3WQ8A

Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
448
structure length
448
Chain Sequence
KFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDAAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLASGFPPGFLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
publication title Monomer structure of a hyperthermophilic [beta]-glucosidase mutant forming a dodecameric structure in the crystal form
doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 177
structure length 448
sequence length 448
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wq8A00
1V0LA 1KCKA 1K9TA 3F4VA 3MUAA 2Y8VA 3GNPA 4X0VA 1NP2A 4F79A 1LL6A 1CBGA 2WSPA 3ARUA 3D5HA 4XUYA 5LYRA 2WCSA 4TX8A 1JG9A 3GYCA 5I6SA 4P7RA 1CPUA 1XD1A 1JD9A 3T2OA 4L4PA 2WVSA 2VVNA 5D4YA 4UCFA 1BYAA 1R86A 4AWEA 1EH9A 2BXYA 3MUZ1 5A8OA 3GDBA 2ZX7A 3EDKA 3N9KA 3PN8A 4PCSA 2A3HA 1Q4NX 1E4IA 2WC4A 4YPJA 1BG4A 3UETA 4YHGA 1LWHA 5A8MA 3SCNA 4CCCA 6CGTA 1J18A 3I3DA 4MB3A 3SCOA 1BVZA 4BA0A 1GVYA 2W67A 1D7FA 5FOOA 2XVNA 3FHAA 1S46A 3HMCA 5A8NA 3RCNA 1AQHA 5E0CA 3OGSA 1WP6A 4MB4A 5A69A 4WF7A 3CZJA 1HF6A 4P8WA 3WQWA 3NJ3A 1VFMA 4PUEA 5A2CA 4J3WA 1UUQA 3T2PA 2EXOA 4UQBA 4EE9A 3WUEA 5A6LA 4FLSA 1UD5A 2PBGA 2VZTA 2YLAA 2FGLA 2EBNA 2W61A 3WN6A 1JZ5A 1X1NA 2O9OA 3PBGA 3RILA 1KGUA 1JNEA 4FLQA 3SCQA 4Z2KA 4HZ6A 4CCDA 3GTNA 3NSXA 3WH8A 2V3EA 5AYIA 1E40A 3MS8A 4WSJA 3ZMRA 3W25A 1BAGA 2Z1SA 3ZT5A 1UOKA 3AS1A 1E15A 1BF2A 2J7FA 4JHZA 1RH9A 4AC1X 2ZIDA 1KBBA 4M82A 1PJ9A 3WH7A 1DHKA 3T0BA 3I3EA 1EA9C 4FLOA 1V02A 2GSJA 1CGYA 2QV4A 3PZQA 4PMDA 2YBUA 1FA2A 4BQ2A 1NWUA 4AD0A 1GQLA 3A4AA 4QLKA 1HKIA 4WJXA 4AZ6A 1JNDA 3UESA 3CUFA 3F5KA 3CUIA 2PB1A 3BSGA 3K4DA 3PZIA 5E09A 1LG1A 4C7DA 3VO0A 3N17A 3VIJA 2CESA 3GH5A 3WH5A 1QNOA 4UOQA 4A3YA 5FL1A 4E4PA 3AIRA 3UG5A 4BQ4A 4EKJA 2OSWA 1OINA 3ARRA 3W24A 1V3JA 2NT0A 5BROA 4EK7A 4CGTA 2E8ZA 2D20A 2JALA 3GM8A 5A6JA 4MNJA 2VZOA 4CD5A 5JIWA 3OLIA 1MQRA 3BXWA 1I75A 4HOZA 1M7XA 4HMCA 3ARTA 3SUUA 1GQJA 1ZJBA 2XFYA 5TD4A 3T0AA 3O9NA 3A47A 4PUDA 3AHYA 3T09A 3WDRA 4Y7EA 1CGXA 3ZT6A 1WKYA 2FHBA 2VQTA 3CUJA 1UR9A 1ZL1A 4MPKA 2XIIA 1TA3A 3WEMA 4CD4A 4NF7A 4LYQA 2J47A 4ACYA 4BS0A 1GOOA 1L0PA 3W38A 3KWXA 2BV9A 2XGIA 1NOFA 2O9RA 1ODUA 3LMYA 2BXZA 3TTSA 2WHLA 3F5JA 3GNOA 2E4TA 3WF1A 1JDCA 2VCCA 1LJYA 4JKLA 3CZLA 2ZX6A 3ECQA 1J0IA 3WD3A 1GUVA 4WKHA 3SCPA 4QAWA 2YA2A 1AMYA 1Q6FA 1TUXA 3OZPA 5ABFB 4HA3A 2ZUNA 4DUVA 3A4XA 3THDA 1YQ2A 2UY2A 1XYZA 1XV8A 3ZJKA 4HP5A 1JI1A 2EPMX 3CZ8A 4J3VA 4UOJA 2OYKA 1GVIA 4RE2A 4GINA 1Q6CA 4GPNA 2YJQA 5AC4A 2YDSA 1HX0A 3N18A 4TUFA 3SCRA 1D3CA 5EMYA 4D6IA 2CBJA 4JHOA 3J7HA 1JXKA 1OT2A 1MYRA 2VL4A 4V2XA 4UFHA 1HJWA 4GQRA 1V6WA 1ISZA 4R27A 1UWUA 1EOKA 4ATWA 4DWSA 5IFPA 1SMAA 4QP0A 3W82A 4UFIA 1PPIA 1AVAA 2DT3A 4J3XA 3WQ5A 4UQAA 2BY0A 3WF0A 1WDPA 1MW0A 4AD3A 5JBEA 3VTRA 2WWDA 3BSHA 1BG9A 2DSWA 1V6UA 4Q7NA 1E0VA 3G6MA 1IZJA 1H1NA 1E6NA 1JZ6A 1GQKA 4DUWA 1V6XA 2BHZA 4WLCA 4D6JA 1FHDA 1H0IA 4LX4A 4W89A 2WMKA 4W8BA 3WUBA 4W8AA 2VRKA 4NRSA 2ZE0A 2DT2A 2ZX5A 2YL8A 4UQCA 2WANA 1UZ4A 4A3HA 2PC8A 3APGA 3CIVA 2ZOXA 1ZJAA 2E0PA 3BH4A 3K1DA 2XYLA 1G1YA 3B9EA 3AHVA 3ARPA 4AZIA 3WL0A 5A6BA 3BAWA 2WVVA 2BVYA 4W88A 2QF8A 2XVKA 3AYSA 1JF6A 8A3HA 1A47A 1TCMA 3BC9A 1UHVA 5I0DA 1EDQA 3BMWA 4GQQA 3FAWA 3MANA 1OWQA 1VBUA 3W27A 3EDJA 3IANA 1V02E 3AI0A 2UY5A 1B3VA 2PF0A 5ABHA 5JUVA 4CUCA 1QNPA 3VDAA 4GI6A 2OWWA 3AHZA 1MWOA 3AHTA 2WVTA 4QCFA 2C7FA 3N11A 3IAPA 4D6DA 1CXIA 1W3HA 1FOBA 2CPUA 3AXHA 3CLWA 2J62A 3CMJA 1GHRA 3S6TA 3RJXA 1MFUA 2XM2A 4BQ5A 4NRRA 1LQ0A 5CLWA 3CTTA 3NYDA 3GXFA 4YN5A 4W7VA 2VRJA 2WCGA 2YL5A 1XHGA 1JYWA 3GBDA 1LLOA 1MQPA 1PZ3A 4MJ4A 1WE5A 1E4LA 2VX7A 1UKOA 1WZAA 2X8RA 1HKJA 2EPKX 3WNLA 3VIMA 3K8KA 1GOQA 3AOFA 1NWSA 4P7QA 2Y8KA 3AMCA 1JYXA 5BWFA 3WD1A 1B3XA 1C7TA 4E2OA 4PMRA 2CBVA 1OT1A 1VB9A 1C90A 1W1TA 1JXJA 4AEFA 1W91A 4TTUA 4E8CA 2BNJA 1E1EA 2YOCA 3AIQA 5CSYA 2VZSA 3POCA 4AD5A 2VR5A 3WNNA 3WEZA 2WHMA 2VX5A 3WL1A 4U2YA 3VNZA 1UWRA 4B16A 1KGWA 5FD0A 2VRQA 3AXIA 3B9AA 2HISA 1ZS2A 2VT0A 1UD2A 2PWFA 2VURA 5BYWA 1V0NA 1B3ZA 3EMQA 4OIFA 4TXEA 1DEDA 2OSYA 1WDRA 1JZ7A 3NUKA 1DWIM 2DDXA 4ATDA 2WW5A 1JFHA 4BCEA 3IJ9A 3N12A 1ZBKA 2QPUA 2W4XA 2G3JA 4S3JA 4AD1A 3G6LA 4PMXA 3I3BA 4D6HA 1E4MM 1JZ4A 2VI0A 3L4ZA 3L4UA 3W0KA 3SEPA 1W3JA 1V6VA 1UR2A 3MUY1 1CZ1A 3PTQA 5A6MA 1OGBA 1GJUA 4AIOA 2VZVA 2F2HA 1W9DM 1GOMA 1UR8A 2WMFA 2BVDA 3A4WA 1PZ2A 3ZO9A 4D1JA 3VDBA 1E5NA 3VIIA 2VQUA 1Z32X 3AIEA 4A4AA 2TAAA 1CIUA 1UKQA 2EPNA 1M01A 1KQZA 3WD4A 3E1F1 2VR4A 3THCA 2XJ7A 2D23A 1OGGA 3PZNA 2WZIA 3M07A 2JF7A 2AMGA 1BVNP 3DYMA 1E70M 1SMDA 4CKQA 3ALGA 2VJXA 1W2VA 4MTVA 2QHAA 2EPLX 1HJSA 1ECEA 4GIAA 4HZ7A 1BGAA 3BCFA 2WYSA 1WPCA 1BQCA 2Y2WA 3KL5A 5JIPA 5EB8A 3VUPA 4TVDA 1NM9A 1EXPA 1PEZA 3W4RA 4KH2A 2J4GA 4ACZB 3NSMA 3W28A 2J75A 7TAAA 4PBGA 1UR4A 2X05A 2YKKA 4PSPA 1QBBA 3W53A 1DWHM 4B9YA 3BAXA 2CKSA 1NOWA 3BAJA 3L4VA 2YBTA 3KEHA 2GJPA 3VU2A 4DWSC 1B30A 2X0YA 3MU7A 4PCTA 3VX1A 2GJXB 1A3HA 3OB8A 2WHJA 2FGZA 1ZB5A 3SCSA 5LA1A 1OIMA 3SURA 1XCXA 2ZUWA 3N04A 1K9EA 3MMDA 1JZ3A 2IXUA 1KQYA 3VMPA 2V3DA 2DT1A 2DEPA 3PZGA 1BYCA 2B31A 3FAXA 4IISA 3ZOAA 5E70A 1NH6A 1LL7A 3W37A 1KXHA 4J3UA 4PMNA 3SUSA 3KL3A 1EGZA 1WDQA 3WD0A 5HDRA 4AIEA 1CGVA 2YL6A 3A6OA 2WNWA 1AQ0A 2IXVA 2VMFA 4D6FA 1XD0A 1B90A 4HTYA 3AHXA 3WENA 2OSXA 1C8YA 1B9ZA 1XRVA 4W84A 4FMVA 3K46A 3T08A 4KGLA 1E43A 2D24A 2ZX8A 5HXMA 3VPLA 2XPKA 1XSIA 4KMQA 1CTNA 4NI3A 1HP5A 1H2JA 2GFTA 1VFFA 2J7HA 3ZIZA 4JFUA 3WMCA 3BMVA 2F8QA 1QHOA 3CHFA 4W87A 3TONA 1E0WA 3MUIA 1BLIA 3EMCA 1G01A 1R8LA 1JGIA 5I77A 3WDHA 3WF2A 4WK9A 3JUGA 5DT5A 4QLJA 3WDJA 1V3HA 4TVCA 1C93A 1U33A 5IHRA 1TFVA 4HA1A 3ZSTA 4AXNA 1MVYA 4H7VA 1H49A 2QLYA 5BXSA 5E6ZA 1EOMA 3K8MA 3SCTA 4N42A 3TP4A 3U5YA 4PMOA 4D1IA 3TTOA 4HU8A 2ZXAA 2W5FA 1CYGA 5E0FA 2XG9A 2DGAA 5AYBA 1QNQA 2YDQA 2A3BA 4V28A 1J0HA 2DSUA 2WHKA 1R85A 1E1FA 1GW1A 3ARZA 2J78A 2OYLA 5A6SA 3WH9A 4AIUA 5A8QA 5AC5A 1V6YA 1PAMA 5HBFA 4WKAA 3WNPA 3HJEA 3VM7A 4AISA 3NDZA 4UOZA 1JZ8A 1EIBA 1VFUA 1UYQA 4LQ1A 1HT6A 3KE0A 3VDHA 4UZUA 2WB5A 3UCQA 1G94A 1HP4A 1X6NA 2D3NA 5AY7A 1QVBA 4JL1A 3EDDA 1GQIA 4LPCA 1R7OA 4KGJA 5CG0A 5HPOA 5EBAA 1EQPA 1QPKA 3VD3A 3DYPA 3AZTA 2VX4A 2DPEA 4CN6A 3L4TA 4M8UA 1D2KA 1OBAA 3WFLA 1PX8A 2WMJA 4XB3A 3CMGA 2ZXDA 2PWGA 1PX3A 3CPUA 5GQBA 5I78A 1TVPA 2GK1B 3VOCA 1MXGA 3RO8A 4N0RA 4P8VA 1K9DA 3AJ7A 3MV01 5BXPA 4IPNB 2A3AA 3CGTA 1FP8A 3NSNA 4OJYA 2IUZA 5ABFA 3SIMA 3M46A 1U2YA 1W2PA 3RMEA 2YL9A 2WPGA 3HN3A 2XVGA 4U5IA 2VZUA 2ZUSA 3OG2A 1FH8A 2WAGA 7A3HA 4GI9A 1U30A 3CZGA 4PSRA 1O7AA 4AMCA 2WMGA 4PTWA 2E9BA 3FXYA 2J7BA 1QI2A 1WB0A 3AZRA 4Z2HA 3VD4A 3MSDA 1BYBA 1MFVA 1G0CA 1WCGA 5D9PA 8CGTA 1VBRA 2XGBA 1CGWA 4AD2A 2WCAA 1C92A 1OIFA 4XZWA 1XYFA 3OIHA 4W5UA 3UERA 1KXVA 1B3YA 3CO4A 1OSEA 4AYSA 4CU8A 4JFVA 2WKGA 1XSKA 1B0IA 1E6ZA 3AIUA 1WO2A 1WNOA 5IXEA 2ESCA 1VJSA 4HZ8A 3GH4A 1W9BM 2DH2A 5EFDA 3VVGA 4J7RA 2UY4A 4OBRA 4U2ZA 4GO8A 4AZCB 3GBEA 2GVYA 2BVTA 4CU6A 1R87A 1FP9A 2G3IA 1CGUA 2PWEA 1V3KA 2AOSA 6A3HA 3VM5A 1C91A 1CXKA 1GORA 3AXXA 3FW6A 1QHZA 4JCLA 2HVMA 2O9TA 1UH3A 3CHDA 2YA1A 2UY3A 1GZJA 3CZKA 1PIFA 3AISA 1JAKA 2CIPA 4OOZA 1UWTA 5F7UA 1JL8A 2PWDA 3T0DA 3L4WA 1MQQA 3TOPA 2VCAA 1OGSA 4HA4A 1Y7VA 4JKMA 4LGXA 3B8SA 1XCWA 2BY1A 1WZLA 2ZUTA 2J7GA 2WKLA 3VGDA 5DF0A 1JZ2A 3W81A 3WMBA 3AZSA 4AY1A 2CKRA 2D22A 1F4AA 2VOTA 2F61A 1KXTA 3CBWA 5LA2A 2BFGA 4AZGA 1ESWA 1XH1A 4UR9A 1E3XA 3M6DA 4J28A 3AS2A 5CQ1A 1DWGM 5IHSA 3WSUA 3CHCA 3D3AA 1C8XA 1GONA 1TZ7A 2O9PA 4IUGA 2X09A 3OGRA 3WDIA 3PZUA 2V5CA 3MO4A 4HOXA 4AW7A 2VO5A 4GZJA 4W93A 4U3AA 2CERA 2D1ZA 2C0HA 4H8UA 1JYNA 1UA7A 3OLGA 4DUXA 4JZ5A 1KCLA 1PBGA 3MSGA 5ABGA 2V3GA 5BRQA 1ZBWA 5M17A 6TAAA 3CH9A 3PZMA 3AS0A 5A95A 3VD7A 1LL4A 1WDSA 3AYRA 3TTYA 5D8ZA 1R7AA 1CXFA 3L4YA 5M03A 3WQVA 3QR3A 4J3TA 2XTKA 3WY1A 4KRTA 5I23A 1DWJM 3PZOA 4HMEA 3RPMA 1J0JA 2J7DA 1FHLA 4AZ5A 5IDIA 3KZSA 2FDMA 3SCWA 2Y24A 5JBDA 4BF7A 1H41A 2JEPA 3W6MA 1HVXA 1FH9A 2WMIB 1ODZA 1QW9A 3FN9A 1IZKA 1BSIA 1E71M 2J7CA 4K68A 3WFZA 1HJUA 4U3CA 3WNMA 1BGGA 1M53A 1QOXA 1OB0A 5DT7A 4F66A 4B15A 3S2CA 4MDOA 5HPCA 2WK2A 4QFUA 1JAEA 1VRXA 1ISXA 1NOUA 1WZMA 5CXPA 4CD7A 1HN1A 5ECUA 1J01A 5A6KA 3MKKA 2J8GA 4QCEA 1XH2A 2GDUA 3EMZA 4B9ZA 5HOSA 3VIGA 4C7GA 4ZFMA 1X6LA 2XWDA 3LPFA 1KR0A 4Z2IA 1NARA 1MXDA 1I1XA 2VC9A 3U7BA 2X0HA 3AROA 2NT1A 2ZXBA 3U57A 3ARSA 1EO5A 3VGHA 3OBAA 1CXHA 5C8BB 1LWJA 4U31A 1IT0A 2QMKA 5A2AA 1GHSA 3BGAA 1VEPA 1W9UA 5CPTA 3GZAA 4EANA 2XVPA 1M03A 2CITA 1E6XM 1XSJA 2WC3A 4JFSA 3UR7A 4DM1A 3WH6A 4DWSD 2W66A 5I24A 3PTKA 3ZJ8A 3L4XA 2V38A 3VX0A 5CPQA 4J3SA 2NW0A 1J9YA 2V5DA 1GNXA 4MAZA 3QHMA 2WWCA 3VNYA 3RM8A 4OOUA 1F4HA 3UG3A 1TR1A 1Q6DA 5D8WA 2WSKA 1K6AA 1EHNA 1TE1A 2FHFA 3QGVA 3EYPA 1H5VA 1W1PA 3CUHA 4D6GA 4F9JA 5CLTA 5A2BA 2X2YA 5GNXA 3U7VA 4CU7A 4HMDA 1KBKA 1JD7A 5FCZA 3OA5A 3WNOA 3A3HA 1ISYA 4PMQA 1GJWA 1H09A 2NSXA 5BXTA 1W3LA 2ZWYA 1W3KA 3VGGA 4ACZA 1E9LA 4FK9A 1MW1A 3BLKA 4MB1A 4AZHA 2JE8A 4GO9A 3ZJ6A 3VDCA 4H04A 3VIHA 2ZWZA 3VKKA 3VMOA 1BHGA 1YHTA 3WUGA 3LPOA 1GOKA 2FHCA 2GUYA 3GXIA 3IAQA 1V3LA 4W85A 2DH3A 3WBEA 5A6BD 4HOWA 1HKMA 4ZEPA 2EJ1A 4PMUA 4MAVA 1E55A 4DM2A 1B3WA 3W6LA 1JIBA 1NWTA 2DSKA 2ZUUA 3AFBA 4UZSA 2GJXA 2XSBA 3ARWA 1GOIA 3KL0A 3EDEA 2GJRA 1CEOA 1E56A 3TA9A 3IJ7A 1NP0A 1BFNA 4JL2A 4TTGA 2A3CA 1UZ1A 4UQEA 1QI5A 1UKPA 2G8ZA 1H0GA 3ZSSA 4W7WA 3WNKA 4AZBA 4M80A 1QHPA 3WDPP 3BCDA 2CHOA 1G9HA 2BHUA 3DYOA 1XC6A 1J10A 3AIWA 3VILA 4Z2GA 3CUGA 3AMLA 2WLYA 5D9MA 4MJ2A 4RL3A 1SR0A 4UFJA 3WIJA 1C8QA 1DTUA 2D0HA 1SYTA 3BLPX 2E8YA 4GXPA 1M04A 1UR1A 2JIWA 1PIGA 3ARYA 1BTCA 3DHUA 4CVUA 4P7OA 1W1YA 2Q8XA 3OZOA 2GDVA 4FLRA 2JFEX 2D2OA 3M7SA 4F9DA 1EQCA 2DIEA 4QDMA 4UFMA 4UQ9A 3PZVA 3N13A 2YA0A 1OD8A 4ZXLA 2DT0A 2J77A 4M81A 3VIOA 3VD5A 3RM4A 1HVQA 1UWSA 3VIKA 1NWRA 1XH0A 2J79A 1DWFM 4U5KA 5CPSA 1H4PA 5CJ5A 2YLLA 1HKKA 4ZE5A 3GNRA 1CLXA 1KXQA 5GNYA 4PEEA 3DC0A 1I1WA 5C70A 5C71A 2BS9A 1MW2A 3TTQA 1HIZA 1ITCA 2Y4SA 1GPFA 4W8LA 1E72M 1HJQA 1EO7A 1TG7A 1ISVA 1KB3A 1VF8A 3W29A 4CVWA 5A8PA 2OYMA 1FH7A 1EHAA 1QI3A 3DECA 3K4AA 1FFQA 4GZEA 2OWXA 1JYVA 1HL8A 4B3LA 2MANA 2VTFA 2ZUMA 4HU0A 1WAWA 2D3LA 1HXJA 1QNSA 2WBKA 4M24A 3NIYA 1IV8A 4M1RA 4NSBA 4PTMA 1V08A 4LYRA 1W9PA 2CCRA 1CXEA 3N15A 1XGZA 4GI8A 3SUVA 4GZIA 1ZBVA 4BZYA 1UH2A 5LA0A 2OWCA 4JKKA 3ZQ9A 2W63A 1LG2A 2D0GA 4KRUA 5I79A 1ZBCA 1W9XA 5BXRA 4ZE4A 2J25A 9CGTA 1L8NA 2W91A 2WZHA 1FFRA 2J8FA 1J0KA 1CDGA 3FHQA 4UQDA 3B9DA 1TA3B 2CBIA 1KGXA 3OGVA 5I3DA 2E9MA 2CETA 2VUYA 1ISWA 1DP0A 3QOMA 5I5RA 1BPLB 2W62A 1UWQA 4JFTA 4H2CA 4QLLA 4BQ3A 3WKZA 1NQ6A 3O6AA 3ZM8A 3IK2A 4PMVA 1H3GA 2DSVA 4AZ7A 4L4OA 5DFAA 2J7EA 4H8HA 2GK1A 1CNVA 2J74A 4OBSA 1UA3A 2ZX9A 3ZJ7A 4W5ZA 2W92A 2EQDA 2PI6A 4EAMA 1OM0A 3ZR6A 1UQZA 3RJYA 2XIBA 1E0XA 4HPHA 4WKFA 4TX6A 1E5JA 1DWAM 3VIPA 2WXDM 3ARXA 1JFXA 4TVUA 4GKLA 4H41A 4IM4A 3WMSA 1E6QM 3O2LA 3GXMA 4RE4A 3WEOA 3BAKA 3AS3A 2OLHA 1AQMA 1KWKA 1VAHA 1HL9A 3UEQA 4B3KA 4TOQA 2VVSA 3FY1A 2XWEA 3MV11 4MNLA 4OKDA 5E9AA 2Z1KA 2CYGA 3BAYA 4M56A 2VCBA 1EDGA 3II1A 3WELA 2FH8A 2RGMA 1TVNA 1VENA 3AIBA 2XFRA 3HU7A 4DWSB 1UH4A 3RM9A 2Y5EA 1UD3A 2VX6A 1QW8A 5FKYA 2JEQA 4R5EA 4JFWA 2RGLA 5DO8A 2PWHA 2WC7A 4HPGA 3W26A 5KEZA 3SCVA 5A6AA 1BYDA 1J0ZA 5D9NA 1HJVA 1K9FA 1W1VA 4MB5A 4AZCA 5A3HA 1V3IA 1N82A 3CHEA 4UFLA 4YHEA 1CGTA 2CXGA 3CZEA 5M5DA 4UNIA 4U33A 4OUEA 5JBFA 4XX6A 2WLZA 1KFWA 4F8XA 1G5AA 2ZICA 2G3NA 3L2LA 1RP9A 4J27A 2C8NA 1B31A 2QMJA 7CGTA 3SCUA 3ALFA 2DQXA 3WD2A 1ZU8A 1SFSA 4CD8A 4CCEA 1P6WA 4ZXOA 3VGFA 4PN2A 1CLVA 5E6YA 4CD6A 1C7SA 1UG6A 5ABEA 2FH6A 1QI0A 4W7UA 2E3ZA 5CZKA 2WBGA 3QOKA 5BCAA 2JIEA 3ZT7A 4PTVA 5M3WA 5A1AA 3RDKA 4URIA 1GCYA 2WVVB 4PMZA 4LYPA 1J12A 4MADA 1JF5A 1CECA 2BY2A 1RP8A 2G3MA 1KWGA 1B1YA 1JI2A 4MNKA 1GOWA 3GXDA 2PBOA 5CGTA 3WBAA 2XM1A 4CN4A 3F5LA 3ZR5A 1UD8A 2E40A 1V03A 4V27A 1V3MA 4D6CA 1RD6A 2E9LA 5D9OA 1UD4A 3MMUA 3T2QA 4P8UA 3NDYA 2XSAA 1ITXA 2X1IA 2DIJA 1VJZA 4IPLA 3AIVA 4MNMA 2QPSA 1J0YA 3BAIA 3LPGA 3QHOA 1H11A 1CXLA 2EEXA 3OLDA 3WQ8A 1MW3A 4C7FA 2BHYA 3VMNA 3VINA 1E73M 1HJXA 3SUWA 1O6IA 3UR8A 1VEMA 3VGEA 2WMHA 3WQ4A 5CSUA 2ZXQA 3WDQA 3ARQA 4RE3A 3N1AA 3PHAA 4WIWA 4Z2LA 4W86A 2DSZA 4D71A 1V0MA 1TMQA 5HNNA 2JF6A 2CEQA 2V3FA 1W32A 2YIHA 2XHYA 3AMDA 1PX4A 3SUTA 4ATLA 3K8LA 4JAWA 1EDTA 2G4FA 4X0NA 4XZBA 1WZKA 2WMIA 3DHPA 3U5UA 2XVLA 4AEEA 5DMYA 1OD0A 1UD6A 4E8DA 2O92A 3AICA 3MMWA 1UWIA 3FNDA 3EDFA 3PZ9A 3AMKA 1V0KA 3VD9A 1LF1A 1UKSA 3LPPA 4P7NA 4H8VA 1US2A 4UTFA 1KR1A 4D6EA 1J11A 2EO7A 1Q6GA 3IJ8A 5CGMA 4P7LA 1QBAA 2VNCA 3VGBA 5BRPA 5EFFA 5I2UA 1VFOA 1VIWA 3UG4A 4XV0A 2BY3A 4ML4A 2WM0A 4S3KA 1CWYA 3GH7A 4PTXA 4LXFA 5FL0A 1W9VA 3EBVA 4PMYA 3WUFA 1C3FA 4X9YA 5FIPA 4MDPA 3VIFA 1RPKA 5IFTA 5GNZA 3WQ6A 1JDDA 2XFFA 1E3ZA 1HNYA 1UQYA 4Q22A 3WF4A 4UFKA 4KWUA 1E6PA 1UR0A 4PYSA 2WVUA 1QI4A 4ZENA 3WF3A 4D72A 3PTMA 4JCMA 4WSKA 2G41A 4M29A 3POHA 4OZOA 1QNRA 2XUCA 1CENA 2YDRA 1E6RA 4AD4A 1JDAA 3ARVA 4JIEA 5GPRA 1OCQA 1E4NA 1UKTA 5A94A 2D0FA 3NCOA 1E6SM 2CHNA 1VEOA 2UWFA 5DEZA 5KZ6A 4P8XA 2CBUA 2CNCA 4FF5A 1US3A 3AQUA 1Q6EA 2AAAA 3QHNA 2WZEA 1B2YA 4Z2JA 3OLEA 2ZUVA 3RIKA 4CN1A 3PZTA 4PRWA 2A3EA 2EPOA 3AMGA 3L2MA 4NZCA
chains in the Genus database with same CATH superfamily
3EX2A 2FPVA 3HF3A 4L1XA 2PDMA 1K9TA 3F4VA 4DPQA 1LQ2A 3GNPA 2ZZ3A 3TYBA 3Q2DA 3GYCA 1WUEA 4P7RA 1CPUA 4XWUA 4BF9A 1JD9A 1DJXA 1O94A 1I2OA 3GG7A 3T2OA 2ZCGA 3NG3A 1THFD 3LCIA 8XIMA 4WRHA 5A8OA 1IEXA 2EG6A 5DRCA 3EDKA 4XZMX 2A3HA 2WC4A 1I0DA 1PKNA 4YPJA 2A7NA 3H54A 2TSYA 3B8WA 3INPA 4NIRA 2VFEA 5A8MA 4XIMA 3WLNA 3SRFA 3BV4A 4MB3A 1A5BA 3KDNA 1BVZA 3SCOA 5TF0A 1CX9A 2XH2A 3VCNA 3B04A 3SRDA 3HMCA 3B97A 3S2JA 3MTWA 1ME8A 3RCNA 2VC6A 5E0CA 4AFYA 2HK0A 4HVXA 2BLEA 3CZJA 1WKDA 3F2CA 1HF6A 2DUXA 1W56A 2QJJA 4PUEA 1FXQA 3T2PA 1ZPTA 4Q4PA 4DO7A 5A6LA 4L56A 2FGLA 1JZ5A 3C3NA 4Q4RA 5FF4A 2J88A 3PBUA 2J6VA 2XN1A 4HZ6A 3NSXA 1I0BA 2V3EA 3W1QA 4UTWC 4NZ4A 3RR1A 3MS8A 3PANA 4LAUA 1YADA 5I3HA 4DI8A 4GCXA 1D8WA 2PTZA 2CC0A 1IIHA 3G8EA 3GQYA 4HT3A 1BXCA 1FWEC 1KTNA 3P93A 4EX4A 2P3EA 3M47A 4IMDA 1NDZA 2V5JA 2QEZA 1BKSA 5AC6A 2QV4A 4JYDA 3PZQA 4BQ2A 4IH3A 4C5ZA 2VENA 3IJDA 5HUOA 1OABA 5AB3A 1P6BA 2OTDA 2YYUA 5D2XA 4AZ6A 3UESA 3CUFA 1B54A 3CAQA 5HJXA 3S5OA 4AF0A 2CLHA 3BSGA 4LCQA 3UXIA 3L23A 4KFNA 3VO0A 1B4KA 3P82A 1OFBA 1GYNA 4A3YA 2PS2A 3VOIA 5EMMA 1AW2A 1D3HA 3UG5A 1AG1O 4LF1A 3UY8A 4BI6A 3O0FA 3W24A 3PF3A 4JDBA 1KV5A 5BROA 4EK7A 2E8ZA 3QR0A 2JALA 5HJLA 3TAKA 4UBPC 3M0MA 4H6RA 5G4WA 1GQJA 1YYAA 1LDCA 2HS8A 3W1AA 3GXPA 3OQ8A 3T0AA 1JJKA 3HGJA 1CGXA 3ZT6A 1WKYA 4A21A 4ECLA 2PC4A 3AXMA 4FP1A 3V5CA 1XBXA 4M0XA 4ZOCA 3IUHA 3M64A 5BWAA 3O6YX 2J47A 4ACYA 1L0PA 1YE4A 3PPHA 3W38A 4ZTYA 4CNPA 3KWXA 2BV9A 2PDJA 3SQLA 3TTSA 2Y89A 3TX9A 1KM4A 3GAYA 2VCCA 1LJYA 4JKLA 3CZLA 4H00A 1A3WA 3E2SA 4IFOA 4X63A 2FZ9A 1UZHA 2ZX6A 2P10A 3HPFA 4H9ZA 2IKJA 6XIAA 1PCWA 4CEUC 1AMYA 3E5BA 4YVXA 5EMJA 2ZUNA 2QW5A 3VA8A 1TPDA 1UC4A 3A4XA 3U2OA 1PZ0A 4HP5A 4DX3A 5FF0A 2PRMA 1JI1A 4B5UA 3M5XA 4Z1AA 1FWJC 1DJQA 1J79A 1P43A 4WD0A 2ACUA 2TPSA 4GPNA 5CPOA 3SCRA 1D3CA 3HV9A 3W6YA 5EMYA 4BK9A 2CBJA 4JHOA 2RHGA 2YXGA 1OT2A 3EXSA 2DVTA 2Z6IA 4UFHA 5BOFA 3G1XA 1ZALA 3N19B 3H22A 1E0TA 2GWGA 3TIMA 1EOKA 1A4LA 3T8LA 3OOQA 1BWVA 1OFAA 4GZ7A 3NYZA 2YXXA 1XI3A 3WBWA 3WF0A 4AD3A 1ZLPA 3I4KA 3VTRA 1JPKA 5XIAA 3BSHA 2DSWA 2I5GA 2PTYA 4Q7NA 2YB1A 4US5A 2PAJA 1E6NA 3R8GA 1NU5A 1RHCA 3GIYA 3GX9A 1V6XA 2ZRVA 5D04C 1FWCC 4LX4A 4M6QA 4H9XA 4XAYA 4N2YA 4Q8WA 2YFNA 3CO8A 3WUBA 3V0TA 2ZE0A 2AKZA 1XRFA 1TV4A 4RV3A 2YL8A 1MNSA 4UQCA 3DG6A 4ZTXA 4A3HA 3UWUA 1IE7C 1TB3A 4L6DA 2E0PA 3BH4A 3K1DA 4RK8A 3DN5A 4XD3A 2Q8LA 4HHHA 3HGSA 2QKFA 3BAWA 2XVKA 8A3HA 4Q3MA 4HU4A 3PJXA 3BMWA 3IIPA 3PY2A 3FAWA 4GQQA 1OWQA 3W27A 1V02E 3MVIA 3S4TA 3TFCA 4Q6XA 5ABHA 2I7GA 2OZTA 3HJZA 3VDAA 2OWWA 4DXXA 4YTUA 3CC1A 3MCNA 1MWOA 3CL8A 2PDYA 3UFYA 3SZ8A 5I3IA 4RUBA 3LHVA 1SJDA 3TXVA 1SFLA 1ZP4A 2C7FA 3IJ6A 3IAPA 2X42A 4D6DA 1CXIA 4QDWA 4DB7A 4HNOA 3LOTA 3AXHA 4GVFA 3CMJA 1VC4A 4IQEA 3W1NA 1DQXA 3S6TA 5G1YA 2TODA 3WQCA 1LBFA 4NRRA 4O1BA 1TUFA 3CTTA 1WQ5A 3NYDA 2VRJA 3M0IA 3M4HA 4L6OA 4ZQPA 1XKJA 1E4LA 1VFSA 1WZAA 3KW3A 2X8RA 3W2LA 3PC0A 3VIMA 3OHIA 5KETA 1YXCA 2Y8KA 3BCJA 2OGYA 1GOXA 4NZ1A 3W07A 1G67A 4E2OA 4XUGA 3RPTA 1ME9A 2IW0A 1K8CA 1W91A 1RLDA 2EKGA 2ZKMX 4QIUA 1FCUA 5CSYA 4O28A 4HN8A 3OO2A 2VX5A 1SSDA 3SAZA 4U2YA 5HMSA 3T05A 1UWRA 3EPOA 1KGWA 2VRQA 3FEMA 2HISA 3W73A 5K2ZA 1UD2A 1H7WA 4ZB5A 5AYYA 1RZMA 4ZO9A 4PUJA 4O8AA 6XIMA 4OIFA 1Z3NA 1DJZA 3KFTA 2OSYA 3S3GA 3DGRA 4ATDA 2WW5A 3M5YA 4BCEA 3IJ9A 3MHUA 1ITQA 2YX0A 4G6CA 3H7RA 3G6LA 4D6HA 4LUTB 1E4MM 3KBMA 3FLUA 3SEPA 4ZMGA 1W3JA 3W2UA 1V6VA 1IXPA 5I03A 3BDKA 2ONEA 3MUY1 3KRSA 1OGBA 1SO6A 9XIAA 4AIOA 1S2AA 4WGXA 1LT8A 1JQXA 3IGSA 3DKLA 1JCJA 2WMFA 3A4WA 1PZ2A 4HQVA 2REQA 3VDBA 3VIIA 1Z32X 3AIEA 1US0A 4GABA 2EPNA 1W5QA 1QATA 1TPVA 1WA3A 2XJ7A 4DQWA 3VAVA 1BVNP 2IPFA 4RJEA 3W84A 3AJXA 3U4FA 4CKQA 1Q7ZA 2CZ5A 5MHBA 1OJXA 3KOFA 1NF0A 4HSOA 3K2GA 1ECEA 4GIAA 2C15A 3WQEA 1KRAC 4JNMA 1D7KA 1BQCA 3EX3A 4B5TA 1NJJA 3NQ7A 5EB8A 4N4PA 3CTLA 1X39A 4GIRA 1F7BA 3M0HA 2DZWA 3W4RA 4KH2A 2PDIA 2J4GA 1VBHA 4J40A 1XPYA 3QZ6A 7TAAA 1UR4A 1EIXA 1EGMA 1MRAA 5DANA 2X05A 3DXIA 4HHPA 1L6SA 4NAEB 3V0UA 4GH3A 3I7SA 4PE8A 1IT7A 4B9YA 2CKSA 2NXIA 1NOWA 4BKNA 4W4QA 4J2PA 3N6HA 2GJPA 3H4WA 2X0YA 4JTJA 1ZQ5A 3UZYA 2FGZA 1E51A 1FHUA 1XLLA 3SCSA 3ICJA 7ODCA 1IYXA 4CQ8A 1XCXA 3W02A 3MMDA 3LGEA 4S38A 4AMAA 2QDHA 3KX6A 1KQYA 3VMPA 2V3DA 2VC7A 3GHTA 4DELA 1LOSA 3FAXA 3LY0A 3BZGA 1NH6A 3DUGA 4REQA 5LIYX 4IGHA 3B0UX 5D30A 2YZRA 2Z4GA 3TMQA 1CGVA 4IIHA 2WNWA 2VMFA 1S1RA 1ICSA 1U5HA 4W9TA 5CZSA 2OSXA 3R79A 1ZFJA 4FMVA 3K46A 3KWSA 3T08A 2HV5A 3UWQA 2GWNA 4N9DA 2XPKA 4KMQA 4DUOA 3UF9A 3HFTA 2J7HA 3WLHA 2IQDA 4MKVA 3OEXA 4J3ZA 1E0WA 4WUIA 4QJ4B 3KCJA 1JRCA 4GI4A 3W1UA 4F2TA 4L80A 1WYIA 2NQ9A 3UPWA 5D03A 4UR7A 3WDJA 5BMXA 2CHRA 3C56A 4GCAA 3FX4A 5D05A 3L68A 5IHRA 3LDVA 1PKYA 4HA1A 3ZSTA 4LU0A 2E67A 5H8MA 1H49A 5BXSA 1KNWA 4KPLA 4S23A 3KZPA 3GG8A 1PKLA 1EOMA 3K8MA 4JTUA 3SCTA 4C6FA 2HBVA 2Q09A 1VHCA 3NZGA 3OTRA 3WJZA 2FTYA 5E0FA 2XG9A 5AYBA 2YDQA 4J35A 1GW1A 3DAQA 5C6MA 3VOFA 2C18A 4AIUA 4H9VA 5A8QA 5AC5A 5EMUA 2QCNA 1RQHA 3WNPA 4ZO8A 2OR2A 3TJXA 4UOZA 1IR1A 1VFUA 1XBYA 3QV6A 1ALDA 4JNYA 1HT6A 3KE0A 1ICQA 2GQ9A 3WQFA 3GWQA 4JY9A 4KW2A 1ECQA 3DG3A 5CSSA 3H70A 3LBMA 2ALRA 2F6UA 2FKPA 3GK0A 5CBJA 3EDDA 5CG0A 1R7OA 5D2VA 1Z6KA 1QPKA 5C2GA 2E1WA 3GW3A 3ABXA 4DBUA 1D2KA 3W7RA 1OBAA 4XB3A 3CMGA 2D69A 4GIEA 3G3MA 3KP1A 3LXBA 2RDWA 4AIBA 1W3NA 2G95A 1UMYA 1K9DA 5BXPA 4RNIA 3QJAA 4KESA 3DERA 3HG3A 2A3AA 4BJHA 1GVQA 2E6YA 2IUZA 3P5YA 3W3OA 2YL9A 2WPGA 3TXZA 2HK1A 3LMZA 4GY7A 1FH8A 7A3HA 4GI9A 1PYFA 4PSRA 2V63A 1AJ2A 4MY1A 1XLFA 3KRBA 4FNUA 4NUWA 3C2OA 3MSDA 4G7EB 1WCGA 1VBRA 2FFCA 4I7VA 3S6OA 3S9IA 2E6FA 1BEUA 1VIZA 1XYFA 3USZA 1OC6A 1KXVA 3O05A 2VDGA 4OT7A 4FXFA 4CU8A 1FUYA 4C5YA 1E6ZA 3WLKX 2NQJA 1TWZA 4DXVA 5EBUA 1YTKA 1VZWA 3CQ0A 5IXEA 1G6CA 4GXWA 5D33A 3TU9A 5EYWA 3CASA 4U2ZA 1LLZA 2B7OA 3BICA 2XN0A 4CU6A 1R87A 1FDZA 3V16A 4UNKA 4PUNA 1A49A 1R9ZA 1DE6A 3TR2A 3TR9A 5TNVA 4N9BA 3MHFA 4JCLA 3LZ3A 2YA1A 3CZKA 3EZ4A 3AISA 1JAKA 4E2VA 3E0LA 1KFBA 3M44A 3W72A 3CAWA 4JKMA 2PDXA 2NVCA 4JNZA 2CXEA 2J7GA 3VGDA 3GAKA 1JZ2A 3W81A 3WMBA 5I7GA 2P53A 5CC3A 3LN3A 3A21A 2D22A 2QJIA 5CC6A 4DHGA 1F4AA 1JCLA 2E77A 5LNSA 2FPYA 3QPYA 3KS5A 5EY5A 1E1CA 3M6DA 3RU8X 1V79A 1U22A 3WSUA 3CHCA 1H7RA 1FDYA 2VDHA 1FX6A 3LU2A 3M9YA 4MIMA 3OGRA 2OEMA 2V5CA 4AW7A 2VO5A 4IIGA 1Y5VA 4E5TA 2D1ZA 4JZ5A 4N7QA 4QQ3A 1POJA 1SZFA 5M2FX 4DF2A 3U48A 5M17A 4FR6A 3CH9A 3AS0A 5A95A 4EXBA 1NFPA 4ZFCA 3SN0A 2RFGA 1P0KA 1H1ZA 3F2BA 4LV9A 1CXFA 3L4YA 5M03A 1KCXA 4IICA 1X1OA 4C6JA 5HWJA 1FHLA 1MDRA 3DGBA 3SCWA 5HJYA 2PEVA 3UR2A 4HK5A 5HA7A 1XGEA 4C1NB 4NNAA 2WKJA 2F2KA 3FN9A 2J7CA 4XISA 2NQZA 2NSOA 2FZMA 1GKQA 1A5LC 1MEIA 1OB0A 5DT7A 4B15A 3IIOA 4ZQNA 2QUNA 2WK2A 3EWYA 5LXEA 1ISXA 3RR4A 5CXPA 4S3EA 3SN4A 4CD7A 1HN1A 4MSSA 1J01A 5ECUA 1VP5A 1HG3A 3A64A 2J8GA 1XH2A 3EMZA 1PO9A 5AVHA 1AD1A 3EXRA 3MSYA 4KF1A 3LPFA 1KR0A 2NVAA 3H2EA 1HGYA 4H6KA 2VC9A 3U7BA 4L65A 2GVGA 4CLMA 4C6MA 2XIJA 3V75A 3LGDA 4DLFA 1EO5A 3VGHA 3OBAA 4QR6A 3TQPA 3LLDA 2BASA 2V2DA 3IIXA 3U2EA 2DW7A 4IFKB 1XINA 2A79A 1W9UA 4F0SA 4S39A 1XLEA 1R5YA 3NPXA 4TIMA 5KITA 3MZ2A 2WC3A 2ZBTA 4AB4A 3UR7A 3G1SA 3RLVA 2ANUA 5HR7A 3TNBA 3B4YA 4FIRA 4XZ9A 5CPQA 4AQLA 4WEVX 4MAZA 1WV2A 3QHMA 1A5NC 1P6CA 3HG5A 4OOUA 3AYVA 1U1JA 3UG3A 5I02A 1G7UA 1Q6DA 3QSTA 1Q6RA 1OHLA 2FFIA 2FHFA 3EKGA 2YR1A 4MVAA 4LS2A 3CUHA 4D6GA 3TROA 2FIQA 3VNLA 1B9BA 5CLTA 1VPYA 3BZJA 5LIKX 4XTDA 2X2YA 1KBKA 3IJIA 2UBPC 3L5MA 1JD7A 3HQ1A 4OTKA 3XINA 1ISYA 4PMQA 2QT3A 2ZRUA 3JZEA 1MW1A 3DG7A 4MB1A 4AZHA 3ZJ6A 1Z7AA 2ABAA 3H2OA 1W17A 3W7PA 3VKKA 5D02A 1VYRA 4DJEC 2FHCA 3CV2A 3U2CA 2GUYA 3GXIA 3IAQA 4W85A 3L9CA 2DH3A 2J24A 4HOWA 4LB4A 2EJ1A 2AQOA 3LEPA 4DZAA 3FK4A 1RA0A 3GG0A 1SJCA 4PB4A 1NWTA 1Q4WA 2GUUA 3M43A 1R9XA 3BW4A 4UZSA 4GH1A 4PRTA 1GOIA 3R11A 3EDEA 4AHQA 3S46A 4JPGA 4NX0A 4TTGA 2DZBA 3G77A 1UZ1A 3RLGA 1GW9A 1ONEA 4LF2A 2NQ5A 4M80A 2R82A 3OVQA 1W1ZA 3GTIA 2BHUA 5L9FA 1J10A 1EUAA 2CFFA 4HD5A 3LB0A 3B0VC 5AHFA 1PVNA 4LBRA 2GQ3A 3BLPX 3PWIA 2JIWA 4BFAA 3ARYA 3P67A 4GXMA 3N4AA 1XIHA 4P7OA 1A5UA 2Q8XA 1NDYA 4OECA 3OZOA 4MG4A 1YXDA 3ITVA 1PTDA 1XUUA 1XYBA 1X1ZA 1MUMA 2R24A 5AHNA 3M7SA 1EQCA 4QDMA 3CL7A 3N13A 4WDUA 1BXBA 2GSHA 3LCFA 4M81A 2C79A 4WJ8A 4XVDA 1ZAIA 2YPIA 2J79A 5CJ5A 3TN6A 1J6OA 3GU2A 3ITYA 5I09A 2PGEA 1CLXA 3UZ5A 3CWOX 1FBAA 4O14A 3DC0A 5C71A 2BS9A 1MW2A 1HIZA 3PULA 1MNZA 1KM5A 3I6TA 3KCOA 4IZGA 1EO7A 2A3LA 3W29A 4AF0B 3VKAA 1FH7A 1QI3A 1FFQA 1EJXC 1AZ2A 4DBWA 4M6UA 4XD4A 2VXNA 1HXJA 4FX7A 4G56A 3BARA 1IV8A 1VGAA 3KDOA 1S5TA 1HQTA 4NSBA 3E74A 3UG8A 1TJ2A 1W9PA 1BD0A 4FXJA 1UH2A 4V1YA 2OWCA 2YZ5A 4A8LA 3EAUA 4Q4SA 5F2LA 5BXRA 1I6NA 3H55A 2HQAA 5K4XA 1UASA 8TIMA 4B5WA 2BB0A 1FFRA 2J8FA 3B9DA 2NZLA 4RV8A 2ISVA 2W62A 2ZADA 1GZ1A 4H2CA 4BWLA 2ZVIA 3WKZA 4INFA 3IV8A 4PC8A 1SJBA 4JYFA 3UJSA 4CQ9A 1TWWA 1ZJIA 4AZ7A 3NZQA 1ADOA 2GK1A 3TWBA 3OA3A 4OBSA 1BF6A 1EEPA 3DI1A 2DZSA 1SJAA 1VCFA 4W5ZA 4M7TA 2EQDA 3K13A 2PDGA 3ZR6A 5REQA 3NA8A 2ALDA 1TV2A 4IIBA 1E0XA 4GYFA 3W7CA 2B81A 1DWAM 3S8HA 3JZUA 4C6KA 3OQEA 5HR6A 2Y6ZA 5DX7A 1E6QM 3WLLA 3V1PA 4GIYA 4G1KA 2JKAA 3OVGA 4MYXA 1AQFA 3KVMA 2Z1KA 1O95A 3BAYA 4YTQA 4M56A 4UTTA 1EDGA 3II1A 2FH8A 3BTNA 5D09A 1VENA 3QGKC 3HU7A 1UH4A 3PAOA 1UIPA 3CM4A 1H5YA 2FQIA 4PH6A 4KCWA 2PWHA 4IXHA 3A4JA 3SCVA 3RITA 1K9FA 1W1VA 2ZRXA 3CV1A 1BTMA 4JY8A 4AZCA 1K8XA 3NR0A 4YCPA 3OBKA 2CXGA 4EXQA 4UNIA 4U33A 1TZZA 1A0DA 2WLZA 4US6A 3MY9A 3QY7A 4DJFC 1VBJA 3L2LA 3N73A 1VD6A 1B31A 3ALFA 3U8GA 4CCEA 1ZU8A 4GUIA 1SW7A 1CLVA 4CD6A 1WUFA 3UGRA 2GVJA 5I3JA 5C0QA 3QOKA 2FYMA 4QEHA 3C0LA 5F4SA 5M3WA 2XISA 1HFBA 4URIA 1GCYA 3NOYA 4DBSA 4MKSA 5HNRA 4LYPA 2OFJA 1JF5A 3GVWA 3TC3A 1FWTA 2BY2A 4RLIA 1SVDA 1B1YA 4QG9A 5IRPA 4Y9PA 1W8GA 5CBIA 3NEHA 3EOLA 3WBAA 1XGDA 2XM1A 1JVNA 3CK5A 4PUMA 1UD8A 4O1FA 4NZJA 4V27A 3HPXA 5D9OA 4F0MA 3LRKA 4MF4A 3AIVA 4MNMA 3N34A 3THAA 3HIJA 1VRDA 1S39A 3LA4A 1EPVA 3VMNA 5E5CA 3VINA 3FEQA 1LZOA 1XYCA 2ZTKA 1VEMA 4LC8A 1TPUA 5CSUA 2ZXQA 2RKXA 3N1AA 1L6GA 4FNPA 3MQTA 3PHAA 3BW2A 4WZHA 3LRMA 4KIEA 4MOZA 3S2LA 4W86A 4GGHA 4ROQA 1YPIA 2V5KA 5HNNA 3OIXA 3T55A 3SGUA 3NVDA 2E5DA 3HQNA 2V3FA 1OFRA 1DOSA 1E0UA 3T4CA 5G2HA 2DJLA 1QMLA 1PX4A 3SUTA 4FAMA 3QV8A 3DC8A 4LS1A 3W1PA 1XC4A 1Z44A 2G4FA 1F5ZA 5K4ZA 1UWIA 3EDFA 3DFNA 3FA5A 3FJ4A 1V0KA 1LF1A 5F1UA 4P7NA 1HO4A 3PBWA 4QG6A 3QM3A 1US2A 4UTFA 1KR1A 5BOOA 2PUZA 4PMJA 1W37A 3IIZA 3I7QA 3TW9A 3SJ3A 4R88A 5EFFA 5I2UA 1XUZA 1VIWA 3UG4A 4A3UA 1LRQA 3H8AA 2WM0A 4GKTA 4S3KA 3QV9A 3ZS4A 4A35A 5LXXA 2YCLA 4X9YA 4NNBA 5FIPA 1VFLA 1JDDA 2XFFA 4UNLA 4UTIA 2VR2A 4PCPA 4PEKA 3BVJA 1TPFA 1VFTA 4KWUA 4Y9NA 3Q94A 1YIXA 1O66A 4DJED 4D72A 3CHVA 4DYKA 3NDOA 4PFHA 2C14A 1FQ0A 3LQLA 2REQB 4OZOA 3I10A 3BO9A 4JHMA 4LY8A 3IIVA 2PWVA 1R0MA 3HQOA 3ARVA 3OVPA 1RR2A 4K36A 3SY5A 5EKYA 4NXKA 1UKTA 3C6CA 2D0FA 1XP3A 2FB3A 3RPDA 8XIAA 2UWFA 1FRBA 4GQGA 4JTGA 1NQKA 4FF5A 1Q6EA 3QHNA 2Z7KA 4CCZA 4O0KA 4Z2JA 3MO7A 3VKCA 2A3EA 4YNGA 3L2MA 4NZCA 4F0KA 1V0LA 6TIMA 5DCBA 1KCKA 1R3TA 1IR2A 3VNDA 1NP2A 3V7PA 4F79A 1CBGA 2JGYA 3ARUA 3D5HA 4MZYA 1OG0A 4HPJA 1OG6A 2GGJA 1I2QA 4O57A 2GLKA 3RRAA 4L4PA 4Y6GA 4L1WA 1XF0A 2GGIA 4LUIA 2WJDA 1XG3A 2FZDA 1R86A 4AWEA 3MI6A 5CKSA 1EH9A 1JQVA 3G8RA 5K9DA 2C6QA 4GUGA 3SSJA 5RUBA 2ZX7A 5E0KA 3W86A 3N9KA 3PN8A 4YMZA 1R3WA 5E9XA 2CLPA 1Q4NX 3F4WA 3EB2A 4YTRA 3LSBA 1SW0A 5FEZA 5C7HA 2VELA 4CCCA 3I3DA 3H53A 1DXFA 1LRNA 4NASA 1L2QA 4AVNA 3F4NA 2E68A 3MB9A 4JN8A 3VE7A 5H8UA 6ENLA 4REQB 1AQHA 2CZFA 3VZZA 3EB3A 1QOPA 3NJ3A 5A2CA 4J3WA 3FGCA 4IJBA 4UQBA 1S5VA 3IWPA 3SRKA 4KFPA 2YLAA 4FHAA 2EBNA 5F4WA 3O3RA 1JNEA 4MZ8A 2AL2A 3DX5A 3SCQA 4IF2A 1O1ZA 3V36A 7TIMA 4CCDA 4JGDA 1DQWA 3UCDA 3WH8A 1E40A 1M6JA 3L7RA 4DLMA 2BGQA 1E15A 1LCOA 4QITA 4JOMA 4YWIA 3W88A 1XLMA 2PSNA 4ICCX 2ZIDA 2EG7A 2QZRA 1H51A 4LUSA 5ENLA 2EJAA 5FF7A 1DHKA 3I3EA 2Q02A 3VC5A 4RZ4A 4GX9A 2G5WA 1CGYA 2YBUA 1FA2A 3U4AA 4KFOA 2ZZ6A 2WZMA 5IM51 3DZ1A 1BXNA 3VCRA 3CUIA 4PL1A 6REQA 2PB1A 1VH7A 3MHGA 3EWWA 2W79A 1LG1A 3C52A 3RLUA 2DZPA 4C7DA 1ADDA 3KLKA 2CESA 1XDMA 4I9TA 1QNOA 4E4PA 3SQSA 5H8PA 2BOFX 4R7JA 4EKJA 1OCNA 3SIZA 2C3ZA 3QW4B 5CSRA 2DV0A 1F3XA 1DJWA 3LCLA 1XCFA 4B2DD 3G1FA 3GM8A 2Z24A 4MNJA 2B7QA 2EG8A 1A5CA 3BXWA 1M7XA 3ARTA 4ADTA 1ZJBA 5TD4A 1T0OA 3K5XA 3A47A 4PUDA 3AHYA 9RUBA 3CUJA 1ZL1A 1L9WA 3WEMA 1GZGA 2YGYA 2V2HA 4K7VA 1GOOA 2FJUB 3LMYA 2BXZA 3CPGA 3R0UA 1AJZA 3WF1A 2NV1A 3LD5A 4QBXA 1TTPA 4Q8TA 2J8TA 2HROA 3LM7A 5LIWX 3WD3A 2ZA3A 3IEBA 1QOQA 5BMWA 2YA2A 1ZCCA 4J4KA 2Z00A 5HNUA 1NFGA 1M9HA 1YQ2A 3QYSA 2UY2A 3MVTA 2KX9A 3CMFA 4DJFD 2OYKA 5LZLA 3F4DA 4U4MA 3S5YA 4GINA 4JEJA 1Q6CA 3GUGA 3NQBA 2YJQA 5AC4A 2YDSA 3PG8A 3M0KA 3TWAA 1WXJA 3VNIA 3UNTA 5C5YA 1UC5A 3J7HA 3ABOA 3W7NA 5HUPA 1S5NA 3M5VA 3LERA 2DORA 1M7PA 1V6WA 2PGRA 1ISZA 4R27A 5H1WA 5CAHA 4AAJA 4ATWA 4DWSA 5IFPA 3B8TA 4QP0A 4DZIA 3EA1A 2PZNA 4I5RA 2R91A 1XLAA 3CU2A 3NO3A 4E38A 4MM1A 3LNPA 4NYUA 3GVVA 3SB0A 1AJ0A 4DO5A 1BG9A 4C90A 1NSJA 3W87A 3GFXA 1IZJA 4DNHA 1JZ6A 3HPSA 3GVQA 1W6TA 2OEKA 3TLQA 4WLCA 1FHVA 4D6JA 1FHDA 3MMTA 3WLJA 2OG9A 4W8BA 4RNJA 2WV8A 4NAFA 5CPMA 4NG3A 1KCZA 5FF2A 3H7VA 2DT2A 5LHEA 2WANA 4LAKA 1UZ4A 3CIVA 3NZ1A 2I16A 2XYLA 2HE8A 3SFKA 3VZXA 4C1LA 3B9EA 3ARPA 1F6PA 3B8UA 5A6BA 4AY8A 2QF8A 3GW0A 2BP1A 4ONVA 1A47A 1PXGA 1PHQA 3BC9A 4TV6A 3R4IA 2EKCA 4WQ6A 3AI0A 2UY5A 2J9ZA 3ONCA 2HRWA 4RPQA 2PF0A 5JUVA 3PJUA 1E1CB 2ACSA 4YU1A 4NT0A 4NYYA 2WVTA 2PF8A 4H83A 4X3ZA 3RCMA 1CT5A 3CH0A 2RJGA 4C6CA 1N7KA 1FOBA 3JU2A 1IWPA 1XLCA 4JX6A 1GHRA 4NP7A 3QY6A 3RJXA 2IMRA 1QWGA 2WJFA 5CLWA 3QV7A 2VOMA 2VM8A 2YL5A 4GYJA 1XHGA 3QC0A 4DNMA 3GBDA 2QCGA 1MQPA 3LX9A 1WE5A 3RRXA 1SUXA 1AW1A 2EPKX 2QCMA 3WNLA 3LUTA 4RE0A 4LNYA 1XKYA 4JBRA 4Q8MA 4ENLA 5BWFA 3WD1A 3H6OA 1B3XA 1C7TA 3WK3A 4PMRA 2CBVA 1OT1A 3FDKA 1W1TA 1JXJA 5TBOA 1WOBA 4PGLA 4TTUA 5MF5A 2Y5JA 4RR4A 3AIQA 3C2VA 4UC5A 4GFIA 4AD5A 2OU4A 4QG8A 1KTCA 1DE5A 1W5OA 1LP6A 3A5FA 4Q8PA 4Y9OA 1F6YA 5FD0A 2HNEA 2IQTA 1Y5XA 2CLMA 3B9AA 3MZNA 4NJGA 4DXKA 3PAJA 1DTNA 3E2RA 1L6FA 1B3ZA 4Y8FA 4FS9A 3N14A 1DEDA 1A3XA 4XD6A 1WDRA 1KM1A 1RCQA 3NUKA 2DDXA 4O4WA 1JFHA 3OYXA 4RZ5A 3N12A 1ZBKA 4S3JA 1TTIA 4K8GA 4G8TA 3M0JA 3L4ZA 3B3DA 5EU9A 4ERGA 3AUOA 3W2MA 5AHLA 1CZ1A 3PTQA 1Q3NA 1XM3A 5DMMA 4O0QA 2CU0A 1UR8A 2BVDA 3N6JA 4ZR8A 1QK0A 4A4AA 3MKCA 4JN7A 3EA3A 3WD4A 4C1KA 3CEUA 4GFSA 2WZIA 3N29A 3S1UA 3NURA 3T8QA 3U6WA 4HMNA 3P81A 4QM1A 3PFMA 4MTVA 3QEZA 2EPLX 1RQEA 2QIIA 4NILA 2VC5A 1RCOB 4HZ7A 1BGAA 3BCFA 1JPHA 1W5MA 1EC8A 5JIPA 3VUPA 4MUPA 2B4GA 1TCDA 3TNOA 4O12A 3MUXA 3R13A 3UQNA 1W3IA 2D2HA 2J75A 3W1LA 1A4MA 2TMDA 4LUJA 1ZUAX 1QU4A 4ZO7A 3TV8A 3E02A 5CC7A 3GTHA 1EYWA 3CT7A 4LVGA 4FOUA 2XINA 2XIQA 2PODA 5A5WA 3T9PA 2PLMA 1OEPA 4BI5A 3VU2A 3MU7A 4GRSA 4PCTA 3NZRA 3VX1A 3HURA 1A3HA 4M6PA 5DELA 5LGXA 1HUVA 2HCVA 3N04A 1K9EA 1S3HA 1BVWA 1JZ3A 2DZXA 2OXNA 3RU6A 4HNCA 1ZRQA 2HXUA 1BYCA 2B31A 3TC6A 5E70A 1UBSA 1LL7A 3S9YA 4H9TA 1Q5MA 1KXHA 4J3UA 1DXIA 3KL3A 1GKPA 3C2RA 5HDRA 3EWCA 4AIEA 3BLOA 3A6OA 3H2AA 1AQ0A 4O4VA 3HG2A 3TZNA 4HTYA 3L65A 4IMGA 3AHXA 4KCUA 4GUFA 1EZ2A 1TPWA 4ORIA 5FI8A 2CZVA 1A0CA 1RVKA 1E43A 3PWAA 2RDXA 3VPLA 1IIGA 4MFEA 4NI3A 3W7MA 3L5AA 4EPEC 1VFFA 5I06A 3VK5A 3C8FA 4JFUA 3GR7A 3G0SA 3TONA 3CHFA 3TLLA 4EP8C 2C71A 4H9MA 1E9ZB 3EMCA 3TDFA 1JGIA 1YNYA 3EPMA 5I77A 3WDHA 4ILSA 1DJYA 3WF2A 4NJJA 3TA6A 4N9CA 3VKJA 3P7YA 1U33A 3ES7A 5SWUA 3BOXA 1TMLA 4O52A 1KFKA 1MVYA 3SN1A 4H7VA 4XK2A 3CQHA 2VFIA 4A8RA 3TP4A 1QRQA 4ML9A 3TTOA 4HU8A 2ZXAA 4YIWA 3MP5A 2YW3A 4UWMA 1QNQA 4DZ5A 4R3UA 2WHKA 1SFTA 4GMEA 1XJBA 4JTRA 3WLSA 4K8EA 5AOUA 3MKVA 4UCGA 5D32A 2IKHA 1PAMA 4WKAA 4LAOA 4CEXC 4RNHA 4Q7BA 3VM7A 1X6UA 4AISA 4LH8A 3ZFHA 3UWVA 1EIBA 4R34A 1V93A 1UYQA 4M7SA 4LQ1A 3VDHA 1OADA 1HP4A 1W1A1 1X6NA 3VZYA 4WOZA 1ADSA 4KGJA 5FJPA 3RFAA 2D2GA 1TV7A 2DPEA 3MJYA 4M8UA 1K7XA 1PX8A 4A6GA 3VC6A 2Z29A 3W74A 4G1NA 4H3DA 4NQ1A 3ORWA 2GK1B 3R89A 3RO8A 4ZB0A 1NIUA 5FF3A 1F05A 4D9PA 3CGTA 4JQ2A 5KZMA 2VWSA 3NSNA 3UJFA 5ABFA 3M46A 3RMEA 5T91A 2VZUA 2AMXA 3IS4A 3H2CA 2QUMA 1U30A 3GDTA 4O1DA 5K3VA 3D3FA 4K7YA 1O7AA 5D2YA 2VFGA 4XBJA 4AMCA 3T1GA 5DY3A 3FXYA 1WB0A 3NM3A 4Z2HA 3G2GA 3VD4A 1YMYA 1BYBA 5PTDA 2P0IA 5LNRA 4KEMA 4G9PA 4HPNA 3HB9A 5AZ1A 3CIWA 3EXTA 1M41A 2FTPA 1RLCL 4W5UA 1B3YA 1RUSA 3NVTA 4AYSA 4JFVA 4JTLA 1B0IA 3TW7A 4B5NA 2QPXA 3G0UA 5LKYA 3E49A 1VJSA 4HZ8A 4MY9A 4WGHA 2DH2A 1TPB1 3VVGA 4AZCB 3CV7A 4LJ3A 1FP9A 5HINA 1CGUA 2FVMA 1A5OC 4I3GA 1VCVA 2AOSA 2PWUA 4HPXA 3VM5A 4V33A 1C91A 4HCHA 1CXKA 3AXXA 3SFWA 1QHZA 2HVMA 3ITXA 1W0MA 5DLCA 2UY3A 1GZJA 1PIFA 4FX6M 1RQBA 3FYOA 3GHRA 1UWTA 3WMLA 4BEQA 3ME3A 2BMBA 3T0DA 1Y65A 4Z1BA 3R58A 3TOPA 3KTCA 2VCAA 1OGSA 2J6XA 3QR1A 2Y61A 3LSCA 3SRHA 2PDHA 3DESA 4XO6A 3STCA 4MZ1A 4MFDA 4WSHA 5DF0A 4X60A 4F48A 1YBQA 3G1HA 2QJGA 4PBFA 3CBWA 2BFGA 3VOGA 2AQWA 1F9CA 3AS2A 3TSDA 4OBTA 1S5MA 3R12A 1EA0A 3WDIA 3PZUA 1FWSA 3AC0A 1PHWA 4GZJA 4W93A 1TVLA 1JYNA 1LWIA 1KCLA 3LCHA 1N8IA 4IPPA 4NX5A 3PJWA 3QKZA 4XAZA 6TAAA 4QQUA 2WSRA 4C6QA 1LL4A 3VOHA 3QMSA 1Z48A 3TTYA 4NY2A 3DFTA 3QC3A 2C16A 3TUUA 4KRTA 1DWJM 4HMEA 5G2WA 4AZ5A 5IDIA 3KZSA 2KZHA 1GYMA 3URNA 5JBDA 3CS2A 3S47A 1H41A 2OX4A 3W6MA 2G96A 4WOQA 4OU1A 1ODZA 2YCKX 1IZKA 1BSIA 4K68A 1F3WA 2OKOA 1BGGA 1QOXA 4F66A 3THUA 1QPOA 1XDLA 3O06A 3ABRA 3HQPA 4RX0A 1OK4A 4O17A 2OQLA 3NTYA 1K6WA 2P8BA 1M3UA 1KO0A 3S9ZA 4HHLA 2BTMA 1VLIA 4FOJA 4J2MA 4OFCA 2GDUA 3HZ3A 1QNVA 4B9ZA 3W22A 4ZFMA 3NO5A 4KETA 3APYA 1OFQA 3SY1A 1GJPA 2X0HA 2YCLB 4IT1A 3VYLA 3TN5A 4UMCA 1XRTA 2G97A 3NL6A 2X16A 4NJKA 4F0HA 1ZY9A 3WYZA 1IT0A 1GPWA 3Q37A 5A2AA 5GJPA 4WJEA 3BOFA 3LI0A 4LBSA 1YXYA 1M03A 1EBHA 2CITA 1GVSA 1E6XM 2XN2A 1UIOA 4NZ3A 1XDJA 3LYEA 2QCCA 1A53A 5I24A 3PTKA 4M19A 3VX0A 3QMTA 1OFEA 4J3SA 3QPZA 2NW0A 2B7NA 3TK7A 3VNYA 3GSMA 1F4HA 3N2OA 2OZ3A 3NWRA 3NQ6A 1LYXA 4YTSA 1U5JA 4US5D 4BEUA 4DPPA 1C8VA 3QGVA 1YPFA 5CPLA 1XIGA 4C91A 1GG1A 4F9JA 2FB2A 1VJIA 3UYIA 4ZGYA 5FCZA 2H9AA 3OA5A 4GACA 3QQWA 3C2EA 2RJHA 3IPWA 2R1LA 1H09A 2NSXA 3VGGA 4I9JA 4FK9A 2DVXA 4NZFA 4YJ5A 3WLIA 3VIHA 4G5DA 4E8GA 4WX2A 3VMOA 1BHGA 1KFLA 4IMAA 1K1DA 4FX8A 3N9RA 1SZRA 1V3LA 2PLCA 3WBEA 1RJRA 1FKWA 5KTLA 1HKMA 2PD9A 3T44A 4PMUA 4QNEA 4JIQA 1E55A 5FACA 3C8NA 3AFBA 1FCVA 3ARWA 2WSQA 3EWDA 3W9ZA 1FTXA 4IMFA 1NP0A 3FA4A 1BFNA 3FV9A 3CUZA 4LT9A 1V6TA 3NFUA 1EJ7L 2DFAA 1WOAA 4YTTA 4UQEA 3OU8A 1UKPA 2G8ZA 3LG3A 2POZA 3ZSSA 4W7WA 1TTQA 2ZC1A 4RDYA 2ZTJA 1QHPA 3W7DA 5XINA 2PP0A 3NXFA 3AIWA 4Z2GA 2Q6ZA 3CUGA 3DFSA 3AMLA 1ENUA 1SR0A 4UFJA 1YPXA 2D0HA 4KWOA 1SYTA 2BODX 3FGCB 2E8YA 1UR1A 1PIGA 3TH6A 1DYSA 3UNDA 4MPQA 5LIXX 4CVUA 3H2MA 3EOOA 3O07A 2AL2B 4FLRA 3HM7A 2JFEX 2D2OA 3FA3A 3TCSA 4ZXLA 3VIOA 1ONWA 1HVQA 3NOEA 1NFBA 4RW3A 2XH4A 7REQA 2MUCA 1QUMA 1XH0A 3URAA 1VPQA 4LUSB 1H4PA 4Q32A 1VLWA 4F40A 2YLLA 4HYWA 4XKYA 3GNRA 1WBJA 3Q58A 4F2UA 4OV4A 1OF6A 3EWZA 3TTQA 4ZQOA 3WO8A 2QDGA 3H26A 3STFA 1PTAA 4W8LA 3R0KA 1HJQA 1TTJA 1ISVA 1VF8A 2H6RA 5A8PA 2OYMA 6REQB 2Z6JA 3K4AA 1AH0A 4UTLA 4L4LA 1JYVA 1HL8A 3PM6A 4HNNA 3W7EA 1TX2A 2MANA 2VTFA 3TZFA 2ZUMA 5EPDA 4OE7A 2H8XA 2D3LA 3BGJA 1O5RA 1QNSA 2WBKA 3NIYA 1W3TA 3PTDA 4R7WA 3QTGA 4JS3A 4PTMA 1V08A 4DZHA 4LYRA 5BNKA 1CXEA 3PJTA 4KRUA 1PL9A 1ZBCA 4IL2A 4ZE4A 2J25A 2VEMA 1X7IA 4GC3A 1CDGA 1KW1A 3NAVA 4UQDA 3QZEA 1ICPA 2F9RA 2E9MA 2CETA 3ATYA 1ISWA 5I3GA 2QS8A 2VGIA 3CPRA 2GSEA 5LNWA 4BQ3A 1QTWA 3PB2A 1W1IE 2INEA 3IK2A 2DSVA 3V18A 1GEHA 1EL3A 3LTPA 6PTDA 2J7EA 4H8HA 2A5HA 2BGSA 4KEVA 2J74A 3EOSA 3GDMA 5MKGA 1UA3A 2ZX9A 4QDPA 1KKOA 5C9WA 2I57A 2Y1HA 4EAMA 3VOJA 2ZVRA 4Z1CA 3DFQA 2VGFA 4XBSA 6ALDA 1PUDA 3FIGA 5DXXA 4IHCA 4ICNA 1J96A 4IWWA 1N2VA 1JCXA 4ZOAA 1JFXA 5C55A 2O7SA 3F7JA 4HTBA 1QPQA 4H41A 4IM4A 2ZQ0A 3O2LA 3TC7A 3BAKA 2XIOA 1DXEA 1VAHA 1PWLA 2WOQA 4B3KA 3NQCA 1YDYA 2CLLA 2Y7FA 5AC8A 2PE4A 3UA3A 3WELA 2RGMA 3A12A 4DWSB 1X96A 1J4EA 1FVPA 1RCXB 3BLDA 2FDSA 4NU7A 4MWAA 5DO8A 4HPGA 7ENLA 3LBCA 5EL1A 3BQ6A 3H2FA 3P61A 2QDDA 1VS1A 2OZ0A 1SU5A 4UMBA 5A3HA 3NQVA 1UP2A 4LY4A 3IRSA 4UFLA 3PVFA 2Y8UA 1VFHA 4XX6A 4HNVA 1G5AA 1Q65A 3B8VA 2C13A 2VFHA 3W7IA 4IGSA 3C0SA 1RP9A 1RV8A 3SCUA 2DQXA 1KKRA 4CD8A 1GVEA 5EA9A 1UJQA 5E6YA 4FOKA 3GFYA 1YDNA 1UG6A 2FH6A 3EX1A 3T40A 3W83A 3GDKA 4B92A 2BXVA 4PTVA 1MZRA 1DIKA 5HMDA 2AL1A 2NWSA 1J12A 4PUKA 4AX6A 1B57A 3R6IA 4D8ZA 1RP8A 2G3MA 4O50A 1JI2A 1O4UA 3DU0A 4CQBA 5CGTA 3UT0A 3ZR5A 2V67A 3N6QA 1V03A 3GVGA 4AX7A 2NUYA 4ZCWA 2E9LA 1UD4A 3CT2A 2XSAA 1ITXA 2WNQA 1VJZA 4IPLA 2ZZ7A 1GVFA 2QPSA 1J0YA 3QHOA 2CWNA 2A6NA 2EEXA 3OLDA 3WQ8A 5CAKA 3ZYZA 1MW3A 4C7FA 1AW5A 2BHYA 2V82A 1UPPA 3PNUA 1HJXA 2CZEA 1O6IA 3CIXA 1H7OA 3VGEA 3WQ4A 4C6NA 2GL5A 1IEVA 3GKFA 4UTHA 1TIMA 4WIWA 5H2ZA 2CLEA 2GDQA 2PDUA 3JS3A 3KTSA 2CEQA 2NVDA 4GVHA 1KFEA 2OCZA 4KT2A 4P5UA 3SJNA 5G1TA 1IT8A 4XZBA 3HTWA 3BWWA 4NL1A 5IBXA 3MW7A 4E8DA 1OYCA 3FOKA 2X30A 4LVAA 4XD5A 3UCCA 3PZ9A 4GUHA 1HGWA 3LPPA 1EFZA 4D6EA 5JMUA 2EO7A 5T9CE 4P7LA 3VGBA 1DHPA 3E6EA 1RBLA 4XV0A 1FWRA 1DIOA 2BY3A 4ML4A 1CWYA 3GH7A 2PU1A 1VKFA 5FEXA 2CLKA 4AXKA 3CQKA 1KBLA 3WQ6A 2D73A 4LANA 1UQYA 4C6EA 4ZQMA 4Q22A 4UFKA 5JQ9A 4B4HA 2CLFA 1QI4A 1X98A 3WF3A 1RA5A 4UUIA 1H7PA 1P1MA 4QJ5B 3Q4DA 4BWLC 2J13A 3POHA 1HKWA 2BWGA 1R38A 4AD4A 4ZQCA 3CWHA 3ZLGA 4YLWA 3O8AA 1E4NA 3TSMA 5A94A 3NCOA 3KBVA 2CHNA 3M0ZA 1VEOA 4NJHA 4P8XA 5JXQA 2AAAA 4UB9A 3TQ0A 3PUDA 2FZBA 4LTSA 1AUSL 3B0PA 2G0WA 1A50A 3PZTA 2EPOA 1Q7QA 4JXCA 1DJIA 3WG6A 2J9XA 2G37A 4P61A 1JCYA 1UUMA 2Y8VA 4X0VA 4WDXA 4DF1A 5TIMA 2A85A 5LYRA 5TQLA 3CUXA 3L66A 3PSVA 1KBJA 3UXAA 4TX8A 4A05A 4AWUA 1XD1A 3TJ4A 3TYZA 1VYSX 4AG0A 2Y85A 2QNEA 3S5ZA 5D4YA 4UCFA 2BXYA 4UTTC 4KCVA 3MUZ1 3W7QA 4JQ4A 1XX1A 2Z7GA 2YYTA 2QUVA 4PCSA 4FNQA 1BG4A 2I1OA 2R14A 1XBZA 3UETA 4XZNX 3SCNA 5B80A 6CGTA 3GNDA 3P74A 1EJWC 1ONRA 3TOYA 4PODA 1H50A 1GVYA 4B5VA 4NKCA 3DFYA 2W67A 1QO2A 2XVNA 3HBLA 5A8NA 1R3YA 1UOZA 4IFRA 4EIVA 1PWMA 2GGHA 4MB4A 1GKRA 3S83A 4WF7A 3R0DA 3ANVA 1DJHA 3PBYA 3LQGA 5T26A 2X40A 1P0DA 4IMEA 4CQCA 3WUEA 3WN6A 3GXTA 4LVDA 1X1NA 1OY0A 2O9OA 3PBGA 3RILA 1KGUA 2ADAA 3WX7A 5XIMA 2VFDA 4QNWA 3ABZA 3ZMRA 1BAGA 1FWWA 2Z1SA 1BSLA 1YE6A 1UB3A 3AS1A 4S2CA 3H7UA 3TN3A 1BF2A 3DI0A 3LGGA 4ICMA 4AC1X 3HO8A 1K8YA 1KBBA 3W2KA 4M82A 1PJ9A 3B8IA 4KS0A 3FKKA 3LNMA 2ZA1A 1Q8JA 4R53A 3HV8A 2ON3A 2GSJA 1BRLA 3W85A 1VPXA 1NWUA 1PDYA 1GQLA 3A4AA 1HKIA 4WJXA 3ZVHB 2QCHA 2P5NA 2BG5A 3QN3A 1K70A 3K4DA 2QUTA 3PG9A 4QISA 4KQNA 3W1XA 3OBEA 5CZJA 3N17A 2NX1A 2NXGA 5FJJA 2OB3A 1ME7A 4BY3A 3AUJA 3WH5A 4UOQA 3A22A 1ML1A 3EKLA 5CH9A 2QXWA 5CJMA 4BQ4A 3QKEA 5C9XA 3S1GA 1OINA 1V3JA 3IV3A 1RY8A 3M0XA 5A6JA 1F2JA 2VZOA 3MCMA 4CD5A 3OLIA 2D2JA 1I75A 4HMCA 1H62A 3R1ZA 2XFYA 3O9NA 3SECA 2G50A 1ONXA 1Q85A 2VEGA 4YYFA 2YFOA 4DJDA 3SBFA 1NDWA 2VKZG 2XIIA 1TA3A 4BHYA 4CD4A 3NQMA 4LYQA 4M3PA 1TIWA 4E4UA 2XDFA 2VD8A 4Z17A 3MUCA 4F0LA 1TV5A 1YW1A 4QSFA 3UU0A 2WHLA 3F5JA 4A29A 3GNOA 4IX0A 4LUYA 4NVTA 1AH3A 3ECQA 1GUVA 3E38A 4WKHA 3SCPA 1RALA 4QAWA 2VYOA 4N6EA 3WJWA 1Q6FA 3CYVA 1TUXA 3D0CA 3OZPA 5ABFB 4HA3A 4ZA0A 3F1QA 3KHJA 1TELA 4HYVA 4E6MA 3DEQA 2VHLA 4PCFA 3PFRA 3CZ8A 4D2JA 3E0WA 4UOJA 4QHRA 4JR5A 2VEIA 2I17A 3NPWA 3AYTA 1AL7A 1IEQA 1EGVA 3B06A 3N18A 4TUFA 2Q01A 3DENA 1POKA 2R8WA 2BDQA 4E2DA 4GJ1A 1JXKA 3KHDA 2NLIA 1MYRA 1U5VA 4V2XA 1HJWA 4GQRA 2HJPA 3NO1A 1UWUA 1S2UA 1SMAA 3OODA 2PD5A 3MSRA 3W82A 2V9DA 1LOQA 1O12A 1AVAA 3VUSA 4YWSA 4J3XA 3JR2A 1V51A 3GDRA 2NX9A 1RVGA 3WQ5A 4UQAA 1MEHA 2BY0A 1MW0A 5JBEA 4H8NA 5G5IA 3CYJA 2WWDA 4DO6A 1V6UA 1EEXA 1E0VA 1V4YA 1H1NA 5CJNA 4X61A 2I5IA 2PDQA 1GQKA 3LHZA 3NQAA 3I68A 4DUWA 2PPGA 3DKJA 4X22A 2BHZA 1ZHAA 2FPTA 3S42A 4KCTA 4W89A 2E25A 2BOGX 4W8AA 2VRKA 4NRSA 3CNYA 2ZX5A 1R6WA 2XU2A 3P0WA 4ZB2A 3APGA 2G3FA 3CEPA 1EP1A 4JTKA 4FNSA 1ZJAA 3GIQA 1PCKA 5C9UA 4ORMA 1G1YA 3AHVA 4AZIA 1XWYA 2UV8G 2BVYA 4W88A 3IGHX 1JF6A 4XIAA 1FCQA 1TCMA 3XIMA 1UHVA 5I0DA 3EKZA 3B05A 1YBQB 3MANA 2Y88A 3IANA 2PGWA 3T42A 4K38A 3AU2A 5EMKA 1QNPA 1YX1A 4XZIA 1V7YA 3H4GA 4QS6A 4LSBA 4QCFA 3IACA 1M5WA 3PBVA 1KM3A 3V5OA 5KZEA 4A3QA 5J5DA 3N11A 4ZBCA 2CPUA 2J62A 3OW1A 4C6BA 1W1B1 3R5EA 1Q7MA 2RUSA 1MFUA 3UY7A 3G0XA 4AYGA 4BQ5A 3W7OA 3L5LA 3FDGA 1TSIA 1DKWA 4YN5A 3STEA 1I2NA 4W7VA 4FF7A 3W23A 4C6PA 1CLKA 1JYWA 3QBUA 1LLOA 1PZ3A 1F6KA 3TYEA 3IJLA 4MJ4A 1P5BA 1HKJA 1EYEA 3AOFA 1NWSA 4FNRA 5DRIA 3BOLA 3LK6A 4QE5A 1JYXA 4O54A 1ZENA 3KP0A 3JW7A 2QVNA 4J1OA 4QE4A 4TV5A 4H4IA 2BNJA 1QT1A 3POCA 3WLOA 3UJ2A 1SQ7A 3BK0A 3WEZA 1QXLA 4K37A 2AGTA 4MUZA 5DCEA 4BF5A 4B16A 3CB3A 3M0YA 3AXIA 1ZS2A 3S0CA 3TVAA 4M1BA 5BYWA 1V0NA 2OPJA 1XFBA 4JIHA 4R7OA 4TXEA 5LSMA 2C91A 3USBA 5DBTA 1DWIM 3VDGA 3EGJA 4PTDA 4WY0F 4AVFA 2QPUA 2W4XA 4AD1A 2XZ7A 3HG4A 4DYJA 3L4UA 2IPWA 3RLHA 4RZBA 1UR2A 4K39A 1MZHA 4CNUA 2QAPA 2VZVA 1EC7A 2F2HA 1E5NA 2VQUA 3E3HA 1P0EA 1UKQA 2OO6A 1XW8A 2R1NA 5C54A 1KQZA 3E1F1 5AFDA 2ZYFA 1OGGA 3PZNA 4PB3A 3M07A 2AMGA 3NL5A 1XFCA 1E70M 3DYMA 3T7VA 3ALGA 2VJXA 1W2VA 2QHAA 3I7RA 2R9RA 4WY0A 4L64A 3KXQA 2PGFA 1XLBA 2V81A 1XR2A 1R47A 2DVUA 1SO3A 2WYSA 1WPCA 2GOUA 4GG9A 3CL6A 3KL5A 4MGGA 5J5RA 1O1HA 2H9AB 2JK2A 3U3HA 4D8AA 1EXPA 1PEZA 5F2GA 1TQXA 4HN4A 2UZ9A 1IQ8A 2PFHA 3NSMA 3W28A 3GC2A 4PBGA 5HQEA 3G1YA 2YKKA 4KIRA 3GG1A 4PFMA 3W53A 3QLDA 2A7RA 3SGGA 3DBPA 3BAXA 3RN6A 3GKAA 1WKFA 3RHGA 1F07A 3L4VA 1IHIA 3R8RA 3Q67A 2WSYA 3M5ZA 4FR1A 4DWSC 1B30A 1IWAA 4EPBC 1IZCA 2ZE3A 4JTDA 3OB8A 2WHJA 4U10A 1ZB5A 5LA1A 1VQTA 3SURA 3XISA 2E09A 4O1CA 3GC5A 1T8QA 5DXYA 1S2CA 3T07A 1XLKA 1EJRC 1I8JA 1UZDA 2DEPA 3BJSA 3ZOAA 2XFWA 4G2DA 2YXOA 3R2GA 1Y5WA 2YB4A 1YKWA 3W37A 4PMNA 3SI9A 3SUSA 1LBMA 1WDQA 2YL6A 3PWGA 4Y2WA 3OJGA 2IXVA 4D6FA 1OYAA 1DIDA 4YVPA 3HGRA 2TYSA 4QXIA 4M51A 3DOPA 4LW7A 1TPH1 1XRVA 4E2BA 4HCDA 2VFFA 4KGLA 4HCLA 2D24A 4N4QA 5HXMA 1XSIA 5BRBA 1CTNA 3GO2A 4EAYA 1J2BA 1HP5A 1OFPA 1DVJA 1H2JA 2I9UA 3ZIZA 1QO5A 3WMCA 4EOUA 2YBVA 1W5PA 3L21A 2F8QA 1QHOA 3P2VA 4W87A 5FAJA 3ZVIA 4S2BA 3MUIA 1BLIA 1WDDA 3D6NA 7REQB 1SM9A 2EHHA 3GFZA 3L0KA 3FJNA 4PRRA 4XKYB 2ZC8A 1Y0EA 4GYPA 2OGJA 1RK6A 2R1MA 4PBEA 4AXNA 2F7FA 4ALDA 1IXOA 2X7WA 4N42A 4PMOA 9XIMA 4D1IA 4IPIA 2DZVA 1CYGA 2DGAA 1J0HA 2DSUA 2WO5A 1R85A 3ERPA 4JX4A 2J78A 1EWDA 1TV3A 1AA1B 1TE6A 2Q3RA 3NDZA 1JZ8A 2POTA 3MCOA 3TYAA 2PCEA 4YCOA 2BGNE 3GY1A 1GG0A 3L12A 2WB5A 3UCQA 1K4HA 3OG3A 3SY8A 1DQUA 3GS6A 4QAIA 4XSMA 4Z1YA 3OPSA 2OQYA 1GQIA 3A9IA 4LPCA 1EQPA 3VD3A 4FO4A 3AZTA 2DJXA 1OCJA 4AH7A 4CN6A 3L4TA 1S5WA 4R33A 2WMJA 1F3TA 1PX3A 5DN1A 5I78A 4B4FA 1A80A 1TVPA 3VOCA 1MXGA 4LAZA 1HTIA 3N2MA 4N0RA 3B0XA 2QCFA 3AJ7A 3MDWA 5MKGB 3R10A 2QQ6A 3MV01 1K7FA 1IF2A 4IPNB 3S5SA 3M1ZA 3RX4A 1FP8A 1CCWB 4L7ZA 4EPDC 3SIMA 1SO5A 4QROA 1U2YA 1C29A 1GK8A 2WNNA 3HN3A 2XVGA 3LTYA 4AY7A 3OG2A 2W6RA 5M1TA 3UWWA 3FYYA 1XLDA 2E9BA 2J7BA 2EF9A 2E5CA 1QI2A 1FCBA 2Y70A 3ATZA 1RJPA 2GJLA 5D9PA 4JEQA 3P8JA 4AD2A 3MI2A 4F3HA 3R43A 1B4EA 1S2WA 3OIHA 3UERA 3QF0A 4XQ6A 1H7XA 3CO4A 1OSEA 1LT7A 1UPMB 2EAWA 1EX1A 1XSKA 3IRDA 4WVXA 3TTEA 3TYDA 3W7KA 2VEKA 1WO2A 3R94A 4PB5A 4MWAB 4CQDA 2ESCA 2XZ9A 3LHTA 3VNKA 1YTDA 4Y90A 4J5NA 5EFDA 2NWRA 3UZZA 2I56A 3GBEA 2GVYA 2DU2A 1QDSA 3EA2A 3H24A 5JH2A 2G3IA 4DI9A 2PWEA 1V3KA 4Q8QA 3FXGA 4KWSA 1GORA 4QRNA 3FW6A 3VE9A 2O9TA 1OQFA 5CBBA 1UH3A 3P84A 1PYMA 4JTSA 3NEVA 4IG2A 4I90A 5HAOA 1RY0A 4S3FA 5F7UA 1JL8A 3LXAA 2PWDA 5GVJA 5F2IA 2HVOA 3VFCA 5U7SA 4HA4A 2OQHA 1QPNA 2OEJA 4FPSA 4LGXA 3B8SA 1AH4A 4IMCA 3S2NA 4ERAA 1WZLA 3A9BA 3WK0A 2WKLA 1Q6LA 3R25A 1EX5A 5C2XA 2ZZ2A 1XIDA 2JGQA 2VOTA 3AWNA 5LA2A 2ATMA 1RBOB 1XH1A 3HPZA 2FJKA 4UR9A 1E3XA 4TR9A 4DBEA 5CQ1A 1DWGM 5IHSA 1GT8A 3BURA 1C8XA 1GONA 1Q2SA 1TZ7A 3BPWA 2X09A 1JDEA 1PIIA 2YDAA 3F03K 1KV8A 3MO4A 4HOXA 1I