J27A 3K2GA 2BG5A 4IQLA 4KCVA 5CPOA 1E0XA 5DFAA 1EHAA 4UTTC 7REQA 3H4XA 1BXNA 1ITUA 2GYIA 3V0TA 1FUYA 4AX7A 2NVDA 1AQFA 4DYEA 3K5XA 5C6MA 4LRSA 4HGXA 1W3KA 1SJBA 2IXUA 4JCMA 2CXEA 1AJ2A 1YXYA 3O6CA 4JIHA 5FL1A 4KCWA 1V77A 3LBOA 9RUBA 5CXPA 3CV7A 4L80A 3GDLA 4Z1YA 4GVHA 2Z24A 3WH9A 1V6UA 1QT1A 4C6CA 3QMTA 5HQMA 2VTFA 3E2SA 3BLKA 3VX1A 1VQTA 4AU0A 4RE2A 1ADOA 2NT1A 3QPYA 3E49A 4XUYA 1PEZA 2W0UA 2NQ9A 1VYPX 2OO6A 2OEMA 2FPTA 3QQ1A 4IXHA 2PDNA 2HWGA 3UW6A 3BANA 1FWBC 3N11A 1VFLA 4A3RA 4MJ2A 1DWJM 5CEWA 2WCAA 1QNSA 4KMQA 3LM7A 1JGMA 4RV3A 3S2CA 4AISA 1JYNA 4HPGA 3KRUA 4C6FA 1O5RA 1MZRA 4OU1A 3QR0A 4KRZA 4TVDA 4R7JA 2OZ0A 3N6HA 3HQNA 4DJEC 1EPVA 3BW2A 1GPFA 5D2XA 3APYA 4MFEA 4GI9A 3L23A 1X98A 4UQBA 4UBPC 2F6KA 3BICA 4RNIA 3TCSA 3URAA 1HT6A 1OC7A 4OOZA 2ZUNA 2WK2A 1YDYA 2ZRWA 3UG8A 4OBSA 3CUHA 4B5WA 4A8LA 1VF8A 5H8MA 2Q8LA 3H7VA 1EDTA 1AG1O 4QJ3B 2J9ZA 1DQWA 4XZMX 5EKYA 4WHBA 2E3ZA 5EMJA 1V7AA 3UY7A 2EKCA 4QROA 3NZPA 1FKWA 3PSWA 3C2VA 3O06A 2WVVA 3ARUA 1M3UA 2WKLA 4G9PA 1P1XA 1LF1A 3KRSA 2R14A 3OLEA 3N29A 1LQ0A 1HNYA 4JTCA 4HU3A 3N15A 4J3ZA 2EXOA 1UMLA 2GUUA 1XYFA 4AZ5A 3ITLA 2PLJA 3CAQA 1RQHA 4I6KA 1HVXA 4P7LA 5JIPA 1SJCA 1IZCA 3VGEA 2Z25A 4F0KA 3H4WA 2ABAA 4K39A 5CPMA 4NHVA 1U83A 2GZXA 3WFZA 1ISZA 4HSOA 3LU2A 1BVWA 4HK7A 4C6BA 1BG4A 1PXGA 1T40A 2J79A 3UZJA 4EAMA 4DVOA 1TB3A 1PUDA 2R24A 3NWRA 2A1YA 3ZO9A 1XYZA 1Q7QA 1M1BA 4HA1A 1UWRA 3WCZA 1DE5A 1EGZA 3GU1A 3MYOA 2J8FA 3S2MA 1LDCA 5BU9A 3CU2A 5BRQA 2BVYA 2F6XA 2FH8A 3ITCA 1DXIA 4HHLA 2I14A 2WZEA 3Q4DA 4XZBA 5GNYA 3LCIA 2EEXA 1EUAA 5K9CA 2ZX8A 1KKRA 4W87A 1I45A 3LTPA 2BVWA 2A7NA 1JZ3A 5H91A 4C1NB 4GUFA 3VZXA 3GTXA 1MUCA 1OT2A 4RZ6A 5A6AA 3L68A 5I3HA 2DVUA 1MYRA 3LQLA 3NGFA 3N2OA 2ZZ3A 3WQFA 3M0MA 3CUJA 3IPWA 1V4YA 1WKDA 3TAOA 2WVTA 4HMDA 4W84A 3TYDA 3RMEA 2WVVB 3T0DA 3RFAA 4JQAA 4AHQA 1UBPC 4N9BA 3CZ8A 3U2OA 4LYQA 4IGNA 7ODCA 1P0NA 5A6TC 2Z27A 3F4DA 2EKGA 3CB3A 1V6TA 1UOKA 2ZRYA 3B8TA 1F74A 1I0DA 2IKJA 3TX9A 3W87A 4CU6A 3VGHA 1GJUA 4OE7A 3VU2A 3C52A 3LYEA 4NJGA 4Y8FA 3QR3A 1R3RA 1XRTA 4GZJA 3H24A 3MJMA 2VX6A 3KZSA 1MO0A 4RL3A 3T2QA 4WLCA 2DV0A 1ZUAX 3O0FA 1A4MA 3GUWA 3PWAA 3RO8A 3WIJA 1M5WA 1AH0A 2DT3A 1AQ0A 4LFYA 1F3TA 2CCRA 3SCSA 1QHOA 5RUBA 1POJA 5AHEA 4EPKA 3IGUA 3O0KA 2EPMX 3W24A 3FYPA 3IANA 4I7WA 3TC3A 3MC5A 4Z1CA 3UYIA 3POHA 1H5YA 4LCQA 4S3BA 1UP3A 3TOPA 3EOSA 3MSRA 4GO8A 1HVQA 3AAMA 6PTDA 3HO8A 4L5ZA 4S2BA 1DXFA 1UH2A 3OVGA 2ZC8A 2XIOA 1EO7A 2VFDA 2Y0FA 1TKKA 2WM0A 3CWOX 4WVXA 3LG3A 5KEZA 4JY8A 3W37A 1E1FA 2NQHA 4TMBA 3GUGA 3AZTA 5BZAA 4C6NA 4RXFA 1SM9A 1SO3A 4GACA 1F3XA 1L6YA 2HQAA 1S1RA 3THCA 1GEHA 5A6LA 5T9BG 4OUEA 1Z8AA 3LN3A 3E12A 3IJIA 2NT0A 4DF2A 1EJSC 4AD5A 1KWGA 3IIXA 1KB3A 3W73A 1EXBA 1J0JA 3CQHA 4IM4A 2V82A 2OZ3A 5CPLA 5HK4A 3S1UA 4DPPA 5D33A 1QMLA 5DXXA 2Z1XA 2Z6JA 1H62A 1BRLB 1VBRA 2BY1A 1SZRA 4JEJA 5K4ZA 1WNOA 5TAOA 2D23A 3QM3A 3K30A 1VFMA 2XUCA 4NI8A 1EO5A 2XGBA 4PTDA 4JQ2A 5LNUA 3GXDA 1TG7A 1OK6A 2G0WA 1TELA 4HYVA 4MWAE 3RHGA 1DTUA 3B9EA 4O1CA 3AIWA 3GD6A 3RXZA 1TZ7A 1XR2A 3QC0A 3CMJA 2VDIA 2EO7A 3THAA 4AZHA 3HGRA 2GWGA 3S6DA 3UZYA 2EF9A 4R9OA 3ARPA 3TSDA 3ENLA 4YJ5A 3VKCA 1K9DA 4Y9NA 5F1VA 5A5WA 2C3ZA 4LUYA 1EWEA 4QDPA 1V08A 3LV5A 3VOIA 3AYTA 3MP3A 1OY0A 1WX0A 5AC6A 1MW0A 3WX7A 4JBRA 4D1IA 2X0HA 2XTKA 4G56A 3QOMA 3IUDA 1IR2A 1L2UA 1V0NA 1GOMA 4O8AA 1R47A 1E4NA 2VMFA 2PLKA 3VIGA 3MI3A 3A4WA 3GXMA 3GYEA 1TZZA 1KGXA 1S2WA 1TMHA 4HU4A 1TIWA 2OXNA 1ISWA 3B8UA 1CCWB 2E6AA 2VEIA 2AL2B 1RK5A 1UR3M 1MQRA 2CZ5A 4MY1A 2HROA 4U2ZA 1DJNA 3PY2A 1QXLA 1KNWA 2X7VA 3V16A 3N19B 1FWAC 1VENA 4ACZA 1E51A 4GMEA 4W93A 1A5LC 5CZJA 4R33A 4Q7BA 2Y8KA 3LB0A 4PMDA 4X9SA 3R25A 5CPTA 3NQVA 2BOGX 3E2RA 3DEQA 4Q4KA 2GSHA 4S3AA 3VABA 2BGNE 1U1JA 4GQGA 2J25A 2ALRA 1YX1A 4GY7A 2V8ZA 3WLTA 1JAEA 1CPUA 1LLOA 3GVVA 3HPXA 2VVSA 1WAUA 3IRSA 4F0SA 4TO8A 3RX2A 3CJPA 3AFBA 1A5SA 3NPXA 2XH7A 4BEQA 1BVZA 1GKQA 3APTA 3PPHA 1ZAIA 1KM1A 1WDWA 3CYJA 4GIEA 4DIAA 5A6SA 1HKIA 4N9EA 1TVLA 1SSGA 4O13A 2PB1A 1RUSA 2VR5A 4MY9A 4E2DA 3QC3A 3FIGA 5D4YA 3CZGA 3S5YA 5U4NA 4NZFA 5GJNA 3URBA 4UMAA 1E71M 1QDSA 2LLEA 4AD0A 3TKFA 4XB3A 4ZTYA 4HNUA 1UZDA 3U3HA 3AYSA 1BLIA 2QCCA 1OABA 3BURA 3CEUA 2XZ9A 4PMUA 1EC8A 4C7GA 4I9TA 4EWND 4WSJA 3W83A 3NNTA 5I3FA 2QKFA 1GZ1A 4H19A 2ISSA 2CBVA 3M5XA 1UPPA 1W5NA 1UD5A 2BB0A 2E9MA 2ZIDA 2F2HA 3ATYA 3G1HA 2GPTA 2WWDA 4AEOA 4XO6A 4JN8A 3WQCA 3GG0A 4PCNA 4NAEB 3TQVA 1MZHA 4NVTA 2HK0A 3T0TA 3UWEA 3TYUA 2AQOA 3RLGA 2YLAA 3SY1A 3KAOA 1CWYA 4HD5A 3UBPC 3OQEA 5EMKA 4CNTA 3BAYA 2WMKA 4AH7A 3RJYA 2CLHA 4E8GA 2G5WA 1MWOA 4MNLA 1REQB 3DFHA 3KBVA 4HA0A 2QNEA 4OUIA 3XINA 3SCTA 1B30A 2BGQA 4OBRA 2BY2A 4JTJA 1FOBA 3M5ZA 4DLMA 3OIHA 3LCFA 1UD2A 5HA7A 3EKZA 4UNIA 1XLLA 4AIUA 4YIWA 2PFHA 3P67A 3UERA 1XCXA 1QNVA 2IS7A 3S9ZA 4OGZA 1ZALA 3ZXWA 2W92A 5M17A 2YCEA 3U8GA 4MSSA 4I8DA 4I90A 1O6IA 4LEFA 4E3VA 2JEQA 4JTAA 3FNDA 2D0HA 1MXGA 2WBKA 1NTHA 4GO9A 1YE4A 2WZIA 2V81A 4FXJA 2O56A 4GFSA 4AW7A 3PB2A 2PU1A 1EFZA 1UJQA 2VEGA 4K1WA 3L5MA 4UIOA 3LZ3A 5HJXA 1XGDA 1S5VA 3ZOAA 4Z0SA 2BY3A 1M7OA 3KL5A 1VBGA 2PDLA 2DSZA 4UTWC 2PGEA 3PSVA 3VZYA 4LU0A 1CLXA 1GNXA 4LXFA 4HU0A 3N9SA 3FLUA 1E72M 4B16A 4WRHA 1TO3A 2WSRA 2C18A 7A3HA 3RM4A 1VKFA 1W2PA 5LIKX 2FZDA 2Z1BA 4YTTA 3DFQA 3IIZA 4K38A 4B5VA 1OZMA 1XUZA 3PP7A 3MI6A 1RP8A 3SY8A 3DHDA 3GW3A 5LGXA 1Q4WA 3EOEA 2WMGA 2XN2A 1I1WA 2BXZA 5HQEA 2IKIA 1JJKA 2WCSA 4J2PA 1FCBA 4JKMA 2BHUA 1H1NA 1NM9A 3B9DA 5F2GA 4ZXOA 1LJYA 2ZUTA 5AC7A 1PKMA 2XVLA 3QZEA 4GCXA 4O28A 4LAZA 5AZ1A 3FAXA 5FEWA 4JQ1A 1P6BA 4LC6A 2PDYA 5DCBA 4QE5A 4US5D 4H9YA 1V0MA 5ENLA 3UXKA 3QH2A 3BLLA 3R8GA 1SYTA 1Q6EA 4V1YA 3BLOA 1KRMA 3HV9A 4GYPA 5E0CA 3VIJA 4WOZA 1GG0A 4LYKA 3T0CA 5DX7A 1RY0A 1F76A 1S1PA 1NARA 6XIAA 1KM0A 4MWAB 5BOEA 2CLKA 1WZAA 3CTLA 3UGVA 2GGGA 4AY8A 1P7TB 3HMJG 1OFRA 3UNDA 1BQCA 3IVTA 2WCGA 3ARYA 3RO6A 3MYPA 5F1UA 1FDYA 3W7NA 2FZMA 4BWLC 3AHTA 5DLCA 3WFAA 1AH4A 2OX4A 1UG6A 1AL8A 4IPIA 1TQXA 2Y2WA 3LNMA 2GJNA 1WDSA 2UY5A 3R12A 2ON3A 3KCOA 5CC3A 4L4LA 4EK7A 1F8IA 3ITYA 4Q33A 2VGIA 3KDOA 2P76A 4AD2A 3NA8A 5DMNA 4YPJA 3R0KA 3A47A 4OTKA 3E38A 1I2NA 3PZOA 3UYCA 1EP3A 1QW7A 1MDLA 5E9AA 2Y70A 4J9JA 3W75A 4LNYA 1AODA 4ERIA 3HFYA 1QBBA 3WNLA 1EJTC 4UFLA 1TX0A 1PS9A 1LLWA 1EIXA 3WUEA 1G7UA 4TTGA 1FDJA 1ZZMA 2QLYA 2PDWA 3PR2A 3PTDA 3ZR6A 2P5NA 4JZ5A 1ZGDA 3N4EA 3DFNA 1XLHA 3NAVA 1XHGA 1NWTA 1SO5A 1IEIA 4W7VA 3O6AA 2OSYA 4GNKB 1X1ZA 3ARSA 1E6PA 1R3WA 3W2MA 4QG9A 4MKSA 5B7YA 2ZXAA 3W25A 1TR9A 2DZVA 3KX6A 2ONEA 4CD8A 5LZLA 1LORA 3AHYA 3ZIZA 4C1LA 3LXCA 3LX9A 2DH3A 2IXVA 5AC8A 3IJ8A 1E4MM 3CV1A 3PBUA 3KCJA 3UJEA 3ABSA 1AW1A 3L2MA 2QUTA 3FVMA 3EWXA 3LCHA 3UXAA 5EB8A 3V0SA 1X1OA 2NQJA 3B0UX 2XHYA 3ORWA 1BKSA 2QDGA 2IMRA 1DEDA 3BK0A 3TWAA 5C2XA 5K9XA 4UMBA 1U30A 4LAMA 4HIBA 2CLLA 3CV2A 4XD3A 1CLVA 3KM8A 2NLIA 2ZZ4A 1EP2A 3IEBA 4Y7EA 3R7MA 3BH4A 4YVPA 4N6FA 1F4HA 4PUNA 5HMEA 1JRCA 2C15A 2J6XA 1HKVA 2DJLA 3H2EA 4E2BA 1EF2A 5E93A 3SIZA 3NQAA 3TE9A 3PPFA 3BOXA 1R7OA 3FEMA 3ES8A 4JIRA 2R8WA 1MRAA 3WO8A 3PM6A 1OGGA 4Z08A 4ZBCA 4J1OA 2CXGA 4MZ8A 1VP5A 1HF6A 3N2TA 1IEXA 2DP3A 1FCQA 3TK7A 4S39A 3G18A 3LPPA 3MWCA 3RAOA 3M47A 3QSTA 4PUUA 3DYMA 1BGGA 3C8NA 4FXFA 5GPRA 1UC4A 1W31A 4GI6A 3WUFA 4IQDA 4PMQA 3VIHA 1KO0A 3UR7A 1ITQA 2QJMA 2HTMA 4L1WA 1YNPA 3I4KA 3CH9A 3EMZA 5D04C 4FLQA 2B31A 4IG2A 1GJWA 3WQ4A 2HSAA 5E6YA 3TN6A 1A47A 1R30A 2ABBA 4ADUA 2OKTA 5I7GA 4NRRA 1GOWA 4RJEA 5BWFA 3ATZA 5BYWA 1DJWA 4C91A 2ZZ7A 6XIMA 2EBNA 2AGKA 4R34A 4DJFA 3JR2A 4LAUA 4GKLA 1D3GA 2X09A 3VNIA 4GQRA 3IGHX 1DWFM 4KCUA 2PP0A 1JPHA 1ISXA 1AH3A 4FNSA 1CI1A 5A6BD 4K7VA 3NL5A 2CLEA 4XAPA 3L4UA 1GVIA 3VYLA 2O7SA 4J3WA 2QF8A 2VURA 5HMSA 1RQBA 4DRSA 1GGOA 4JN6A 1WBHA 1K1DA 3TSMA 4Y8EA 2G37A 2ZDSA 3MMUA 1BF6A 2VP8A 4O17A 1OFBA 1YEYA 1RVKA 1WUFA 3KBWA 4LUTB 4TX9A 5BOOA 3I68A 1PKLA 2ZZ5A 3L67A 3T4CA 3B4UA 4HA4A 4ROQA 4Y9OA 5CCZA 3TTSA 4Q8UA 1QR7A 3ANYA 2ISFA 4GQBA 1NH6A 3AU2A 1P6CA 1VAHA 1AFSA 1KM5A 1R3YA 3G3DA 1FHUA 2NLYA 1CNVA 3W1TA 3HIJA 2A5HA 2EG8A 1UHVA 3U0HA 3B06A 1HKMA 4F8XA 1OT1A 4L56A 3WBAA 2E6YA 4CNSA 1Q6GA 4ASTA 3W22A 1O66A 4YTUA 4DJDC 3W7DA 2QIIA 4WXZA 4QISA 3H70A 5FEXA 4O1DA 1NWUA 1OADA 3TLQA 1YYAA 2W91A 1DWGM 2QT3A 3GDMA 1XLDA 3IWPA 3K8LA 2AOSA 3B9OA 3FDKA 4MHBA 1GYMA 1R9ZA 1ZAHA 3E74A 3HURA 2WWCA 3V4BA 1MW2A 2YFNA 1LQAA 1PWLA 1BKHA 4O57A 4C6EA 3HG2A 3SB0A 4OQVA 3VD5A 4UTKA 2WQDA 3W7EA 4U5KA 1K8YA 2XVKA 3ME3A 4ZA0A 2JQXA 2NUYA 3MUXA 4XTDA 3EYPA 2J7DA 3BO9A 4UUIA 1KBBA 2J75A 3A6OA 3DHFA 4LCRA 2P0OA 2XISA 3AXIA 3DGRA 1ADDA 1XV8A 2PWUA 4YXGA 1QPOA 1MEHA 1OYCA 4TX6A 4GVFA 3TFXA 4KESA 1LLZA 2BVTA 4IQEA 4PCSA 2ALDA 4EXAA 1FWWA 1TJPA 1LG1A 1T99A 1R2RA 2FH6A 3NZ1A 4Q8VA 4O1AA 1GOOA 3GX9A 4AXNA 2V69A 4MPKA 4D6HA 4JFVA 3U9IA 2H3DA 4W8LA 2V5BA 3IARA 2OO0A 1EHNA 2YA1A 2H8XA 2O7QA 4OWGA 4GFIA 1LRNA 4O53A 3VDHA 1OGSA 3WDIA 3P60A 1O12A 2YL9A 1TCDA 1I9CB 2PCEA 2VKZG 2WSKA 1YTEA 2ZA2A 4MB1A 1SJDA 3A5VA 4REQA 5REQB 4OHQA 4UQDA 3N9RA 1J79A 5E9XA 4DJEA 3CMFA 3EDDA 3F4VA 5TNVA 2QXWA 1X6UA 1TFVA 3W23A 2YL5A 4AZBA 4I5RA 4OVXA 5D2WA 4IFRA 4KRUA 2PC8A 3QVQA 2DORA 2UBPC 1W5MA 3L4TA 5CPNA 4CD6A 2OQLA 1H0GA 2C7FA 3W7QA 3N6QA 3NSMA 2Y63A 3SGZA 1Y7VA 3KXQA 4WR3A 4S2CA 2DUAA 1TUFA 3B3DA 1A50A 1Q6CA 4DUWA 2DSKA 1WDQA 4HKPA 2QQ6A 1ZP3A 1YRRA 3ONCA 1HP4A 1DJYA 5C5YA 5HJYA 3QHMA 5C9WA 4P8WA 5DT7A 3UCCA 2HVMA 3VDBA 3VKAA 4MJ4A 5CGTA 4HMCA 3R6IA 5FJOA 4S1FA 2DVTA 4PMNA 3BG5A 5CAKA 1JRBA 4Q32A 3GXNA 3RX4A 4IL2A 3KP0A 2ZWZA 5D30A 3TQ0A 2VCCA 4PULA 3PFRA 3KBJA 3WF2A 1TRDA 1ZY9A 3AO0A 5HNNA 2J88A 3ZJKA 3T9PA 3VNJA 1WYIA 4HJWA 2RGLA 4PTNA 4RZ4A 4J4KA 3TTEA 4QNEA 4PEEA 2Z2BA 3MANA 4YS1A 4IQJA 3RDKA 4IMAA 1P0DA 5F2MA 4REQB 2YXOA 4Z0JA 7XIMA 3RK8A 1S2UA 2D1ZA 3U2ZA 4PB4A 2O0TA 4YWIA 1N82A 1WKYA 1HJQA 5FI8A 1Z44A 1BWKA 3DKLA 4OECA 2NUWA 4ATDA 1TWSA 3ABRA 2XJ7A 3TJXA 2EPHA 3CT7A 1FP9A 4HTBA 4GJIA 2BZNA 4S3JA 3OG2A 4KWVA 5U7SA 3WLIA 1IEWA 1ICQA 4UTHA 3WJZA 1JDDA 2VNCA 3WENA 4FF7A 3R4IA 4FNQA 1TCMA 1ZPTA 4Z2IA 1U2YA 2X0SA 1WOBA 3MMTA 4CU7A 5JMUA 4FLSA 1NDYA 5IM51 2ZZ1A 1XIJA 4IX0A 3XISA 1VLIA 4Z2HA 1ZP4A 4KQNA 2VCAA 1VFOA 1W2VA 3FHAA 2Q3RA 1RBOB 4O0KA 4D9PA 1M41A 2P10A 2RUSA 4Z1AA 3DBPA 1K8ZA 4PYSA 1XBXA 3DYOA 1BFNA 3NQGA 3QQWA 1FKXA 5LIXX 3F4NA 4PMZA 2Z26A 3VIPA 3PG8A 1J0YA 2IW0A 5LHFA 1EP1A 3V5OA 1XYBA 3AJXA 2VJXA 4YCOA 3W84A 2F7FA 4U3CA 4GQQA 3W7KA 1QUMA 2W4XA 2PRLA 4WY0A 1DV7A 2YOCA 2ESCA 4WDUA 4AZCA 2PAJA 3JRKA 2J7CA 4IZGA 3FSTA 1XUUA 4LW7A 1W8GA 1RSCA 3W1MA 4HQVA 1PL9A 3U5YA 1L0PA 2E40A 3PTQA 1M6JA 3G24A 3FCPA 3RM8A 2D69A 4BQ2A 1R3TA 4DUXA 1VRDA 1XYCA 1OYBA 3O6DA 2ISDA 5KZEA 1GEQA 4AF0A 3BCJA 1A5CA 4QEHA 2J7EA 3VD7A 5A3HA 4A2SA 1J8VA 3CUIA 2C0HA 2PCQA 4NZ4A 3HQOA 4ZSTA 5HNTA 1W3IA 2HZGA 3IIVA 4R7OA 3W3OA 1QNQA 1UR4A 2VRKA 4PTVA 3SJ3A 4UOZA 4W7WA 2V38A 3WL0A 1YPIA 5IOBA 3SM0A 5T26A 3KOYA 1OQFA 3TCEA 1TV8A 1UC5A 4GGBA 3AISA 1TRIA 4UOQA 1RCXB 4AY1A 2EPNA 1WZLA 4GXPA 2QDEA 3KCLA 3ITVA 3G0SA 1QPNA 3HZ3A 3OA3A 1XKYA 1GQKA 2H8ZA 2OPJA 3AICA 3G1FA 5HANA 3RYSA 4B3ZA 3PUGA 1DJQA 2E1WA 3BQ5A 4KEUA 4HZ8A 4WOQA 2FFIA 5CBIA 1H1YA 3WH6A 3QOKA 1V3HA 2J4GA 1E4IA 3PBWA 1NVMA 2CWXA 3RRAA 1J11A 3RNDA 1QPKA 2IPGA 4BI5A 4EOUA 2CKRA 5CSUA 3E3HA 2ACUA 1PB0A 4YVXA 1V3KA 3TW6A 1AJ0A 2Q8XA 3VO0A 2ZA1A 1ZRQA 3GIYA 5E1QA 1J0HA 3KWXA 8XIMA 1JQXA 2NQ5A 4AY7A 4UTUA 1KV5A 4B91A 5C9RA 3KE0A 2A3EA 4IPLA 4O14A 3KL3A 5AYYA 2W9MA 3O15A 4L4MA 1G67A 3S5SA 1FP8A 3RM9A 4MPQA 3BV7A 4Q4OA 3UPBA 2PTZA 4RR4A 3A12A 4H9MA 5AY7A 1TE1A 4DXVA 3LMZA 3W88A 3OGVA 2QDDA 3CPRA 1BTCA 3V5FA 2QS8A 4YNGA 3TJ4A 1L8NA 2XSAA 1Q7ZA 1IWPA 2GJXB 4K36A 1G1YA 3CQIA 4PUMA 4WGXA 3M0ZA 3WD3A 2Q6ZA 4D6FA 1US2A 4Q4RA 1ZTVA 1R9YA 1UD6A 3LI0A 1FHVA 3N3MA 3ALFA 1V6YA 2UZ9A 4G7EB 3ZJ6A 1TV3A 2DFAA 5FA5A 1RHCA 1JPIA 2J7BA 4M56A 2VZVA 1UUMA 3NOEA 4CQBA 1CB7B 4WF7A 4IMGA 3QYSA 4CEXC 1ONEA 1C93A 4LEQA 1TZ9A 4CQ8A 3SQLA 1E0WA 5GNZA 1G6CA 4X2PA 4J35A 3OLGA 1EX1A 4AC7C 4GA8A 3F4CA 4K8HA 5HNUA 4G2DA 3HPFA 1B4EA 1V0KA 2PU0A 3WDPP 4TX8A 3BGGA 4LUSB 1WXJA 4CU8A 3IV8A 3OTRA 2PF8A 4UQCA 2WHJA 5D38A 3YPIA 2O9OA 3K8MA 2WJFA 3PAOA 3TFCA 2W79A 5HUPA 3AMCA 3CLMA 3QMSA 1UUQA 2Z7GA 5K2ZA 4PCTA 3W7CA 3QBUA 4HJFA 2WANA 4QTGA 1ONXA 5H8UA 4RE0A 2Z1WA 1GYNA 3KHJA 4CN6A 3GHUA 2FYMA 3QKEA 4F2UA 1OFPA 5E0KA 4BKNA 3PULA 5A8QA 3D3AA 4JYEA 1GQNA 1YADA 4AVOA 3WBYA 4O50A 2E68A 1YNQA 3G0XA 3W7OA 1XC6A 4JNYA 1U1HA 3NUKA 4W86A 3MHUA 5HWMA 3EDEA 4MY8A 4HP5A 1GVSA 5DCDA 3S5OA 2XM2A 4DLFA 1IWAA 4XD6A 2FHBA 3FX4A 3SSZA 3PZTA 3R43A 1D7KA 1KM2A 5HPCA 1LWHA 3A9IA 4EANA 5LXXA 3CK5A 4RV8A 2GK1B 3N4FA 4A3HA 3PBGA 1P0BA 3SGUA 1AJZA 3GLCA 3A9BA 1QAPA 3ZT6A 3RN6A 3FOKA 3CYVA 4I5UA 1NIUA 4ZO9A 1BF2A 3FV9A 3IV3A 2Y1HA 1YDVA 2Z6IA 3LLDA 1Q6QA 2CIPA 2J7GA 5I77A 2TSYA 3GRIA 1XDLA 3QR1A 5M2FX 3ZLFA 5D05A 5HATA 2WZHA 2QCGA 4TVCA 5A8MA 4JD4A 1ZBCA 4ERGA 3H4GA 1V6XA 4IT1A 1UW9A 4M24A 3PAJA 1EC9A 1IZKA 1RLCL 2VX4A 1JUBA 3LBCA 3UR5A 1WE5A 1PHWA 2CBUA 3UQNA 1C29A 3UJ2A 2YXGA 2UY3A 4PA8A 1N7KA 5I78A 4F48A 3IK2A 2CLIA 2G4JA 2XVNA 1VHCA 4FXSA 4WSKA 4O11A 3TN5A 1JF6A 1XLMA 3WDQA 4S23A 1R3VA 2XN0A 3OYXA 2ACQA 2BS9A 1Y8BA 4ALDA 3GSMA 3P8IA 1UWTA 3U5UA 3RCNA 1LCOA 1MQQA 3W7PA 2UY4A 1DQXA 4WEVX 3TWBA 1Y5XA 1DWAM 1JZ5A 3G1XA 1U22A 3NSXA 2QAPA 1CX9A 5C70A 4RW5A 3WLOA 4R3UA 3GVQA 1DE6A 4QLJA 2YYTA 3VI2A 3GZ3A 4DXXA 3I10A 1JPMA 1R86A 4MZYA 3BLIA 2DZTA 1B54A 1GTEA 1J2WA 2BX7A 4CVUA 1KXHA 4MADA 4E0CA 3GNPA 1CGXA 1CGUA 4J3SA 2B0MA 4KPLA 4LB3A 4H00A 5ECUA 1KFCA 3AZSA 3R0DA 4GIYA 3QY6A 1U5HA 2D0GA 1XIFA 3N3TA 2GWNA 2VX7A 4C6LA 2Y4SA 3T0AA 1KFJA 2FMNA 2OGJA 1M53A 1CGVA 3VGFA 2WMFA 1B3YA 4J5NA 4OFCA 3QRHA 1HFBA 4OBTA 2OB3A 1OX5A 2NUXA 2HBXA 3AI0A 1PTDA 1O5QA 5HR6A 5DEZA 7PTDA 2C14A 1ME8A 3W71A 3VNZA 4HPXA 2R1KA 4GQ0A 4FS9A 5LNRA 1XGZA 2P3EA 4GC3A 4UR8A 4GHRA 4HNNA 2DH2A 2XFFA 1BQGA 2KX9A 4IMDA 5A94A 1HJVA 1ZFJA 1W1IE 3QLDA 1R2TA 3FKRA 3MMWA 3ZR5A 4EAYA 3INPA 1KA9F 4PC8A 5BXPA 3H2AA 4Q6JA 1K9EA 5ABGA 1PTGA 1WZKA 1M9HA 4PRWA 3TJIA 1OCBA 3M46A 5DBUA 4C6MA 1TREA 5DRIA 4GVIA 4ZOAA 4WDTA 1GW9A 4M6QA 4NT0A 1PIGA 3WJYA 4GX8A 3VPLA 4EACA 1GYLA 4KEZA 2A3AA 2BV9A 3PF3A 4JFWA 1YPFA 3KUMA 1K3UA 2QCMA 2NWSA 3BGJA 4WDWA 2RFGA 4UTFA 2VFFA 1TJRA 1W9PA 3B8SA 5F2IA 3N17A 2RHGA 1V8EA 3FJ4A 2JEPA 3P0WA 2PPGA 4QR6A 2BSLA 4E2VA 3T05A 3T1GA 3C0JA 3H2CA 2WVUA 4W7UA 1KTCA 5MKGA 3QGAC 2QV4A 4BEUA 1WB0A 1XIMA 4MLRA 1HQTA 2E8YA 1JI1A 3KBSA 4RNFA 2W66A 2FGBA 1VJIA 1G9HA 3AQUA 2VZUA 4PTWA 1W17A 3O2LA 3KRZA 3TQPA 1J6PA 4LS0A 1F2JA 3CXOA 3NL3A 1UB3A 4FNUA 3BLDA 5C7HA 1TTJA 4EXQA 1NP0A 2L5HA 1I75A 3SFWA 1KWKA 3OQ8A 2E28A 1XQKA 2QJJA 3N2BA 3CIXA 3M0JA 2SFPA 4BA0A 2O55A 2Q8ZA 1JNDA 1XYMA 3HJZA 4F0MA 3J7HA 1WDRA 4M19A 2ZX6A 3MHGA 4IX2A 3SO7A 4E38A 1WDPA 4IIEA 3PJUA 1UKOA 3OVQA 2NWRA 3S9YA 2E9LA 3FW6A 2PZNA 3S4TA 4H9UA 3SCNA 3H8AA 4MWAC 1ME7A 2PGFA 4JEQA 1QRQA 1FQ0A 3EA3A 2JF7A 2JFEX 4LAOA 2C6QA 4U33A 1XGEA 2EPKX 3ABQA 3ZJ8A 1W5OA 1R8LA 1EJUC 1TPH1 2Z00A 3BSMA 1TJ0A 3KOWA 3N12A 3SUUA 3KW3A 5D2VA 5ABFB 4RLIA 5H6HA 1VS1A 3ZYZA 3OIXA 4BZYA 5BWAA 3SUWA 4XKYB 1JDAA 4JCLA 5HAOA 1O95A 5CZ0A 4Z42C 3OZOA 3DUGA 1O94A 1R0MA 3SUSA 2QUNA 2XSXA 4HYWA 4ZFMA 1Z42A 3B0VC 4JHMA 3STPA 3G6LA 3SGGA 1T6MA 2G3FA 3ARRA 3S3GA 1DJXA 4H01A 3SUVA 1YXDA 4FI4A 2HXUA 3L4WA 5LA2A 3QQ0A 3S0CA 1CXLA 2E5DA 2EAWA 2J62A 2ZUWA 2QMJA 1LRQA 1VYRA 3W2LA 1SJAA 1B31A 4QP0A 4YLWA 5FAJA 1ONWA 2X1TA 3ZSSA 2BNJA 4RXGA 4XIAA 3MSDA 4TU1A 1TVPA 2OLHA 4RNJA 4DM2A 4MAVA 4OIFA 2YDQA 4KT2A 3UA4A 4OV9A 3STCA 2VM8A 3NDZA 5D37A 3NFUA 4FLRA 4WKAA 3F2BA 1PWMA 1W1A1 5A69A 3UPMA 4OKDA 1X6NA 2X1UA 4BFAA 3SCUA 3S2NA 1HJSA 1FBAA 2IPWA 2XINA 4UMCA 2OSXA 4GYJA 3CQJA 4FA3A 1IT8A 2WLZA 2QIWA 3VUSA 3LZ5A 2D22A 4IFKB 3TVAA 4AG0A 2CFFA 2WMIB 5DF0A 9XIAA 3KHDA 1CTNA 3C8FA 1UP2A 3WNKA 3VGBA 3E0FA 3M5YA 2PDFA 2PWVA 1XLAA 1FFRA 1XRFA 5FESA 4A6GA 3W86A 2PBGA 4PMYA 3O9NA 1JIBA 1W1YA 3K46A 3I7RA 5G1TA 2JF6A 3ZLHA 1BSIA 1F9CA 2DUZA 4LJ3A 4DWSA 5C55A 1O68A 3QY7A 1I8JA 2WHLA 1E73M 2REQB 5M5DA 3MSGA 1RV8A