3WQ8A

Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
448
structure length
448
Chain Sequence
KFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDAAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLASGFPPGFLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monomer structure of a hyperthermophilic [beta]-glucosidase mutant forming a dodecameric structure in the crystal form
doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Beta-glucosidase
total genus 177
structure length 448
sequence length 448
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wq8A00
5EMYA 3ZO9A 5BXPA 5FIPA 4W93A 2W67A 1JFHA 3MMWA 3IAPA 4GIAA 3ECQA 2FGZA 2O92A 3WQ4A 1NWRA 1OCQA 2WVVA 2VR5A 3WNKA 3CTTA 1HIZA 1P6WA 5I6SA 1V3IA 2GJRA 5C8BB 1F4AA 4NZCA 5GNXA 2OYLA 2J4GA 1I75A 1BQCA 4WF7A 4H8UA 1GJWA 1DP0A 1H0GA 2DT0A 2DSWA 2PWDA 2VRQA 3SCQA 3A4XA 4HOXA 4D6HA 2GUYA 3VINA 3T0DA 1GQKA 4EK7A 2G3JA 5AYBA 1E55A 3U57A 4WKHA 2DIJA 3WD2A 2J79A 4JCLA 4NRSA 2JF7A 1QVBA 1UR4A 1BGGA 1KXQA 4UQAA 3K4AA 3IJ8A 4RE2A 3UG4A 5JUVA 2XFRA 3FHQA 1OBAA 3PZGA 2WVUA 5E0FA 2X05A 4LQ1A 4UR9A 1O7AA 3WH5A 3B9EA 3L4ZA 4KMQA 3VD4A 4GO9A 1BYAA 3WEOA 1OIMA 4QCEA 3VIOA 4AD1A 1FA2A 1V02A 2YBUA 3ARTA 3WD1A 4AW7A 5CLWA 4WK9A 1XYZA 4H04A 4S3JA 3BAWA 3GYCA 2O9PA 3VU2A 1SMDA 3VGBA 4PBGA 1E6ZA 1WDQA 1VFFA 4UOQA 1VBRA 4MJ2A 4LYRA 2WM0A 1FFRA 2DSZA 4PEEA 2GFTA 5I78A 1W9VA 3AMLA 5A8MA 4PMUA 4W7WA 1CGWA 1UZ1A 4D6EA 1HKMA 3CZJA 3U5UA 3EDEA 4QCFA 3T0AA 1C91A 2WSKA 3CHEA 2DT1A 1XCWA 4XZBA 2ZX5A 3VUPA 1WO2A 3OGSA 5I23A 1HNYA 2DT2A 2GJXA 2IXVA 3WBAA 4HA4A 2WZEA 1VFMA 4OOUA 3D5HA 4CUCA 4TVUA 3TTQA 1E6NA 4AZCB 4Z2HA 3PTMA 1FH7A 2OWXA 3AFBA 3LMYA 4ZE4A 3PZMA 5GNZA 1UD6A 1A47A 3ZR6A 2J8GA 3QHMA 3VMPA 1DWJM 3ZMRA 1LL6A 4F8XA 4BZYA 2J77A 1VJSA 4D6DA 4DM1A 2VQUA 3VDCA 2ZUTA 3NSMA 3VIGA 1HL9A 1ITCA 1OSEA 3AXIA 1ITXA 1W9BM 2VNCA 4JL2A 4AIEA 4OKDA 2RGMA 4J28A 5A8OA 2CEQA 4S3KA 2E8ZA 1NWSA 5A6JA 1X6LA 1PIGA 4UQDA 1E43A 2ZX6A 2XWDA 3L4UA 3GDBA 3EDFA 3DYOA 3MU7A 4P7NA 3RPMA 3PZOA 3K8LA 4MAVA 2V3EA 4PYSA 2D0HA 2Z1KA 1C8QA 1ZJAA 1UR0A 5EBAA 1W1PA 5IFTA 4W8BA 4UFKA 5CJ5A 4JFVA 1UG6A 2XTKA 4LYQA 4J3WA 4ATLA 2GDVA 3CUJA 2Y5EA 4MNKA 1ISVA 2GK1A 4CD5A 4U3CA 2VX7A 1EHAA 3OGVA 3THCA 5D9NA 3PZ9A 2BHZA 2XM2A 1FH8A 1JD9A 3WDJA 4EE9A 2YLLA 1VRXA 2EO7A 4MNLA 8A3HA 5BXSA 1US2A 1OT2A 2FH6A 1AMYA 3HU7A 1JIBA 4H8HA 4KRTA 1WDPA 2WBKA 4ZEPA 1WZLA 1HJSA 5LA1A 4MDOA 1EGZA 3CMJA 4L4OA 1S46A 2J7BA 1WE5A 5A95A 4MNMA 4CD6A 4GQQA 4YHGA 2VCBA 3ZJ8A 5A6BD 2WCGA 3LPGA 4BQ2A 2XG9A 5JIPA 5A8NA 1E6RA 1CXHA 4UQCA 3IANA 3N04A 1G5AA 3BCDA 1ZBKA 1H3GA 4AD4A 3AS3A 1JF5A 3GNRA 3WUEA 3DYMA 4CKQA 1DWHM 2XIBA 5IXEA 3FAWA 2HVMA 1UD3A 1UH3A 1UR9A 3WQVA 1JAEA 3MS8A 3WNNA 3CBWA 2GJPA 1JYVA 2WMFA 3L2LA 3WDQA 3W38A 1E73M 4P7LA 3MUZ1 4UFLA 3SUUA 2XJ7A 4D6CA 3S2CA 3WH9A 3GM8A 5ABFB 3L4TA 2D3NA 3WD0A 1Q6FA 2X0HA 4BS0A 3RILA 1CBGA 4B9ZA 3E1F1 1JNDA 3ARVA 1BFNA 5D9MA 1R87A 2XUCA 1V02E 5CSUA 4F9JA 5CPSA 4X0VA 3WY1A 3WIJA 2JALA 5BWFA 2BHYA 4W8AA 4MADA 1MW2A 2O9RA 4PMVA 3K4DA 3WD3A 2DSUA 3N12A 3BAXA 2UY2A 4PMZA 4U33A 1UWSA 4AZBA 4YHEA 3W37A 3VIKA 1TZ7A 4EANA 2X8RA 2YA2A 3AYRA 4TX8A 4DUWA 3J7HA 5FD0A 1M04A 3WL1A 3AS0A 1HJUA 3ZT5A 1VF8A 3AYSA 1E4NA 4J3SA 4EAMA 4TX6A 5ABFA 3WF2A 3CUIA 3TOPA 2CBJA 3A6OA 1BVZA 2VUYA 4D1IA 2CKRA 1GHSA 2ZWYA 3POCA 4QFUA 2AOSA 2J74A 4B15A 2VURA 5E0CA 3CUGA 1X6NA 3VGFA 4WKFA 2J62A 1NP2A 3WKZA 1GQLA 1HXJA 9CGTA 1GW1A 4CU7A 2V5DA 2A3AA 4CU6A 2Y4SA 1WB0A 2QPSA 1BSIA 3WEMA 4HZ7A 1CTNA 2D23A 4U31A 1DWGM 1UD4A 1NWUA 3CHFA 2V38A 1XH1A 3UEQA 3ZJKA 2YLAA 2VX6A 3AOFA 5AYIA 1KXVA 4FMVA 3TTYA 4AZ5A 4A4AA 3FY1A 3A47A 1VB9A 3VOCA 3VDBA 2YA1A 4PTVA 4U2YA 1WZMA 5I2UA 2G4FA 2WVSA 4JIEA 3VD9A 2WPGA 2CERA 2WANA 2VQTA 4CCCA 1XGZA 1UWRA 3BC9A 4PMXA 1RD6A 2OWWA 2DH2A 1VBUA 1CGVA 1E6QM 1R86A 1E5NA 1CDGA 3BLKA 4FLRA 3UESA 3I3EA 2J7FA 4ZXOA 3UR8A 1KGXA 3SCUA 2IUZA 3BLPX 4QLJA 1W1VA 2X2YA 1DHKA 4PMOA 3OZOA 3WBEA 5DT7A 5DFAA 5IHSA 4AWEA 1H49A 2XYLA 1ZB5A 5I3DA 4OJYA 5FL1A 1KBKA 3MMUA 4XB3A 2VVSA 4UTFA 1BF2A 3WMSA 2WZHA 1BYDA 3NJ3A 5GNYA 5A1AA 2GJXB 2D20A 3EBVA 1HKJA 2D1ZA 5LA2A 2Y8VA 4A3YA 2UWFA 1W3LA 4XZWA 1E6XM 1XH0A 1V3JA 4XX6A 4Z2KA 4TTUA 5HDRA 3MV11 2YBTA 5ABHA 2DH3A 2QF8A 5A6AA 7CGTA 4AD0A 3I3DA 4EKJA 1KCLA 1UD5A 2ZUMA 1KR1A 4CD4A 1ECEA 1OGGA 3CZGA 1TG7A 3AMGA 1E1FA 2E3ZA 3VIIA 1GOWA 1W32A 2V5CA 3BAYA 3CUFA 2EJ1A 1NARA 3G6LA 4NRRA 3EDKA 1HKKA 3PZIA 4PTMA 1BYBA 4M80A 3W29A 1L0PA 2VT0A 4AYSA 1OD0A 5CXPA 4WSJA 2BFGA 5FOOA 2YL6A 3MV01 3VIFA 3OGRA 3AZSA 7A3HA 3K8MA 1J18A 3ARPA 4UNIA 1CLVA 1IT0A 3AMDA 1BHGA 4MB4A 1BG4A 2DSKA 1E72M 1PZ2A 1UKOA 1VFOA 4DUXA 2DDXA 4Z2JA 2GK1B 1W2VA 2QHAA 2BVDA 1ZBVA 5LYRA 2WLYA 4RE4A 3OG2A 5CGMA 4H8VA 1B31A 5TD4A 1HF6A 3WELA 2PWEA 2WNWA 1BAGA 3A4AA 3VGEA 4UFMA 3KL5A 2BXZA 1B90A 5CG0A 3SUTA 1PIFA 3NDZA 2FDMA 5I5RA 1WKYA 4AZ6A 2VOTA 1J10A 2ZICA 3GNOA 3II1A 1QNRA 4C7DA 5DMYA 4MDPA 1DWFM 3DHUA 4V27A 1FP8A 1HT6A 4FLSA 2WHJA 2J78A 1CNVA 5E9AA 4W88A 2VZTA 3TP4A 2C7FA 4TXEA 1UWTA 5A6KA 3VGDA 3DHPA 3PTQA 4Y7EA 3A3HA 1F4HA 4B3KA 3QOMA 1MXDA 1VAHA 1KQYA 4ACZB 4F9DA 3N11A 2DSVA 4PMQA 1PEZA 2Z1SA 1E0VA 4HMDA 3AIQA 3GXIA 2JE8A 3ZR5A 1HJQA 3ARQA 3NSNA 4W5UA 4W84A 2OYKA 2WWCA 3VNYA 2FH8A 2VTFA 3ARRA 1JZ8A 5F7UA 3QHOA 2CNCA 2CHOA 1UHVA 4MAZA 2WMHA 1H5VA 3SCSA 3BGAA 1BTCA 4AEEA 1MW0A 3RM8A 4AEFA 4HPHA 5FL0A 4LGXA 4WIWA 1QNPA 1JDDA 1V6UA 5KEZA 4AC1X 4W87A 1B3YA 4PSRA 2VJXA 4R5EA 3AMKA 4UQBA 2EPMX 1H1NA 1XSIA 2WW5A 4AD5A 3AISA 2DEPA 1B0IA 3APGA 3BSGA 4UFHA 3L4YA 4JKLA 2ZUNA 3AZRA 4JKKA 3AIRA 3W6MA 4DWSC 4LXFA 3HMCA 2BY3A 2CITA 2G8ZA 4MTVA 2Y24A 4U5KA 3AHYA 3POHA 3VDHA 5DEZA 1L8NA 2IXUA 2J7GA 2VCAA 1CXKA 2J7EA 2NT0A 3ZM8A 3MMDA 1W9DM 1C8XA 4DWSB 2WKGA 1E15A 3TTSA 3VM5A 6A3HA 4AZCA 3THDA 1CECA 1UH2A 3FNDA 2NSXA 3WDIA 3ZOAA 3ZIZA 2CKSA 1CGTA 3GBEA 3AHZA 1J9YA 1UWUA 1MQPA 1V0NA 4Z2LA 3VX0A 1EDTA 3BXWA 5BYWA 1GNXA 3PZVA 4B9YA 2WBGA 1KWKA 1OD8A 1MW1A 3CUHA 4D6JA 3VIMA 1R7OA 4W5ZA 2WVVB 2VRJA 3O2LA 3WENA 1UQZA 4GZJA 4PMNA 2FHBA 3AIVA 1FHDA 2XFYA 3IAQA 3W53A 2DPEA 3AZTA 4D6FA 4HOWA 2PBOA 4PRWA 1C7SA 1PX8A 4W85A 3RM4A 1UKTA 2XVPA 4HP5A 1C3FA 4CD7A 4GI6A 4H41A 3T2QA 5CSYA 4AMCA 3RJYA 3N9KA 2W63A 2W91A 1UR8A 4BQ3A 1FOBA 2XVKA 4CGTA 1K9FA 2XWEA 3OLIA 1TE1A 4TOQA 1EH9A 4M81A 3WQ5A 2PWHA 1E1EA 1PZ3A 1QBAA 3A4WA 3BH4A 3N17A 1TUXA 1ODUA 5D4YA 1CGXA 2FGLA 4WSKA 3AIUA 1E56A 4ZFMA 3WUFA 1EIBA 1ZU8A 5A2AA 5A6BA 1HP5A 4OZOA 5GPRA 2E8YA 3WUBA 1WDSA 2V3GA 4CVWA 1CXFA 4P7OA 2VO5A 4UOJA 2QLYA 2XSAA 4JFUA 4GXPA 2WSPA 2G3IA 5A8QA 2X09A 3GZAA 1MFVA 1W1TA 1A3HA 3VD7A 5A3HA 4TVCA 4P8WA 1E3XA 1W9UA 2PC8A 3PBGA 1M01A 3GNPA 2VX5A 3W24A 1CENA 1HJXA 2MANA 1CGYA 1JD7A 1KQZA 4JFSA 1MWOA 1U33A 1JL8A 2BV9A 4WKAA 2ZXAA 2W61A 4PMRA 3EMQA 1B2YA 1M53A 3SCRA 1EO7A 3B8SA 2WC7A 2VI0A 3N13A 1Q6CA 3WFZA 2DT3A 1AVAA 5I79A 2F61A 3KZSA 1PBGA 4P7QA 2E4TA 1W3JA 2W62A 4X9YA 2DIEA 1KR0A 4KRUA 3UG3A 1EDGA 3UCQA 3TTOA 4AD3A 1GOMA 1CXLA 4E2OA 3KEHA 4H7VA 4ATDA 3AXHA 3TONA 2WK2A 2E9BA 5BRPA 3GTNA 2YL5A 3GXDA 3WSUA 5CLTA 1D7FA 2A3HA 4ATWA 1W9XA 1UZ4A 1OWQA 3VIJA 2FHCA 2JEPA 3FN9A 1KB3A 3OLGA 1Q6EA 3PZUA 2WLZA 4AIUA 2E9LA 3QHNA 2F2HA 3WNPA 3SUVA 4W7UA 1PX3A 1D3CA 1Q4NX 1MQQA 3FXYA 4F66A 1WNOA 1E4LA 2ZX7A 1AQ0A 4MB1A 3MUAA 4PTWA 5E6ZA 3O9NA 1WCGA 1CYGA 1ZJBA 2J8FA 3W26A 5ABEA 1EQPA 1FP9A 2ZUUA 2XVGA 2YIHA 5ABGA 1CZ1A 1QHZA 5BXTA 2WXDM 3VNZA 1UR2A 3EDJA 2XFFA 3WMBA 2OSYA 2EPOA 2ZUVA 3PHAA 4PUEA 1ISYA 2PWFA 1ZBCA 2G3MA 1O6IA 1CIUA 1JI1A 3T09A 5A6LA 5ECUA 2D22A 4MNJA 1NH6A 1E4MM 3QR3A 1JZ6A 2Q8XA 1E0XA 3PZNA 2XPKA 4LX4A 4D6GA 1FH9A 2JIEA 4LPCA 3GXFA 3WH6A 3ARUA 2D2OA 2J75A 2F8QA 1QOXA 3PN8A 1HX0A 3WQWA 1J01A 3AROA 1HVXA 3AXXA 5CZKA 1K9TA 2V3FA 3VO0A 1G9HA 1LG2A 5A2CA 2WC4A 3NIYA 2CETA 3SCOA 3EDDA 1VEOA 3ARSA 2X0YA 2UY3A 5GQBA 4CN6A 4Z2GA 3NDYA 1TCMA 5A94A 1B3XA 3CO4A 2VCCA 4AZIA 1TVPA 1KCKA 3G6MA 1GOQA 3EMCA 3KL0A 1RP9A 1JAKA 4UCFA 1QNQA 3WF4A 1EA9C 1MQRA 5I77A 3SCTA 2EPLX 3N1AA 1OIFA 1XSJA 4BA0A 1V03A 1JYNA 1UR1A 1W91A 2W92A 5BROA 2DGAA 4ACZA 1C8YA 3AHTA 2A3BA 2GDUA 3JUGA 1H0IA 1QNOA 1IZKA 1GCYA 3RIKA 3K8KA 3FAXA 5I0DA 2OLHA 1MXGA 4PMDA 1TA3A 3GBDA 3SURA 4KGJA 1H09A 2CESA 2XGIA 2PB1A 3CZLA 4PTXA 2PF0A 4CCEA 1LWJA 4IISA 1UYQA 1UA3A 4J3XA 3KE0A 2NW0A 3RDKA 3RJXA 5JBDA 2E9MA 3PTKA 1ISXA 3VX1A 3VDAA 4CCDA 1TR1A 3GH5A 5AC4A 5A8PA 3OLDA 2J7HA 1GJUA 1H41A 2CBIA 2YKKA 5A6SA 1JYWA 5AY7A 2ZOXA 1V6XA 1H2JA 2VR4A 1AQHA 1JGIA 1MYRA 1NOWA 1NOUA 3F5JA 4PCTA 3UERA 2XHYA 3BCFA 1VEMA 3ZT7A 4C7GA 3K1DA 1V6YA 4J7RA 2EQDA 2XVLA 1EQCA 1K9EA 1V6WA 4C7FA 4PMYA 1ISWA 2BNJA 4RL3A 3CPUA 3T2OA 2A3CA 3WQ8A 1EDQA 5D8WA 2YL8A 5IHRA 3RO8A 1OGSA 4P7RA 2EPKX 3SCPA 1BGAA 3CZEA 2ZXQA 4MJ4A 1NWTA 2YL9A 1XCXA 1V3MA 1CWYA 2W5FA 1J12A 2BVYA 4JHOA 5IFPA 2VRKA 2ZWZA 1QPKA 2JF6A 3WH8A 1E9LA 2WCAA 1C7TA 4TUFA 5IDIA 1UH4A 4X0NA 3D3AA 4CU8A 3DC0A 5D9OA 4U5IA 1JZ4A 3MSDA 2B31A 1NOFA 1JDCA 4KWUA 1JYXA 5JBEA 1GORA 4M82A 3AIEA 1E40A 3WUGA 3PZTA 3ARWA 3VIHA 1BVNP 3AJ7A 1ZBWA 3AMCA 2ESCA 3CZ8A 3DECA 2HISA 1QI5A 2DQXA 1G01A 3W81A 1OB0A 1LLOA 1VIWA 1NP0A 3ZSTA 1XD1A 4URIA 4IPLA 1B30A 1B3ZA 2C0HA 2XGBA 3ARYA 4ML4A 3W27A 5M5DA 5DO8A 3VGGA 2ZXBA 3VM7A 4JHZA 1IV8A 7TAAA 1B1YA 2WAGA 2GSJA 4DWSD 5CPQA 2CXGA 1HJWA 2BY1A 4HTYA 1JXJA 5EB8A 1V08A 3MO4A 2G41A 4M8UA 3NSXA 1UUQA 2VC9A 3UR7A 4PCSA 1JF6A 1B3VA 2QPUA 2WMIB 4P8VA 2WVTA 1W3HA 4AZHA 2UY4A 1MVYA 1GOKA 1E6SM 1KXTA 3CZKA 1EO5A 1WP6A 1LJYA 3IJ7A 8CGTA 4W8LA 1LL4A 3SCNA 4PUDA 2QMKA 2BXYA 3FW6A 3MUY1 4U3AA 4BQ4A 1VEPA 3L4WA 3VKKA 1QW9A 2EXOA 2PWGA 2W66A 2RGLA 3HN3A 5D8ZA 5E70A 1DEDA 2CCRA 4Q7NA 3I3BA 2PBGA 1SFSA 4U2ZA 3RCNA 3PZQA 2ZE0A 4GO8A 4JZ5A 1K6AA 2VX4A 3VILA 3WN6A 4M29A 4M24A 4GZIA 5KZ6A 4DWSA 3O6AA 2A3EA 3W6LA 1QHOA 1RPKA 3BMWA 5C71A 3AHXA 5BXRA 4GPNA 3WEZA 1C90A 4XV0A 4OBRA 5FKYA 2CYGA 4H2CA 1I1XA 2OYMA 1R8LA 2OSWA 1XV8A 1YHTA 4HU0A 2YDRA 1JI2A 3VIPA 4QLKA 1TA3B 3SCVA 3KWXA 4L4PA 1ESWA 3QGVA 5HNNA 4E8CA 1KBBA 1GZJA 2WYSA 2VZSA 1QHPA 2JFEX 1J0HA 1J0ZA 2CPUA 3QOKA 1SMAA 3EYPA 3OLEA 4UFJA 1E3ZA 3FHAA 1XC6A 2NT1A 3CH9A 6CGTA 3VTRA 4UOZA 1VJZA 4N42A 3M6DA 4NF7A 3BMVA 3W4RA 3F5LA 1UKPA 3HJEA 2WWDA 2E0PA 2WMGA 1JZ3A 5E09A 2OWCA 2YJQA 4ZENA 4IUGA 1DWIM 1X1NA 2ZX8A 1Q6DA 2WZIA 5EFDA 3DYPA 1GVYA 3T08A 1UKSA 1OT1A 5CPTA 5DT5A 4UFIA 1JZ2A 1H4PA 1FFQA 3LPFA 4V28A 2BY2A 1VENA 4UQ9A 3WDRA 4A3HA 1QI2A 4ACYA 1UQYA 4N0RA 4WLCA 5M03A 3WL0A 3W82A 3CHCA 4MB5A 3ZJ7A 1WZAA 3NYDA 3GH7A 1HVQA 1GHRA 4ZE5A 4E4PA 1LF1A 1WAWA 1V3LA 4YPJA 1KFWA 4CN4A 4D71A 4J3VA 3WF0A 2D0FA 1E0WA 2EPNA 1KGUA 3AHVA 1WDRA 2Y2WA 1M7XA 3AIWA 1V3HA 1JZ7A 2V3DA 2BVTA 3EMZA 4JCMA 4ZXLA 3VMOA 2UY5A 4JFWA 5BRQA 1CGUA 1TMQA 2E40A 3ZSSA 1GUVA 2ZUWA 2EEXA 4LYPA 1BG9A 2GVYA 1G1YA 3U7BA 3T0BA 2EBNA 4M56A 2AMGA 3LPPA 3NCOA 1J11A 1R7AA 2ZUSA 1V0MA 4MB3A 5LA0A 1CXEA 2FHFA 1XRVA 1UWIA 2TAAA 4B16A 1GQJA 2JIWA 1PPIA 1QW8A 3WD4A 1DWAM 3M7SA 1U30A 3OBAA 3VPLA 1ODZA 2Y8KA 1XYFA 4DUVA 4HMCA 3KL3A 1N82A 1W2PA 2O9TA 1PX4A 3MKKA 2CIPA 1MFUA 1G0CA 1WZKA 1C93A 2BHUA 4UZSA 3MUIA 3CIVA 1R85A 5AC5A 3S6TA 3WNOA 4XUYA 2CBUA 3GXMA 4F79A 4Q22A 3OB8A 3WNLA 4W89A 3VGHA 3ALFA 2YOCA 4HOZA 1U2YA 1GOOA 3VMNA 5HPOA 3ZT6A 1V0KA 1LL7A 2XIIA 3RM9A 2X1IA 1HN1A 1KGWA 3WQ6A 4BCEA 2OSXA 5HOSA 2WKLA 3CLWA 2WHLA 2WB5A 5JBFA 2QV4A 4J3UA 4JL1A 4JAWA 4OIFA 3AIBA 3SUWA 1UA7A 1SR0A 4AIOA 3CGTA 1CXIA 1EHNA 4IPNB 2WHKA 1MW3A 4P8UA 1TVNA 4GINA 1VFUA 3WNMA 3ZQ9A 1PJ9A 5E6YA 4QDMA 3W25A 5M3WA 3U5YA 2WMJA 1XD0A 3UETA 1HL8A 1K9DA 4NSBA 1EOKA 3WF1A 1H11A 3WF3A 2CHNA 1HP4A 4J27A 4WJXA 4FLQA 1J0YA 1GVIA 3M07A 2VMFA 5HXMA 1W3KA 4PSPA 3N18A 5HBFA 4E8DA 1RH9A 2YDQA 3L2MA 1JFXA 1J0IA 1BLIA 1DTUA 2BY0A 4R27A 4OBSA 3N15A 2G3NA 3UG5A 2J7CA 1KWGA 2WMKA 3T2PA 2XVNA 1XHGA 3AQUA 3VVGA 4MPKA 4TVDA 3AS1A 3OZPA 4QP0A 4P8XA 4Z2IA 1WPCA 3CHDA 2CBVA 2D0GA 3MSGA 4PN2A 2VZOA 2QMJA 4IM4A 4AISA 3VD3A 1KXHA 4DM2A 1UOKA 4HA3A 1OGBA 3BAJA 3SEPA 5C70A 4JFTA 1HKIA 4AZ7A 1UD2A 5D9PA 1EOMA 4BQ5A 2VVNA 5CGTA 4BF7A 5HPCA 2C8NA 4OOZA 5A69A 3MANA 1E71M 2AAAA 5BCAA 3WH7A 4TTGA 3RMEA 2VL4A 4D1JA 4D72A 4QAWA 1M03A 4QLLA 1Z32X 4W7VA 3K46A 3BSHA 4FK9A 3U7VA 3OIHA 5JIWA 1YQ2A 4CD8A 1J0KA 2VZVA 1QI3A 3TA9A 1UD8A 2ZX9A 2J47A 2YDSA 3LPOA 1V3KA 1QI0A 3AI0A 5A2BA 3ALGA 4GZEA 4M1RA 4AD2A 3L4XA 3W0KA 4FF5A 1W1YA 1OM0A 2WHMA 1JZ5A 1LQ0A 4W86A 5M17A 4GQRA 4CN1A 3BAKA 1Y7VA 3GH4A 1FHLA 2WCSA 1I1WA 4K68A 3VD5A 4KH2A 4AXNA 4NI3A 1HJVA 4FLOA 4V2XA 3AICA 1JG9A 3F5KA 1G94A 1BPLB 1SYTA 2ZIDA 5CQ1A 1ZS2A 1CEOA 1GPFA 1CPUA 4YN5A 3SCWA 4OUEA 2J25A 3SUSA 3BAIA 2XM1A 1C92A 4HA1A 3IJ9A 3M46A 3WDHA 3OA5A 1CLXA 2D3LA 3ARZA 1E4IA 1QBBA 1E6PA 4J3TA 6TAAA 1GONA 1US3A 4GI8A 3B9DA 1B9ZA 2PI6A 2VZUA 1B3WA 1LWHA 3L4VA 1GOIA 3F4VA 2D24A 1UWQA 2WC3A 3B9AA 4KGLA 2XSBA 1XSKA 2YA0A 3SIMA 1BYCA 1V0LA 4HZ8A 4RE3A 4AY1A 4HPGA 4JKMA 5A6MA 3ZJ6A 1JNEA 1NQ6A 1RP8A 4HZ6A 1V6VA 5DF0A 1AQMA 3WFLA 3ARXA 2O9OA 5EFFA 2JEQA 2BS9A 1JDAA 4D6IA 1J0JA 4GI9A 1EXPA 1Q6GA 1QI4A 1TFVA 4HMEA 4HU8A 1D2KA 2ZXDA 3CMGA 3NUKA 4AZGA 4GKLA 4UQEA 3WMCA 4UZUA 1NM9A 1PAMA 1XH2A 2WMIA 1E5JA 4CVUA 3IK2A 1IZJA 3WDPP 2J7DA 1GQIA 3AS2A 1JXKA 1W9PA 2W4XA 1UKQA 5I24A 1ISZA 1LG1A 5FCZA 1E70M 3W28A 1OINA 1QNSA 4B3LA 1ZL1A
chains in the Genus database with same CATH superfamily
5BXPA 4F2TA 5JU6A 1XYCA 2W67A 3APYA 1JFHA 5H8UA 5F4XA 2R8WA 4GIAA 4J2MA 2P53A 1VP5A 1YPFA 3ECQA 4LCQA 2FGZA 5DBUA 2FPYA 3PM6A 1BXBA 1OCQA 4QGCA 3CTTA 1P6WA 2NVAA 1V3IA 2IQDA 2J4GA 3HA1A 3VKAA 2GWGA 3VCNA 4US5D 1DP0A 2DT0A 3BANA 3BJTA 3NXFA 1DQXA 3M0MA 4OTKA 1XBXA 4D6HA 4DJEC 3VINA 2PDLA 1UUMA 1XS2A 5AYBA 4H9TA 3U57A 1BEUA 2DIJA 3UP8A 2ISFA 2PDCA 1QVBA 5JXQA 4ZL1A 2DIKA 2R1NA 3HJZA 1W6TA 3GHRA 3URNA 3FHQA 3KZPA 2WVUA 3MMTA 4MUZA 1FCVA 4WY0F 2GSEA 2HS6A 2WM1A 2OTDA 3IVUA 3VIOA 3MPGA 1FA2A 1V02A 4ZO8A 5CLWA 2YBVA 1GT8A 3UXAA 4Y9MA 4Z1DA 4TV5A 1PXGA 4MWAA 5I3JA 1VFFA 1VBRA 1I2NA 3L2IA 1X8CA 4RDWA 2OEJA 1UIPA 2QUVA 3I7RA 4W7WA 3CZJA 4BF5A 1ECQA 4FXFA 2VKZG 1IXPA 3S1WA 2PGFA 1W3TA 4XZBA 3S83A 2FMNA 3VUPA 1G67A 2HBXA 1M68A 4QHRA 2IXVA 3WBAA 2IW0A 4HA4A 4AF0A 2WZEA 4ZR8A 4OOUA 5REQB 1ZY9A 2OWXA 3I4KA 5CSSA 1DBTA 3ENLA 4C6MA 3SJNA 1UD6A 3IIPA 4YU1A 1W1IE 3U4AA 4NZ1A 1DWJM 2J88A 4MZ8A 4Z08A 1LL6A 4BZYA 1I2OA 2J77A 3NQ8A 3O05A 1VJSA 3LS9A 4FNSA 2XH2A 2QAPA 4QJ1A 3NSMA 3W70A 2ZRWA 1NEYA 4MMWA 3AXIA 1W9BM 3STCA 3GXPA 3DHDA 1U1HA 5BOFA 5AHFA 3SRHA 1VIZA 4GBDA 3ZS4A 1PIGA 2AQVA 2VFEA 2ZX6A 1HW6A 1LOQA 2PPGA 4L61A 1K7XA 2I5QA 3FGCB 3L4UA 3DYOA 1C29A 2DZWA 3SRDA 3RPMA 3B3DA 1ALDA 3M64A 3B4UA 4MAVA 2D0HA 4GABA 1LROA 1UR0A 1LT8A 4RJEA 5CJ5A 3LQLA 4JFVA 3E6EA 4LYQA 1NJJA 3CUJA 1ISVA 4HIBA 1NFBA 3HTWA 3PZ9A 2XM2A 1JD9A 4EE9A 5LKYA 2EO7A 4MNLA 8A3HA 1VQTA 5BXSA 5CCZA 3JU2A 2DU2A 3CMFA 4KRTA 4Q33A 5FF7A 5RUBA 1SU5A 1HJSA 1S46A 1I8JA 1BKHA 3TKFA 3DIPA 4HSNA 4GQQA 2NV1A 5A6BD 4IMEA 2XG9A 4WZHA 5A8NA 5JIPA 3IANA 3N04A 1ZBKA 3HOJA 1H3GA 5I3GA 1ADOA 3BW4A 4IP5A 3GNRA 4CKQA 4MWAD 1XCFA 2QCHA 2HVMA 1UD3A 4FALA 4F2BA 1UR9A 1JAEA 4V1XA 1FX6A 2WMFA 3OOQA 5E0KA 1HKVA 1IEQA 1A5MC 4N7QA 3UF9A 1X1ZA 3AAMA 2F6UA 1MRAA 3WH9A 2E09A 3BGGA 3L4TA 2X0HA 3RGTA 3S1VA 1RPXA 5D9MA 3RPTA 3VOHA 3S6OA 3QPZA 3PWIA 2QULA 2O9RA 1EF3A 2Q3RA 4PMVA 3K4DA 3WD3A 2Y7DA 3N12A 1FHVA 4O1FA 4N6EA 2UY2A 4FOKA 1UWSA 2R14A 3W37A 3VIKA 2BWGA 4EANA 3LI1A 1ME8A 2X8RA 3AYRA 2PDNA 1ZZMA 1XIGA 1XLIA 3AS0A 1HJUA 5D02A 4Y90A 1E4NA 4PCPA 4J3SA 4TX6A 5AOUA 3W7MA 5ABFA 2CBJA 3NPVA 1GHSA 4EOUA 2J74A 1GG1A 4YTUA 3CUGA 4A2SA 4Z1YA 2J62A 3U6WA 4ALDA 3KAOA 4M3PA 1GW1A 9CGTA 1Z7AA 5KZDA 2QPSA 3JW7A 3QV8A 1R3RA 1BSIA 4U31A 3BSMA 3L5MA 1OFDA 2V38A 1XH1A 3STGA 2YFOA 3SN1A 5AYIA 3C2YA 4FMVA 4A4AA 3RLVA 3A47A 3CWOX 3LGDA 2YA1A 5I07A 3JZUA 4U2YA 2WVSA 3VD9A 1RJQA 3KX6A 4RK8A 5CC7A 1XGZA 3BC9A 4B5NA 4UTWA 1EJ7L 1Z48A 3TU9A 1X1OA 4B90A 2WQDA 3BLKA 4HVXA 2VYOA 1NDZA 3QRHA 2J7FA 4ZXOA 3GTIA 3T0CA 3BCJA 1KGXA 2YX0A 1LT7A 1QPQA 2G37A 2X2YA 1DHKA 4PMOA 4QS6A 4G9PA 5DT7A 3FSTA 4WOZA 2AQOA 1GVSA 2FPTA 3SRFA 3PPFA 3MJMA 4IIEA 4AWEA 1H49A 2C1GA 4HCLA 1OZQA 3H4WA 3O7UA 3FA3A 1BYDA 3EBVA 3TYEA 3D0CA 2NV9A 2D1ZA 3W85A 1NQKA 3C3NA 2Y8VA 2V30A 4MHBA 4XZWA 1E6XM 2W27A 4Z2KA 4QDPA 4TTUA 3NL3A 3ZFHA 1KBLA 3MV11 2YBTA 4E3TA 1SM9A 4HPNA 5CBJA 4GYJA 2JGYA 1U22A 4KERA 4AD0A 4ZA0A 3I3DA 2E7FA 3AXKA 4QE1A 1I9CB 2WNQA 4IMCA 1ECEA 3OW1A 3TZNA 1TG7A 1BKSA 4RZBA 4I5XA 1E1FA 3VIIA 1GOWA 1W32A 1ZP4A 2YCKX 3NR0A 2EJ1A 4YL2A 4XAFA 4X60A 4KBXA 4NRRA 1TQJA 1HKKA 1Y5WA 4M80A 3TXVA 1P1XA 3E49A 1R9ZA 3RAOA 3NXLA 3K8MA 1J18A 3NGFA 1CLVA 4YS1A 4AY7A 4HK5A 3W2JA 1KV8A 4DUXA 5FJIA 1YDOA 2DDXA 4O0ZA 4Z2JA 4G7EB 3ITOA 3H12A 4GD0A 2BVDA 4V1YA 4L6OA 4NU7A 3KRBA 2OB3A 1AD1A 1CT5A 3MT1A 1BAGA 3M7WA 4R7WA 1XBVA 2E5CA 1B90A 3NQFA 1S5TA 3SUTA 2CXEA 5FJTA 1TTJA 3W23A 5HWJA 1QU4A 2ON3A 1K7FA 4FLSA 1Z8AA 1U83A 2C15A 4W88A 2BODX 2DZTA 3UT0A 4A2RA 4JN8A 3HMJG 1UWTA 5T9CE 2VP8A 3VGDA 3DHPA 3PTQA 4X2RA 1W5NA 1EJVC 3FJ4A 1VAHA 1KQYA 3QH2A 4ACZB 4F9DA 2OR2A 3WO8A 4KFNA 4NIRA 1E0VA 4PUKA 3AIQA 1IWBA 1GVOA 1OG6A 2JE8A 4BF9A 3M0ZA 1WKFA 2DZSA 1RK5A 3CQJA 4HBKA 3QKZA 3NSNA 1AMKA 2FH8A 8XIMA 1W54A 3FXGA 2VTFA 3M6YA 5F7UA 3QHOA 3V1HA 2CNCA 5C6MA 3W1NA 4H19A 5AYYA 1MW0A 3B0VC 2VGBA 4YYFA 4LGXA 2Q6ZA 3TYCA 1JUKA 3DFQA 4MGGA 7XIMA 3AMKA 2XGZA 3ZZ1A 1MNZA 4LVDA 3SIZA 4GHRA 2EPMX 1X98A 2HMCA 1CB2A 3W2KA 3G1RA 1RALA 4IXHA 4RNHA 3TC7A 3TW7A 1Q6OA 1H5YA 4AD5A 4DLFA 4YXGA 3APGA 3C52A 4Y9AA 4IQDA 1QRQA 1P0EA 3ES8A 3EPOA 1SFLA 3W1MA 3FV9A 4DJDA 3KBMA 3NA8A 2G8ZA 3WLIA 5BNKA 5G4WA 1A3WA 4LUSB 3UQNA 2C79A 4A3QA 1P5BA 2J7GA 3TIMA 3RR4A 2VCAA 3DGBA 2NT0A 3ZM8A 4WDWA 4XZMX 3QYQA 4GYFA 1W9DM 4GACA 4EWJA 3TK7A 1QJWA 1E15A 3VM5A 3MI2A 6A3HA 4TR9A 4PZVA 3KS5A 2CKSA 4A3RA 1UWUA 5AYXA 4Z2LA 4C6DA 3CH0A 3A3WA 1GVEA 3LCWA 4CQ8A 1KWKA 2WBGA 1MZRA 3VNJA 3GFZA 2FVMA 3IS4A 3B04A 2VRJA 3N2BA 4XVEA 3WENA 1H7OA 5AHLA 1GGOA 1SUXA 4PRWA 1FWGC 1C9DA 1PX8A 4W85A 3EX3A 1UROA 1JR1A 1UKTA 3IUHA 2I1OA 1DJWA 3W7KA 2X30A 2NQZA 2W91A 2GVJA 5K9XA 5KSWA 3A22A 4LBRA 4HPJA 4CGTA 1TPC1 4IX0A 3BVJA 4M81A 3WQ5A 3SQMA 2OJPA 2BVWA 8TIMA 5EL1A 1IXNA 3K1GA 2AGKA 2OT1A 3OJGA 1A5NC 3PBUA 2WJFA 3GC2A 4ZQOA 1M3UA 2G5WA 4CVWA 4O18A 2BZNA 4JFUA 1AH0A 4C90A 1RK6A 5DCBA 1A3HA 3VD7A 5FF0A 3EOLA 1W9UA 1H7NA 3PBGA 5CZ0A 5HMEA 1CENA 2G97A 2MANA 2VFIA 2NXHA 4WKAA 4MWAE 3O63A 4OUIA 3SCRA 1ZFJA 3B8SA 2ZVIA 2WC7A 1MUMA 1R2TA 4YVPA 3WFZA 1AVAA 5I79A 1PBGA 1DL3A 4P7QA 4DNMA 4JN6A 1W8GA 2W62A 2OCZA 2J6VA 3TUUA 2DIEA 3E9AA 2BGQA 3UG3A 4XIAA 3A64A 4IQLA 4B5XA 5HMSA 4C60A 3TONA 2WK2A 1RQHA 3GTNA 2YL5A 2GWNA 1D7FA 1W9XA 4JEJA 1WDDA 1OWQA 1FTXA 2JEPA 1D8WA 1IT8A 3QHNA 3U8GA 2YCLB 3WNPA 4W7UA 1R30A 1ZSXA 3W88A 3GDRA 3OTRA 1Q6QA 1BD0A 1WNOA 3Q58A 1DXFA 3F03K 2IQTA 4MB1A 3BW3A 5HNUA 1CYGA 4E4FA 3DFNA 3W26A 5ABEA 2C1IA 3S1XA 4QG8A 1FWCC 4NJIA 3IJQA 4DBWA 2YW4A 5ABGA 2YIHA 3N2OA 3W87A 1CZ1A 3KS6A 2ZZ5A 1UP0A 2F38A 4JIHA 2INEA 3U2EA 4Q4KA 4Z0SA 2ZUVA 3BARA 1SPQA 3PHAA 3ZVHA 3GW3A 5EKYA 1O6IA 4K39A 4LB3A 1K77A 1NDVA 1E4MM 2G96A 3VKCA 4DUOA 3SAZA 1ADDA 3GXFA 3W2MA 4MKVA 3M0HA 1W17A 4FSAA 4JQ2A 1HX0A 1P0NA 4OV4A 1KM6A 5T26A 2BDQA 1HVXA 3AXXA 5CZKA 2PDMA 1K9TA 5HWNA 3OQ8A 3CT2A 5A2CA 4XD3A 2CETA 4H7ZA 2Y7FA 3IJIA 1VEOA 2X0YA 4H9VA 1ME9A 5T9BG 4WGXA 1DV7A 4BKNA 1KTBA 3KVJA 1B3XA 2D2HA 1V5XA 5BMXA 1TVPA 2ZRUA 3V5OA 2V82A 4R9XA 1XLDA 1QNQA 1EA9C 6REQA 1LLZA 3YPIA 3QV9A 4BA0A 1M7JA 2PDXA 3S9ZA 2I57A 2QDEA 1W91A 5BROA 4MKSA 4ACZA 3AHTA 1DORA 3LBOA 2XH7A 1H0IA 4QJ5B 3K8KA 3HGRA 5I0DA 2OLHA 4M1BA 3KBVA 4EPDC 1ICQA 4EWND 4C6FA 2CESA 3E74A 2XGIA 4BI6A 4BK9A 1RAKA 2PF0A 4CCEA 2ZZ3A 1UYQA 4MZYA 2QT3A 4J3XA 4CEUC 4ZTYA 5CG7A 3IACA 1UB3A 1P7TB 2GGEA 3MJYA 5HR7A 1HFBA 1JPMA 5G1YA 3WZ0E 1TJ2A 1W3IA 1DXEA 4CCDA 4DF0A 3GH5A 4K7VA 3OLDA 1BQGA 1GJUA 2J7HA 2YKKA 5A6SA 1JYWA 4LBUA 2D2JA 3WBXA 4LFYA 3M5VA 1V6XA 1MXSA 1B3OA 4H6RA 1P0BA 3ME3A 1JPHA 3KDNA 1V6YA 3E02A 3UPBA 2V5JA 5FACA 2EQDA 3CV7A 3G1SA 1XYAA 2XVLA 4FB7A 3CPUA 4YCOA 2A3CA 5D8WA 2PURA 5DMMA 2YL8A 1EJTC 2E6FA 1OGSA 2EPKX 3WJWA 3V36A 3CZEA 2YCEA 4UBPC 2G50A 1O5RA 2A2IA 3GIPA 2E25A 2AMXA 3DESA 2JF6A 1FWBC 3WH8A 1E9LA 2WCAA 1C7TA 4X0NA 1X96A 2PRMA 3D3AA 4S3EA 3CXOA 1AW1A 1J5SA 3URQA 4HB7A 1JZ4A 3MSDA 3CIWA 4BHYA 4UCGA 2NZLA 3MKCA 3H26A 5JBEA 1KM5A 4LUIA 3PSVA 1UUOA 3LTYA 3WMLA 4NXKA 3WUGA 4QITA 3VIHA 5XIMA 4AQLA 1M6JA 1RSCA 3DECA 2XN1A 2VD9A 1LRNA 3CQ0A 1F6KA 2HV5A 1VIWA 1MZHA 3ZSTA 1RCQA 1YW1A 4N9CA 4URIA 4DIAA 2XIJA 1XFBA 3VXGA 3ITCA 2ISWA 4RCXA 1FCUA 3K4WA 3VGGA 2C91A 3VM7A 3C0QA 3NQCA 1B1YA 2WAGA 4ERIA 4QEHA 4DWSD 2CXGA 1EPXA 3CAWA 3PY2A 4HTYA 3W9ZA 3GVRA 2GVGA 1IXOA 3B0UX 1C9WA 4Q7IA 2VC9A 2R1LA 3THQA 3GSMA 3UR7A 1YE6A 3EPNA 4AFYA 2WMIB 3QPYA 2XINA 4P8VA 3UZ5A 2WVTA 4WEVX 1W3HA 4AZHA 1JCJA 2UY4A 2B7NA 2B7OA 4B5UA 1ITUA 1ELSA 8CGTA 1LL4A 3TV8A 5CPLA 2PLCA 3FW6A 2FZ8A 3N4AA 4U3AA 4BQ4A 3TQPA 1ME7A 4LVAA 4EP8C 2EXOA 4DX3A 3A24A 4LUTA 3NQAA 2RGLA 3O8AA 1ZLPA 1DEDA 3VKDA 4Q7NA 4Y8FA 1SFSA 4EF9A 1Y5VA 1K6AA 3VILA 3FOKA 1G7VA 5KZ6A 5E93A 2J66A 3O15A 2A3EA 2IPWA 5BXRA 1PCKA 1Q2SA 4ADUA 4J9JA 5FKYA 4H2CA 3M5ZA 1M7PA 3SR7A 2YDRA 3V1PA 1SQ7A 3OVQA 4QLKA 1TA3B 1LORA 3QGVA 5HNNA 1GZJA 2WYSA 4S3BA 2VZSA 1QHPA 4QXIA 4JICA 2ZKMX 1SMAA 3OLEA 2D73A 4PFHA 1E3ZA 3FHAA 3MBDA 3VNLA 3WJZA 4IPIA 1LCOA 1VJZA 4JYDA 1VHCA 3C4UA 3P5YA 3F5LA 3K5XA 4G6CA 2OELA 4UIOA 4IUGA 2RJGA 2CLIA 1K03A 3PJUA 3AU6A 2GQ8A 7TIMA 2ACUA 4EACA 1KFCA 4HYWA 3L66A 3T08A 1OT1A 4HHMA 5DT5A 4UFIA 1H4PA 3W7HA 4CNTA 1MO0A 2BY2A 4CNPA 3LI0A 1PSCA 4UQ9A 4KFPA 2G95A 1NAL1 5HNRA 3GLCA 3GUWA 3D6NA 5M03A 4WLCA 2RKXA 3FCPA 4US6A 3V75A 2P50A 3G1DA 5EBUA 3GH7A 1GHRA 4E4PA 1LF1A 2PA6A 1WAWA 1A3XA 4H3DA 3W75A 4J3VA 3N6JA 3LCXA 2ZA3A 1WDRA 2OO0A 2Y2WA 3PVFA 3ISIX 3A5VA 2OZ0A 3VMOA 1DE5A 3KVLA 2WJZA 3V0UA 4HHPA 1VFTA 2PDYA 1GUVA 4D8ZA 4S23A 3A23A 2CC0A 4LEQA 2AMGA 4H6EA 5K3VA 1J6PA 2FHFA 2QDDA 1UWIA 4A8NA 1GYLA 1GQJA 2JIWA 3LEPA 1AODA 1DWAM 4CEXC 3EWBX 1U30A 3DFOA 4IZGA 3WFAA 4LANA 1LRTA 1J6OA 2I9EA 3QQ0A 2O9TA 3S1GA 1TELA 2CIPA 4RLIA 1G0CA 2ZC1A 3HZ3A 1NF0A 1R85A 4EF8A 3V16A 3WNOA 1UOZA 1ZRQA 2GOUA 3GXTA 4HNOA 3VOGA 1H61A 3WNLA 1TTIA 4NAFA 4W89A 1YIXA 3ALFA 3LTPA 2EGZA 1U2YA 1GOOA 4GBUA 3N4EA 4NNAA 1U5JA 3M9YA 3UR2A 1DJGA 3CT7A 3RUBL 1H1ZA 5MF5A 1ZALA 4GUFA 3WQ6A 5JVLA 3U2OA 5HOSA 3W1LA 1YBQB 3ZVIA 3UWWA 1OABA 1PV8A 2QV4A 4OIFA 3H21A 3SUWA 3C8NA 3NO1A 3GFXA 2QCFA 2QNEA 1RHCA 4IPNB 1MW3A 1LBLA 4GINA 3ZQ9A 3QY8A 4QDMA 1XF0A 1O5XA 2WMJA 1GKRA 2V2CA 2Z0IA 9XIMA 1O68A 2WO5A 4UMAA 1H11A 2HVNA 4J27A 1J0YA 4GVHA 2VMFA 4PSPA 3N18A 3QZ6A 4S1FA 3T6CA 4E8DA 4JIRA 3TA6A 1O66A 4LVBA 4G1NA 1JFXA 1J0IA 2YCIX 3R0UA 2YR1A 3PJXA 3EOUA 3TC6A 4OBSA 3MA8A 2G3NA 3CJPA 2WMKA 4HJFA 3CPRA 2Z29A 5CH9A 3AQUA 3UXDA 1JCMP 2ZDRA 4ICCX 1A5OC 3T4WA 1PKMA 1Q66A 4P8XA 1X8FA 1PHWA 1NF7A 3TW6A 4Z2IA 3MP4A 4DN1A 2PP1A 1MMFA 2AL2A 1F61A 2OQLA 2OQHA 2QV5A 1YPXA 2PEVA 4F0SA 1KXHA 2AGTA 3VNKA 1L6FA 4X2PA 4YYCA 4WDUA 4AZ7A 2QUUA 4E5TA 3FLUA 5D9PA 1KTNA 4QM1A 4BQ5A 2VEIA 4BF7A 2C8NA 4OOZA 5SWUA 2YFNA 4DBDA 3WH7A 4I7UA 2P8BA 3H2NA 4GH1A 1Z32X 4IL2A 1BXCA 3H23A 4AWTA 3KOXA 1OADA 3ONCA 1QI3A 4LU0A 3LPOA 1V3KA 1QI0A 1YNPA 3PB0A 1F07A 4GZEA 4BEQA 1Q65A 2OZ3A 3L4XA 4XD4A 5MKGA 4JTQA 2BLEA 3GXNA 3IGSA 3N6QA 1LQ0A 4GQRA 3KHDA 3BAKA 1G4EA 2PS2A 3TH6A 3K2GA 1FRBA 1FDYA 2PFHA 4K68A 4IIDA 3VD5A 1KKOA 4A6GA 4RXGA 1KV5A 4V2XA 1W3NA 3WQOA 3L67A 1G94A 3TYUA 1BPLB 1SYTA 2DUXA 3MY9A 4C6EA 4JOMA 3O1NA 3R4IA 4YN5A 4IP7A 3SSJA 1WX0A 3SECA 3PG8A 4HA1A 4NXSA 3OA5A 1H7WA 3GKAA 1E4IA 4NZ3A 1QBBA 3IRSA 4J3TA 1GWJA 5J04A 1B9ZA 2PI6A 2VZUA 1Q6LA 3F4VA 3R5EA 2WC3A 3BGJA 2XSBA 2EHHA 5DCDA 2YA0A 3EB4A 4RDVA 1V0LA 1BYCA 3PP7A 5G2IA 3QEZA 4RPQA 3DOPA 4XSLA 3ZJ6A 1YNQA 4B5VA 3PPCA 2OVLA 2JEQA 2BS9A 1XKYA 4IGMA 1QI4A 5I3KA 1JCXA 1TFVA 1EUNA 1OC5A 2Y88A 4GKLA 3WMCA 4UZUA 1NM9A 2CLMA 2BMBA 1IZJA 1Q5MA 1OZMA 1GQIA 4I8YA 1ISZA 1LG1A 1E70M 1IEIA 2GPTA 3W28A 1OINA 1QNSA 4HJWA 4B3LA 1QPRA 1ZL1A 1KFKA 6PTDA 5EMYA 4W93A 5HUPA 2OX1A 3IUIA 4O1AA 2H3BA 2O92A 1M9HA 4C1LA 5GJPA 1XGDA 3WNKA 1HIZA 3GTXA 3BOLA 1F3EA 1FQ0A 4PRRA 5FJOA 1MNSA 1ITQA 2OYLA 3STPA 2F84A 4HU4A 2A7PA 4WOQA 1KNWA 3QY6A 1GJWA 1OFEA 1H0GA 2Z4GA 1QOPA 2Z2BA 3BZJA 4HOXA 1DJZA 2ICSA 1ZQ5A 2PTDA 2GUYA 1EC8A 2G3JA 2J79A 1XIFA 3ZLGA 4L1XA 4RX0A 4C91A 1KXQA 4PE8A 3IJ8A 1QW7A 3MHGA 4I9MA 4UR9A 3SFWA 4GO9A 3MCNA 2XIQA 4QCEA 3ERPA 4WK9A 1XYZA 4E6MA 3BAWA 4IICA 4GYPA 4KFOA 3GYCA 4XAPA 3TTEA 3U3HA 3RR1A 3T44A 1FDZA 3VU2A 1OFQA 4PBGA 1Y5XA 1YX1A 1V4YA 4MJ2A 1ZUAX 1TUFA 4LYRA 5AHEA 2WM0A 4L9XA 1EZWA 1LRQA 5I78A 1W9VA 4UTTA 4Q8VA 5CSRA 4PMUA 3SY1A 5D09A 3T0AA 2PD9A 1LYXA 3FDKA 1XCWA 2ZX5A 3REQB 5M2FX 5I23A 2Z1VA 4LC8A 2V81A 5CBBA 2OLSA 4RV8A 2GJLA 3VDGA 3TTQA 1A5LC 4AZCB 4Z2HA 1FKWA 2NX3A 4ZE4A 3PJTA 5GNZA 1XYLA 4PULA 3NOEA 1H63A 3QPEA 1PDYA 5HJYA 1EEPA 1EWEA 4LAOA 1ZAIA 1EXBA 3O6DA 2VFGA 4LALA 2VQUA 4M51A 4H8NA 1P48A 1HL9A 1ITCA 2H8XA 1WKEA 1TWDA 3LLXA 4GG9A 4OKDA 2RGMA 3WLJA 1DTNA 4TU1A 3PNZA 1UP2A 4L6DA 1X6LA 3H6OA 1DJYA 4UQDA 2H90A 2Y5SA 1XQLA 3E38A 1S5MA 2XWDA 3TNBA 1R9YA 3GDBA 2QW5A 3DX5A 3HM7A 2QGHA 1KTCA 4CCZA 4IFRA 2Z7KA 4AF0B 1IEXA 1C8QA 1ZJAA 4FA3A 5EBAA 1KA9F 2QKFA 2ZBTA 4JTIA 4UFKA 1OJXA 1PKYA 3NQ2A 4ATLA 4XD6A 4BR1A 2GK1A 3NGJA 4U3CA 2YXGA 1Y8BA 5I7GA 2BHZA 4RE0A 5FAJA 1SJBA 3GO2A 1UZDA 3HU7A 3UYCA 1WDPA 4ZEPA 1AA1B 2XFWA 5JMUA 1EGZA 3CMJA 3HB9A 3H54A 4O17A 1WE5A 5A95A 3W2UA 3KBJA 4CD6A 3HO8A 1BTMA 1YE4A 5U4NA 2OMAA 2TMDA 3LUTA 1E51A 3G1FA 3W1RA 5EMMA 4K1GA 4BQ2A 4B5TA 4UQCA 3W3OA 1WBHA 2PTWA 1G5AA 1FWSA 1TVLA 4AD4A 1JF5A 2MUCA 3DYMA 1DWHM 4IT1A 5IXEA 2F6XA 1Q6RA 3WQVA 1RBLA 3C0SA 3SY5A 1L6GA 3BQ6A 2GJPA 4NJKA 3GAKA 3OIXA 3L2LA 2E67A 3HIJA 2HRWA 1XQKA 4NKCA 3RPDA 3W38A 3QC3A 4P7LA 4N6FA 4UFLA 3T8QA 4GVGA 3GVGA 4NZ5A 4RKAA 3RU6A 2DQWA 3GM8A 3QW3A 2D3NA 1BRLA 1Q6FA 3H2AA 4ORIA 3RO6A 3RILA 1I0DA 2G4JA 3E1F1 2C19A 2GGJA 4XQ6A 3CS2A 3UFYA 1R87A 2XUCA 4F9JA 1SW7A 4IPPA 4X0VA 2JALA 4R3UA 4MADA 1KLYA 4PB4A 1W5OA 4Y9PA 3P84A 4N02A 5IBXC 4AZBA 4UTLA 1M04A 3TFXA 3ZT5A 5CEWA 2NXIA 1DJXA 3CUIA 3HV8A 1BVZA 5DCEA 2CKRA 5BU6A 4QFUA 2QAFA 3UPMA 1ZAHA 5E0CA 3RX4A 1G6CA 1OC7A 4HNNA 3TOYA 1NP2A 3GDTA 1GQLA 4JDYA 2V5DA 2EG7A 3WX7A 4Z1AA 3QC0A 4F2UA 4OQVA 2Y89A 3EAUA 5AHNA 2Z26A 1YKWA 2BB0A 1EFZA 3TTYA 4R7OA 4FXRA 1VB9A 5DXXA 3VOCA 1HL2A 4C1NA 4PTVA 1WZMA 4JIEA 3W72A 1JCTA 2WANA 2ABBA 4ML9A 2VQTA 4AHPA 4CCCA 3FJ6A 1AG1O 1UWRA 3M41A 4A8RA 3NAVA 1VFSA 3W73A 3LN3A 2DH2A 4Q8UA 4UMBA 1TWWA 2D69A 2X41A 5C0QA 3S3GA 4HYVA 1GJPA 3I3EA 3UR8A 1Z6KA 3IIVA 3I6TA 4QLJA 4DJDD 4W9TA 5TNVA 1Q8AA 4QE5A 3W1QA 2BASA 4XUGA 4F3HA 3WQCA 5IHSA 2XYLA 4OJYA 3V4BA 1KBKA 1BF2A 2WZHA 2D20A 3N2MA 4XISA 2OQYA 1W3LA 3A9IA 4C65A 1V3JA 1NIUA 2VDIA 4C6NA 5HDRA 1IQ8A 3W7GA 3GVVA 3UGRA 4MPQA 3VI2A 4CQDA 3IRDA 1IEWA 5A6AA 3VK5A 3KOFA 2ZUMA 3QVQA 4Z0JA 3NO5A 3OU8A 3AMGA 4H6KA 1X39A 5AYZA 3CUFA 3URBA 2ZFAA 5LXXA 3G6LA 3PZIA 3GG1A 3H55A 1O4UA 2Q3OA 2BG5A 1L0PA 4AYSA 2FJUB 1TPVA 1PHQA 4Q4SA 5FOOA 3VIFA 4XD5A 3WQPA 3QW4B 4UNIA 3RCYA 1QAPA 5D30A 3OO2A 4MB4A 3N4FA 2CLHA 4NNBA 2DSKA 1PZ2A 3QSTA 2C13A 1LQ2A 1W2VA 1NFPA 4FX8A 1GKPA 1ZBVA 5LYRA 4RE4A 3WK0A 1P6BA 1IR1A 2FB3A 3LU2A 3NURA 3COTA 5CGMA 5I3IA 4JDBA 4PBFA 4H8VA 5TD4A 1J4EA 4BI5A 3A4AA 2L5HA 3PUDA 2TRSA 3AC0A 1TX0A 3N2XA 3SQSA 4AU0A 3NDZA 4IOTA 1WKYA 4O10A 4AZ6A 1J10A 2NQLA 3PWAA 2CU0A 4PB5A 3UXKA 3II1A 1QNRA 4C6QA 4C7DA 1EJRC 5DMYA 4MFEA 5F1UA 1CNVA 2VZTA 3TP4A 3HQOA 4WHBA 2PDWA 2QCGA 3CWHA 5HMDA 3P80A 4Q6XA 1NDWA 2YGYA 3A3HA 3FEMA 1V7AA 4B3KA 5I09A 3M0LA 4DO5A 3W6YA 4C6IA 1I45A 4GIEA 3TXZA 3RLGA 3KRSA 2I17A 3CV6A 1A49A 3VNYA 5H8PA 2GGGA 1YYAA 5BOOA 1PYMA 3USZA 1QK0A 2YCJA 1D3HA 1UHVA 4RZ5A 3TAKA 2WMHA 3WLQA 1BTCA 3WK2A 4JTLA 1Z42A 2E5BA 3DH7A 3LRLA 3H22A 4YWSA 4F48A 4AC1X 4W87A 3LCHA 3UBPC 4V33A 2VJXA 3ELFA 4R5EA 2B7PA 2DZVA 3M1ZA 1FWHC 1DYSA 1OF8A 3E2QA 3M16A 1H1NA 1XSIA 2DVXA 2WW5A 1VLIA 2NUXA 2YZ5A 4JKLA 1TZZA 3VCRA 4FIQA 3HMCA 2CITA 3AHYA 2UBPC 4B4HA 2IXUA 1DIOA 3NQ6A 1CXKA 4OGZA 1W1B1 1OFOA 2CZ5A 3MMDA 3RXZA 4DWSB 2QJJA 4JXCA 2IKGA 4AZCA 5FJPA 1W1ZA 3FNDA 3NQEA 1XRFA 3R13A 2TYSA 1EYEA 3AHZA 1J9YA 2QZRA 1V0NA 1OEPA 1YTKA 3GTFA 1JCLA 5LIWX 1Z3NA 3MP3A 5BYWA 4CNNA 1GNXA 3PZVA 4B9YA 4LUJA 3TMLA 4D6JA 4B4FA 1A5AA 3V5FA 4DJFD 1R7OA 5DY3A 2PZ0A 2WVVB 3PAJA 4RDYA 3T42A 4O50A 1UQZA 1EL3A 3AIVA 4D6FA 3W53A 5HATA 4HOWA 3VOJA 1DPMA 2E5DA 1O1ZA 5HQMA 2E28A 3VE9A 3OVPA 2ZA2A 3T2QA 5CSYA 3N9KA 2IS7A 4DO6A 5C55A 1UR8A 4BQ3A 3W7CA 3W01A 3OLIA 1TE1A 1EH9A 1PIIA 2IKJA 1XBZA 4XZHA 1EYWA 2PWHA 1E1EA 4O15A 1PZ3A 3KWSA 1HG3A 4ENLA 1TKKA 2ZVRA 1DXIA 1K8YA 1TUXA 3HQNA 5DANA 3T9PA 3UWEA 4WSKA 4F0HA 3NNTA 1WBJA 3TROA 2H3DA 5AC7A 3WUFA 3BMXA 1Q85A 4B2DD 1FWAC 2Y5JA 2QQ6A 5A2AA 5KZMA 4I8DA 1WDSA 4P7OA 2VO5A 4UOJA 4JTDA 3WLSA 3V35A 4GXPA 3ZXWA 3GZAA 5A3HA 2Z6JA 1E3XA 2PC8A 1M01A 1QWGA 2VX5A 1XJBA 2JQXA 4O11A 1QMLA 1CGYA 3C8FA 2YSWA 3KOWA 1PZ0A 3IJ6A 4L65A 4XO7A 2ASHA 4GKTA 1M53A 3GR7A 1TIMA 2VI0A 4LC6A 1V79A 4O28A 2F61A 1E9ZB 5AZ0A 2HPMA 2E4TA 1XR2A 3SN0A 5JH1A 1XIEA 4X9YA 1KR0A 4Z1CA 3UW6A 1EDGA 1YXYA 3UCQA 4LS1A 5LNVA 4AD3A 1IF2A 1UR3M 3KEHA 4H7VA 1EGMA 1CW2A 4MY8A 1XXXA 4O4WA 3WSUA 4CNSA 3LY0A 4NNCA 1IIHA 3EXTA 3QXBA 4MIMA 3S47A 3R10A 1BRLB 3VIJA 1KB3A 1B4KA 1ONEA 4AIUA 4WR3A 4XZNX 4FNPA 2E9LA 4PTNA 2F2HA 5GJMA 3RRXA 3HG5A 4C5ZA 1Q4NX 4QR6A 4F66A 3IIOA 5FESA 1E4LA 1KRMA 3ATYA 3OYXA 3MO7A 3WLNA 4PTWA 3MKVA 5E6ZA 4DAIA 3O9NA 2DY3A 3LGGA 5D2VA 2Z00A 2W9MA 1EQPA 2OZ8A 3HGSA 3I6RA 4ZSTA 3GTHA 2H6RA 2B81A 3HFTA 2WXDM 3VZXA 1UR2A 2VC6A 4NYUA 3WMBA 3W84A 1SJCA 2CLFA 3KCOA 1GZGA 2Z1BA 2PWFA 5EMUA 1ZBCA 4PL2A 3T09A 5A6LA 4MNJA 1TV7A 1NH6A 4HNTA 3QR3A 3UJRA 4R88A 2FJKA 3PZNA 3ONBA 4OV9A 2R91A 5KTLA 2D2OA 3G0UA 4YLWA 1Q7ZA 1TWIA 4ZVJA 1QOXA 3PN8A 2IPJA 3LD5A 1AQFA 3CU2A 1A0EA 3WLHA 2V3FA 3B8DA 1EP2A 3VO0A 1LOSA 3QGAC 1LG2A 3A12A 5CBIA 4LV9A 4ONVA 4KQNA 2QJMA 4G5DA 4CN6A 4JTHA 4S39A 3NDYA 6ALDA 2I5GA 3CO4A 1XDLA 2VCCA 4AZIA 3LYEA 4JTUA 3NM3A 4UCFA 4JQ4A 1RBOB 3B9NA 2PDJA 1MQRA 5A8GA 3RX2A 2RDUA 3DG3A 1A5SA 5JQ9A 3HPFA 1XUZA 1K02A 2A3BA 2GDUA 4YVXA 2O7SA 3UY8A 4DHGA 1IZKA 1GCYA 1JQXA 1KO0A 5E5CA 1MXGA 4PMDA 3ZVHB 3ABRA 1TA3A 3GBDA 4PODA 1OYBA 3LXAA 1H09A 2ZE3A 1VYRA 2PB1A 1UJQA 1LWJA 4FX6M 4IISA 3N2TA 1GK8A 1TPB1 2NW0A 3OZYA 5HULA 4QEEA 3CYVA 4HCHA 4HSOA 2X7VA 3PTKA 1ISXA 2CZVA 3VX1A 4GVFA 4NQ1A 3TWAA 4MLRA 1JCYA 5A8PA 1H41A 2CBIA 3LHYA 2R82A 4GFSA 3G24A 2PDGA 2Y1HA 4O12A 2ZOXA 4JHMA 3T78A 1CX9A 1H2JA 4LOCA 4EPEC 1Q7QA 2PLMA 1JGIA 3S5ZA 3FVDA 4I7WA 1YADA 3M5XA 3VABA 5AC8A 3V3WA 1VEMA 3ZT7A 3LHZA 4I5RA 3EX2A 3GU9A 1RQEA 1S2TA 4OE7A 1KM0A 1RJPA 1LM1A 3A13A 2WSYA 1O5KA 1A53A 1K9EA 4C7FA 2BNJA 5FF2A 1WQ5A 4AWUA 1EDQA 3S6DA 5IHRA 3RO8A 4H6QA 4NJHA 4O16A 1TWSA 2QDGA 3UD6A 2YL9A 1XCXA 2A21A 3PS7A 5AECA 1V3MA 1R38A 2PUZA 2BVYA 4DF2A 2FLIA 4FOJA 3R89A 4N2YA 3V5CA 2X2GA 4Q8TA 3R7MA 3AYVA 1FWWA 2FFCA 2CHRA 1M1BA 1S2CA 2C18A 4XZLX 2XN0A 4K6AA 1P0KA 4D2JA 1TJ1A 2WQPA 4M82A 5CGQA 2FZBA 1ENUA 1BVNP 3NPXA 3UVAA 3CZ8A 1PVNA 3BICA 4GQBA 1QI5A 2C14A 4IL0A 1G01A 3W81A 1OB0A 4DVOA 4AX7A 3KP0A 4HHHA 5CPOA 3F7JA 1NP0A 3LRMA 1XD1A 4IPLA 1MEWA 4KW2A 2C1HA 1B3ZA 1A5KC 2XGBA 4ML4A 4B5SA 5DO8A 3HBLA 3L5AA 2VC7A 5I06A 4JHZA 1IV8A 4DO4A 7TAAA 4Q8QA 2EJAA 1HJWA 5H8MA 1IIGA 1XLCA 2RFGA 2BY1A 1X6UA 3PANA 5EB8A 4LCSA 1PKNA 1V08A 3MO4A 1DOSA 2G41A 1Q8JA 1EJUC 1XIBA 1UUQA 3AU2A 3CK5A 3LG3A 5B80A 2CWNA 1KFBA 2ISDA 4PCSA 2J13A 4ADSA 1LDCA 3GDLA 4WSHA 3SI9A 3R43A 4I6KA 2DUZA 3CZKA 3NTYA 1WP6A 1LJYA 3D3FA 4W8LA 4PUDA 4CNUA 2BXYA 3C0JA 4FI4A 3UXIA 3VOIA 4DBUA 1VEPA 5MHBA 5PTDA 1QPNA 2PWGA 4AUBA 1S1RA 4Q8PA 2OEMA 2OEKA 2W6RA 5HINA 2X1TA 3PB2A 4U2ZA 4GY7A 1AUSL 1QR7A 3C56A 4IJCA 3G3DA 1F3TA 5EMLA 4GZIA 4DWSA 4FP1A 3O6AA 1RPKA 1YRRA 3AHXA 2P1FA 3TYBA 2PWVA 3MHUA 4OBRA 4Q32A 1J5TA 3IGUA 3TSBA 3OA3A 1XV8A 1YHTA 3M44A 4FNTA 5G4HC 4L4PA 1ESWA 4LAKA 4A22A 4E8CA 2JFEX 2V8ZA 3B8UA 3NEHA 4YTSA 3GHSA 1R3WA 4MY9A 4YTRA 2NT1A 2CZFA 3CH9A 6CGTA 3BMVA 3W4RA 3W71A 3FKKA 1XIIA 2GL5A 4IMAA 2IQ0A 3R0KA 4AVNA 2OWCA 2JKAA 4ZENA 4HU3A 1DWIM 3INPA 3BJFA 2CLPA 1VPXA 1HQTA 1W5QA 1Q6DA 1PL9A 4ZQNA 5CC3A 1GVYA 3M0KA 4H00A 3AJXA 3R1ZA 3UWZA 3LV6A 1JPIA 3VAVA 1JZ2A 5HJXA 2HS8A 1VENA 2QCCA 3WDRA 1K6WA 4H9UA 4HZMA 4H01A 4WUIA 3SM0A 1RUSA 4K8GA 4N0RA 2HQAA 3CHCA 3N6HA 4MB5A 4RDZA 3CC1A 1L6YA 3ZJ7A 2QCDB 4RR4A 4NI8A 3BK0A 1KFEA 4ICMA 2A0NA 2HNHA 1V3LA 3THUA 2Y63A 4JIPA 5CJNA 3AHVA 4GWEA 5C5YA 1XPYA 4QTGA 1BF6A 4QBXA 3QZAA 4O8AA 1OX5A 1V3HA 4O54A 3QSRA 4HQVA 1XL9A 2ZUWA 2JBMA 3TW9A 3WBYA 1BG9A 2Q71A 4NG3A 4DO7A 4UUIA 1ZP3A 1V7YA 2W0UA 1UZHA 1XRVA 4L6HA 2PMQA 1RLDA 3EWWA 3OBAA 1ODZA 2Y8KA 4JTEA 4H4IA 1XYFA 4DUVA 4A8LA 3T7VA 1N82A 3DXIA 1PX4A 3TQKA 1VPYA 1WZKA 1C93A 4PCNA 2BHUA 1H62A 2V69A 3MUIA 2FZMA 5AC5A 3S6TA 4PMJA 4ZQMA 3GXMA 3OB8A 3GVWA 2EPHA 3CO8A 3JS3A 1ZNNA 3B97A 1ZTVA 3VMNA 5HPOA 2HPIA 3ZT6A 4U28A 1LL7A 1YEYA 4GI4A 4MVAA 1IZCA 2XDFA 3MZNA 4BCEA 1JULA 5DLCA 4JS3A 4N9DA 3C86A 2FIQA 3NL6A 3CLWA 5JBFA 2Y62A 3GWQA 1UA7A 3CUZA 3EWCA 1KRCC 1CXIA 3EEZA 2NX9A 4L64A 4P8UA 4IIFA 1VFUA 1PJ9A 2NX1A 5M3WA 3UETA 2EG6A 1HL8A 3I7SA 4NSBA 1EOKA 3CLMA 3WF1A 3WF3A 2CHNA 4Z17A 3B0YA 4H1ZA 4C1KA 1RA0A 3P60A 1VFHA 5HXMA 1W3KA 3RLUA 1VYSX 5HBFA 3SY8A 1RH9A 2YDQA 3GB6A 2NWRA 4IJBA 3L2MA 4JTFA 1KFJA 2Z27A 1NELA 4HNCA 5F2IA 2Y0FA 1FY6A 1DTUA 3B03A 3PG9A 1AJ2A 4XZIA 1IWAA 1PE1A 3M47A 4GZ7A 3BURA 1W1A1 4DZIA 2J7CA 1KWGA 2XVNA 3GDKA 4MPKA 3AS1A 4JY8A 5LSMA 3S2NA 3PUGA 2HXTA 4YVVA 3H2MA 4JX4A 3OZPA 3VNIA 1THFD 5LIUX 1KC7A 3CHDA 3GNDA 4ADTA 1QASA 3E0FA 2CBVA 3RLHA 2VZOA 2P88A 1HUVA 1XBYA 1Y0EA 2QMJA 2Y7EA 4IM4A 4DM2A 1XRSA 4HA3A 3BAJA 2E77A 1HGYA 1H7RA 3E0IA 4GRSA 1IEVA 2QCEA 2GZXA 4AIBA 4ROPA 3DFSA 3SQLA 5A69A 2QVNA 3RMEA 2VL4A 4D72A 1TR9A 1RXOB 5DRCA 4W7VA 1T8QA 4CQ9A 4FK9A 1ONWA 4HPXA 1YQ2A 4CD8A 1UMYA 1Y65A 4GNKB 3B05A 3P0WA 1YXDA 3G77A 1XLKA 2VGFA 4DXVA 3W0KA 3BL3A 4O52A 1PYFA 2WHMA 4IUOA 4XIMA 4W86A 3CL6A 5M17A 2OZTA 1Y7VA 1OG0A 3M4HA 1KRBC 3OBKA 2J9YA 1K8ZA 4KH2A 4XKYA 3VOFA 4AXNA 3DI0A 4NI3A 1HJVA 2QXWA 3AICA 4L1WA 3F5KA 2ZIDA 1ZS2A 4D8AA 3SCWA 3DERA 3EA2A 3BAIA 5BZAA 2XM1A 4JD4A 1CLXA 2VDHA 3E3HA 2D3LA 3M43A 3URAA 3WJXA 3XISA 4HGXA 1TTPA 2DUAA 2H9AA 1US3A 1EBHA 2NV2A 1C8VA 1WYIA 4RPPA 2D24A 1UWQA 1YNYA 1SSDA 1XSKA 3BOXA 3W7QA 2ZA1A 4RE3A 5FJRA 4AG0A 4O14A 5K2ZA 3GFYA 9RUBA 9XIAA 5DF0A 1V6VA 1YXCA 5H2ZA 4D6IA 3F2CA 4GMEA 1J0JA 4GI9A 5D2TA 2O4QA 3RHGA 3B40A 4HMEA 2A79A 1FCBA 3CMGA 1XINA 4OU1A 4RNIA 3R11A 1W37A 2QIIA 1E5JA 3IK2A 5AC6A 4E2DA 8RUCA 1LUCA 2HDJA 2YYTA 4H9ZA 5H6HA 4MKNA 3W7RA 3PSWA 4JTRA 4O8RA 2PGWA 2J7DA 1I0BA 3T05A 3AS2A 1JXKA 1W9PA 1R3SA 1YTEA 4DF1A 4P61A 2WPBA 3SSZA 3DBPA 5IRPA 1IT0A 2VR2A 3ZO9A 3EGJA 3P74A 2VGGA 4IFOA 1W5PA 3CAVA 1OX6A 4WCJA 3UWYA 3WQ4A 2J8TA 3DCPA 3WQGA 1N7KA 1PWMA 2WVVA 4N9EA 1TB3A 1LBFA 3GG7A 2BGSA 5I6SA 2GJRA 5FEZA 3XINA 4NZCA 4DEFA 5GNXA 3Q37A 1I75A 3EKZA 4QQ3A 4FZIA 3F1QA 1NFGA 2VEMA 2DSWA 2PWDA 2VRQA 3A4XA 3GDMA 3T0DA 3ES7A 4L80A 1E55A 3WD2A 2Z28A 4ZO6A 4DZAA 1UR4A 1BGGA 1WXJA 4HCDA 4CNOA 3UG4A 5JUVA 4DB7A 2XFRA 1OBAA 3EKGA 2A7RA 1KM3A 4MSSA 1QDSA 3MCMA 3B9EA 3L4ZA 5D37A 1S3HA 4XWUA 3WEOA 4AD1A 3ARTA 5HA7A 3EZ4A 3I10A 2O9PA 4MLJA 1SMDA 4DJDC 1E6ZA 5BRBA 1OCBA 3PPHA 4O1DA 3UJSA 5I03A 2FZ9A 2DSZA 4GA8A 4PEEA 3GHUA 3AMLA 4CQAA 1XDMA 1UZ1A 4D6EA 5DN1A 3AUJA 4H2HA 2WSKA 1K4GA 5AHIA 1XLJA 4GGHA 2DT1A 3C2EA 4WX2A 2FZNA 4O53A 1WO2A 3OGSA 1DJNA 3TSDA 1HNYA 3VNMA 1WXYA 2QUMA 1O1HA 1K8CA 2YPIA 4TVUA 1E6NA 4GJIA 4IIGA 3AFBA 4KCUA 1P7TA 4M7TA 3SFKA 3T07A 3GX9A 1UW9A 1A47A 3XIMA 4K38A 2J8GA 3O3RA 3ZMRA 2PDKA 3IEBA 2P76A 2QCLA 3PK7A 4DM1A 3WJYA 4D6DA 3EOSA 3IJLA 2ZUTA 1G69A 1XPGA 3G1YA 4UXDA 1VKFA 3VIGA 3WQDA 1ITXA 3QJAA 4JL2A 4AIEA 4E4UA 5A8OA 2CEQA 4Y6GA 2E8ZA 5A6JA 3TJLA 2YDAA 4QG6A 3Q67A 4UTKA 3K13A 4K36A 4RV3A 1H51A 1NTHA 1KBJA 3C2VA 3UR5A 3K8LA 4POCA 2V3EA 4PYSA 1TTQA 3S2MA 3M0XA 3FYYA 1UC4A 1W1PA 3ABOA 4Y96A 4EXBA 5IFTA 3LSBA 1UG6A 2XTKA 5ECVA 1IE7C 4J3WA 1BWKA 2Y5EA 4CD5A 2VX7A 3W7NA 1OHLA 3THCA 5D9NA 4XBJA 3NZ1A 3AXMA 3WDJA 5DY2A 3KBSA 2EKCA 1US2A 1OT2A 2Q01A 1AMYA 5IDZA 2E1WA 2AKMA 4H8HA 4NYYA 2QUTA 2WBKA 1DJIA 1S1PA 3QZEA 1FVPA 4MDOA 3L23A 4L4OA 3QQ1A 2WNNA 4EIVA 2R1PA 2SFPA 3WYZA 4MNMA 3W1PA 3LB0A 4M6PA 3WQEA 1AJ0A 3LCLA 2VCBA 3ZJ8A 3E0WA 2WCGA 3QBUA 4HTBA 3LPGA 1XDJA 1MEIA 4NZ4A 1DJQA 4JIQA 4HNVA 4OWGA 1CXHA 1TPEA 4QX4A 3UG8A 4FXJA 2DORA 2Y85A 1MEHA 1L8PA 5EMJA 1PUDA 4KEVA 5HQEA 1L2QA 1WOAA 3QLLA 3H7RA 1UH3A 3FVMA 4QNEA 4QAIA 5LGXA 3MS8A 3HPZA 4IG2A 1N8WA 2FYMA 3WLKX 1JYVA 4GIRA 1OFAA 1YDNA 3ANVA 3RITA 3S9YA 3UA3A 5XIAA 1SZEA 3MUZ1 3R58A 1R2RA 2XZ7A 2XJ7A 4D6CA 4R33A 3F2DA 3MBFA 5FSEC 1Q63A 3S2CA 4CQCA 3RMJA 5ABFB 4MM1A 4XBKA 4BS0A 1CBGA 1JNDA 1L6WA 2O4MA 3ARVA 4LY8A 1TV3A 5FSDC 1V02E 4F0RA 5CSUA 5CPSA 1OCNA 3WY1A 1J96A 2BHYA 3NQVA 1MW2A 2CLOA 4ZGYA 1OX4B 2DZXA 2ISSA 2VEGA 4PMZA 2DZBA 4DRSA 1KD0A 1TZ7A 2I7GA 3I65A 2YA2A 2XU2A 4FS9A 2RHGA 3WL1A 3DG7A 3MI6A 5LZLA 4EAMA 3JRKA 1SFJA 3MP5A 4BWLC 4Q8MA 3TOPA 4GY0A 3A6OA 2VUYA 2ZWYA 4GYKA 4X9SA 4LJ3A 2VURA 4A3UA 4RZ6A 1X6NA 4ES4A 1VS1A 4DXKA 4JGDA 1HXJA 4J35A 1REQA 4UTMA 2G3FA 1WB0A 4IF2A 2Q02A 4HZ7A 1POJA 3MVTA 1CTNA 2J9ZA 1UD4A 1E9YB 1NVMA 1POKA 3WJSA 1NDYA 3NEVA 2PGEA 2YLAA 4ZFCA 2VX6A 4PRTA 1KXVA 3GG0A 1E0TA 4AZ5A 3FY1A 3FA4A 5D32A 1JQVA 3QMRA 5H91A 4HSHA 2G4FA 5I2UA 2CERA 3PBYA 1XIDA 1S2VA 4PMXA 2OWWA 4KIRA 3E0VA 1VBUA 1R86A 1E5NA 1CDGA 3QMTA 3TCSA 4CQBA 2O7QA 2V2HA 2YXXA 4KIEA 3W76A 4RNJA 3BLPX 1XLFA 3R8RA 3G1XA 1Z9AA 3OZOA 3W7DA 3WBEA 3PC0A 5AVHA 5K9CA 2XIOA 4NAFB 4WVXA 4Z42C 3GW0A 1ZB5A 5FL1A 3MMUA 5TIMA 4XB3A 4UTFA 3WMSA 3WLOA 5A1AA 3LMZA 2GJXB 3NWRA 1RR2A 2PAJA 1HKJA 2GQAA 3E2SA 3HG2A 4A3YA 2OO6A 2UWFA 4ROQA 3TFCA 4XX6A 1RY0A 3N34A 1HO4A 1GVRA 2XH4A 4JQ3A 2V67A 1F74A 3NQMA 4FPSA 5ABHA 2QF8A 1TV5A 4JTSA 2X7WA 7CGTA 3TJ4A 4KRZA 2R94A 1UD5A 4GNVA 2OPJA 5I3HA 1XLEA 2MNRA 3CZGA 2ZRZA 1TPWA 2ZTKA 3BAYA 2ZZ6A 4IMFA 1NARA 1XLAA 1BYBA 3Q45A 3RRAA 3VUSA 2PE4A 1OD0A 4QIUA 2BFGA 5FAGA 2YL6A 1IYXA 3OGRA 3AZSA 3LTSA 3G18A 3TWBA 3ARPA 2HWGA 1BHGA 2V6AA 3SBFA 4DWDA 1E72M 1XYMA 4KPLA 1UKOA 1DIKA 3VA8A 4UTUA 4DI9A 4K1WA 2QHAA 3A5FA 2WLYA 3H53A 4JIIX 1KM2A 2FKPA 3QMSA 4ASTA 3WELA 3CQIA 2PWEA 2WNWA 4EVZA 3MDUA 4QE4A 3VGEA 3B8WA 2BXZA 4U10A 3N3TA 4YIWA 5I5RA 2FDMA 3HGOA 2VOTA 1PS9A 3VC6A 2FFIA 2NSOA 1XX1A 3PTDA 4D8LA 1DWFM 3MSYA 4V27A 1R3TA 2INFA 3CPGA 3T4CA 3IIZA 5KINA 1XG4A 2QIWA 4KWOA 2NWSA 3GE7A 2C7FA 2HNEA 5ABTA 2ZZ2A 1SZNA 3DZ1A 3PJWA 3WBWA 5A6KA 5FF4A 3U4FA 1V51A 1F4HA 5ENLA 4NZJA 1OFPA 3QOMA 1MXDA 3W1TA 3N11A 4Q8NA 4Q6JA 4INFA 3Q94A 1PEZA 2Z1SA 3ABXA 2RUSA 2HZGA 2R1KA 2VOMA 3GXIA 3UVIA 2WJDA 3ZR5A 1XWYA 1HJQA 4GCAA 4W5UA 2OYKA 2WWCA 4JPGA 3VYLA 1SR9A 3ARRA 2FTYA 1JZ8A 3GS6A 3ZYZA 2CHOA 4MAZA 4JN7A 4PA8A 3UJ2A 1SO3A 1A5CA 3C61A 3BGAA 4NAEA 4HPHA 2VEFA 5AN7A 1UBPC 5FL0A 1QNPA 1JDDA 5TAOA 1V6UA 4FR6A 1XIJA 2C16A 4JNYA 1B3YA 4PSRA 4MJMA 4UQBA 1R3VA 1H7XA 1SZGA 2WSRA 3V0TA 3PNUA 2OOGA 4DZ5A 3PR2A 3FX4A 3AZRA 3AIRA 3W6MA 5G4EA 4IH3A 4LXFA 3EWZA 2ZC8A 3LZ5A 4KS0A 1TIWA 3ANUA 4MTVA 2QEZA 3RFAA 4DI8A 1XGEA 4UNKA 5DBTA 3VDHA 4Y2WA 5DEZA 4A8IA 1L8NA 3R6IA 5HR6A 5DQPA 3OYZA 1TWZA 3QM3A 3A4JA 3V18A 2V9DA 2WKGA 4RW3A 3G0SA 3Q4DA 1FWFC 3BTNA 3THDA 4LF2A 2OU4A 2NSXA 1QWKA 3WDIA 3H24A 1CGTA 3SZ8A 3F4NA 1U5VA 4JNMA 1EKOA 1XYBA 1MQPA 1N8IA 3REQA 2AL1A 3VX0A 4GYPC 1EDTA 3BXWA 4ECLA 3H8AA 3MI3A 4GFIA 4ILSA 1HZYA 1MW1A 1BWLA 3CUHA 1TMLA 3VIMA 3TLLA 4E2BA 4GGBA 1QFEA 4UTTC 3O2LA 3FYOA 4PMNA 2FHBA 4OT7A 3FKRA 3LHUA 4L4LA 3IAQA 4WDTA 2GLKA 5TBOA 1S2UA 3HPSA 3IV3A 1C3FA 4AMCA 4QJ3B 3LA4A 1VC4A 3RJYA 4ZOAA 2ACSA 3W2LA 4LVGA 1LBMA 2XVKA 3R94A 1K9FA 2XWEA 3EWUA 4J5NA 1EX5A 3E96A 4TOQA 2Z2AA 3CQKA 1Q45A 4C5YA 4FHAA 1QBAA 3A4WA 2PRLA 3BH4A 3N17A 2ISVA 2WSQA 1HO1A 3P81A 1AZ1A 1CGXA 2FGLA 5CZTA 4EXAA 4YTTA 1HP5A 5A6BA 1F8MA 5GPRA 2E8YA 3WUBA 1CXFA 4JX5A 3PULA 3VC5A 2WSPA 2G3IA 2X09A 1MFVA 1W1TA 1TZ9A 4UR7A 5J8LA 2I56A 4P8WA 1X7IA 1JCNA 1Q3NA 3APTA 3GNPA 3VKBA 1BVWA 4M6UA 4ZOBA 4JFSA 2A6NA 1JL8A 2ZXAA 4UTWC 4JYEA 4ZOCA 3CEPA 4F4RA 1XICA 2PDIA 5BMWA 3E5BA 1JUEA 3ITGA 4AB4A 3N13A 1JRBA 3HPXA 1XLLA 3G2GA 3W86A 1W3JA 1HKWA 4KRUA 1F05A 1GOMA 1CXLA 3DDMA 3AXHA 5BRPA 3P8IA 3TN3A 4EXQA 5CLTA 4GY1A 4NL1A 1P4CA 2A3HA 4ATWA 1UZ4A 1Q4WA 2FHCA 3PZUA 3FN9A 2WLZA 4O0KA 5EGRA 3SUVA 3P2VA 4WXZA 2GGIA 1PX3A 2QS8A 3F2BA 1D3CA 3GNNA 3WLLA 3D47A 4C6CA 5DMLA 1MQQA 4IFKB 3FXYA 4PB3A 1WKDA 2GQ3A 3R79A 3QFEA 4ZB5A 1WXZA 4LVFA 4HK6A 1E9IA 3G1AA 3JR2A 3MUAA 4N9BA 5FEXA 3W1UA 1ZJBA 2J8FA 4JBRA 2I14A 4US5A 3ID7A 1FP9A 2OKTA 2XVGA 3ZWSA 4TMCA 1F76A 3B06A 1GVQA 4FNQA 3C2RA 1TRIA 2ALRA 3VNZA 3MWAA 4YTQA 3BZGA 4JYFA 3EDJA 2XFFA 2PU0A 2QCMA 2EPOA 4EAYA 3S5OA 4PUEA 4Q4QA 4Q4OA 1CIUA 4UMCA 1JI1A 4J1OA 4BY3A 3TVAA 4MUPA 4FOUA 1JZ6A 3S5SA 3E5PA 2HK1A 4DPPA 2BBFA 3AUOA 1FH9A 4NHVA 1VBGA 4HA0A 3T81A 1GTHA 4GQ0A 3WH6A 3ARUA 5GJNA 1GG0A 1A0CA 1W5MA 1T6MA 3AROA 3TJXA 1R2SA 1A5UA