3WQ8A

Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
448
structure length
448
Chain Sequence
b'KFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDAAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLASGFPPGFLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVSVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
publication title Monomer structure of a hyperthermophilic [beta]-glucosidase mutant forming a dodecameric structure in the crystal form
doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 177
structure length 448
sequence length 448
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wq8A00
3BCFA 2EO7A 4JAWA 1LLOA 3ARWA 3CZLA 4PUEA 3AISA 1W1TA 1PIGA 3BAKA 1CECA 1ODUA 4FLRA 4S3JA 3LPOA 3A6OA 5C71A 2OYLA 3PZNA 1EH9A 2VTFA 4URIA 1UUQA 2DT0A 4HA3A 1GQKA 2YA0A 1PBGA 5E9AA 2EPOA 3NCOA 4MAZA 4UQ9A 3SUTA 3VD5A 4J3XA 3WD2A 1CXEA 3LPPA 3N13A 1H49A 2WWDA 2QLYA 3T0DA 2RGMA 3VIHA 4PMOA 3U57A 1E5JA 5IXEA 1XSIA 3OLEA 1HKMA 5CGMA 2JE8A 4PTXA 3GNPA 1VEMA 4C7GA 1IT0A 1TUXA 3VD4A 1C90A 4HTYA 3IJ7A 5IDIA 2EPLX 3WSUA 1PX3A 3CZJA 2CEQA 4W93A 1WAWA 2BS9A 2XJ7A 3QHMA 3WQ4A 4Y7EA 3SCQA 1E6NA 1TA3A 4BQ3A 2BHZA 1Q6EA 2D0HA 3AS3A 3WELA 1W3LA 2DIJA 1J11A 1US2A 1UZ4A 5JBFA 3L4UA 4J3TA 3CZKA 5E0FA 2CPUA 2QHAA 4MB4A 2WHKA 1ZJAA 5DT7A 3WD3A 2ZE0A 3WUBA 5HXMA 4E2OA 2VR4A 1PEZA 2WM0A 4KWUA 3HU7A 1KQYA 4H8VA 3MMUA 1CXLA 4AZCB 1KB3A 2V3DA 2ZUNA 1JIBA 4LXFA 3VIKA 4E8CA 3ARXA 4OKDA 4HU8A 2JF6A 2UY5A 2YL6A 3BAWA 4GZIA 3CUFA 1GUVA 3I3BA 7TAAA 3MSDA 1UKTA 4U2ZA 1OGGA 4P8VA 2XHYA 4JZ5A 2X0HA 3VGDA 4TUFA 3ARVA 2BVTA 3VTRA 1Q6GA 3SCVA 3MV11 3OLIA 3N17A 2DSKA 4JKMA 1J01A 5I23A 3N18A 4Z2JA 4WSJA 4DWSD 1I1WA 2VCAA 3VX0A 3OGVA 3O9NA 2GK1A 2MANA 2VQUA 1UR8A 3OZOA 3RILA 3EMCA 3AZSA 4V28A 3NYDA 3LPGA 1B30A 3GXIA 4EANA 2WVVB 3WUFA 1WO2A 4W8LA 4D6CA 1GOMA 2BFGA 5A6KA 3ZIZA 2WZIA 4FF5A 1WNOA 2G3MA 1GOKA 3GYCA 1Y7VA 1GHSA 4AD4A 2UY2A 1H41A 1TMQA 2BVDA 4XB3A 3EBVA 4YHEA 5A2BA 2YL8A 1ZBVA 3VMOA 2WHLA 1XCWA 3N1AA 2G8ZA 1FH9A 3W4RA 2XVPA 2DH2A 3VD7A 3BC9A 2XVKA 3SEPA 3OGSA 2YA1A 3FN9A 3L4TA 3VPLA 5BXPA 2J7CA 1EDQA 4F8XA 1CGWA 2VQTA 1H11A 1KGXA 1XH0A 2FHCA 5AC5A 4PMRA 2WKGA 5ABFB 3AHXA 2JEPA 2NT1A 3WDJA 2DQXA 2DSVA 4AD3A 2CBVA 4H8HA 3ZSSA 1D7FA 4B15A 2ESCA 3EYPA 1AMYA 2CBIA 4F66A 1B9ZA 4TVDA 5ABEA 1WZMA 4JKKA 1J0KA 3WNMA 1V3IA 1E0VA 3ALGA 2VT0A 3RDKA 2TAAA 1E6ZA 3SCWA 2IXVA 4GPNA 4F9JA 1PX4A 1LWJA 2QMJA 1WDSA 1W1VA 4PCSA 4QCFA 1ISZA 1VENA 5DFAA 3EDKA 1DP0A 4AZ7A 4D6HA 1H1NA 3II1A 1K9DA 2WC3A 4PEEA 5TD4A 5F7UA 4OIFA 1HVQA 2A3CA 5CSUA 5AY7A 4P7OA 2WWCA 3G6MA 4LYPA 1HJVA 4Z2IA 4ZE5A 1CPUA 2PBGA 5A3HA 2PWDA 4IUGA 1E0WA 2V3FA 2ZIDA 1WDQA 1EGZA 1NWSA 4R5EA 3BAYA 4HPGA 1UD5A 4HZ8A 3MO4A 3WDHA 2XUCA 3B9AA 2HVMA 1G1YA 3RM9A 2A3EA 1JL8A 2J79A 4W84A 3QHOA 4N0RA 4J3VA 3DYMA 3VGHA 5A2CA 2VVSA 3SCNA 1W3HA 1JD9A 4FMVA 5DF0A 1H0IA 4W7UA 5JBEA 4MJ2A 1XD1A 4U33A 4PBGA 5C70A 3ZT6A 3WBEA 3IAPA 2WANA 3WL1A 1V3JA 3VGGA 4UQDA 3GXFA 1WCGA 1MQQA 1J12A 3CO4A 2WPGA 3VDAA 3K8KA 4DWSA 1US3A 1FFRA 5A8PA 2ZXQA 3SCPA 2BHYA 2XWDA 3NDYA 1DTUA 4P7NA 5CQ1A 2JALA 3WUGA 3VMNA 1CXKA 2D2OA 3VU2A 1WP6A 3AIRA 1LF1A 3FXYA 4M8UA 3AFBA 1TCMA 1OIMA 3M46A 1MXGA 4Z2HA 1EA9C 4M81A 3THDA 4UQBA 2WMIB 4ATDA 4YPJA 4C7DA 2JFEX 4UOJA 4B9YA 1W2PA 4MTVA 2VZTA 3VIIA 4JFUA 4UZSA 2Y24A 1HJWA 3AXIA 2CYGA 2WHMA 3M6DA 1QHPA 4JFSA 1ISXA 1O6IA 3ZT7A 4XV0A 2BVYA 4KGJA 1E3XA 1UA3A 3LMYA 3CH9A 2VX6A 2F2HA 4PTMA 3CUHA 3VGBA 3VIGA 4EE9A 4CU6A 2DSZA 3ZJ6A 1XRVA 3W26A 1B90A 3WQVA 4TOQA 4CCCA 1FHLA 3MMDA 1WZKA 3K8LA 4WIWA 5DO8A 3UCQA 2ZUWA 1B0IA 4GI6A 1J9YA 1FP8A 1UKOA 2WVUA 1VEPA 1XH2A 4U5IA 2OLHA 4MB1A 4NI3A 1BYAA 4HOWA 1E6SM 3PN8A 3WEZA 4AZGA 1ZBWA 4UOZA 1MQPA 3AJ7A 3MKKA 1EIBA 3WL0A 1DWJM 1CYGA 3MS8A 4B3LA 1ISWA 1CWYA 3TA9A 4BA0A 4LX4A 1JDCA 5D9NA 1JZ3A 2GK1B 4CD5A 3ZJ8A 4HA1A 1TG7A 4AIEA 1UD4A 1R7OA 3T2QA 1JD7A 3AHVA 1ISVA 4QLJA 3WNNA 4DM2A 4DUXA 1CLVA 3CLWA 3U7BA 1WKYA 3ZT5A 1CENA 1V6WA 1K9EA 1I75A 4JL2A 1B3ZA 3M7SA 4ML4A 4GO8A 1B3VA 1Q4NX 2JF7A 2GFTA 3G6LA 3HN3A 1AQHA 1E40A 2RGLA 2G41A 3J7HA 4Z2LA 4CVWA 2EPNA 1UD8A 4IM4A 1J0IA 1X6NA 5I2UA 5A6BD 3APGA 5ABGA 1EOKA 1UD6A 2WMFA 4AD0A 1VB9A 3BCDA 4D72A 3AMLA 3WF4A 4UOQA 3BXWA 3VGFA 3F5LA 4BQ4A 1UR4A 3MV01 2VR5A 4ACZA 6TAAA 1QNOA 1QOXA 1V6UA 2C0HA 4AMCA 2OYKA 3RM4A 5FD0A 1C7SA 3UETA 4TVCA 1FH7A 3ZOAA 1PIFA 1DWHM 4FLSA 3AZTA 4UFHA 1V0NA 2J78A 1MFUA 1V08A 2X05A 5D8ZA 1UD3A 5I77A 2YBUA 1PAMA 1YHTA 5CLWA 5JIPA 4CVUA 1BFNA 1H09A 1L0PA 1YQ2A 1J10A 1SMDA 1UWRA 1G94A 2XSAA 3WBAA 4AEFA 1FP9A 4OBSA 2YLLA 2WCSA 2D0GA 3WQ5A 1ZJBA 3OA5A 1NWUA 1VAHA 5IHSA 1QPKA 1PZ3A 1BYCA 4JKLA 1GPFA 3F4VA 1J0ZA 2GJXA 2Z1SA 3SIMA 5JIWA 4HU0A 5I6SA 1LQ0A 1E6RA 1E72M 2WHJA 1EO5A 4JL1A 4A4AA 5DT5A 1MWOA 1GVIA 1W3KA 4LPCA 1C92A 2ZWYA 4XUYA 2G3NA 5CLTA 4W87A 4NZCA 1KWKA 3W81A 4GKLA 3UG3A 3E1F1 4U5KA 5C8BB 5A6SA 1C91A 2FH6A 1LJYA 5BXTA 2DH3A 1B1YA 1W91A 1PZ2A 1UR0A 1XC6A 1QNQA 3WDPP 1VJSA 1VFMA 1BLIA 3GNRA 2VX7A 3L4WA 1MVYA 3UR7A 1BVNP 1VIWA 2ZXBA 1NWRA 3ZR6A 1CGVA 2XPKA 3CZGA 3CIVA 3PZOA 2VVNA 2JIWA 1K9TA 1V0MA 4PN2A 3AZRA 5M17A 4UQCA 2WMHA 3BAJA 2EBNA 4UR9A 1E4NA 3CHDA 3TTSA 4PMNA 1TVNA 5IFPA 1VRXA 3CGTA 1E1EA 9CGTA 1NWTA 2WBKA 1VF8A 2WVTA 4UFKA 3UESA 3CUIA 1IZKA 4H8UA 5A6BA 4YN5A 2W63A 1UZ1A 1ZL1A 1KXTA 2D3LA 3CPUA 1ZU8A 1IZJA 3OLDA 3SCTA 2Y8VA 1E73M 3F5KA 4OJYA 2OSXA 2A3AA 1QW8A 1E9LA 3GTNA 1HVXA 4ZENA 1CGTA 3WF0A 4AZIA 4AW7A 2O9PA 2E4TA 3S2CA 1UOKA 1BSIA 3VVGA 4D6FA 2XVLA 3UR8A 4AYSA 1EDGA 1LG2A 4RE3A 3VDHA 4PRWA 3K1DA 4UQEA 2CHNA 1NOWA 3RO8A 1X6LA 1L8NA 3WN6A 1W1YA 3W37A 1DWFM 3PZQA 4FLQA 2C8NA 2XIIA 1E5NA 3VIOA 4E4PA 5AYBA 3OB8A 1M7XA 4PSPA 4NRRA 3B8SA 1OB0A 1KBKA 3CMGA 1UR1A 1XYFA 4AWEA 1BGGA 3MANA 1GZJA 1U2YA 1BVZA 2WNWA 1R8LA 3AHZA 4BS0A 2WZHA 1U33A 4PTWA 4ZXOA 3SUSA 4J7RA 4M82A 2XGBA 2NT0A 2PI6A 3VM7A 1Z32X 4R27A 1W32A 2PF0A 4U2YA 5D8WA 1QNRA 3CHCA 1E6QM 4GQQA 2V5DA 4V27A 3CUJA 4MDOA 4TX8A 4H7VA 4TVUA 2FGLA 4WKFA 1VFFA 3JUGA 4MADA 5CJ5A 2W92A 2PWHA 5JBDA 4P7LA 1DWIM 3ARUA 4HMDA 3VNZA 1C8YA 7A3HA 4NF7A 1E15A 2EJ1A 4QLKA 2J7GA 4X9YA 2CBJA 2D0FA 1B3WA 2OSYA 3ARZA 1UH2A 3CHEA 3PBGA 4K68A 3OIHA 5KZ6A 4MNJA 2V3EA 1EHAA 1QNPA 3W38A 4PCTA 1UH3A 2EEXA 2WCGA 1E0XA 1D3CA 4M56A 1EOMA 1XYZA 1JZ2A 1E4LA 1MW3A 4X0NA 4LYRA 1ZBKA 5BWFA 2ZXAA 1X1NA 4HMCA 4GQRA 2WYSA 1V6VA 4D6IA 5D9OA 4NSBA 4KMQA 1V3HA 4W5UA 2E0PA 1VBUA 1WZLA 3AOFA 2CIPA 3ALFA 5LYRA 5M03A 3POHA 5ECUA 1JAEA 4L4PA 4ACZB 3VIPA 4HZ7A 3U7VA 5A6LA 1ZBCA 4U31A 4Z2KA 2CETA 2VI0A 2W61A 3SUUA 3I3DA 2VZUA 3HJEA 4JHZA 3W6LA 5FL0A 1JYNA 3FHAA 1C8QA 1ITXA 3B9EA 4PMXA 3SCOA 2XG9A 3UG4A 1GORA 2VRKA 4AC1X 1ZS2A 1QI2A 3IJ8A 4OBRA 1NOFA 5HBFA 2WC7A 3ZM8A 3PZTA 1K9FA 1R87A 3AIVA 2CKSA 2ZOXA 4B3KA 5DMYA 4UTFA 1C3FA 3AIWA 5CPQA 1UR2A 2AOSA 4W88A 4GIAA 1E70M 1SFSA 3A4AA 2UY4A 4FK9A 3L2MA 5D9MA 2VRQA 1QNSA 1HL9A 2VJXA 3O6AA 1UQZA 1OGSA 1QI4A 5EB8A 2E40A 1V03A 2E8YA 5GPRA 1UH4A 5A6JA 2VZOA 3PZMA 3RIKA 3KWXA 4W7VA 1CGYA 3IAQA 4PMZA 2XSBA 3L2LA 1UWIA 2OWXA 2J77A 1W2VA 2W67A 3A47A 2FHFA 1KBBA 3VIMA 4WSKA 4H2CA 5A6AA 1W9BM 2J7HA 1QW9A 1JXKA 2QMKA 3RM8A 1V3MA 1BYBA 5A69A 1LWHA 1CXFA 3FAXA 3VD3A 5A95A 3WKZA 1DWGM 4PMVA 3PTKA 1HIZA 4GO9A 4F9DA 4XX6A 1KXVA 2ZWZA 5D9PA 5HDRA 2DGAA 1HKJA 4A3HA 2QV4A 3WDRA 1B31A 4MB5A 4MJ4A 1BG9A 5FCZA 1PJ9A 5BXRA 4CU8A 3T2PA 2DSWA 1PPIA 4QLLA 2E8ZA 1JF5A 4CKQA 2WXDM 3W28A 2X2YA 3AMKA 3WY1A 3CZ8A 4MNLA 3CUGA 1W9VA 4GI9A 1IV8A 1K6AA 2Q8XA 4CD6A 2PBOA 3U5UA 1TA3B 4CCEA 1CGXA 3WMBA 2DEPA 2VX5A 3BH4A 3MSGA 1BTCA 3T09A 5A1AA 2E3ZA 2Y4SA 1HJSA 4TXEA 2GSJA 4AIUA 3T2OA 1WPCA 1V02A 3A4WA 1WDRA 3A4XA 5FIPA 3L4VA 1KXHA 1VFOA 1CLXA 3W82A 3GZAA 1D2KA 2D1ZA 4UNIA 5LA1A 4ATWA 3GXMA 2YA2A 2ZX5A 3BMWA 3NDZA 2GUYA 2WC4A 5LA2A 1HJUA 1NP2A 2ZUUA 3BGAA 1FH8A 3PZ9A 4EKJA 5A8NA 5M3WA 3BLPX 1MQRA 3AXXA 3DHUA 2CBUA 1KR1A 2WBGA 1JAKA 2XWEA 1E4IA 3WD1A 4AZCA 3UG5A 4PMQA 1W9UA 3PHAA 1B3YA 2W62A 1RD6A 4P8XA 4OOZA 3WH8A 3VKKA 5LA0A 1XCXA 2J74A 1JI2A 2VC9A 1WDPA 2XGIA 3IANA 4OZOA 5CPSA 3VINA 3BLKA 1GQLA 2YJQA 2ZUVA 3QHNA 1KCLA 2WLZA 3TP4A 3WH5A 2VZSA 3L4ZA 1GOOA 3WDQA 2VL4A 8A3HA 2GJPA 4IPNB 3UERA 1N82A 4JFWA 2DT1A 3BAIA 1UA7A 4M24A 3AIUA 1OBAA 1LL4A 4JCLA 4AD1A 1HN1A 1OIFA 3NSMA 2OWCA 2ZUTA 3TTYA 1SMAA 1I1XA 1BG4A 3WQ6A 1UWTA 4P7RA 4W8BA 3AHYA 2PB1A 4WKHA 2BHUA 1GCYA 4EK7A 3GBDA 1E1FA 2UWFA 1E71M 1GNXA 1V02E 3RJYA 1QHZA 3EDEA 2VMFA 3ARPA 1CNVA 3ZJKA 3FW6A 5HPCA 3WIJA 2BXZA 5BROA 1UHVA 1HKIA 3AI0A 3ZR5A 5A8QA 1MXDA 4CD7A 3NSNA 4CD8A 5ABFA 3WENA 5I79A 3AS2A 2J62A 4CN1A 2CERA 2JIEA 4JHOA 1JDDA 5E0CA 5IHRA 2WK2A 5GNYA 3SCUA 2FDMA 1CDGA 3QR3A 4QAWA 1QBAA 3N15A 3KL5A 3K4DA 1OD0A 4W8AA 1UKPA 1M04A 2CHOA 5EBAA 1XSJA 2FH8A 2VOTA 4D1IA 3AMGA 2ZX9A 3QOMA 4RE4A 4YHGA 3OLGA 2VRJA 3CTTA 2G4FA 1V6XA 3DYPA 3ARTA 3WEOA 1EQPA 1XD0A 2ZX8A 3TOPA 1PX8A 3MUAA 1KQZA 3VNYA 1F4HA 2D23A 5I3DA 1AQ0A 1JZ4A 3GH5A 3ARQA 1H3GA 1KFWA 1KR0A 3GH4A 4CGTA 3WNOA 2J47A 1NH6A 1E6XM 4U3AA 1B2YA 1HJQA 4JFTA 7CGTA 1OM0A 1BAGA 2E9BA 2WZEA 2WSKA 2BY2A 1XV8A 4QFUA 2XM2A 3L4YA 4RL3A 4JFVA 4L4OA 2ZX6A 2BY1A 6CGTA 3T0AA 3VX1A 1CXHA 3EDFA 3T08A 3GM8A 2DPEA 3AROA 4TTUA 2GDVA 2UY3A 3VUPA 3GXDA 2V3GA 4OOUA 4P8UA 4F79A 3ARYA 4B9ZA 4LYQA 3KEHA 2W91A 4W85A 4V2XA 4XZWA 3SUWA 3KL3A 1KCKA 1TR1A 2OYMA 2PWGA 5BXSA 1Q6DA 5I78A 3IJ9A 1ISYA 3CHFA 1M53A 2O9OA 5E6YA 4AZ6A 1VBRA 2WMKA 3T0BA 3WNLA 3D3AA 5E09A 3W24A 4KGLA 4DWSB 5CPTA 2ZUSA 1SR0A 3WEMA 1EXPA 2EQDA 3NIYA 1UWQA 2DSUA 2NSXA 4MDPA 1BQCA 2ZXDA 3AS0A 2WVSA 4FLOA 2XVNA 4DUWA 4PUDA 1AVAA 3RCNA 3VIJA 2CITA 4HOXA 1HP5A 1OD8A 5EFDA 2D22A 4IPLA 1CZ1A 3WNPA 3TONA 2EXOA 2YLAA 1GOQA 1JYVA 1ZB5A 3MUZ1 3EMZA 3RMEA 4ZE4A 2WMIA 2IXUA 1E3ZA 1HX0A 3TTQA 1DEDA 2QPSA 1JZ6A 2B31A 1BHGA 1HL8A 1NARA 3ZQ9A 4UCFA 3K8MA 1JG9A 4AY1A 5AC4A 5CXPA 1HT6A 3B9DA 3BSHA 1UKSA 2YKKA 2GVYA 1BYDA 2J7BA 2V38A 4C7FA 1HNYA 5DEZA 3BSGA 3LPFA 3W0KA 1V0KA 1XSKA 1J0HA 5JUVA 3WF1A 3AMDA 1GJWA 3WH9A 3UEQA 4HZ6A 3SCSA 4AZHA 2IUZA 3IK2A 1W1PA 1R7AA 1W9DM 1RP8A 2D24A 3FAWA 4HOZA 4H04A 3FHQA 4PTVA 5I5RA 3ARSA 1JXJA 3KL0A 2F61A 1V3LA 1JDAA 2WMGA 4KRUA 4Q22A 2VZVA 1E56A 2ZICA 4MNKA 2JEQA 1TVPA 3GDBA 2XYLA 5HPOA 2AMGA 4W86A 4W7WA 5GQBA 1VJZA 3O2LA 1C7TA 4D6GA 3A3HA 3TTOA 3WQWA 3D5HA 2CESA 4OUEA 4D71A 3ZJ7A 1CXIA 1ESWA 1EO7A 3K4AA 1W9XA 2X09A 3VDBA 3AMCA 4MPKA 1GOWA 4QCEA 1OGBA 1G9HA 4TTGA 3POCA 1CBGA 5M5DA 3GBEA 1LL7A 1UYQA 4J3UA 1JFHA 3WFZA 3W27A 1CEOA 2YIHA 2J75A 4AD5A 6A3HA 1RP9A 5HNNA 4NRSA 2VUYA 1MW0A 3W53A 3RJXA 3WD0A 1NQ6A 2V5CA 1G0CA 3RPMA 3PZVA 4D6EA 1LL6A 2EPMX 1XGZA 2J8GA 1C93A 2XIBA 5FKYA 3KZSA 4TX6A 4D6JA 3AICA 4AIOA 2J4GA 2A3HA 1EHNA 2BY3A 4BCEA 2X8RA 2VNCA 1RPKA 4QP0A 4GINA 2CKRA 4LQ1A 3VOCA 1F4AA 4CU7A 2G3JA 3WF2A 5A94A 4M1RA 5BRQA 4DWSC 3WUEA 5BCAA 2D3NA 3FY1A 5E70A 2Y8KA 1OWQA 1A47A 4WJXA 3F5JA 4HPHA 1CTNA 5A8MA 1OSEA 5FOOA 4UZUA 1O7AA 4PSRA 1MYRA 2WCAA 4EAMA 1GQIA 3EDJA 1E6PA 2ZX7A 4GXPA 3PZGA 4HMEA 4CCDA 4AD2A 4P8WA 1RH9A 3MUY1 2WW5A 1UWUA 1M01A 4MAVA 3MUIA 5GNXA 1TZ7A 2BXYA 1KGWA 3ARRA 3AXHA 4Q7NA 4W5ZA 2XFYA 1JZ7A 2VO5A 2DT3A 4D6DA 1UQYA 2GJXB 2NW0A 3HMCA 3W29A 1KGUA 5AYIA 4PYSA 1U30A 2GDUA 2WMJA 3CMJA 1NP0A 2X1IA 4J3WA 5CZKA 1UWSA 1FOBA 3GH7A 1FFQA 2E9LA 2YOCA 1KXQA 2DT2A 2XFFA 3PTQA 4DUVA 1ODZA 4QDMA 1G01A 3WF3A 4PMDA 1QVBA 2BNJA 2Y2WA 3QGVA 1UD2A 4UFMA 2A3BA 2J7FA 4H41A 1MFVA 3K46A 1XHGA 1GONA 4A3YA 1WE5A 4BQ2A 1CGUA 3SURA 2BV9A 1QHOA 4ZEPA 4CN4A 2XFRA 3VILA 1OT1A 5E6ZA 5EMYA 1JZ5A 1W9PA 4E8DA 2XM1A 1Q6FA 1HF6A 2WAGA 5A6MA 4AZBA 3WDIA 2WB5A 3BAXA 2YL9A 2OSWA 2FHBA 2EPKX 4J27A 1QI3A 4N42A 2ZUMA 3OG2A 3N12A 2C7FA 1EDTA 2G3IA 3AIQA 4GZEA 1GOIA 1EQCA 1KWGA 1JYXA 1G5AA 2YL5A 5A8OA 2Y5EA 3NUKA 3WFLA 3N04A 2WLYA 1FA2A 2XVGA 4UFIA 1GJUA 3L4XA 1ECEA 3W6MA 5I0DA 2WSPA 4JIEA 1BGAA 1M03A 2XTKA 3WQ8A 4WF7A 1JNEA 1R85A 4D1JA 2HISA 3DC0A 1J0JA 4ACYA 4ATLA 2FGZA 4IISA 4WLCA 2YDRA 4UQAA 4AEEA 1V6YA 1FHDA 1UG6A 1V3KA 4BZYA 1SYTA 2E9MA 3N9KA 3WMCA 3VDCA 4MB3A 3WNKA 3EDDA 3NJ3A 3AS1A 1P6WA 1A3HA 3THCA 3MU7A 1MW2A 1NM9A 2J25A 1H4PA 1MW1A 1OCQA 1JGIA 2QPUA 2DIEA 1B3XA 5GNZA 2O92A 5CGTA 1AQMA 1V0LA 3WH6A 3U5YA 3ZSTA 4CN6A 1HP4A 1JI1A 3VMPA 5CSYA 2W66A 3EMQA 1H2JA 4AZ5A 5HOSA 5I24A 3PZIA 3AHTA 2J7DA 1VFUA 3PZUA 2YDSA 4P7QA 1GW1A 2D20A 4WK9A 3W25A 1DHKA 3ZMRA 5KEZA 1UKQA 3WD4A 2W4XA 2O9RA 3OBAA 1H0GA 4GZJA 4ZFMA 4GI8A 1CIUA 4KRTA 5BRPA 4X0VA 2O9TA 5D4YA 4XZBA 1JYWA 4BF7A 3QOKA 2PWFA 5EFFA 1R86A 1HXJA 2VX4A 2GJRA 1WZAA 2WVVA 3KE0A 2YDQA 2QF8A 4AISA 4UFJA 5FL1A 1JFXA 3AQUA 3VM5A 1C8XA 3WH7A 1JZ8A 2J8FA 1VEOA 4KH2A 1GHRA 1JF6A 1NOUA 1HJXA 1E4MM 1JNDA 2J7EA 2Z1KA 3ECQA 3AIBA 4CD4A 1E55A 4HP5A 1UR9A 1TE1A 3AYRA 1QBBA 4BQ5A 3CBWA 4RE2A 2PWEA 4PMUA 1HKKA 2AAAA 2X0YA 4M29A 5IFTA 3OGRA 1BPLB 2WKLA 2VCCA 1ITCA 3PTMA 2VCBA 5CG0A 3MMWA 1W3JA 1XH1A 2CNCA 4HA4A 4W89A 4Z2GA 4B16A 4U3CA 4PMYA 3AIEA 3OZPA 3VD9A 2F8QA 3GNOA 4J28A 1LG1A 2VURA 1H5VA 4LGXA 8CGTA 1QI0A 4CUCA 2DDXA 1OT2A 3M07A 2YBTA 3N11A 1Q6CA 1OINA 1S46A 3VO0A 4JCMA 2BY0A 2CCRA 4WKAA 2W5FA 3SCRA 4S3KA 1TFVA 3VGEA 3NSXA 3CZEA 1WB0A 1GQJA 3WMSA 3ZO9A 1QI5A 1E43A 3FNDA 1J18A 3I3EA 2CXGA 5ABHA 1GVYA 2PC8A 4UFLA 3DYOA 3S6TA 1J0YA 4M80A 4DM1A 3BMVA 3VIFA 3SUVA 3AYSA 2OWWA 5A2AA 5BYWA 4J3SA 4MNMA 1BF2A 4ZXLA 3DHPA 1DWAM 3DECA 4AXNA
chains in the Genus database with same CATH superfamily
2QUUA 4XIMA 1LLOA 3K30A 3O05A 3IJDA 2DORA 4LNYA 1PIGA 4M6PA 2V0TA 3GHUA 2GYIA 3W1LA 1RAKA 3PZNA 2ZVIA 4UBPC 4URIA 4ZSUA 4HA3A 4FX6M 3LGGA 1PBGA 3IACA 1JQVA 4MAZA 4KS0A 3MHGA 3NTYA 1N7KA 6TIMA 3VD5A 3WD2A 1RR2A 4Q4PA 4IJBA 1H49A 3ITCA 3SGGA 4B5VA 3VIHA 4H9YA 1E5JA 2HDJA 5IXEA 5T26A 5CGMA 2JE8A 2FB3A 1VEMA 1H7XA 4JYDA 4US5D 3WYZA 1S1RA 1W3TA 4HTYA 1IWAA 3W1MA 3U2ZA 1PX3A 3QMSA 3EX6A 2PDFA 3WBYA 1WAWA 2YX0A 4O8AA 3SCQA 1EPXA 1TA3A 3I10A 4BQ3A 2DIJA 3A12A 1F8IA 4FR6A 2PUZA 5FEWA 3UPMA 1J11A 4KFNA 3B0VC 3EPNA 4IMFA 3L4UA 2FVLA 3L9CA 5H2ZA 4OGZA 5E0FA 1O5RA 4KCTA 3TK7A 4H8NA 1Z69A 4O1AA 3OO2A 3W1XA 1OG6A 3U0HA 2CPUA 2WHKA 1ZJAA 1SM9A 2QUMA 3WD3A 3GVQA 1PZ0A 3WUBA 1E9ZB 1FDYA 4QNEA 1XRSA 2OXNA 3HU7A 3SB0A 3M1ZA 2WJFA 2GJNA 1UPPA 1JIBA 5DCBA 2Z6JA 4HU8A 1YBQA 3LM7A 4ASTA 3DFHA 3I3BA 7TAAA 4ZO7A 1UKTA 4LBSA 3CPRA 1KM3A 3VGDA 4TUFA 2OG9A 4FPSA 4G2DA 1FY6A 5JQ9A 3N17A 4JKMA 2QJJA 1FQ0A 2KAUC 3H2EA 5I23A 3FJ6A 3TLQA 2WM1A 3VX0A 2MANA 4J5NA 4Q8MA 3MUXA 3NYDA 3LPGA 3ZS4A 4PCNA 3GXIA 2WVVB 3CIWA 4IXXA 2BFGA 1PXGA 3EB4A 3ZIZA 4FF5A 1V7AA 2G3MA 3GYCA 1Y7VA 3WQCA 1GHSA 3FDGA 2RDWA 4AD4A 5CZSA 2QXWA 2UY2A 5F1VA 1H41A 3GX9A 2ACUA 2IKHA 4XKYB 2X7VA 2XVPA 4LEFA 2DH2A 5FAJA 3OGSA 3UWVA 1TJ2A 4GVIA 3KW3A 2VQTA 3BW4A 3OP2A 4PMRA 1R3WA 4YTRA 3FA4A 4D2JA 3T4CA 3QSRA 3M47A 1ZRQA 4ICMA 1I6NA 3DIPA 4N2YA 1JCNA 3UXLA 4A29A 4GYFA 4F66A 4LVBA 4TVDA 4DZAA 3M0ZA 1W3NA 3WNMA 3JS3A 4NKCA 3S2LA 1V3IA 2HMCA 1DORA 4MMWA 2PU1A 3SCWA 4A21A 2IXVA 4WDTA 1EXBA 4F9JA 1TPDA 1JDEA 4RW5A 3TCSA 1H7WA 3II1A 1K9DA 5EPDA 4X2PA 4B5WA 5TD4A 2FVKA 1K8YA 1HVQA 4RDYA 4P7OA 2WWCA 4LYPA 1HJVA 4ZOCA 5B7YA 5E1QA 1E0WA 1AJZA 2ZIDA 3P2VA 4AG0A 5C6MA 2QCDB 4LY8A 5T8GA 4C6FA 3ES7A 3CB8A 5AVHA 1UD5A 4QJ3B 5F2GA 3FYOA 3B9AA 4GK8A 3QTGA 1JL8A 5CPLA 3UG8A 4JN7A 4W84A 1XLLA 1S5TA 1DL3A 4O12A 1WA3A 1PKLA 1FWJC 2Q3RA 3IJ6A 1IXPA 4Z42C 4H7CA 1K7XA 5K9CA 4GFIA 4U33A 5CBJA 1O1HA 2AQVA 4JYFA 4MF4A 3WBEA 3BPWA 1YIXA 4RKAA 2QZRA 4CQCA 3NYZA 2I1OA 1K4HA 2WPGA 3MQTA 1US3A 3M44A 1VH7A 2ZXQA 3SCPA 3WQEA 3EWZA 3B4YA 3U6WA 2WQPA 3NDYA 1DTUA 1GVEA 3BW2A 3W7QA 2AQOA 5JVLA 1FWGC 3WUGA 1CXKA 3VU2A 4R7JA 4IIBA 1WP6A 3AIRA 3MHUA 1I8JA 4UCGA 2BDQA 3PG9A 4MSSA 3BV7A 1BWVA 2NXIA 4YPJA 3V18A 2JFEX 1W2PA 4F0RA 1UBSA 3N19B 2VXNA 3HG2A 4FOKA 3M41A 1Q7ZA 4JFUA 4D8AA 2ZBTA 5KMYA 2OLAA 2DZPA 4XV0A 4Q6JA 1DXIA 1KFJA 2B81A 4KGJA 5T9CE 4K8GA 3EAUA 3GDMA 4PTMA 4LCRA 5HNRA 2F6UA 2E77A 3HGSA 1XRVA 4QISA 2EG8A 2Z1BA 1B90A 3GIYA 2A6LA 4CCCA 1YMYA 4WIWA 4IJRA 3UCQA 5GJPA 2P0OA 1FP8A 1UKOA 2VM8A 1VEPA 1TWZA 1SUXA 4FNUA 3S1UA 4NILA 3BGJA 3PN8A 3GZ3A 2HVNA 3YPIA 3B97A 1DWJM 3GFXA 1QXLA 2PEVA 3TA9A 4XQ6A 4WY0A 3MPGA 3RYSA 1EGMA 4RK8A 2OQYA 1JRCA 1KCXA 3U8GA 5AHIA 3E2SA 2OU4A 1UD4A 2YGYA 3LK6A 1KFBA 2EG7A 4UUIA 1CENA 3DH7A 4LALA 1K9EA 1I75A 4DJFC 5MKGB 4D8LA 1B3VA 3HN3A 4HQVA 3L0GA 1TUFA 4Z2LA 2EPNA 1UD8A 4IM4A 4EPBC 2PTYA 4K2SA 3APGA 4Z17A 4A22A 4DEFA 4DI8A 3NL2A 2WMFA 4AD0A 4D72A 3WF4A 3T40A 3N2OA 3VGFA 1UR4A 3W87A 3N25A 4H9XA 4HK5A 2P0IA 1YDYA 6TAAA 2C0HA 4AMCA 1GTEA 2FPVA 3UETA 2Y8UA 3DHDA 3C0SA 1FWTA 3I6EA 1FH7A 3ZOAA 3OHIA 5K4ZA 6PTDA 3LB0A 5D8ZA 3HPZA 4DUOA 3KS5A 1ML1A 4MKSA 3KVMA 1VBJA 1LRTA 4LVAA 1YHTA 5CLWA 1KCZA 3KCLA 3FLUA 2ZA2A 3DBNA 1G94A 3NL5A 4GVHA 1TR9A 4ZODA 4OBSA 2J13A 3WQ5A 4A05A 1RY0A 1S5MA 2GGEA 2GJXA 4DI9A 1ZY9A 2QUVA 5I6SA 3SN1A 4YNGA 3FA3A 1E6RA 4JL1A 4KIRA 3HF3A 3TNOA 5DT5A 3S1VA 3CPGA 1GVIA 5LNRA 2DZAA 4XUYA 4R7OA 4IPIA 1VJIA 1GZGA 1XYAA 3W81A 4ZCWA 4M5PA 1LUCA 1QOPA 3FCPA 3NEVA 1Q4WA 2WKJA 1VYRA 3V7PA 2OGJA 2V5JA 1LJYA 5BXTA 2J9XA 1I0DA 4ZB5A 3D47A 1KV5A 1RQHA 4IG2A 2NQJA 4EF9A 2Z27A 4QROA 2D2JA 3C2RA 3P74A 7TIMA 3TJIA 3UR7A 2PTDA 2ZXBA 3NA8A 3ZR6A 1CGVA 2XPKA 3CZGA 4BY3A 3F4WA 2QYGA 2AAMA 1QTWA 4LTSA 3P0WA 3OOQA 4I6VA 4O1EA 3KBNA 4ERIA 1A5LC 4PN2A 5D37A 3AZRA 4PTDA 2PGFA 1D7KA 3WLMA 4QJ1A 3UVAA 5I02A 3VOGA 4EPEC 2J27A 2OODA 3CGTA 4REQB 1E1EA 9CGTA 2WVTA 4UFKA 4YN5A 2EGZA 3TYEA 4AY8A 1UZ1A 4MKVA 1ICQA 3CPUA 1IZJA 3OLDA 1KM1A 3SCTA 3H7UA 3T1GA 1EX5A 3GTNA 3S9IA 3WF0A 4TR9A 2CZVA 1DJIA 1B4EA 1Q66A 1QJWA 3VVGA 1DOSA 2XVLA 1XL9A 1EDGA 4PRWA 1BVWA 2QJMA 3WK1A 1NOWA 3RO8A 1X6LA 1L8NA 4MZ8A 1DWFM 1EC8A 2C8NA 2Q8LA 2XIIA 3VIOA 4KEVA 4E4PA 5AYBA 3A64A 5HATA 1AJ2A 1KBKA 4O10A 2DVXA 5FESA 1S3HA 1BGGA 1L2UA 3GHTA 4DF0A 4CQBA 1BVZA 1R8LA 2XIQA 3H12A 4PTWA 3RN6A 1P1MA 4ZXOA 1QPOA 4R27A 4EVZA 3IS4A 2Y0FA 1FCQA 4L6HA 3WJXA 5DLCA 1E6QM 4GQQA 4RZBA 1FX6A 4H7VA 1MZRA 2ISSA 3EOEA 4MADA 2PWHA 5JBDA 1UASA 3GFYA 3VNZA 1C8YA 3IIOA 2J7GA 1REQA 3W2KA 2PGWA 3D3FA 3W7MA 4H4IA 3CHEA 2OSYA 1TV5A 3VOJA 3EA3A 5KZ6A 3CU2A 4AFYA 1UH3A 2EEXA 2WCGA 1DIEA 2QIWA 1D3CA 4XD5A 5I3IA 2TMDA 3SADA 4C1NB 1ZBKA 2JQXA 5BWFA 4QG9A 2ZXAA 1X1NA 4B3ZA 7ENLA 2Z26A 2NX9A 1VBUA 2DJLA 3LERA 3AOFA 3NM3A 2VEGA 3LUTA 2QAFA 5LYRA 3W2NA 1XLKA 3POHA 1JAEA 4L4PA 4HZ7A 1SPQA 2VFHA 3W7IA 5C5YA 5A6LA 3HG5A 2PODA 3STEA 4UTIA 1A5UA 3M0YA 1HG3A 3P67A 4H9VA 3RF9A 4Z2KA 1R47A 1TJRA 3SUUA 2VZUA 3W6LA 3GK0A 4GJIA 1ITXA 4PMXA 3BLOA 3SCOA 2XG9A 3LHWA 1GORA 1VPXA 1SJCA 3Q37A 1T0OA 3ANVA 1OFRA 3IJ8A 4L9YA 2CWXA 3RUBL 4PTNA 2CLPA 4GUGA 1R87A 3AIVA 2CKSA 4AWUA 3PJTA 1VCGA 3G1RA 1PKMA 1RQBA 4W88A 5D2WA 1YNPA 4M51A 5D9MA 2VRQA 2YW3A 1YTKA 3TH6A 5EB8A 3CC1A 1MUMA 3TC7A 3W70A 2VZOA 3KBWA 3RIKA 1G4TA 4JTDA 3KWXA 4HYRA 2P50A 3L2LA 4NJHA 2OWXA 1GYNA 2FHFA 3VIMA 3F1QA 4IIEA 2F9RA 3R0DA 3TWAA 2QMKA 2RAGA 1V3MA 5A69A 1LWHA 5A95A 3FAXA 1DWGM 2TRSA 1AZ2A 2DVUA 4ZFCA 1N2VA 4JOMA 3RU6A 3MBDA 1W5QA 1ZNNA 1H63A 1A3WA 2G0WA 3VOIA 1Z42A 2VFGA 1BG9A 4DO7A 5G1MA 2OCZA 3DUGA 4PFHA 5KINA 3NQCA 4WJ8A 4LNCA 1AJ0A 1S38A 2PTXA 1GKQA 1I9CB 2WXDM 4CKQA 3RRAA 3AMKA 3GUGA 3CUGA 4GJJA 4DXVA 2RJHA 2FPTA 4CD6A 3OG3A 1QCWA 4O13A 3KLKA 4UTLA 2VX5A 3MSGA 3T09A 5G2WA 3TYBA 2VHLA 3BV4A 1RCQA 2ODOA 3T2OA 4UNLA 1SO4A 1WPCA 3QW3A 1ICPA 1WDRA 4ZO9A 3CO8A 3R43A 3TXVA 2Q6ZA 1KXHA 3FYYA 4CQ8A 3QY6A 4UNIA 4H9TA 3BMWA 3NDZA 3NPUA 2X41A 4FSAA 1FCBA 1FH8A 1EJXC 1JR1A 3T7VA 5FA5A 3HPSA 3DHUA 2CBUA 1V4YA 2XWEA 1E4IA 3WD1A 4IJCA 3W76A 1W9UA 4UC5A 4HK7A 3WQOA 2W62A 3EA2A 2Z1XA 2PZNA 3HURA 4OOZA 3RAOA 3RLHA 2GGGA 4HJFA 3H26A 3RXZA 3VINA 4WRHA 1GQLA 1H62A 2FFCA 5B80A 1CT5A 1IEQA 3CJPA 4IX0A 1KCLA 1WOBA 1ZJHA 3PUOA 4ZL1A 3DG3A 5LXEA 1J93A 4KRZA 1GOOA 3WDQA 8A3HA 4IPNB 3UERA 4JFWA 2TSYA 2Z0IA 3A24A 2GVEA 4N9BA 3W7GA 2EF9A 3AIUA 1R30A 1ZTVA 3UXIA 3DGRA 3TTYA 1SMAA 3L5MA 3N3TA 2NSOA 3FV9A 4W8BA 3CAWA 3PAJA 3TCEA 2OO0A 3DERA 1EPVA 4JR5A 3GBDA 5CJMA 3L65A 2ANUA 3WX7A 1V02E 4HN8A 4XISA 4XKYA 3VNDA 1Q65A 1X7FA 3EX1A 4OTKA 1PDYA 3ZJKA 5HPCA 5DX7A 2BXZA 4GH3A 5BROA 5C9ZA 1UHVA 4N4PA 4KPLA 4DQWA 5A8QA 1MXDA 4N9DA 4G7FA 3SFKA 4CD8A 1OFQA 1W8SA 2QEZA 2HNEA 1JDDA 2QAPA 1UJQA 5FJOA 3SCUA 1QBAA 3EZ4A 1FCVA 1OD0A 1M7PA 3FKRA 3OODA 2RHGA 1VHNA 4IMCA 4YHGA 2ZZ2A 4IF2A 1XD0A 2ZX8A 3KTXA 1KQZA 4AB4A 2NLYA 3W84A 1W5PA 3SDOA 2WJZA 1SO6A 4IX2A 1WYIA 5K9DA 4U3AA 1AW5A 1B2YA 3ID7A 4AIBA 1HJQA 5KSWA 1OM0A 3LHTA 2IQ0A 5LHEA 2E25A 2WSKA 3RR4A 3TSBA 2WO5A 1OK6A 3UWQA 1QPRA 1U5VA 4UMCA 5HWMA 3UJSA 3W1RA 4K39A 4RPPA 3T0AA 1CXHA 3EDFA 3TYCA 4LV4A 4DJFA 2DUXA 4XKMA 3B05A 2HE5A 4TTUA 1SR9A 3T81A 4OOUA 4O54A 4P8UA 4LAMA 2QKFA 2W91A 1N8FA 4V2XA 3SUWA 1KCKA 1TR1A 4IL2A 5XINA 5I78A 3IJ9A 4FIQA 1ISYA 3P81A 5L6UA 5DXXA 3W24A 4DWSB 3EKGA 3L0KA 3O63A 2ZUSA 1Y8BA 1W3IA 2ZA3A 1R3SA 4NYUA 1BQCA 4E38A 2WVSA 4DUWA 3RNDA 4OV4A 3VIJA 1WBJA 3L67A 3KDOA 2D22A 3TSDA 3TONA 4TMCA 4QJ5B 3GR7A 3KP0A 1JRBA 1E3ZA 3P82A 2Y62A 2QPSA 3M0LA 1HL8A 3QEZA 5AC4A 2QULA 3LV6A 4GXWA 1NSJA 3IK4A 3B9DA 1XINA 2HS6A 3BURA 3O0FA 3CL8A 2YKKA 4J35A 3W0KA 1V0KA 3M5YA 3SECA 5JUVA 1NDYA 3UEQA 4HZ6A 4UXDA 5FF7A 4AZHA 5T9BG 1QRQA 1JPKA 5LNVA 1XBVA 5CCZA 3FAWA 4R34A 3FHQA 1JXJA 3KL0A 1V3LA 1JDAA 2WMGA 2P8BA 4Q22A 1B5TA 4LC6A 1NU5A 2FDSA 3M0KA 2JEQA 5K2ZA 3S6DA 4DWDA 5HPOA 2AMGA 1ICSA 1UC5A 3TUUA 4D6GA 3A3HA 1JULA 4GC3A 3WQWA 5A8GA 4OUEA 4LRTA 4RX0A 5AHEA 1SGJA 1EO7A 2BG5A 5CSRA 3W01A 1W9XA 2HVOA 1T40A 2OZ3A 4FNQA 1G69A 3POCA 3GR8A 3T6CA 4PL2A 2NV1A 5M5DA 1TTQA 1JFHA 4KEZA 1UBPC 1CEOA 4XWUA 2J75A 3O6DA 2WZTA 4L4MA 3RJXA 2HJPA 1QK2A 1S2VA 2V5CA 3I4KA 4OHQA 3W1NA 3PZVA 4R33A 1W8GA 4D6EA 1LL6A 3TFCA 5FSDC 1XIDA 1C93A 3NFUA 3A9IA 1TWIA 4UTWC 4D6JA 1TELA 3AICA 3KOXA 3HTWA 5C9WA 2A3HA 3NG3A 4HN4A 3ZYZA 2VNCA 2PMQA 1RPKA 3GAKA 4QP0A 3P62A 4B5NA 3H23A 5BRQA 3S2NA 3EKZA 3EWBX 3TYUA 1BXNA 4DWSC 3EPMA 1VQTA 3WUEA 2D3NA 4KFOA 2A85A 3FY1A 2V30A 3K13A 1YPXA 3SN4A 2OJPA 5PTDA 1OSEA 3NL3A 1O7AA 2VFIA 1A5OC 4GIYA 4JNYA 4LS0A 2WCAA 4EIVA 4EAMA 1TV8A 4GNKB 4DBEA 2ZX7A 4TX9A 1VPYA 3AUJA 1IYXA 3LS9A 1UUMA 4JTHA 2OKOA 5K3VA 2WW5A 5AHLA 1UMLA 4X22A 4BEQA 2WNNA 1M01A 2OT1A 1SFLA 2QDEA 3CL7A 4FNTA 4W5ZA 1BTMA 1P48A 2XFYA 4GY1A 1JZ7A 4DPPA 3EPOA 3HQOA 2X30A 3DFYA 2AKMA 3UBPC 4D6DA 3HMCA 3W29A 3TU9A 2HSAA 1KGUA 3QMRA 1RLCL 5AYIA 4PYSA 1BWLA 4YMZA 1W5MA 5F4SA 4HD5A 1Z41A 1X97A 4IT1A 1NP0A 2X1IA 5CZKA 1A0DA 3BK0A 1KXQA 1OADA 1POKA 3HQ1A 1OYAA 2BNJA 4EAYA 3K46A 1GONA 4A3YA 3APYA 1BRLB 1WE5A 3CT2A 4N02A 4EPKA 2WSRA 4YCOA 1NTHA 4PE8A 1XG4A 3M0VA 5E6ZA 5EMYA 1IIGA 1W9PA 3LTYA 4E8DA 3WJWA 9XIMA 2REQB 4Q8UA 2ZZ4A 2HXUA 4LVGA 2WB5A 3BAXA 2YL9A 3NO1A 4NZ4A 2EPKX 4C1LA 2FFIA 1QI3A 1RCOB 3CT7A 2C7FA 3ITGA 3EWUA 3FK4A 4UIOA 1KWGA 1D8CA 2YL5A 3S0CA 1YNQA 3NUKA 4ERGA 3WFLA 1EJWC 4UFIA 5AC8A 1GJUA 3DOPA 1ECEA 4REQA 5I0DA 4PMJA 2Y89A 1GEQA 1F76A 3ZVHA 3DFOA 1M03A 2PDWA 4GWEA 1R85A 3NO3A 2HISA 1HGWA 1J0JA 8TIMA 4ACYA 2FGZA 4WLCA 1M65A 1XIBA 3FVMA 3T9PA 1K02A 1Y65A 1V6YA 1TPC1 2ZADA 4FXFA 1V3KA 4BZYA 2VWSA 3N9KA 3QKEA 3UCCA 4A6GA 2YCJA 3WMCA 3FIGA 3BVJA 3DKLA 4QXIA 3SJNA 3EDDA 2FQIA 3P80A 3AS1A 4ZO8A 4O53A 3CQHA 2BB0A 2Y5SA 1EJRC 4N6EA 4HHPA 4XAZA 2J25A 1H4PA 3ZFHA 4GUFA 1OCQA 4L1XA 2QVNA 3CAQA 2PAJA 3G1VA 2O92A 1AQMA 4Z0SA 3EOUA 4XZMX 3MW7A 1MNZA 3WLTA 1JI1A 1NAL1 3VMPA 5CSYA 1H2JA 2Q3OA 1UWAA 1F6YA 3PZIA 5RUBA 3EKLA 1VFUA 2YDSA 1GW1A 1A3XA 2D20A 4IFRA 1AH3A 2DW6A 3ZMRA 4C6NA 3IRDA 3LMZA 1EF2A 1S2WA 3VFLA 4ZFMA 4GI8A 2UZ9A 2E5CA 1OHLA 3VKDA 3SRKA 2GSEA 4X0VA 4XZBA 3M64A 4BF7A 1FWHC 4I3GA 4I8DA 1ZENA 2VX4A 3KE0A 5LNSA 4UFJA 4C6CA 1GQNA 2C1IA 4EPDC 3VM5A 1YDNA 4KH2A 1IEWA 3NQ8A 2MUCA 3PBVA 2Z1KA 1YE6A 3AIBA 5AHNA 1UR9A 1TE1A 4O0KA 4C91A 4Z1CA 1NVMA 4QNWA 1QO2A 3SO7A 2HNHA 4PMUA 1GPWA 2X0YA 4IMGA 5HJXA 4O11A 1BPLB 1ITCA 2PCQA 4ZQNA 3E5BA 5U4NA 1FDZA 2FZDA 2VCBA 1JUKA 2CNCA 1XW8A 1QT1A 3QPYA 4W89A 1Y0EA 2BGNE 2WPBA 4U3CA 2PC4A 1P43A 2P88A 2DVTA 2Q71A 4ZQCA 3N6HA 4M6UA 4M7TA 4C1KA 2F8QA 3SRHA 4LV9A 3B9NA 5FJJA 4J28A 3W7JA 4U28A 4JTQA 4OV9A 4FO4A 3C3NA 1J4EA 1PCWA 4LGXA 1ALDA 4RE0A 2YSWA 3PSWA 1VHCA 1S3TC 3N11A 3C3UA 1Q6CA 2R9RA 3VO0A 4H19A 4JCMA 4NAEA 2CCRA 4WKAA 4YVVA 4A8IA 3GC4A 2W5FA 2FZNA 3NQDA 1QK0A 3QR0A 3NSXA 3CZEA 3FJNA 3EXSA 3RHGA 3ZO9A 4GA8A 2R94A 1EL3A 3GVGA 3VKJA 4LC8A 2OT0A 5ABHA 3RGTA 2PC8A 2PDCA 1YLVA 3A22A 3BMVA 3VIFA 4BJHA 4NT0A 5A2AA 3IGXA 5BYWA 2VD9A 3W7KA 1K70A 2PP3A 3DECA 1NDWA 3BCFA 2FVMA 1XKJA 3CZLA 4PUEA 1W1TA 1U1UA 3W83A 5CEWA 1EX1A 1ODUA 4LY4A 1TIMA 4GIRA 4N9EA 5HUOA 1KC7A 2PDUA 2NX1A 1JUBA 3DENA 5DBTA 1W1ZA 1UUQA 4CNNA 3W02A 1T99A 3NCOA 4H6EA 3V0UA 4J3XA 4M3PA 1CXEA 2P3EA 1X38A 3JRKA 1UP0A 2RGMA 1AUSL 3E3HA 1XSIA 1XLDA 1U5HA 1P0BA 3LENA 3VD4A 1C90A 2OB3A 3BG9A 1UZHA 1RCXB 2ZZ6A 3WSUA 4ZSTA 1B57A 3ITLA 5D2VA 5HUPA 3EWYA 3E12A 3H4WA 3LI1A 5B7ZA 5LIXX 3C61A 1SJAA 2D0HA 2V5KA 3AS3A 4WCJA 1H7NA 3DG6A 2PRHA 4MWAB 4R53A 3OVPA 4Y90A 2W3ZA 3IIXA 4JS3A 3TN6A 3WBXA 3U3HA 4BI7A 1RXOB 2ZKMX 2QHAA 4MB4A 3O16A 1V7YA 2Z2AA 4GQBA 2ZE0A 4GNVA 5G4WA 5HXMA 1W54A 3E49A 3C8NA 2IKJA 1UB3A 2WM0A 3IUIA 4US6A 4NXKA 3GNXA 1C9WA 2I57A 4JN6A 1OX5A 3R8GA 3ATYA 2ZUNA 4Y9NA 4FS9A 3IUDA 3P0XA 4E8CA 2JF6A 3IJLA 5JU6A 4HHLA 4U2ZA 1XLJA 4JY9A 1OGGA 2E09A 3VTRA 3AU6A 3O15A 3L0NA 3V5CA 1H7PA 1L2QA 3C5QA 3N18A 1XIEA 3V5FA 4FALA 1B4KA 4O57A 3OGVA 2GK1A 2ACSA 1UR8A 3AZSA 4DJED 3C0JA 2BP1A 5D09A 4WY0F 3BG5A 2W0UA 1WO2A 2WZIA 1WNOA 1GOKA 1U5JA 5H8UA 3A3WA 1PWLA 3EBVA 4YHEA 4IQJA 4Q8TA 2YL8A 3KOFA 3VMOA 2VEIA 2WHLA 1FH9A 3LGEA 4M7SA 2XIMA 3KBJA 4Z0JA 3VD7A 3GIPA 2XVKA 5I00A 4B2DA 4PB4A 2J7CA 4J3ZA 4MPQA 4RXGA 4B4FA 2PDYA 3U4AA 1VGAA 1Q5MA 4O1CA 1BF6A 2A2IA 3FGCA 2DSVA 3WQFA 2GVJA 3DAQA 3ZSSA 1D7FA 1M7OA 3WQPA 1QDSA 3N6QA 1B9ZA 1XRTA 1V93A 2VUNA 2AL1A 2ZVRA 1VPQA 3SY5A 4FF7A 1E0VA 2ZRWA 3RDKA 2PFHA 1I2RA 1PIIA 1E6ZA 2GVLA 3KFTA 1F6PA 4PBEA 1XLMA 4WDUA 1PX4A 2WSYA 3VKBA 1IT7A 3GHRA 4PCSA 4QCFA 2DP3A 1EJTC 1XDLA 4W4QA 3W6YA 1SZRA 2DFAA 2JGQA 3BQ5A 3PY2A 1F2JA 1QPNA 2CLLA 3MWAA 4H6KA 3W7DA 4OIFA 3H24A 3PS7A 4S3EA 3GR4A 2HCVA 4ZE5A 1CPUA 2PWDA 4L4LA 2RDXA 2V3FA 1WDQA 1EGZA 1XGDA 2BX7A 1FWWA 4UNKA 3BAYA 4GBUA 3MO4A 2I5IA 2XUCA 2HVMA 1G1YA 3QW4B 3RM9A 4XD3A 2A3EA 2VDGA 3H53A 3E0LA 3QH2A 4N0RA 8XIMA 3SCNA 1W3HA 2ZC8A 4UTWA 4XBKA 3OBKA 3WMLA 3GNNA 2A0NA 3TDFA 4IUOA 4MJ2A 1ME9A 4HB7A 4HU4A 3UZWA 2PLJA 5C70A 3ZT6A 1PS9A 2INEA 3IAPA 4UWMA 3ABXA 5K4XA 3GLCA 4JIIX 4UQDA 3OVRA 1WCGA 1MQQA 2CZ5A 4DWSA 2FZ8A 1FFRA 5A8PA 1GZ1A 1F9CA 1ONXA 4Q8PA 3WCZA 2YW4A 4DBDA 4LB4A 4C6MA 4WSHA 5LGZA 1LOLA 1CCWB 3DN5A 1AD4A 4J2MA 1LF1A 3FXYA 4HCLA 4M8UA 3AFBA 4O28A 1J2WA 4F0HA 3M46A 4K37A 1TPEA 4Z2HA 3JW7A 5LGXA 3THDA 3AC0A 4UQBA 3CWNA 4ATDA 1ZGDA 4YVPA 2PDKA 4UOJA 1ZCCA 2INFA 1ENUA 4MTVA 2HXTA 1HZYA 1PB0A 4Q7IA 3L12A 1GVQA 2VD8A 5F4XA 3JR2A 2FMNA 1O6IA 3W2JA 1S2CA 3MKCA 2BVYA 3H2MA 4NZ3A 2DZUA 2YFOA 3LTSA 4KETA 1SZEA 3CH9A 7XIMA 1TSIA 4DRSA 3S1WA 4EE9A 4CU6A 1DJYA 4ZQOA 1SJDA 2PPGA 1XIJA 3CS2A 1KFKA 1PTAA 3ELFA 2OFJA 3TYZA 4GI6A 2OLHA 4MB1A 4NI3A 4JXCA 1BYAA 3MI6A 2VKZG 2NWSA 4UOZA 1MQPA 3BE7A 1OABA 2NZLA 4HSHA 3B8VA 3WL0A 2NQHA 2OX4A 1ISWA 1CWYA 4GX8A 4BA0A 1EYWA 4FXSA 5D2XA 1NDZA 1TTJA 3ZJ8A 4HA1A 1WXZA 1WDDA 2X2GA 1R7OA 3AHVA 1JQXA 1GG0A 5FJIA 4HA0A 5IDZA 1CLVA 3CLWA 3UR5A 1OK4A 4K1WA 3U7BA 3ZT5A 1QFEA 3S4TA 2R1KA 1L8PA 4ML4A 1IQ8A 1Q4NX 2GFTA 5JMUA 2RGLA 2ICSA 4CVWA 1DJHA 3ITOA 5A6BD 3GW3A 3GXTA 5ABGA 3EX3A 1YYAA 3CWOX 2P1FA 2WZMA 3EA1A 4I9TA 4UTTC 2J6XA 1DTNA 1KTBA 5D03A 3M6YA 1XUZA 4WX2A 1QNOA 2G5WA 2PSNA 3KRBA 3RM4A 5FD0A 4TVCA 1IF2A 3NNTA 1W31A 3SN0A 4EF8A 4GCXA 2XGZA 5HULA 2A7PA 2J78A 5AFDA 3BWWA 1MFUA 1DV7A 3ITTA 1V08A 2X05A 1UD3A 3DFQA 5HINA 2Z6IA 3VCRA 1X8CA 2GLKA 1F05A 2QGYA 3T42A 3Q67A 1L0PA 1YQ2A 1QWKA 2H8ZA 1EJ7L 5FF2A 3AXKA 1UUOA 1UW9A 3UNTA 1DQWA 2XSAA 2EG6A 1MMFA 2PZ0A 4AEFA 3BLFA 1H61A 5AZ1A 3LNMA 4YYFA 1O94A 4XZLX 1ZJBA 3I6TA 1PZ3A 5CKSA 1J0ZA 1N8IA 2NQ5A 3SIMA 1JGMA 5JIWA 3LQLA 1DQUA 1GOXA 3MSYA 5I06A 4S3CA 1EO5A 3KDNA 1GT8A 1XF0A 2WNQA 3F4NA 2ZWYA 5CLTA 3NXFA 1B54A 4W87A 4NZCA 4B5UA 4RNFA 1M5WA 1A53A 3UG3A 4Y8EA 3E1F1 4U5KA 2VC7A 4O1DA 2HBVA 1C91A 3KRZA 1B1YA 1MO0A 2QPXA 4XAFA 1BRLA 1W91A 1VYPX 2OMAA 3TOYA 3WDPP 1Q7MA 1VJSA 4J2PA 5D02A 1BVNP 4GNJA 1FWFC 3MT1A 2REQA 3CIXA 4QAIA 2VVNA 1VC4A 2C3ZA 1K9TA 3OA3A 3TNBA 4L80A 1XPYA 4UQCA 2WMHA 2R91A 4C5ZA 1M7JA 1CW2A 1VRXA 3PBWA 1XJBA 4OVXA 1Y5WA 2J6VA 1VF8A 4JTRA 3IIVA 2GJLA 3EX4A 1XYCA 4WD0A 1TJ1A 2W63A 4Q7BA 1OG0A 2VEFA 2X40A 3QV9A 3OTRA 2Y8VA 3F5KA 4QHRA 4Z1DA 1HVXA 4ZENA 1CGTA 2O9PA 4GHRA 1UOKA 1BSIA 5AB3A 1VCVA 3LHZA 3GC2A 2DQWA 3UR8A 1N55A 1YPIA 5CC5A 4HCDA 3VDHA 1IHIA 2QCNA 5DANA 2CHNA 3TMQA 5DY3A 3A9BA 3IPWA 4DJDC 2GQ9A 4FLQA 4ZMGA 1PYMA 2UBPC 4HSNA 4PSPA 4NRRA 1OB0A 3L5LA 3PANA 3B8IA 4MY9A 4AWEA 4RNHA 4Q8QA 1TPWA 1U2YA 2WNWA 4H3DA 1QWGA 1FWSA 4BS0A 2WZHA 1U33A 1L6SA 2PI6A 1EZWA 4RXFA 1Z32X 2CXEA 1W32A 2PF0A 5D8WA 3VOHA 1QNRA 4V27A 1MXSA 2FGLA 4X2RA 1VFFA 4JPGA 1P7TB 3SY1A 4P7LA 3ARUA 1V79A 3FKKA 7A3HA 4NF7A 4XSMA 4AF0A 1E15A 5HWNA 3LI0A 2EJ1A 2CBJA 2RKXA 2D0FA 1B3WA 3ARZA 1PWMA 1QNPA 5AHFA 6XIAA 2WJDA 1K1DA 1EOMA 1XG3A 1JZ2A 1E4LA 1MW3A 4I5RA 4HMCA 3AXMA 4JIQA 1PZ1A 4PUNA 2WQDA 1V3HA 4W5UA 2E0PA 4IFKA 4GG9A 3ALFA 5M03A 2ISVA 2R1LA 3S1GA 1KLYA 1QATA 4OT7A 3DX5A 1OX4B 2CZFA 3QV6A 3O8AA 4U31A 1TRDA 3R8RA 4XTDA 2B7PA 3W73A 5C2GA 1R6WA 3ITVA 4INFA 3FSTA 4K8HA 3SSJA 3S9YA 1H7RA 3W85A 3QMTA 4DLMA 3UG4A 4CQAA 4C5YA 2NXHA 3L5AA 2QV5A 2POTA 4ALDA 2WC7A 2DUZA 2H8XA 3NL6A 4E5TA 2PRLA 4UTFA 3B0YA 1C3FA 4RV8A 1D3GA 1UR2A 3R5EA 3UPBA 1W0MA 3IGUA 4GISA 3TIMA 3S8HA 4IMEA 1HL9A 1US0A 3M16A 1LBFA 2E40A 5GPRA 3PZMA 3R6IA 4Q3MA 4W7VA 3IAQA 3MYPA 3PWAA 3Q45A 3W7LA 1W17A 1UWIA 4AH7A 3E9AA 1W2VA 2W67A 4NXSA 1ECQA 3TJLA 4Z08A 2G3FA 1LUCB 3VNIA 3WK3A 3BICA 3FDKA 3G3DA 3LRLA 1I45A 1R3TA 1Z48A 1BYBA 3VD3A 3LXCA 4IG2B 1HIZA 1HTIA 1ZAHA 1YTDA 4XX6A 2ZWZA 1TCDA 5D9PA 5HAOA 3LEPA 3GSMA 5FJTA 2VWTA 3GHSA 2DGAA 3W86A 5BOEA 4IGSA 1KBIA 1NFGA 2HK1A 5FF3A 3PULA 1NEYA 2B7OA 4TIMA 2DSWA 3GG0A 1PPIA 3GFZA 2AGKA 2QDDA 1TO3A 4GI9A 1V51A 4WJEA 1K6AA 4M6VA 2XSXA 2Q8XA 1MDRA 4G56A 3NPXA 4CCEA 4QS5A 1MUWA 1QW7A 1BTCA 5A1AA 4XAPA 4GMEA 4LU0A 2Z00A 2NWRA 1N8WA 4AIUA 1KD0A 1Q85A 1V02A 4YTTA 5FACA 1W5OA 2FYMA 3EWXA 5D05A 1VFOA 4KEMA 5LKYA 3GZAA 1XFCA 4HHHA 3W07A 1YKWA 4GZ7A 5D38A 2V2CA 4LBRA 4ZOBA 4WOQA 5LA2A 2HS8A 3S2MA 1YX1A 1NP2A 3PZ9A 4Y8FA 5EKYA 3NQFA 3NQVA 3JVAA 1CI1A 3AXXA 1KR1A 2O7QA 2WBGA 1LQAA 4PMQA 1SZGA 1G7UA 3ITXA 3KRUA 3PHAA 3H4GA 2TODA 3RR1A 2YXOA 3USZA 3V0TA 1M68A 5BRBA 2J74A 4I6KA 4OZOA 5CPSA 4A8LA 4NASA 3BLKA 2DV0A 4IQEA 2ZUVA 3QHNA 4CNOA 4AWSA 3LM3A 1JCXA 3OYZA 1TX0A 3TE9A 1EKOA 1N82A 4NNBA 2DT1A 4M24A 4GFSA 1LL4A 2RH9A 2UV8G 4JN8A 2TYSA 3VNKA 2QCHA 1REQB 3WQ6A 3VDGA 4GABA 1S5VA 4LF2A 1GJPA 2O0TA 2ZTJA 3KCOA 1QHZA 1D8WA 4KWSA 4GH1A 4MJMA 4O4WA 3TZNA 3ARPA 1CNVA 4FP1A 3WIJA 5HMSA 3R7MA 4KF1A 2YCKX 1W1IE 3AI0A 3H8AA 3N4AA 3WLNA 2ZQ0A 3NSNA 3UD6A 3WENA 2OEMA 2JIEA 5E0CA 2NVCA 1QUMA 3PJUA 2PLKA 5GNYA 3A5VA 3N15A 4IP7A 4W8AA 1UKPA 1M04A 2BOEX 5CC3A 4IIGA 2C1GA 3AMGA 4KIEA 4RE4A 2POZA 3OLGA 4IMDA 3ARTA 1DPMA 4BI5A 3C2VA 2NQLA 4G7EB 4I9MA 3P7YA 3GH5A 4N9CA 4CEXC 3P5ZA 1OZQA 3GH4A 1LLWA 3PFRA 2J47A 3AWOA 4EXBA 3P61A 1BAGA 2HTMA 1GVSA 3NQMA 4PGLA 3B04A 4JFVA 2H6RA 3BSMA 3MJYA 1EP3A 3IIPA 1FRBA 3W7EA 3T08A 3UWYA 3QQ0A 4DO5A 3DU0A 1FBAA 3ISIX 4B90A 4O0ZA 4C6QA 3ARYA 3V35A 4ES4A 4XZWA 4JICA 2XN0A 1G7VA 4UTTA 1Q6DA 2DU2A 2O9OA 2Z4GA 3M0IA 1L6YA 4F2TA 2NX3A 2WMKA 3T0BA 2OO6A 5M1TA 5E09A 1FWCC 1R3QA 3VC5A 4M19A 3T0CA 4LUIA 3VZZA 2X1SA 2PA6A 2NSXA 4LOCA 4DXXA 2ATMA 3AS0A 4FLOA 3RO6A 4PUDA 3RCNA 4NY2A 2CITA 2AMXA 4DY1A 2AL2B 1F3XA 4BHYA 1HP5A 1DYSA 1KV8A 3UP8A 3PFMA 2YB4A 3I7SA 5HK4A 3L23A 1GOQA 1JYVA 1UROA 4DO4A 1I2NA 3EMZA 3MMTA 4IP4A 4ZE4A 2ASHA 3CV7A 1PTDA 3R94A 1HX0A 3TTQA 4HPNA 4Z1BA 1DEDA 3K1GA 1PYFA 1NARA 4UCFA 3K8MA 1AL8A 1JG9A 3TN5A 4AY1A 3QFEA 3D0CA 1HT6A 4I7WA 3BSHA 3DKJA 4FAMA 1RA5A 1UKSA 1ZALA 3O06A 2V38A 1IXNA 1HNYA 5DEZA 3BSGA 3LPFA 4ZQMA 3WH9A 1RBAA 2J24A 3ZZ1A 1E1CA 4S3FA 4GY7A 3SCSA 2VDHA 1W1PA 1R7AA 1AH4A 1RP8A 2D24A 2E6FA 2R1NA 2PD9A 3TQVA 1IWPA 4PTVA 3ARSA 1TQJA 4KRUA 4WXZA 4GUIA 3QY7A 2VZVA 3ZWTA 5LIKX 2ZICA 4MNKA 2VFEA 4XO6A 3GDBA 4QG8A 4GVFA 3VNMA 4W86A 1VJZA 1EZ2A 3ANUA 4FX8A 3F2DA 1OEPA 1U1JA 1VZWA 2XIJA 3UQNA 4D71A 3G18A 4ICNA 5CJNA 5CBIA 3HFYA 3AMCA 3ENLA 1GOWA 2HK0A 2ZFAA 4QCEA 2G50A 4M1BA 1G9HA 5AVNA 5G2IA 4OU1A 1KBJA 4JDBA 4QITA 1O4UA 3GBEA 4L7ZA 5G5IA 1Q3NA 3WFZA 4NNAA 3SBFA 4S2BA 4AD5A 4QE1A 1RP9A 2Y7EA 1WUFA 4L6OA 2VUYA 1MW0A 3E96A 3TR9A 1ADOA 1WXYA 3RCYA 4FXRA 1G0CA 1TKKA 3RPMA 4MVAA 4J40A 5KZMA 2E1WA 1DBTA 4F48A 4KT2A 2XIBA 4MWAD 5CC7A 1QNVA 1VFLA 1Z7AA 3KZSA 4TX6A 1AQFA 1R2SA 3DFPA 1OC6A 5M2FX 4AIOA 1Z3NA 2J4GA 3WLIA 1HUVA 1I2PA 1EHNA 3F7JA 4BCEA 2X8RA 4PB5A 1J5SA 1R46A 4EWJA 2CKRA 2V81A 4CU7A 4KWVA 2WNZA 4HYVA 2G3JA 1A0EA 1JEZA 3VI2A 4MOZA 3MA8A 1UIPA 3PBMA 2Y8KA 2DIKA 1IEVA 4NYYA 1XLEA 3QVQA 1A47A 3F5JA 4HPHA 1YADA 1CTNA 2FZ9A 3R10A 5FOOA 3NQGA 4X60A 4PSRA 1F61A 3ONBA 5G2HA 2QS8A 4DJDA 1ZUAX 3VZXA 3EDJA 4AD2A 3RX4A 4P8WA 2ADAA 4NQ1A 3MUY1 3U2OA 3UCDA 3E0IA 1UWUA 5AC6A 3PNUA 3W72A 3MUIA 5GNXA 5DN1A 1KGWA 1EYEA 4AVNA 3TA6A 2F84A 4Q7NA 2V68A 3H6OA 4QEHA 3IGSA 3MC5A 3BTNA 2ALRA 2NW0A 4E2VA 2FIQA 4OUIA 3IIZA 3DBPA 3VNJA 4AEOA 5DCDA 3TFXA 1U30A 3EEGA 2EAWA 5I3FA 3CMJA 4RV3A 4J3WA 1FOBA 1SJBA 4JTTA 2E9LA 2DT2A 3PTQA 3O07A 3BJFA 1G01A 3S9ZA 3PM6A 1UD2A 2A3BA 4H41A 3VKCA 3UXKA 3LZ3A 1EF3A 3SZ8A 3LGDA 4BQ2A 2PRMA 1CGUA 2BASA 3PJXA 1QHOA 2FTYA 3ZWSA 5D32A 1OT1A 4RCXA 3CQKA 4NIRA 2HV5A 2XM1A 4Q8WA 4K38A 2G96A 1HF6A 1YTEA 2WAGA 3PNZA 4AZBA 1ONWA 3WDIA 3I68A 3L2IA 3EGJA 2OSWA 4A35A 3H2CA 4F2BA 4J27A 4O52A 1MI3A 3HO8A 5DELA 1EDTA 3F4CA 2A7RA 4D8ZA 3W22A 4TV5A 2OR2A 2XZ9A 5A8OA 2Y5EA 3N04A 1QMLA 3L4XA 3W6MA 2WSPA 4C6JA 1KFEA 1XKYA 3WJYA 4JIEA 4N4QA 3PJWA 2XTKA 3LTPA 3W1PA 4D1JA 5DCEA 4ZZ9A 3DC0A 4RUBA 3N34A 3RMJA 4UQAA 3QC0A 2IPFA 1UG6A 1SYTA 2FZMA 3T55A 3G24A 4MB3A 4DZIA 3WNKA 3HBLA 4KEUA 1MW2A 1R2TA 2X1TA 4A3RA 2Y7FA 1EJSC 3HG4A 1B3XA 5GNZA 2XH0A 4AU0A 4CQ9A 3U5YA 2JKAA 3GD6A 3HJZA 3UJFA 4JNMA 3SSZA 4Y6GA 3I7QA 2W66A 4HTBA 3A23A 4HNOA 3EWCA 3AHTA 3PZUA 4P7QA 3V3WA 4AYGA 5CPMA 3RLGA 4WGXA 4HPJA 3WD4A 4PCFA 5K9XA 2O9RA 2QDHA 1H0GA 1CIUA 3G77A 4KRTA 5BRPA 4DNMA 2PDLA 2O9TA 4MUPA 3OJGA 3FJ4A 1C9DA 4KFPA 1MDLA 3W7CA 2PWFA 2QDGA 4LBUA 2GJRA 2O4MA 1Q45A 2YDQA 4KBXA 1KRMA 2QF8A 1O5QA 1R3VA 2VELA 4L9ZA 1P7TA 3D6NA 3IVSA 3W7PA 3N73A 1JZ8A 2J8FA 5SWUA 1VEOA 1GHRA 1GGOA 3ECQA 3V16A 2GSHA 3MI3A 4HP5A 3UZXA 2Z29A 3B0XA 4ZGYA 1ZCOA 2A4AA 3APTA 3B3DA 3CBWA 4RE2A 1HKKA 2AAAA 5H8MA 5I07A 4FX7A 2IPGA 1KRCC 2YCEA 3G0SA 5IFTA 1AA1B 3F03K 4CEUC 5CPOA 5I3HA 5CG0A 3MMWA 1W3JA 3O3RA 1XH1A 1KKRA 3A4JA 2DZXA 3CQ0A 3PBYA 3PR2A 3HFTA 1RBLA 2E67A 3MDUA 2Z2UA 1OX4A 1YDVA 4EX4A 3AIEA 3NURA 1WKEA 5DQPA 2CZDA 3G0XA 3TEVA 3O1NA 4H01A 3PAOA 1LG1A 3BMXA 4S39A 3H2AA 8CGTA 4CUCA 8RUCA 1XIHA 3DCPA 5TF0A 3W7HA 5CAHA 3MZ2A 4HZMA 2ZDRA 3M7WA 3NOEA 3R2GA 5E5CA 4S3KA 4UTKA 1Q2SA 1QU4A 4HK6A 3P8IA 3QGKC 4Q4QA 1A50A 2PCEA 1QI5A 1E43A 2Z1WA 5F2MA 2CXGA 1GVYA 2Z2BA 4UFLA 1E0UA 3NM1A 4DM1A 2I17A 3LN3A 2NUXA 4NZJA 1DWAM 4JAWA 3ARWA 4TU1A 5I3GA 1K8XA 5D04C 1CECA 4WGHA 4FLRA 3LPOA 3GTXA 1EH9A 3GKFA 5JH2A 4UTJA 2DT0A 1GQKA 2YA0A 3LZ5A 2B7QA 1ZAIA 4UQ9A 2EJAA 3UR2A 2WV8A 4G9PA 3SUTA 5J5RA 3GDKA 3LPPA 3N13A 4Z1AA 3E6EA 3U57A 2F2KA 1FWAC 2CLOA 3OLEA 4O1BA 4DJDD 1H1ZA 3GNPA 1TUXA 1PV8A 1H7OA 3LCGA 3IJ7A 3CZJA 2CEQA 4W93A 3E38A 2BS9A 5CGQA 2XJ7A 3QHMA 1LROA 3WQ4A 3H2OA 4Y7EA 4GX9A 3LOTA 1E6NA 4N7QA 3SGZA 1F8MA 1LBLA 1VBHA 1Q6EA 3REQB 3WELA 2DUAA 2QR6A 1W3LA 2Y5JA 1DVJA 3ZVHB 3V0SA 1H51A 1US2A 1UZ4A 4RJEA 1X1OA 1X8FA 2IKGA 1A4LA 3WFAA 1D3HA 4PR4A 4ZOEA 2E6DA 2CLIA 4O17A 5DT7A 1TREA 3LRMA 4E2OA 2VR4A 4YYCA 1PEZA 2PWVA 4H8VA 3MMUA 1DE5A 4AZCB 1KB3A 1BXBA 1LWIA 4JTAA 4LXFA 1OY0A 4IZGA 3VIKA 1LZOA 1JPHA 3ARXA 2JKEA 4OKDA 2HPMA 3UXDA 2UY5A 2YL6A 4GZIA 2HWGA 2SFPA 1GUVA 3VABA 3HA1A 3UWWA 4HNCA 3LHUA 2INZA 1H60A 5I3KA 4JZ5A 2X0HA 1EEPA 1Q6GA 3SCVA 3OLIA 3BLIA 1J01A 4Z2JA 1O95A 4WSJA 1I1WA 3FXGA 3O9NA 3RG6A 1SZFA 3NZQA 3UNDA 2VQUA 3RILA 3EMCA 4GUHA 1R0MA 3OZMA 2VFFA 3U9IA 3P60A 4EANA 4QQUA 9XIAA 4D6CA 4OQVA 1GOMA 5A6KA 1MSSA 4PUJA 3W3OA 4GIEA 2ZC1A 1I60A 2BVDA 5A2BA 3VE9A 1ZBVA 1W1A1 4ZVJA 4JNZA 3N1AA 3W4RA 5A5WA 4UR7A 1AH0A 3SEPA 4C6KA 3FN9A 3L4TA 3EOLA 2FKPA 1FWRA 3G0UA 1H11A 3ABSA 3LRKA 2WKGA 2A79A 4JHMA 2NT1A 1ZLPA 3WDJA 4PL1A 2DQXA 1F6KA 3LY0A 2CBVA 1Q7QA 2WSQA 3PUGA 3MCNA 2ESCA 4WDWA 1AMYA 1KFCA 2OOFA 3CV1A 2C19A 1J0KA 1IXOA 1UOZA 1EC9A 4LH8A 4CNPA 1JPIA 2VT0A 3N14A 3GY1A 1LBMA 2TAAA 4G1NA 4IXHA 2XH4A 3CLMA 3HZ3A 4C6LA 3QY8A 1O12A 1ZHAA 4QX4A 1WDSA 1W1VA 1VENA 4FNPA 4G7EA 2PDGA 4NAEB 2Z1VA 2GUBA 3NQAA 2PDNA 4JX5A 3UWUA 4ADUA 1H1NA 3STFA 5F7UA 5C55A 2A3CA 3URAA 5AY7A 4LUJA 4GGBA 3LSCA 4AHQA 2V9DA 2OX1A 1Q6LA 4I5UA 1K6WA 3S47A 1WV2A 4R5EA 1IEIA 4HZ8A 3CV6A 3QJAA 4B4HA 1J2BA 3N2MA 5HR6A 1IR2A 2J79A 1P4CA 2VP8A 3QHOA 3DYMA 2XH2A 2VVSA 1X6UA 4XZNX 4GQ0A 4YVXA 4FMVA 5DF0A 1H0IA 4W7UA 4JTKA 3AU2A 4PBGA 1YPFA 4LT9A 5HMDA 4LVDA 2XN2A 2WANA 3WL1A 2OELA 3BG3A 1OC7A 1EJVC 2BHYA 2XWDA 5CQ1A 4F0SA 4P7NA 2JALA 3B06A 4RDVA 3VMNA 2D2OA 3NQ6A 3WLSA 1JUEA 2AL2A 1MXGA 2NLIA 1EA9C 1OYCA 3KVKA 4M81A 1K7EA 2WMIB 3HPXA 4F0LA 4LCQA 4B9YA 3LBOA 1XP3A 1SSGA 4I9JA 2VZTA 1F3TA 1HKWA 3VIIA 2Y24A 1PCKA 3AXIA 2CYGA 2WHMA 4JTEA 1QASA 5EU9A 3W88A 4JBRA 2XN1A 3NO5A 1UA3A 3TJ4A 3TW7A 4QRNA 1XLBA 1SO5A 3C4UA 1SW7A 2VX6A 2F2HA 1E0TA 3CUHA 2NQZA 4KKXA 3G1SA 2BWGA 3VZYA 3W26A 1POJA 1R2RA 1ZSXA 1WZKA 3K8LA 5DO8A 2ZUWA 1B0IA 1J9YA 1RLDA 3R0UA 3BQ6A 2VGBA 2WVUA 1NY1A 3IJQA 1ZAJA 4U5IA 3DESA 4R88A 2PDBA 4HOWA 5HJYA 3HV9A 1E6SM 1XIGA 3NXLA 3L21A 4HGXA 2BSLA 4PUMA 4IHCA 3DI1A 3RX2A 4KWWA 3N2XA 2RUSA 1CYGA 3MS8A 4B3LA 5BOFA 5EYWA 3VCNA 4LX4A 9RUBA 2Q8ZA 2GK1B 4CD5A 3GG8A 3E2VA 1TG7A 3LLXA 1YEYA 3SQSA 4AIEA 3T2QA 1JD7A 1ISVA 3WNNA 4RW3A 1XCFA 1ITUA 1T5AA 4F2UA 5EA9A 3UA3A 4GO8A 1VYSX 1AQHA 3FX4A 2G41A 4C6EA 5C7VA 3RFAA 4XZIA 1J0IA 4BK9A 1X6NA 3N9SA 1EOKA 4UOQA 3BXWA 3W2UA 3P8JA 2VR5A 4ACZA 4A8RA 3JU2A 2OYKA 2A3LA 3EX2A 2H9AB 3O7UA 1H5YA 5LHFA 3F2BA 3FGCB 2HZGA 3T78A 4C60A 3LCWA 1PIFA 3R4IA 4AC7C 2C0AA 4FLSA 3AZTA 3BZJA 4HNNA 2R1MA 2VC5A 3THAA 4LUTB 5I77A 1IXQA 1GKPA 2VC6A 3QBUA 3QSTA 3P14A 1PAMA 5EL1A 3OZYA 1BFNA 2CLFA 4EP8C 4ECLA 4ZR8A 1J10A 3ME3A 3PB0A 4LS2A 4HSOA 1UWRA 2Q01A 4IIFA 3P6LA 3CWHA 4LANA 3IV3A 3QPZA 1F74A 2D0GA 3OA5A 7REQB 4IGNA 3C2EA 1NWUA 4DBUA 1VAHA 2J88A 3V75A 1QPKA 1YXDA 4JKLA 3Q94A 2GGJA 2DJXA 1UC4A 4P61A 2WHJA 3T8QA 3C0LA 4JYEA 4A4AA 4PFMA 4CNTA 1MWOA 3PTDA 4ZOAA 1Q13A 4BR1A 1TJ0A 1W3KA 4XAGA 4MLJA 1C92A 4QE5A 1OCBA 2G3NA 3CUXA 1EIXA 3RITA 1KWKA 4GKLA 1HO1A 1XWYA 3QGAC 2VFDA 5C8BB 1T96A 1IEXA 5A6SA 4G5DA 2FH6A 2DH3A 1BKHA 4GOAA 5CZTA 3UZJA 1TZ9A 1PZ2A 1UR0A 1XC6A 3A5FA 1QNQA 4HMNA 2V63A 4MYXA 3GVVA 1BLIA 1DJQA 3GNRA 3UWEA 2JKPA 3L4WA 3BLDA 4XVDA 1VIWA 5HMEA 1NWRA 3NZGA 4ROQA 4I7VA 2MNRA 1R9ZA 4DYEA 2JIWA 1V0MA 1XFBA 2G95A 1TE6A 5M17A 3TQPA 1OX6A 3CHDA 3TTSA 4PMNA 1WKFA 4GYPC 1NWTA 2PDHA 4JTLA 2WBKA 3IVTA 1YDOA 5EY5A 4K36A 3UESA 4DZ5A 3VAVA 4H8UA 4NAFB 1BD0A 2D3LA 4IPPA 5FJPA 5DMMA 4GCAA 3KTCA 1E73M 3LBCA 4V1XA 2OSXA 2E7FA 1E9LA 4MY1A 1PTGA 4JY8A 3W1TA 1MNSA 3G1HA 1T41A 1LG2A 3EXRA 3MUCA 3MCOA 3K1DA 3CM4A 1UMYA 3C8FA 3R25A 1WAUA 2A1YA 3WN6A 1W1YA 3LHYA 3PZQA 2O4QA 2C6QA 4ADSA 5LIWX 1G4SA 3CMGA 1TPB1 2RDUA 1UR1A 1XYFA 1PHQA 1DIKA 3W7RA 2HRWA 1U83A 1X1ZA 2ISFA 1GZJA 3UGVA 3G1FA 3NQBA 1O5XA 3SUSA 3GE7A 4J7RA 5HNTA 4M82A 1G6CA 3GWQA 3LU2A 1YNYA 2X1RA 3W1AA 3FA5A 3RPDA 3Q2DA 4C65A 2PS2A 2V5DA 2EKCA 3CUJA 4PA8A 4DXKA 4FEZA 3JUGA 1XIFA 3C2FA 5CJ5A 2W92A 1DWIM 5FF4A 5HQMA 3G8EA 4Y2WA 4X9YA 3MKVA 2OZ0A 1UH2A 4K68A 3OIHA 1FUYA 4GACA 2G4JA 1EHAA 3GQYA 4PCTA 4M56A 1J96A 1LM1A 4LYRA 2Z28A 4E2DA 2V2DA 4GQRA 3VXGA 1V6VA 3KRSA 1LRNA 5J8LA 4HIBA 5ECUA 2YBVA 2FJUB 3GG7A 3UYIA 1PSCA 3LLFA 3QKZA 3A13A 2C14A 1X98A 5BZAA 1M41A 2VI0A 4FR1A 2DZTA 4Q4SA 2W61A 4IQDA 3HJEA 4JHZA 3SR7A 5FL0A 1JYNA 3FHAA 4MKNA 1BEUA 2VRKA 4GGHA 5LXXA 4K7YA 3TLLA 4UR8A 1PVNA 4DELA 5AZ0A 4OBRA 1NOFA 5CG7A 3WZ0E 4LUSB 3PZTA 1K9FA 3W71A 4FB7A 3AIWA 3STCA 3N2BA 3SFWA 1XYBA 3PVFA 1VD6A 1E70M 2DW7A 1XDMA 5FJUA 5C7HA 4G8TA 5J5DA 2UY4A 4FK9A 4RDZA 3L2MA 3VCCA 1TVLA 3O6AA 4DN1A 2QQ6A 2PLCA 3MSRA 1V03A 1S39A 5A6JA 4E3VA 3W2LA 1ITQA 1CGYA 4PMZA 4D9PA 2XSBA 3PBUA 2J77A 1V77A 3A47A 4WSKA 4AQLA 1AD1A 5A6AA 1UIOA 2J7HA 1JXKA 3RM8A 4AAJA 4HYWA 2OZTA 2Y6ZA 4NJIA 5EMJA 4F9DA 2QVHA 1NIUA 2PDJA 1NF0A 5FEPA 3VFCA 3MB9A 3CTLA 1UR3M 4C6OA 2PD5A 4A3HA 1X96A 4XD6A 3WDRA 1A5AA 3LYEA 5FCZA 2ATSA 3O0KA 5BXRA 2O7SA 1Z44A 2PU0A 4JQ1A 2FB2A 1JF5A 1FWEC 2BZNA 3DHFA 3WY1A 4LVFA 2I9EA 3I7RA 4O1FA 3U5UA 4S1FA 2BOFX 3WBWA 3BH4A 3B40A 1OC5A 1RA0A 2E3ZA 1HJSA 3REQA 1XICA 4BF9A 1F7BA 5FIPA 3L4VA 4JTSA 3LCLA 1SU5A 3MYOA 1CLXA 4TQTA 3SQLA 5FEXA 1D2KA 2D1ZA 1XQKA 3MCMA 4ATWA 3GXMA 2WC4A 2Y85A 2AKZA 1HJUA 5CH9A 3C0QA 2A21A 2ZUUA 4EKJA 3BGAA 3BLPX 4GUJA 1FCUA 3OPSA 3CUZA