3WQCA

D-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
total genus 147
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqcA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqcA02
2RJGA 4KBXA 1KNWA 4FS9A 2NVAA 5FAJA 2J66A 4BEQA 2YXXA 1XQKA 3CO8A 5BWAA 1F3TA 1RCQA 2P3EA 3WQEA 3WQCA 2RJHA 3ANVA 3BTNA 3GWQA 1W8GA 4ECLA 3C5QA 4DZAA 3AWOA 2ODOA 2PLKA 1XQLA 1QU4A 1BD0A 4BHYA 3B8WA 2OO0A 1L6GA 4XBJA 4ILSA 2SFPA 3NZQA 4PB3A 3WQDA 3WQGA 7ODCA 3LLXA 1NIUA 1FTXA 2TODA 3UW6A 4QHRA 5GJPA 4A3QA 3SY1A 3CPGA 5GJMA 3B8TA 3MT1A 4PB4A 2O0TA 3B8VA 1TWIA 3N2OA 3S46A 1SFTA 1HKVA 1XFCA 4V15A 4LUTA 4Y2WA 4BEUA 3VABA 5GJNA 3N29A 4DYJA 3HURA 4LUYA 1VFTA 4WR3A 2NV9A 4PB5A 1VFHA 3OO2A 3KW3A 3AWNA 3B8UA 4LUTB 3HA1A 1SZRA 2DY3A 4AIBA 1HKWA 2VD8A 5IRPA 5FACA 2VD9A 1B54A 1L6FA 3ANUA 3WQFA 1EPVA 1CT5A 1NJJA 1TUFA 1VFSA 2QGHA 1D7KA 4LUSA 3E6EA 5FAGA 1KO0A 4BF5A 3N2BA 3E5PA 4LUSB 4ZGYA 4XG1A 2PLJA 2ON3A 3R79A 3NZPA
chains in the Genus database with same CATH superfamily
1XIDA 1F3WA 3FHAA 3NPUA 2VDGA 4YHEA 4L5ZA 2VC7A 1UR0A 1BGGA 2KAUC 3MVTA 4WXYA 4IH3A 3VI2A 1X97A 5DT7A 1VBJA 3QXBA 3F5LA 4NZ3A 3B3DA 3ME3A 4N9DA 2EAWA 1WO2A 4US6A 3II1A 3T0AA 3AWOA 1EBHA 3QQ0A 5H1WA 2ATSA 3A47A 2HNEA 3LENA 3W0KA 1ZB5A 2OT0A 1Z6KA 2HBXA 1HG3A 4AUBA 1FCVA 2V5LA 4B5NA 3F4CA 4X22A 1M6JA 2POTA 3M0HA 2QCNA 3VIIA 3L4UA 4IIDA 4DYKA 3RF9A 1KCLA 2XVGA 3OP2A 3TKFA 3W7DA 2FPTA 1XRTA 1KFKA 3B0YA 3B9EA 3DC0A 5E0FA 3GX9A 4V33A 5GJNA 1D3HA 3Q45A 4F2BA 4JFSA 4JX6A 4V27A 2PLMA 2VEFA 3NZGA 3GTNA 5FEXA 4W89A 3R25A 1GVRA 2WQDA 3KLKA 4HZ8A 3C0SA 2ICSA 1C90A 3A4WA 3SN4A 4QNEA 3DOPA 4QG9A 2WVSA 1ME8A 3DKLA 4RZBA 4LNYA 1CIUA 2OX4A 3G3MA 4NILA 5A3HA 1VFFA 3NZPA 1KWGA 2ZC1A 3W82A 3GH5A 3TCEA 3DU0A 5DFAA 1XQKA 3KHDA 1QW8A 1I2OA 4UFLA 1YXYA 2C0AA 2BS9A 1WUFA 3T08A 4LEFA 2CEQA 3E0WA 1S46A 2QCGA 4XD3A 2HVNA 5CG7A 4DZAA 4GINA 3FN9A 3PZ9A 3M5ZA 3WQ6A 4GLEA 4JQ4A 4J28A 1FX6A 1E1EA 4TOQA 2HISA 1LT7A 1JCNA 3TR9A 4NP7A 1EGZA 1VPXA 4UTWC 3PNUA 2VX4A 1GTEA 3E0VA 4IX2A 3T78A 3UW6A 2GFTA 1KTCA 1JCJA 1R7OA 4HYRA 4WDUA 1NFBA 3MUY1 4GRSA 1QPNA 1EX1A 3W88A 3GHUA 3CWOX 3L0GA 1EBGA 3CU2A 5LYRA 2FPYA 3PTDA 3IAQA 4FAMA 4LUIA 1F3XA 1EKOA 1QNRA 4LUTA 3HMJG 3B97A 2CITA 4B5UA 3GIPA 1ESWA 2QVNA 4AZHA 4MWAE 5A6LA 4L7ZA 3B04A 4H7CA 2OU4A 3PBGA 5A8QA 5DRIA 1CDGA 1HX0A 3W2KA 1HL2A 3MSYA 5DN1A 1CPUA 3CHVA 4UNLA 3AYSA 1W0MA 4AEEA 2D24A 3R10A 3QFWA 3VMOA 4R53A 4IFRA 3B8SA 1C9WA 1UC5A 1G4SA 2WNZA 5LGZA 4I6VA 2DZWA 5FIPA 3L65A 5I23A 3WEOA 4GUFA 2NXHA 5AHNA 1L9WA 3AXMA 3TE9A 6REQA 3QV6A 1Z8AA 4UIOA 1IGWA 3OQ8A 4QCFA 1JGIA 2CXGA 1IXPA 1WDPA 1FCUA 2E5CA 5G1MA 4UTKA 1VR6A 2R1MA 3WDQA 2EG8A 2Z29A 1Q6OA 4CQ8A 3S1UA 3WD1A 4XZMX 1TJ1A 4B3ZA 4QLKA 1DQUA 3QR1A 4HYWA 1JZ2A 1XG4A 1CNVA 1ZAHA 5ABTA 1UPPA 5HR7A 2TPSA 5CZKA 1WQ5A 4K39A 4H8UA 1QATA 3C3UA 3KZPA 4OECA 3QW3A 4CNOA 2ESCA 2BTMA 4NJGA 5D2YA 4NT0A 2IKJA 1HZYA 4XQ6A 1WYIA 4JKLA 3MA8A 4RJEA 1F4AA 1ITCA 1CXHA 3DC8A 3UY8A 4RW3A 1L6FA 4HNLA 1S2AA 1BWKA 2X0HA 3W9ZA 2H3BA 4H9XA 2H90A 5A6SA 5D2WA 4LH8A 7REQB 5HJYA 5I02A 1MI3A 2G41A 1WAUA 3AHYA 1SJAA 1R5YA 4S23A 3KOZA 4JEJA 4W87A 1MRAA 3CAVA 2E09A 3BLEA 4AD4A 2CHNA 3M0JA 1C92A 3QV9A 1E4NA 2CBJA 3AO0A 1RQHA 3VD7A 3RG6A 4HNCA 4QQ3A 1OFAA 4HK5A 3LGGA 5I06A 4LYKA 1DQWA 2VYOA 5HBFA 2V9DA 4P2VA 1NFGA 1H1NA 1X1ZA 3I7QA 5AVNA 1FWTA 4A2RA 2YCLB 3CTLA 3SCSA 1BQCA 5DBUA 2OCZA 5G2IA 5D2VA 3E12A 3G1HA 2C14A 3SGGA 1XIJA 1OK6A 1F76A 2D20A 4CNTA 3UPMA 4YNGA 3MSDA 3R13A 3TYAA 3IIPA 2AL2B 3SUUA 1QTWA 3GHSA 1QDSA 2R1PA 1KM5A 1V08A 1RPXA 1PUDA 3WEZA 3WLLA 3DGRA 3TAKA 4FIQA 4ML9A 4DJFA 2WC3A 1VGAA 4LPCA 4BI7A 3RLUA 4GXWA 1KR1A 3QTGA 3N11A 4RUBA 3VDGA 3EPOA 2C91A 5JH2A 4O8AA 2X09A 3RLGA 1Q2SA 2RDWA 4RZ6A 1UOZA 1TWDA 1H2JA 4XZ9A 2PBOA 3KWXA 5M3WA 1GQNA 3ITOA 2G0WA 2BBFA 3UEQA 1B4KA 4MJ4A 3LCFA 3WH5A 4CNNA 1FRBA 4QP0A 3O06A 1RJRA 5FJJA 3OEXA 3O16A 2OZ3A 2YCJA 3FJNA 4EE9A 5AHIA 1XDJA 2OO0A 4KPLA 3N17A 3CQKA 4OIFA 2OWXA 3GAYA 2HTMA 2WSPA 1QNVA 1LUCA 3M46A 5DCEA 1YTEA 3GH7A 3LQGA 3GNNA 2REQB 3M5YA 2E25A 5HAOA 3U7VA 1Q8AA 1J96A 4JCMA 3CPGA 3GU9A 1SYTA 1YKWA 2ZZ4A 4QE5A 1X6UA 3LRLA 3L4ZA 1O1HA 4J5NA 1KTBA 5DO8A 1R9YA 1JZ5A 1Q13A 3I3EA 5EA9A 1Q85A 4O1FA 1TMHA 2G3IA 1JEZA 3A22A 5LIUX 2D73A 3BL3A 3EBVA 2WMGA 1WAWA 4PB5A 4JFUA 4HSHA 3WBWA 5DX7A 3KOYA 2C71A 4FSAA 1JR1A 3EB4A 1GPWA 3F1QA 3RNDA 3F2CA 4HB7A 3EDDA 4EPBC 3CUFA 1J0IA 3W1NA 2J7BA 1V5XA 3VIOA 3P61A 4NJHA 1C9DA 3T2OA 1HTIA 2GWNA 3CZKA 1G4EA 4MJZA 2CU0A 3PPCA 4MUZA 2AKZA 1S5MA 4LBRA 3EDJA 1JRCA 1RAKA 5J8LA 1AZ1A 1MNZA 2R14A 4JTIA 4LEQA 5C70A 2W3ZA 3HN3A 3TQPA 5HWNA 4M6PA 1V0NA 3V1HA 1WUEA 4HCLA 5EFFA 1U33A 1GW9A 4GQGA 2B4GA 3U2EA 3ZWTA 5GQBA 3UWWA 1W9DM 3L2MA 2NX3A 4UCFA 1EQCA 1Q4NX 2YCEA 2Q09A 3KEHA 5EMMA 4S3FA 1NP2A 3CL6A 4AC1X 3NQ6A 1W37A 4IP5A 2O92A 4AMCA 3VNZA 5MKGA 1GORA 1D3CA 1HKVA 1XBYA 3HGRA 1O5XA 4NG3A 4A3UA 1HJUA 3TW7A 3W2UA 4WXZA 4O1CA 1P4CA 1RVGA 4H9UA 5F1UA 2OWWA 1EPXA 2FGZA 4ZQOA 1X38A 2INZA 2ALDA 2VEMA 3KFTA 1Q6QA 1UUMA 5IM51 2WHKA 4DJDD 3QY7A 5EYWA 3GTFA 3M47A 3LXCA 2HXTA 2POZA 3M0YA 1EP1A 5D03A 1SFSA 4C5ZA 1AL8A 3W7IA 3ZT7A 5C9XA 3T8LA 3VDBA 1ZUAX 4PZVA 4LYPA 1GYNA 1BG9A 3W1PA 1M01A 3VD3A 3GZAA 5A8NA 3VGFA 2CCRA 3TDFA 2CERA 3AMCA 3NQAA 4O17A 4C6JA 1SSGA 3AHVA 3NM3A 4L4MA 3W6LA 1XIFA 1TPVA 4CGTA 5LNUA 2A3CA 4F0SA 3VE7A 5D9PA 2Z25A 2HS8A 1UIOA 4BQ4A 1ITQA 2IPFA 5CG0A 3RR4A 2W91A 1EA9C 1XSJA 1QBBA 4HKPA 2ZA1A 3W6MA 5HOSA 1B3ZA 3NZRA 1LM1A 2VZOA 4HIBA 1IWBA 1EJSC 1R85A 3V5CA 3HA1A 3BCDA 2BY1A 2PGEA 1XRFA 2FZNA 4M5PA 4UQAA 2WM0A 3MHUA 4C6QA 8RUCA 1OFEA 1I6NA 3UQNA 1T8QA 2Y5SA 3E9AA 3BG5A 2Z7GA 3WO8A 4NXKA 4LYRA 3QV8A 3A5FA 3IK2A 1YXCA 3D3AA 2WBKA 1FKWA 3MMUA 2BHYA 4XZLX 3N6JA 1J01A 3P60A 2ZADA 1G4TA 3LPOA 1GZJA 1E72M 3TTYA 3SY8A 3J7HA 1PWLA 3GG7A 4BZYA 4AYGA 3TSMA 1E9LA 5GVJA 1BD0A 3QMRA 1W9PA 1K8YA 3W00A 4MHBA 2P50A 1GVFA 2DQWA 1XPYA 1VFOA 3UJEA 4OOUA 3URBA 3HQOA 5E09A 3AC0A 4AMAA 1V7AA 3SY1A 1QK2A 1VQTA 3FJ4A 3QY6A 4A3YA 4C1NB 4XBSA 1PV8A 1KTNA 4NUWA 1IZCA 1LWIA 4Y2WA 4ICNA 4KCWA 2CLFA 1A5BA 4MZ1A 2TMDA 1JCXA 3F5JA 3HQ1A 3T9PA 3QY8A 3GUGA 1O60A 4XD4A 1TJ2A 4AD1A 3SIZA 4WOZA 3U48A 1IXQA 4RE0A 3OZYA 4YPJA 3MCNA 3LV5A 3ABXA 1FBAA 2JIWA 3WMLA 4JFVA 3TP4A 2P1FA 1G67A 4GCXA 3CO8A 3I7SA 4NI8A 2FZDA 4U3AA 5C2CA 4QXIA 5G1TA 3VA8A 3GHRA 4OZOA 4ZTYA 4DXKA 1KFBA 1LTDA 1UHVA 3NAVA 2Y8KA 2XSXA 1Z41A 4IIEA 5BMWA 2VO5A 1GGOA 3OIXA 1G1YA 3PSWA 5BXRA 5CQ1A 1W31A 4PB3A 5IFTA 5C5YA 5LA0A 5I6SA 4TV5A 1EJUC 3V35A 1AZ2A 4O11A 3LDVA 4GJIA 3CHDA 2P10A 1VH7A 4WJ8A 3IV8A 3TROA 3SUWA 4H4IA 5CSUA 2BGNE 1U83A 4MZYA 3PZTA 5DRCA 3CM4A 3BUVA 2EPNA 2ABBA 4CQDA 4A29A 2HPMA 4FF7A 3NO1A 2DZTA 1OGBA 4AHQA 2VFGA 2O9PA 2GJLA 3EOSA 7TAAA 3DFSA 3WJWA 4GVIA 3WLHA 3M5XA 1GOOA 1M9HA 2J7GA 2OWCA 1JD7A 4QE4A 2GGIA 2G3NA 2ZDRA 3AIRA 3W7MA 1TTPA 1TV4A 1ISVA 1VYPX 2NLIA 1US0A 3T0TA 1IZKA 1QNSA 1R30A 5K7JA 4V2XA 2R1LA 5HJXA 3RX4A 3GNOA 5HA7A 4YTRA 2BWGA 3G1FA 3APGA 3TOPA 2ACRA 3THQA 1AL7A 3WD3A 5FEZA 3WF4A 1FVPA 1JPIA 3CEPA 3GU1A 2D2HA 3ONCA 4ZSUA 1UR3M 2OELA 4XUGA 2BMBA 1TVNA 1UD4A 2DZVA 2O56A 4Z2LA 1H63A 3MQTA 5M2FX 4JY8A 2BY2A 2VTFA 1P0KA 3IIZA 1AH0A 3FGCA 1BRLA 3WQ4A 2OOGA 4O53A 1LQ2A 1MQQA 2VRJA 1ZRQA 3VX1A 2QT3A 5HXMA 4UQEA 4DYJA 3MCMA 1POKA 3SCTA 3WFAA 2VELA 4FF5A 3SBFA 4M19A 1OFQA 4H8VA 4N2YA 3B8UA 4D2JA 3Q4DA 2L5HA 3G3DA 1OJXA 3O0FA 1C29A 1GG0A 1NEYA 1KV8A 3GDLA 3W1MA 5I3DA 4GG9A 2NVDA 4D6FA 3LCIA 2FKPA 3Q58A 1GQKA 4H9ZA 1S5TA 1TRDA 3UT0A 4NF7A 3C2EA 2QUMA 1OABA 1E55A 2DT1A 1LQ0A 2WJFA 3KOFA 3PJTA 3LMYA 5A8MA 3NO5A 5DMMA 5EU9A 1M65A 3WQ8A 5DCBA 2FDSA 4Y9PA 3P0XA 1F3EA 1FDJA 3IVTA 4LY8A 4TQTA 5IXEA 3E2RA 1O6IA 3B9OA 1H7NA 4PTMA 3DBNA 3KZSA 4H2CA 1W5MA 1JUEA 2YL6A 3SCOA 3UJFA 2EEXA 1VPYA 4JQ3A 3DG6A 1MSSA 1OC7A 3WBAA 4AH7A 2FIQA 3HPZA 4O50A 1X6NA 1VJSA 4PUKA 3SJ3A 1EQPA 3W86A 3N34A 1HNYA 1TZ7A 3UXDA 4FLSA 4W85A 4DWSC 1XCXA 1U5JA 1ENUA 2RDTA 2JQXA 5CZTA 1Q5MA 4CNUA 3VO0A 2Y85A 4I5RA 2XH0A 2F38A 3MDUA 2VP8A 2I16A 2WSKA 2WSQA 2IW0A 5I09A 2FHBA 2DVXA 1DHPA 2RUSA 1LWJA 3SJNA 4DUWA 1G0CA 2XIJA 3NDZA 2DEPA 3M16A 2Z2AA 3KDNA 3ATZA 5FESA 1KCXA 3C8NA 2WLYA 1I0BA 2DT3A 1JVNA 4F2UA 3UFYA 4WKHA 5KZMA 3FS2A 1XLCA 5CAKA 3FA5A 3IJ7A 4D1IA 2ZRYA 2ZE3A 1H51A 5MHBA 2XVKA 4RV8A 2QAFA 3DYOA 4ATDA 2NQJA 3VIJA 1H0IA 3OVPA 3GC4A 3M6DA 1Q7MA 1TZ9A 1KGXA 1C8XA 4H9MA 1H49A 2YPIA 1PE1A 4MZ8A 3RX3A 4U2YA 1KFLA 4MDPA 2B7PA 1D8CA 2H8XA 3QM3A 4JNYA 1BWVA 4HMCA 2E1DA 3GRIA 1E1FA 3F03K 1BYCA 1KRCC 4R7WA 1J11A 2YA0A 3TA6A 4H6EA 4TMBA 1BKHA 1OCNA 1RBOB 2NSOA 4QTGA 2MNRA 1PCWA 1OFDA 2YSWA 4AW7A 1UH3A 1K6AA 3RHGA 3ZR4A 4YHGA 4I7WA 3ZJ7A 3N4FA 3P2VA 4HNNA 1ZBVA 1C93A 1CXIA 4H6RA 1MFUA 1ME7A 4NL1A 4CCEA 4EXAA 3TWAA 4UMCA 1EB3A 4AISA 1SQ7A 4TVUA 3TFXA 4CU8A 3UJSA 4F4RA 4C7DA 3VKKA 3ZLFA 3JZEA 1MXSA 2QIWA 1KLYA 1GEQA 1E0UA 1S2UA 3RCYA 1ZSXA 3M6YA 3WDRA 4BI6A 2DDXA 4FOKA 1ECEA 4ML4A 3QMSA 2CHOA 4KH2A 4Q4QA 2WMFA 1KFEA 5LSMA 4IMCA 4ZO9A 2ONEA 3U2CA 3EB3A 3UWUA 1RY0A 3GW3A 1QBAA 1KGUA 3NGFA 5G5IA 1UZDA 4XVEA 4RK8A 1V3MA 3OYXA 1VP5A 2ISWA 2EJAA 1T8XA 2XFYA 1JYXA 2HMCA 3P6LA 3H2FA 3P67A 4WJXA 1EDGA 4PMZA 4QJ3B 5DXYA 1JNEA 5G2WA 1EGVA 2A3AA 1I1WA 2QPXA 4G1NA 5G4EA 4Y8EA 1B1YA 1Y5VA 1ISWA 1QI0A 1SZGA 2PTXA 3K4AA 3BQ5A 2V0TA 4AIUA 5KETA 1PCKA 2CWXA 1JZ7A 2ZC8A 5E9XA 3COTA 4JTLA 3VMNA 4JTQA 3V0SA 2C1HA 3CV6A 5C6MA 1XBVA 1HF6A 1BSLA 2GVJA 4ZO7A 4C1KA 5FJRA 4YXGA 1NJJA 4NASA 4MJ2A 5K2ZA 1A5CA 2ZZ1A 3RRXA 4MFEA 3MPGA 4IG2B 3IS4A 4QDMA 5D8ZA 3E2QA 4YVXA 3PFMA 4LTSA 1XIBA 3HU7A 1MEWA 4Y8FA 1KRAC 3UF9A 4W4QA 2XIQA 1R8LA 2RHGA 9XIAA 3SR7A 1NDYA 1LOSA 3VCRA 4HA0A 3F4VA 3FHQA 3B0UX 2Q8LA 1YPIA 4H9VA 5AYIA 1LL6A 1W56A 4ECLA 3TC3A 3L7RA 2C0HA 1EFZA 3KBSA 3VC6A 1P0NA 3L5MA 3BGAA 3RDKA 2Y63A 3N6HA 4P5UA 2B81A 3TUUA 1C7TA 3SGUA 1EF3A 2G97A 3BDKA 2X05A 2VGIA 3IGSA 5CGTA 3UVAA 5FEPA 1E70M 1EO7A 3LRMA 3NL5A 4WGXA 1BQGA 3P82A 2YDQA 1R3QA 1ISYA 1MDRA 1P1MA 3LGDA 3GO2A 4D6GA 5DMNA 3QLDA 1Q6LA 3BWWA 2ZWZA 2BVTA 4PCNA 5K3VA 2GVGA 1GVIA 3QGAC 1PEZA 2I5GA 5I0DA 2E40A 1QNQA 1NOWA 2OZTA 1BYDA 4B5WA 1RXOB 3OJGA 5HQEA 3R7MA 4XVDA 3TSBA 4A8LA 1KXHA 2F2HA 1PDYA 1TTQA 1UP2A 5BXPA 3BMVA 3LCHA 3O6DA 3Q67A 1GVSA 3GTXA 3ZT6A 4B3LA 2P5NA 2P53A 4HA3A 3GFXA 3CIXA 3IGHX 2VVSA 1C3FA 4G7EB 1HL9A 1IWAA 4CN4A 4K6AA 4O1AA 2RJHA 4X2PA 3RLHA 3C5QA 1JULA 1E71M 3WQOA 4IGSA 3LYEA 3PJXA 2GSEA 3KVMA 1QRQA 4DZHA 3I3BA 1K8CA 3PULA 4O0QA 4IL2A 4IMEA 5REQB 4UZUA 1LG1A 1YDVA 1H61A 4S3JA 1LROA 3I6TA 1ZAJA 1OG0A 4WY0F 5DQPA 4KGLA 5H8UA 4K1GA 2W9MA 1SMDA 5FSEC 5BRPA 3EZ4A 4S3BA 2PC4A 3AFBA 1ADSA 1E15A 4RCXA 3WQPA 4LOCA 2A4AA 3G1VA 4JDYA 1E1CA 1QCWA 5CPLA 2FHCA 5I3IA 4W7UA 1WXZA 2Z0IA 2A6LA 2P88A 4OFCA 1GUVA 1R0MA 4BFAA 1B30A 3NQ8A 1BXNA 4NZJA 5FI8A 1LQAA 3BK0A 4Z1BA 4ZOBA 3WNOA 3CWNA 3L4YA 2W5FA 3IRSA 3BAJA 2HVOA 1S2CA 2A7PA 4LVFA 4B5TA 3CMGA 2PDFA 3AU2A 3DHDA 3PWGA 1THFD 3W7PA 2PD9A 4R34A 3W1AA 1J5TA 1CXKA 1GKPA 4GUHA 3S5OA 1P43A 3WG6A 4DBEA 2Y88A 1HJWA 2CLOA 3HV8A 1F05A 3CZGA 1IYXA 3WLKX 4DO5A 2PTYA 4J3UA 2OVLA 4EWND 1MRQA 1CLXA 3TJXA 1LRQA 3VKAA 3OA3A 3MANA 4PB4A 1H4PA 5BOOA 1ZY9A 3ELFA 3BCJA 1P7TB 3FVDA 2QCMA 4MOZA 3R4IA 2DPEA 4GI9A 4FO4A 4H01A 2VGFA 4PBGA 1WX0A 3PWIA 1JRBA 1WV2A 4O54A 2Q71A 1D8WA 2ZBTA 6CGTA 4DJDC 5F2IA 5AZ0A 3PB2A 4PCPA 5HMDA 2NWSA 2GQAA 3P62A 2X41A 1FWNA 1AK5A 5CLTA 1XC6A 3FXYA 3WJZA 1TE1A 2QS8A 2VEPA 1HVXA 3S2JA 2QUUA 2Z2BA 2ZUWA 1E43A 1ICQA 3U4FA 4PULA 1PB0A 2PWUA 2VCAA 4QJ1A 3ZLHA 3ITVA 4DBSA 4MDOA 1G69A 1ALDA 2G8ZA 3UG5A 4EKJA 4H2HA 2ZUUA 4LANA 2DH2A 3E02A 3TTSA 3KP1A 2JKPA 3NQMA 3VIFA 5LIYX 2AKMA 2V5CA 4GVHA 4K1WA 3AIVA 2RGMA 2WNNA 1RY8A 4B16A 1AQ0A 3CBWA 1Q2RA 1TX0A 2VR2A 4CQAA 1FWCC 3STEA 3HOJA 4P8VA 3UCQA 4ORIA 4N42A 3O05A 1X8FA 4F48A 3STCA 2YBVA 2ZDSA 1A53A 5IDZA 2KX9A 1PDZA 4JL2A 2EKGA 4JS3A 1XKYA 4ZSTA 2QJGA 4IMAA 3S9IA 4S2CA 5K9CA 3QR3A 1VRDA 3L67A 4W93A 2VZUA 4AZCB 3MJMA 1UQZA 1OD8A 2NLYA 2XIMA 1X7IA 4RR4A 3SN0A 3S5NA 2QPSA 3UWYA 1K4HA 3GFYA 3H7VA 4RXGA 1V0KA 3BAXA 2QAPA 3W26A 4ONVA 3SUVA 3WH7A 5KTLA 1EP2A 1XLKA 3DYPA 3NQ7A 5KITA 2PA6A 5DBTA 4OUIA 1KBJA 4GX9A 3W76A 3P8JA 4JYEA 3MCOA 2CHRA 2ZQ0A 4ROPA 2FVKA 2DT0A 1JFHA 1NDWA 1XLGA 3FYYA 2YOCA 6ALDA 4I3GA 2G4FA 2C79A 4LRTA 4O18A 2YR1A 4PFHA 2W4XA 3L12A 2DJXA 4JTKA 3KBNA 2A85A 1E9YB 2QMKA 3GIQA 5GJPA 3S9YA 3C2VA 2E6YA 1E4LA 4W7VA 3LBCA 1IT7A 3NIYA 5I3KA 5A6BD 3JS3A 3DGBA 4X9YA 5CC7A 1EX5A 4C60A 2JKAA 1K8XA 2OJPA 1E6ZA 2WKJA 3DEQA 4BA0A 2PF0A 2WVVB 4H7VA 2W27A 3UGRA 5CAHA 1OT2A 4W86A 1QXLA 4BQ3A 1BTCA 3U57A 3WK0A 1AQMA 2AGKA 2J6VA 1JZ4A 1EJWC 3QR0A 5BOEA 3C4UA 4O1DA 3VU2A 3WYZA 5CC3A 1FP9A 2Y62A 2CW6A 1XWYA 4DJED 2QHAA 3E2SA 2NX1A 4Q6XA 3UD6A 1XI3A 1J79A 3WMBA 2WPGA 2O9TA 3ABSA 3GVQA 3MUCA 3PUEA 2P8BA 4GZEA 3WCZA 4FNQA 1HO4A 5D2TA 5JU6A 2GVLA 4ZOEA 4UR7A 4GE8A 1K8ZA 1RK5A 5AC7A 1H3GA 1I2PA 1TJRA 4E3TA 3BSMA 1SR0A 3CO4A 4GIYA 2BLEA 2J4GA 3W83A 1MEIA 3W1LA 2ZRZA 2ZUNA 3OLIA 4P61A 3SSJA 4BKNA 3ITLA 4HHLA 1YPXA 1O68A 4UQCA 2NQZA 4NZ1A 2F61A 3HM7A 3I6RA 4NAEA 4KRUA 4WCJA 4DM1A 4QGCA 1V3IA 2PLCA 3UY7A 1XIMA 2HE5A 3EWYA 2VVNA 4FOUA 3SADA 3S9ZA 5AFDA 4F66A 4IIBA 4QHRA 2Q3OA 3IUIA 5HMSA 3L0NA 3P8IA 3LN3A 4JFTA 2PDWA 4O16A 3TW9A 2XUCA 3AIQA 3EYPA 3N2XA 3E1F1 4I9TA 4IGHA 3N2OA 5DEZA 1F2JA 2O9RA 3LK6A 1MXDA 1XLDA 2D2OA 1D7FA 2R6OA 3UGVA 4EK7A 2F6UA 3S1XA 1I0DA 4M6UA 1F6YA 4YCPA 3IV3A 4LV4A 1P0EA 4ZBCA 2ADAA 1KW1A 3CUJA 2VFIA 2PDIA 3NVTA 2EPHA 3WUBA 2WWCA 1TSIA 4FI4A 1TPEA 1AMYA 1UWAA 3SGZA 3HZ3A 4XX6A 2YXOA 4KBXA 4N4QA 2PCEA 4MM1A 2WAGA 4M8UA 3HO8A 1BLIA 1UWSA 4KFOA 2BV9A 2ZFAA 3Q65A 1QR7A 3WLQA 3L5AA 1KKRA 5A8OA 4OOZA 5CPMA 3FLUA 1VBRA 4RNHA 3MMWA 3WLTA 3U6WA 4W7WA 4ZQRA 1EJTC 1EDTA 1X98A 3WF3A 4GWEA 1EIXA 1ZP3A 2ZUTA 4ZL1A 4N9BA 5BZAA 4A3QA 1XIGA 2QCDA 5MKGB 2VHLA 1A5NC 2Y1HA 3IWPA 4UTLA 2E68A 2WO5A 1OYAA 4GYFA 1J12A 3RITA 1TUXA 8A3HA 2B0MA 1UD6A 3G1YA 2PP1A 3RLVA 2PDYA 3CIVA 3BOLA 1UR4A 1DKWA 4BWLC 2G4JA 1V6YA 2GK1B 4R5EA 1XBZA 4HTBA 3R5EA 4PMYA 2VD9A 2PDUA 3V0UA 5AECA 2OSYA 1SJCA 1PSCA 4LS2A 5LNRA 1V6TA 4R27A 3OG3A 1XYCA 4BR1A 4N6FA 1R46A 3BVJA 3L4VA 2GOUA 4FXFA 3R94A 3QSTA 4XAPA 1KM2A 3TU9A 4BQ5A 4MAVA 2R1NA 4Y9MA 1PBGA 4UXDA 2I56A 3MB9A 3FJ6A 4F0RA 2H9AB 5D30A 1S2VA 4U4MA 5C2XA 4PUDA 4JCLA 5CPTA 4PEKA 1MYRA 2OTDA 1HGYA 1HP4A 4ACZB 3NM1A 1JCTA 1MNSA 1MMFA 3TN3A 4NQ1A 3CPUA 3MTWA 3PNZA 2TSYA 1NY1A 1C7SA 2HPIA 4NVTA 4PC8A 5A95A 3BXWA 2DSUA 2PDPA 1EJVC 1UH2A 1P6WA 1W1TA 4MLJA 3MYOA 2G3JA 3AYRA 3LBMA 3BAWA 4HNOA 1S2TA 3N29A 4P8WA 1G5AA 3UYCA 1GCYA 3AXHA 3E96A 4ADUA 1CGWA 1JCMP 4JFWA 1JCLA 2GGHA 1A0DA 6PTDA 1DBTA 2QLYA 1GJUA 3M0ZA 1BRLB 1K1DA 3GC2A 4PUJA 1L6WA 3AZTA 3B40A 3T0DA 1WXJA 3QGVA 3NG3A 4J3SA 5XINA 2PDNA 3TYBA 3OBAA 3GAKA 5JIWA 1CXLA 3R79A 3PPFA 1LZOA 2VURA 1NVMA 3TQVA 1V51A 3KRUA 1LG2A 3LZ5A 4IT1A 1R6WA 1I8JA 3PWAA 2XN1A 3BG9A 4OV4A 1OG6A 4JNMA 3H70A 4ZO8A 1UCWA 1BFNA 4AWTA 2HEJA 3AHXA 3BC9A 1W54A 3WFLA 1S3HA 1IEQA 1Y7VA 2AGTA 4NNBA 2OZ0A 2ODOA 3ZSSA 4PMQA 1RD5A 5EMUA 4AF0A 5KZDA 4PUWA 3A4JA 3HG5A 3STPA 3P84A 4QS6A 3QPZA 4MSSA 3RPMA 1QOPA 3M0MA 4EANA 1ONEA 3MBFA 5CCZA 5FL1A 2RDXA 5GJMA 1OB0A 1QI5A 2XVPA 4NZCA 3SFKA 4FNUA 3CQ0A 1N82A 3OGRA 4U5IA 2RAGA 2R24A 3W22A 2VQUA 4MADA 1TQJA 1UWUA 4J40A 3EDKA 5I3FA 3UYIA 3PZNA 1EHNA 3P5YA 4W9TA 1C8VA 5FF3A 4QJ5B 4UC5A 2YBUA 3BW4A 1CXFA 1VFSA 1SR9A 5JMUA 4AX7A 1EJ7L 2WPBA 4GABA 2AQWA 3QZAA 2YB4A 3UG3A 2ZZ7A 1HKJA 4C1LA 4ERGA 2OZ8A 2DZXA 2VWTA 4A35A 3KCJA 4FNSA 1X1OA 5FF4A 4WOQA 2PC8A 2ACSA 1W1VA 2VQTA 4MJMA 3OLGA 3G0XA 4HZ7A 2VDIA 4EWJA 2PWDA 1TZZA 2QJHA 8TIMA 1GQLA 4O57A 5G4WA 4Y96A 3T0CA 4LS0A 4C7FA 4MNKA 1TE6A 3TONA 3UWEA 2OYKA 3R1ZA 3SECA 3NYDA 4RE3A 3AS3A 1OCBA 2ISVA 3MV11 4Z2JA 2ZX5A 3D46A 4I7UA 4JIIX 1TPC1 4HA4A 1KM1A 3EMCA 4AD2A 1ZJIA 1K77A 2GLKA 2QPUA 2YKKA 2AAMA 4UTJA 3WH6A 1RA0A 4R3UA 1Z44A 1GEHA 2G3MA 1BF6A 4Q7BA 4DELA 2OLAA 2VFHA 4MNLA 4CVWA 5CPOA 2PDLA 3N15A 1UPMB 2G3FA 1NH6A 3VIKA 4IQDA 2VD8A 4XAFA 2X1RA 3ZWSA 1YNPA 3TWBA 3G1SA 3K13A 3KM8A 4QCEA 4K38A 4GZIA 3ZFHA 1Q66A 2J25A 2BDQA 4ZENA 4IMFA 4PTDA 3U2OA 1VHCA 2ZTKA 3CUXA 3LI0A 2OYLA 2HDJA 3IJDA 1HVQA 3UXIA 4ZB0A 2W67A 1GOQA 8XIMA 4Y6GA 2QF7A 4LFYA 2QULA 4CEXC 1GT8A 3E0FA 2DV0A 2AOSA 3AXXA 5DMYA 3WK3A 3VKCA 1QHOA 1DOSA 3L0KA 1TMQA 5CJNA 3T7VA 4UMAA 4AVNA 1KBBA 1QU4A 4GI8A 1BXBA 3USZA 3MP4A 1XINA 3LX9A 3MUXA 4Q4SA 2PE4A 4HHHA 4DF2A 4ZE5A 4JTTA 4ZA0A 3WQDA 3UBPC 4QNWA 1G6CA 2TODA 4FXSA 2YA2A 1M41A 3TYCA 4UMBA 1KXVA 1TV5A 4GIRA 4E8GA 4KRTA 4MKNA 2QZRA 3H12A 4CQBA 3BAIA 2C16A 1MW0A 4IIHA 2Y4SA 2IPWA 3S3GA 2CPUA 3ZS4A 3B9AA 3TN5A 3NL2A 3AISA 3W73A 4GNVA 1UW9A 3SB0A 3BLDA 2XIOA 3UNTA 1M7JA 2QR6A 3NOYA 4IQEA 1DJGA 4C7GA 2QCHA 4OKDA 3DDMA 5LXXA 1MXGA 2DORA 2DW6A 1EPVA 1EEPA 4D6CA 3QBUA 2ZVRA 1MZRA 1J2BA 1EEXA 1YTDA 1DJXA 1RP8A 4UUIA 4WHBA 3LPFA 2ZZ5A 4ZB2A 3QV7A 2DUAA 2FTYA 1QWKA 2XJ7A 1K9TA 4GUIA 4KFPA 3IJIA 2R9RA 1S5VA 4M0XA 3R11A 4WY0A 3C0LA 1A80A 1E0XA 2GDQA 3HQPA 1K4GA 4GOAA 3NXFA 5JXQA 3PM6A 1VEPA 1U22A 3UCDA 3CYVA 2D0GA 4LY4A 3VILA 3W27A 4PSPA 3NEHA 1B5TA 1TX2A 3LBOA 2EBNA 3W37A 4ZZ9A 3LHWA 4HPNA 4QQUA 4NNAA 1CECA 4UTHA 2DU2A 4MPKA 2QVHA 3M44A 3G1RA 1YQ2A 5CZJA 1GWJA 3DECA 3UERA 5AHMA 1OFOA 4LS1A 3SN1A 2PDCA 4S3EA 3WEMA 3ARTA 4QFUA 4JTHA 3ARUA 1VF8A 2I5QA 3PUOA 4GACA 3MBDA 1KWKA 3G6LA 3F2BA 3L2LA 1T99A 2ZXDA 4LUTB 4MB3A 3CLWA 5D33A 4HZMA 1WDWA 2Z27A 1PKNA 5IHRA 4B9YA 1PS9A 3KS6A 3WBXA 2WCAA 5PTDA 2D2GA 3BMXA 3EOUA 3WJSA 4NX0A 2J78A 4MB1A 5FAGA 3PZGA 4Q8PA 3M7WA 4GO8A 1HGWA 5AYZA 4H1ZA 4LAMA 4X0VA 2WB5A 5FAJA 4KCVA 4GVFA 3N04A 5I24A 5E5CA 5ABGA 3JU2A 3KL3A 4I9JA 4D72A 1ZBWA 3WJYA 2YFOA 4QJ4B 1TPB1 3GS6A 3G24A 5B80A 2DUZA 4G6CA 3JVAA 2QUTA 5H2ZA 4M3PA 3ARWA 3B8WA 4C65A 1S38A 3H24A 2YZ5A 3RAOA 3WDJA 3CEUA 4AZIA 3NL3A 3W7JA 1IR1A 3N25A 3REQB 3VPLA 1YBQA 2Q6ZA 1ICPA 1XXXA 1JZ6A 3W7RA 2F9RA 3FNDA 5I07A 2W61A 3F5KA 2FJUB 4M24A 4IJRA 3NSNA 1XSIA 1GTHA 1E3XA 3U4AA 2ACUA 3LTPA 2PGRA 3DERA 4LAZA 5I7GA 4WDWA 1H0GA 1XH0A 1QPRA 3PR2A 1NOUA 5BRBA 2I7GA 2E7FA 4LUSA 4MY1A 1JL8A 4B9ZA 5A6BA 2BOFX 4XO6A 4C6NA 4CNSA 4D71A 1IEWA 1WZLA 2OODA 2ZOXA 1R3VA 3DFTA 4AZCA 2CLPA 2QW5A 4AU0A 2V2DA 2BOGX 3A13A 4EACA 1I2NA 3BW3A 3QH2A 4E2OA 4CCCA 1Q63A 1O5RA 2GJNA 2WJEA 1DYSA 5I77A 1FKXA 1LL7A 4KMQA 4WUIA 2RDUA 5EKYA 3KLLA 1RVKA 4AD0A 3LI1A 4KEUA 4FOJA 4HOXA 1OK4A 3WELA 1AD1A 2JE8A 1UZ4A 2OMAA 2BVYA 5T9BG 1EXPA 1W3KA 1NU5A 4WGHA 4CU6A 1ML1A 3MHFA 2W6RA 3TC6A 4E2VA 2B7NA 3RYSA 1LWHA 2YXGA 4H41A 5C9ZA 3EX2A 3F4WA 1VHNA 3GXIA 5FD0A 3KP0A 1REQA 2V3DA 4AG0A 1EWDA 4JPGA 1XBXA 1JUKA 4IP4A 1XUUA 1CGUA 3WUFA 5ABFB 1YLVA 1SO5A 3VTRA 4LNCA 4BS0A 1OD0A 1AW5A 4A8RA 3GNXA 2MANA 3GG8A 1LBLA 1EO5A 1CT5A 3I65A 1K7FA 1E6NA 3GSMA 1W32A 3DH7A 3PK7A 2WMKA 3HPSA 4JBRA 2BSLA 4Z17A 3N2BA 1WDSA 4NIRA 5HPOA 2Z2UA 3ZO9A 1LF1A 3XINA 4LBUA 3TMLA 3BJSA 4C6FA 4IJBA 3BG3A 2BVWA 2FLIA 2D22A 2YDSA 1VCFA 5A6MA 3EEGA 4WKAA 4IGMA 3ARZA 5BMXA 4EXQA 3WQCA 1K9EA 4L64A 3WKZA 3EWDA 2WC7A 3K30A 4JOMA 1RALA 3PHAA 4PUMA 3HFYA 4BHYA 2UY3A 5EMLA 2OQLA 4X63A 4JX5A 3S5SA 1CGYA 1W17A 1WCGA 3RM4A 2INFA 4M7SA 3EA2A 4Z1AA 3VD9A 3W7CA 4AZ7A 2CIPA 1FTXA 3W07A 3CZ8A 4ZXOA 2PDHA 3VC5A 4O12A 2XWEA 4CN1A 3IRDA 3RO8A 2XZ9A 5AYYA 5H8PA 1L8PA 4A6GA 3GVRA 4X2RA 1GZGA 4GBUA 4IHCA 3EA3A 4I5XA 2PD5A 2FB2A 3MZNA 4JHMA 3GD6A 1WE5A 5RUBA 1TB3A 1VJIA 3OODA 3R0UA 2P8CA 1TPH1 2XIIA 1WKFA 3S1GA 3FEQA 4H9YA 4OU1A 5LHFA 4DBWA 4QDPA 3WNNA 1FH9A 1TV8A 1OF8A 4L6DA 4KRZA 3H2CA 3S42A 5ECUA 3W7HA 2C3ZA 4HHPA 3LY0A 1CX9A 1KXQA 1P1XA 3EB2A 4D8ZA 1IQ8A 5CLWA 3TAOA 3EOLA 2DH3A 3UA4A 1NDVA 1OFPA 4XZHA 4E38A 4HK7A 3VOIA 4CQ9A 2C13A 3AMDA 1RP9A 3IACA 1CLKA 3M43A 1W1ZA 4QRNA 2GL5A 1RA5A 3V5FA 1Y0EA 1X39A 3MW7A 2WZMA 4OT7A 3H2NA 1FCQA 1XYZA 4PN2A 3WQGA 2Y6ZA 4CQCA 1HFBA 2XSAA 2PP3A 3W7QA 2VI0A 3WK1A 1EL3A 2FFIA 1TFVA 3GUWA 3NURA 1HL8A 2ZXAA 3OPSA 4DJEC 2CLMA 3PS7A 4M56A 2VNCA 1UOKA 3OQEA 3WENA 3R0DA 1W3TA 2NT0A 5BXTA 3NQDA 1W2VA 1MW3A 3VIHA 4DRSA 3G0SA 5EL1A 1FXQA 3EWBX 1ZCCA 2ZKMX 2BHUA 2J9XA 1WKDA 1G94A 2DUXA 3VNLA 3U5UA 1B3OA 3FYOA 1P6BA 4WJEA 1S5WA 4S3KA 3UESA 1R3WA 3F4DA 3H7UA 4Q8QA 2JFEX 1XW8A 5BYWA 2ZRUA 1EDQA 3A4AA 4AY8A 3K8KA 4QIUA 1JCYA 4AYSA 2EF9A 2FH8A 1T6MA 2IKHA 3OLDA 4XZIA 4E4UA 1DWFM 2G95A 1TWSA 1DWAM 5KMYA 2QV5A 1IT8A 4MFDA 4OWGA 1RBAA 3CQJA 1CENA 4YTSA 1XF0A 1PX4A 3CS2A 3LMZA 5HUPA 1YHTA 3LHTA 2OG9A 3WDIA 4B5VA 4D6IA 3TA9A 3H8AA 2IQTA 1R9XA 4HU3A 1MVYA 3V5OA 2IUZA 4US5A 3AYVA 2E9LA 4ZFCA 1XSKA 1QPKA 1M3UA 1OZQA 3E2VA 1TWIA 1B3VA 3QF0A 4U31A 1QJWA 3BZGA 5AYXA 5A8GA 5CGMA 3CQHA 1IR2A 1JJKA 2OO6A 4S3AA 4UOQA 2GUBA 3PC0A 2WMJA 1BWLA 3N13A 2PU1A 4LW7A 5A1AA 3LSBA 3VAVA 4QSFA 3FYPA 3CNYA 3KL5A 4XTIA 4D8LA 3MJYA 3O6CA 1NWUA 1TIWA 4XUYA 1XYAA 2PURA 1EC8A 2GWGA 4HNUA 3ARQA 4N9CA 4E8DA 3LXAA 2CBVA 2EPLX 4PMUA 3KRSA 3D0CA 2PEVA 3HIJA 1XH1A 3CHEA 5H91A 1OIMA 3NQCA 3PBVA 1RZMA 1G4PA 1VBUA 1JAKA 2CZVA 3ZJ8A 3SSZA 3SFWA 4R7OA 3PTMA 4DUVA 2VRKA 2ACQA 3RM9A 1AH4A 3QHNA 5CZSA 1E3ZA 5CGQA 4Z0JA 3NQFA 3OLEA 2IS7A 3AIEA 3IJQA 2Z1WA 3ONBA 4YVPA 2FYMA 3OZPA 3TIMA 3ALGA 1R3RA 1UR1A 2INEA 3GKAA 4XWUA 3AZRA 6XIMA 3VGDA 3CAKA 2ZA3A 4L6HA 3CYJA 2Z1BA 4FB7A 3V1PA 4FK9A 4AZGA 3BLIA 3BQ6A 4PMDA 4LT9A 4ADSA 2PDBA 4JTRA 4MNJA 4WRHA 3FCPA 4E2DA 1H7RA 4ZOCA 3Q2DA 4BF7A 5FJOA 2NXIA 1SUXA 3WZ0E 3BV4A 2GJPA 3ORWA 2ZTJA 3SCWA 1YRRA 2E77A 4INFA 4JTAA 4IIGA 2B31A 2V5BA 4PODA 2JGYA 1J0ZA 1XGDA 5FJTA 3O8AA 3VDCA 3LNPA 5KZEA 1EUNA 5IHSA 3G1AA 3GBEA 3ATYA 4UBPC 3MUAA 2A2IA 1JDFA 3S1VA 2EGZA 2FMOA 3LLFA 5LIWX 4O52A 5A69A 4FX6M 1OEPA 5JQ9A 1M7PA 4XAYA 3ZR6A 4LCRA 4JIQA 3OGVA 4R9OA 3VNKA 4GA8A 4FNPA 4GVGA 1OSEA 4UTMA 1MUMA 2OQHA 5EMYA 2A3BA 4TX8A 4IPNB 2PWHA 5FKYA 5AC8A 2KZHA 4AZ5A 2GOKA 4MWAB 2FJKA 1N2VA 4KFNA 4HCDA 1K7EA 1LBFA 4TVDA 2QJNA 4DBUA 3AIUA 4M6QA 1OT1A 3DI0A 3GDMA 4GMEA 4HN4A 3BANA 3SURA 4DI8A 2J88A 4K8GA 1EUAA 2DP3A 4BJHA 1H60A 2TAAA 4JKMA 4FR1A 2VC5A 2ZVIA 3QEZA 3ZJ6A 3O6AA 4OTKA 3NXLA 2TYSA 5HNNA 1FUYA 4LXFA 1KBLA 1CB2A 3BURA 5E70A 3H4XA 5EFDA 3URNA 1JZ8A 4TTGA 3JZUA 2ASHA 3N2TA 2DJLA 4RX0A 2ALRA 1GVEA 5CSYA 4DPQA 3K8MA 3ITCA 4DI9A 4CCZA 3LHVA 1DE5A 2VX5A 1B3WA 4GH1A 4MYAA 3ITYA 3RPTA 1JYWA 2GQ9A 3S6DA 6A3HA 4JTCA 3EOOA 4IFKB 5AHLA 2FZ8A 2Q02A 2VGBA 6XIAA 3MI3A 3M0KA 3TX9A 5K4XA 1CGVA 2ZUMA 4Q4MA 1S1RA 6TIMA 3SO7A 4C6MA 3G2GA 5HDRA 2A3LA 3ABQA 3U8GA 1UKSA 4ATWA 4JY9A 4IXHA 4Y90A 4BQ2A 3AROA 5SWUA 2C15A 3M64A 5EGRA 4D6JA 2ATMA 3UWZA 2DFAA 1O7AA 4HNVA 2O55A 4J3VA 1KXTA 3KVKA 5CBJA 1B0IA 3SCVA 1H50A 1PVNA 3A9BA 4GH3A 4N7QA 3LSCA 4K7YA 5A6TC 3WQWA 1BEUA 5TQLA 2YCIX 3ES7A 4XIAA 3VOGA 3SW6A 1R9ZA 3TZFA 2X0SA 3W7LA 2XGBA 1TV3A 4LGXA 2WM1A 4G9PA 3CPRA 3CZLA 1RUSA 4AIBA 2OT1A 3AICA 3U5YA 2CLEA 1K02A 1Q65A 2HWGA 1FWGC 1D7KA 4U10A 1MQRA 5I2UA 1EJXC 2VX7A 2R1KA 2X16A 3NR0A 3VIPA 4GZJA 1V4YA 2V81A 2NVAA 2QEZA 4G5DA 3P3BA 2WANA 4DBDA 2QF8A 3E5BA 2G50A 1XM3A 6REQB 2CZDA 4MNMA 3W7GA 2WYSA 3H22A 7PTDA 4UTTA 4DXVA 1MEHA 1SFLA 1N8WA 3DI1A 1BHGA 3VD4A 5K9DA 1Y65A 3GDTA 2VL4A 3ZOAA 1AH3A 5CPSA 1UMYA 3QN3A 1PZ1A 3CL7A 3V16A 4HJWA 1W5QA 2ZIDA 5GNZA 4D6HA 3DYMA 3VZYA 1WKYA 2CWNA 4G7FA 4EAMA 1ZENA 2YLLA 5CC6A 3DFYA 1PTAA 4FLOA 3EXRA 3FAXA 4JYDA 4OJYA 4IG2A 1TCDA 4XBKA 3RGTA 3CL8A 3C2FA 3H21A 1FQ0A 3NZ1A 3BZJA 4O15A 5HQLA 2XVNA 3CUZA 1XICA 3UR5A 3QZ6A 5EMKA 1E1CB 3ITTA 4MF4A 5DY2A 2Y0FA 1KKOA 3GXFA 2WJDA 2QGHA 4QAIA 3ENLA 2WSRA 5T26A 4B5XA 2BASA 3R89A 2PDXA 2J8FA 2NQ5A 2E6DA 3OTRA 3SIMA 1SO6A 4XG1A 2XVLA 1OYBA 1KNWA 1NWRA 2O7SA 4WDTA 4W84A 4KWSA 3PB0A 2V3FA 3VGBA 4QITA 4WSJA 2XYLA 3S5ZA 2E4TA 2QV4A 3L23A 5BU9A 3G1XA 2PWEA 1FFRA 2PDGA 1FOBA 3POHA 1CCWB 3D5HA 1AJZA 1PIGA 2X7VA 4YN5A 3VOJA 4GPNA 4EOUA 5LHEA 4JIEA 4J3XA 2PLKA 3KBVA 4L4PA 5IOBA 4WVXA 2C1IA 3PP7A 3TW6A 2Y8VA 4X0NA 3G8RA 3BLOA 4DWSB 1W9VA 4GNKB 1CBGA 2IMRA 2ZX6A 1Q6DA 5AZ1A 3H4GA 1EXBA 4GO9A 2PWVA 2E3ZA 1ONWA 3AMKA 4HPHA 4NKCA 1NAL1 3AIWA 4R88A 1YEYA 2IKIA 3JRKA 3P74A 2YCKX 1XPGA 1P7TA 1UKQA 3L21A 5F4SA 1GOIA 1O1ZA 2V5JA 2J24A 3HG3A 3CUHA 3D3FA 4UZSA 1KLZA 2HNHA 3W1UA 3GTHA 4DJFC 1GKQA 2YL5A 3MHGA 3RMJA 5EMJA 2WKGA 1MDLA 2DVUA 1RPKA 2NV1A 4ZE4A 2Z1VA 7TIMA 2PF8A 3EX3A 3TTOA 2Z00A 1HT6A 1J4EA 4Q8UA 4A2SA 4DO4A 3EXSA 2WBGA 2E6AA 3AS2A 4J35A 1SZFA 4OQVA 1N7KA 1A5OC 3RU8X 5A6JA 1KQZA 3NQVA 3TSDA 4JXCA 2Q3RA 2V82A 3UA3A 4AF0B 4WLCA 1ISZA 1LLWA 1HKKA 1D2KA 3NCOA 5T9CE 2E28A 1OCJA 1A0EA 3LQLA 4PCTA 2HROA 2JBMA 4PL1A 2SFPA 1RD6A 4M51A 1PKMA 2Y7DA 4DJEA 3CQIA 3UPWA 3ANYA 1CI1A 3I4KA 3OOQA 3V36A 3PZOA 4UQBA 4EVZA 3NSXA 1HW6A 4A05A 3QGKC 4POCA 4LSBA 4HU0A 4ERIA 4PBFA 3VGEA 2X2YA 1BVZA 3C6CA 3ALFA 4AZ6A 1OBAA 3V7PA 2P76A 1NFPA 4QROA 2PP0A 4LU0A 4OHQA 2VDHA 4ES4A 1F4HA 2GQ8A 3EWXA 3PZMA 1OINA 1LLZA 3FVMA 2HS6A 1KM3A 5A2BA 4N6EA 2WNWA 1NWTA 2OGJA 4KIEA 4JTUA 1K70A 3KRBA 3ABRA 3TXVA 4R7JA 4B15A 1W9UA 4LAKA 4YMZA 3EDEA 3U7BA 4ZGYA 3KBMA 1DTNA 3O2LA 1Q7ZA 1W3JA 5D37A 4F40A 5EBUA 2X7WA 4I5UA 3RJXA 3PZVA 3OB8A 3OIHA 2G96A 5HJLA 4MKVA 3H4WA 1FP8A 3OGSA 4IUOA 4LQ1A 1Q6RA 2BFGA 4GXPA 4L80A 3W2NA 4N9EA 1BYAA 3H2MA 1VZWA 1TPUA 2CBIA 3IIVA 2X30A 2DSVA 2OFJA 3N9RA 4IGNA 1WBHA 2V69A 4XBJA 3NQ2A 1GJPA 2C19A 3CC1A 3ZXWA 1WPCA 3MUIA 3OVGA 1BKSA 1TELA 3TJIA 7REQA 2DGAA 3GM8A 4QM1A 1CEOA 3GB6A 3MT1A 3C52A 1DJHA 3LTSA 1HJVA 3MKVA 1FA2A 3WLOA 1V3HA 4ZMGA 3NPVA 2C8NA 4M7TA 3RUBL 1V02E 2Q8XA 2HE8A 3VOCA 4XZNX 1WP6A 1JIBA 3GE7A 3URAA 2R94A 4HCHA 1YDYA 4LCQA 1QW7A 1JG9A 4RE4A 2OEJA 3EWCA 1E40A 1I2QA 1V7YA 3UWQA 3I68A 1XLLA 3R8RA 3MMDA 3E5PA 1UR9A 2GVEA 5HANA 1Q6GA 1IGSA 2HBVA 1FWHC 1DWIM 2NXGA 4QS5A 2ZX7A 3IAPA 3WD0A 1XC4A 1U30A 1UZ1A 2C7FA 4LRSA 4XKMA 3DXIA 1DP0A 1PIFA 5XIMA 4M81A 4AIOA 1E73M 1H7PA 3FSUA 3MDWA 1R3TA 1HN1A 5CPQA 2DVTA 2X40A 1L2QA 3W24A 1J0KA 3A3WA 4QEHA 2PRLA 3MMTA 3WLNA 4DNMA 3ZQ9A 2V8ZA 1AMKA 3CB8A 1OZMA 1JXKA 4EXBA 4CEUC 2FZMA 4D6DA 1B9BA 3NO3A 4GISA 4R85A 2NVCA 4M6VA 5CPNA 2IQDA 4MY9A 1V77A 1ICSA 1K7XA 1IIGA 5FEWA 3BMWA 4B90A 3VOHA 3KAOA 3TOYA 1AW2A 4E0CA 1XLJA 4F8XA 2VGGA 4GBDA 3W28A 4KS0A 3U3HA 4DAIA 4Q4OA 4W88A 4FX7A 2E67A 1OC6A 3CV1A 2XG9A 4B91A 4QR6A 1A49A 2RKXA 4KEVA 4RW5A 1SZNA 4HNTA 4MYXA 2IQ0A 1J6PA 1CZ1A 2CLKA 4ZXLA 5C8BB 1ZJBA 1ZLPA 1L6SA 1UQYA 1AJ0A 3IJ8A 3H7RA 1R2SA 1T41A 3WUGA 1UA3A 4O10A 4L1XA 3KBWA 4MG4A 4HHMA 1XDLA 2PFHA 3HGOA 3NEVA 4YWIA 2VXNA 4F0KA 1W1A1 1XUZA 1XKJA 1HJQA 2VKZG 1QW9A 4O1BA 4A21A 4YS1A 3HBLA 2V2HA 3W85A 1EWEA 1V6VA 4G2DA 3OVQA 3MVIA 4MIMA 3MWAA 2H6RA 3B05A 4J1OA 2J7EA 3QKZA 2DIKA 3UCCA 4PRTA 1VFUA 3FIGA 3WL0A 4PMNA 1WDQA 1C91A 2BXVA 1OGSA 4X61A 1H11A 1EF2A 1UD5A 5FOOA 5TNVA 1YXDA 3NDOA 2FZ9A 3A24A 1AD4A 3FSTA 4JIPA 4BEUA 4P7RA 3S6TA 1VIZA 3STFA 3UU0A 3M5VA 3O0KA 1TKKA 1H62A 2Z6IA 3TCSA 2XGZA 4H83A 1EOMA 1V3LA 3CT2A 1M5WA 2BZNA 1ZJHA 1VFHA 3EWUA 2BXZA 1PX3A 3QPYA 4LVGA 1IZJA 4D6EA 2Q01A 2D69A 1T7LA 3BPWA 2NV2A 5CXPA 4CVUA 4A8IA 4KCUA 3I6EA 2EG7A 3HGSA 2B7QA 3NQEA 4PMOA 1L6YA 1BSIA 4GFIA 1EYWA 4J2PA 1VEMA 4XAZA 3GR4A 3H54A 5H8MA 1BPLB 3UR2A 2GGGA 3OHIA 3MC5A 1HQTA 1FHDA 4IQLA 3SRKA 2NUXA 2YBTA 2CKSA 1YDNA 4OBSA 1VJZA 2J74A 1B9ZA 4Q4PA 2YJQA 1OX6A 5LXEA 1FHUA 2IPJA 4Z08A 3FKRA 3FA3A 1EIBA 1TV2A 3TTEA 5FJIA 2VFDA 3UZZA 3V3WA 2X1SA 4FXJA 1PHWA 1RQBA 3LM7A 3GU2A 1VFLA 2I9UA 3MU7A 4HOWA 4PMVA 3G6MA 2XDFA 4JHOA 1BYBA 3KOWA 9CGTA 3N3TA 2YYTA 1XGEA 3T8QA 4D9PA 4KERA 3LERA 1HUVA 3VGHA 2GUYA 1A5KC 4Q7IA 5A6AA 3BO9A 4MB4A 3QFEA 4FXRA 2Z7KA 2REQA 1XISA 2OXNA 3BSGA 3RO6A 3EX4A 4C5YA 1OWQA 3MWCA 1MUCA 4XD6A 3KCOA 4TU1A 4RDYA 3GXTA 1KRMA 4LAUA 5BOFA 3JR2A 1PJ9A 1FWRA 4H6KA 9RUBA 2HV5A 2FHFA 1TA3B 4XKYB 1F7BA 5LZLA 1V03A 3GYCA 1Y5WA 4Y9NA 1YADA 4DHGA 1FWWA 2ISSA 2RH9A 3L4WA 3RXZA 4ACYA 2I1OA 2JEQA 1KV5A 1QMLA 3PG9A 4HPXA 4GKTA 5EB8A 5AYBA 4FR6A 4UNIA 3WLJA 1KGWA 2YX0A 5HR6A 3GVWA 3A5VA 4NJIA 3VZXA 2RJGA 4KWOA 1R38A 4FS9A 2P3ZA 4CD8A 4K36A 3PBYA 3BCFA 3GKFA 3K1DA 2RFGA 3P0WA 4KCTA 1SO3A 1GYLA 1K3UA 4FNRA 2VZSA 4O13A 3W1TA 3KHJA 5DY3A 2HK0A 3VCNA 1XRSA 1XQLA 2XH2A 3EMZA 4H6QA 3RU6A 1U1UA 2GDUA 4DY1A 4Q8TA 3R12A 4LALA 8XIAA 3PAOA 2NZLA 3WF1A 2VUNA 1JDCA 4UOZA 1P5BA 1YNQA 5F2MA 4FNTA 2DZUA 2P0IA 5C9WA 4H7ZA 4J3TA 1OFRA 4QISA 5A8PA 4QEEA 3UZYA 2O9OA 3MSRA 3HG2A 3U0HA 3K1GA 3U2ZA 3SRFA 4XB3A 1JPKA 4L56A 4LUYA 4UWMA 1KRBC 1M03A 2Z4GA 5C54A 4IP7A 2FTWA 3D6NA 3SRHA 1MW1A 4B3KA 3USBA 1QVBA 2OB3A 2CXEA 2WVUA 1AVAA 2JEPA 3GNPA 3WSUA 3ANUA 3VIGA 1UC4A 1FHLA 5CKSA 4XZWA 1PTDA 1B90A 2BB0A 1XD1A 4X9SA 3WIJA 1PAMA 1HKIA 4JICA 1JDEA 2BX7A 4B2DD 5I03A 3LM3A 4N4PA 2OEKA 2HRWA 3LG3A 3VGGA 2DSWA 4Q22A 4PFMA 2BGSA 2PPGA 3B4UA 3T09A 3H53A 5F2LA 2D3LA 3WN6A 3AZSA 3P80A 1KM4A 1X96A 4HGXA 3MSGA 5B7ZA 1IV8A 1XGZA 4K8EA 2D0HA 4XZBA 4Q8VA 3CGTA 5CJ5A 3DCPA 5HK4A 1BVNP 4HU8A 3GYEA 4O4VA 1SVDA 3RMEA 3M0LA 2E0PA 5F4WA 3VUPA 2QYGA 1O12A 4ZQMA 4JTGA 5DXXA 2CLLA 2DIEA 5HPCA 1A0CA 1W3NA 3TLLA 1LBMA 1E4MM 1NM9A 4N0RA 1DE6A 4W5ZA 3ARRA 4NRRA 4GC4A 1N55A 4GYPC 1FWDC 1YMYA 1KC7A 3W70A 3AMGA 4Q4RA 3RCMA 3W7KA 4E6MA 5LNVA 1SSDA 1YPFA 1RK6A 3PFRA 4O28A 5CBBA 1DWGM 5FJUA 2OLHA 1Z3NA 1TPFA 4UFKA 2GVYA 3QJAA 3M4HA 4LF2A 4FMVA 4LVAA 1QK0A 3G5EA 4EPEC 1IT0A 5AC4A 3W7OA 4C90A 3VKBA 3RIKA 1QO2A 3P81A 4OE7A 3AUOA 2NT1A 3AU6A 3V4BA 4CUCA 1EC9A 2YIHA 3SEPA 1DIOA 1R3YA 2EHHA 4P7NA 1UJQA 1YW1A 3ARVA 1R3SA 2XISA 4D1JA 3N6QA 3QYSA 1OCQA 3EAUA 1Q4WA 2HXUA 2ANUA 3TQ0A 1VKFA 1WZKA 1HO1A 2IKGA 4P7QA 3A12A 3W75A 2OPJA 3TR2A 2WOQA 2ZUVA 4ENLA 3WD4A 3W87A 1DTUA 1GG1A 1LP6A 4PMRA 3S2CA 3B9DA 3ZMRA 3UG8A 1VLWA 3ITXA 1UB3A 2VX6A 2NQLA 3APYA 4KEMA 1IXNA 3UXAA 1QO5A 3HPFA 3W6YA 5AKQA 2OQYA 3CB3A 4NAFA 4DWDA 1XX1A 1FWSA 1GQIA 1YNYA 4HOZA 4ZB5A 1TG7A 3C2RA 3PN8A 2PRHA 1BXCA 4AIEA 3SY5A 3DHFA 1HKMA 3E6EA 2ZICA 4JN7A 2Y5EA 3CAQA 3UXLA 1E9ZB 4DF1A 1EGMA 2A6NA 2PDMA 3LHUA 3RFAA 3MI2A 5JH1A 5GNXA 4HPJA 1JI1A 5DF0A 4PE8A 3KE0A 3NYZA 2YXXA 3O07A 3KRZA 4PSRA 1QWGA 1TVPA 1KM6A 1S3TC 4O1EA 4ZOAA 2J13A 3QMTA 3VZZA 3WLSA 4IXXA 3NQBA 3VFLA 4JX4A 1W8GA 3W72A 2BP1A 4IPIA 5XIAA 1EOKA 4YJ5A 4F9JA 1MO0A 3T1GA 2FMNA 4AD5A 3E74A 3FV9A 5CSSA 3DG3A 4PA8A 1IWPA 4O8RA 4Q8MA 2NWRA 4GKLA 1YX1A 4WX2A 1E6SM 1E5JA 2EJ1A 4ZTXA 5AC6A 1GK8A 3IPWA 2Y70A 1DJIA 1F6PA 4S39A 3ZLGA 4C6PA 2I57A 4ATLA 3VUSA 4IFKA 3T0BA 7ENLA 1XYMA 2XFRA 1JXJA 2X2GA 4JGDA 4DIAA 3ZVIA 2Y7FA 4K37A 4LCSA 3C86A 2GGEA 2X42A 4RDWA 3N14A 1LCOA 1F8IA 2BHZA 2WMHA 1DEDA 4LAOA 4GQRA 4QG8A 1GVOA 1H5YA 4JIHA 1NELA 2DQXA 3TJ4A 3KTXA 3LRKA 4L9YA 4E4PA 1AG1O 2CFFA 3LB0A 2FGBA 4A3HA 2QKFA 1W1IE 3A21A 1KCKA 4GY0A 4REQA 4NYYA 3W81A 2W92A 4PTNA 4JR5A 5TD4A 4AVOA 3K4DA 3EPNA 3RCNA 4RXFA 3CZEA 3HV9A 1H7WA 2CZ5A 3ZYZA 3AMLA 1I45A 4GC3A 3P5ZA 3MKCA 1ZBCA 3EPMA 2BOEX 3EOEA 2VT0A 1JDAA 5C7HA 4PRRA 3CXOA 2R82A 2YDAA 4HZ6A 3MUZ1 3C8FA 1A3WA 4X60A 3W53A 1WZAA 4TIMA 4ERAA 2XGIA 3OHMB 4MAZA 3FDKA 1XDMA 4IQJA 3QKEA 2JK2A 4IUGA 3I3DA 1W3IA 4Q8OA 2XINA 4NAEB 5FF0A 2VOTA 1PHQA 4TX9A 2UWFA 3AS0A 4YIWA 4K2SA 3CHCA 2XN0A 3P93A 1ECQA 4KESA 2ZWYA 4RZ5A 1S1PA 3CZJA 1Z7AA 3AHTA 3OA5A 3UZ5A 3SM0A 1M7XA 3H2OA 4HYVA 4EP8C 2J8GA 3FW6A 4GXMA 3FK4A 2F6KA 3LV6A 3WLIA 2ZZ2A 3S6OA 1DVJA 5C9RA 2YL8A 3TVAA 3K46A 1C8QA 4UQDA 2EPKX 2NQHA 3SQMA 1RSCA 4OBTA 4HMDA 5JBEA 5I3GA 1UASA 4WY0B 1ZZMA 1J0HA 1XYBA 5C9UA 3PTQA 1TQXA 4YVVA 4HT3A 1JDDA 1GQJA 1K03A 1JF5A 3ABZA 3GY1A 5HINA 2DZSA 3DIPA 2VZTA 4F0LA 1VIWA 1NQ6A 1ZGDA 3VE9A 3TXZA 2W0UA 3UR7A 1DXIA 3RN6A 4GIAA 4IZGA 1Q45A 2A5HA 3C56A 4H8NA 2OLSA 3S8HA 1O66A 1TJPA 4RDVA 3KXQA 3UETA 2PODA 1OX4B 1JQXA 1RHCA 2PDQA 4ZODA 3KOXA 5ABFA 2NQ9A 4JTFA 3PY2A 2VOMA 2GZXA 2XN2A 3RR1A 1TWWA 3GG0A 4KF1A 1CTNA 4JTEA 2QCLA 3W2MA 3WMCA 3JUGA 1WDDA 3TH6A 3DFQA 1B31A 1PYMA 3MV01 4Z1CA 4DO6A 4GY7A 4FLQA 3POCA 3T6CA 1TJ0A 2J8TA 1JYNA 4GGHA 2J75A 4RL3A 1AQFA 3IANA 1QAPA 1VBHA 1W5NA 3ZVHA 1DJNA 1TO3A 1HXJA 1IEIA 1PPIA 1BTMA 4B4FA 1E51A 1RQEA 1W3HA 2HVMA 3CIWA 2XHYA 3TYUA 1DIKA 2I5IA 1SGJA 4HP5A 4YYCA 3KWSA 4MWAD 4TO8A 2ABAA 4GUJA 2W66A 4JZ5A 2QJJA 1GYMA 5I79A 3DUGA 4UFHA 4DWSA 3O7UA 3UVIA 1A5UA 1OVDA 4DJFD 3QYQA 4GYKA 1M7OA 1TMLA 4NZFA 3AS1A 4ORMA 2A7NA 2ZZ3A 3AALA 5E6YA 1ZS2A 1ISXA 1OADA 2ZYFA 5I00A 2C6QA 1H09A 3ES8A 2Z1SA 3NFUA 4E5TA 1YDOA 4IMDA 1XLBA 1VBGA 3S1WA 3OBKA 3KBJA 4P8UA 1J6OA 1FH7A 3ZVHB 1XLAA 1YBQB 2QMJA 1U5HA 3F4NA 3GWQA 1XR2A 1YIXA 4ACZA 1O4UA 2YB1A 2B7OA 4L1GA 1XLEA 1SW0A 1M04A 3HPXA 1QOQA 4L9ZA 3WDHA 3NZQA 2QXWA 1S5NA 1I75A 2WHMA 2OEMA 1QASA 3CUGA 3B8TA 4MVAA 5I3HA 1W8SA 5J04A 2V3EA 3A4XA 3VDAA 4C6LA 3THDA 3AQUA 3LLDA 4L6OA 4WK9A 5KSWA 3M07A 1DL3A 1SZRA 1R86A 3VNMA 2AQVA 5JUVA 2V63A 1R87A 2HK1A 2ZA2A 4L65A 2BY3A 3IVUA 3FXGA 3THCA 1UKTA 2VEGA 3CV2A 1TCMA 3M1ZA 4X3ZA 2WK2A 1Z32X 1I4NA 1T40A 4PUNA 3DZ1A 3WMSA 3OZOA 2V6AA 1A5AA 1DJYA 3LGEA 5EBAA 4AEOA 4GJ1A 3IGXA 2GDVA 3QOMA 3EX6A 3G0UA 1W3LA 4M1RA 1WZMA 4IPLA 4Q6JA 2F84A 3W38A 2ZE0A 1J18A 3QRHA 5BW6A 2NSXA 1R47A 3APTA 4TXEA 3OYZA 1V0LA 2XIBA 1L6GA 4CU7A 4DJDA 4YTTA 2Y2WA 2J62A 4H8HA 4PCFA 3UZXA 4XO7A 5AOUA 3R6IA 4PEEA 4S3GA 3WK2A 4Y9AA 4E4FA 3PTKA 2XH7A 1HIZA 4QE1A 4XIMA 1OF6A 4JQ2A 3CWHA 1Q3NA 5D32A 1PKLA 3VABA 4F3HA 1T5AA 3O6YX 2MUCA 5A94A 1E0WA 1LT8A 3SAZA 4J9JA 4PTWA 3MI6A 1P0BA 1XCFA 3BAKA 2AMXA 3OO2A 3EWZA 2VWSA 4G56A 3NPXA 1LYXA 4HK6A 4C91A 4WSHA 1DPMA 4NI3A 4TUFA 5D9NA 4AD3A 1BGAA 3B8IA 2YW3A 1I2RA 4LWWA 4MMWA 1FWBC 3BLFA 3WBEA 1TREA 4MUPA 4DB7A 2W63A 2V38A 2D0FA 2J7HA 1F73A 3IJ6A 3SCRA 5LIKX 5DLCA 1O95A 2E8ZA 2VM8A 3WDPP 3BOXA 1EYEA 2QCEA 4GQ0A 4OVXA 4OUEA 5ENLA 1KR0A 4J27A 3WJXA 1YE4A 2UZ9A 2F2KA 1UWTA 3K8LA 4KEZA 3A9IA 3W1QA 3I4EA 4I6KA 2PS2A 1OQFA 4DQWA 2WHJA 3BJTA 2EG6A 1J10A 3WLMA 3T55A 4U3CA 1DV7A 2R91A 1LOLA 2H3DA 4I9MA 3SZ8A 2QUNA 3H6OA 1TTIA 5L6UA 1QI4A 2V2CA 2D1ZA 4XKYA 3TYDA 2VEIA 1A5SA 3O15A 4XISA 3WNPA 3LS9A 4OV9A 3QOKA 5HNTA 2A21A 3N73A 2VUYA 3W1XA 2ZRVA 3PPGA 4JTDA 1VYRA 4QSHA 1ADDA 4GHRA 3W29A 3WNMA 2ZXQA 1XFCA 1W91A 4HTYA 3CK5A 4L61A 4RZ4A 1MWOA 1GJWA 3N1AA 1B4EA 1LJYA 3HG4A 3SQLA 1N8IA 1ZBKA 1VLIA 4L4OA 1U1JA 4FHAA 4WEVX 5D4YA 2DY3A 1QPQA 5BU6A 4BWLA 2AMGA 5FF2A 1NQKA 3L4TA 3VOFA 3S47A 4A3RA 4W5UA 1ZJAA 3RRAA 3IUDA 3BE7A 4ZFMA 1Q7QA 4RNJA 5T91A 3QVQA 1NTHA 2OOFA 3T4CA 3EKLA 3BICA 1DJWA 4GX8A 1NF0A 1JPDX 2WKLA 1GHSA 1RR2A 1ONRA 4IJCA 4BEQA 1ITUA 1RCOB 2PAJA 3T81A 4J4KA 3O63A 1H1YA 2UY5A 4WDXA 3VM5A 5ABHA 5H6HA 1V6WA 2AL2A 3GC5A 5LA1A 2OR2A 3GTIA 1CYGA 5HWMA 3GXNA 1GVQA 3SQSA 3QPEA 3SRDA 4LC6A 4W8AA 5TBOA 1EZ2A 2GPTA 2Y24A 4KGJA 1VAHA 4EAYA 1KBKA 3K4WA 3SCPA 2PZ0A 3ZIZA 1JGMA 2QDDA 4UFIA 3E49A 3L4XA 2Z26A 3W1RA 3GR8A 1VS1A 4F2TA 3GK0A 3THAA 3WBYA 4Q8NA 4Y7EA 3PUGA 2OSWA 5D09A 1KA9F 1UROA 1XIEA 4AWSA 2WCSA 4GD0A 3UZWA 4WD0A 4AQLA 1Z69A 4Q8WA 1W9XA 2A3HA 3GLCA 3TC7A 3GDBA 4US5D 1E0TA 1FDZA 5HQMA 1GVYA 1XD0A 2ZZ6A 5TAOA 1K9FA 2FB3A 4AFYA 4PMJA 3MY9A 2O7QA 9XIMA 2IXVA 1B54A 4XAGA 6ENLA 3WQFA 1W2PA 4PTXA 1VYSX 1PIIA 4LX4A 5J5RA 2V67A 2GGJA 3LPGA 4V1YA 5HMEA 1U1HA 3EKGA 1V8EA 1KO0A 2FGLA 4BF5A 1UP3A 1D9EA 4GI4A 3WLRA 2XU2A 1ELSA 2VFEA 3T2QA 2V30A 3NNTA 2G5WA 1FFQA 3F7JA 3W71A 3FOKA 2Y89A 5C2GA 4NJJA 3PAJA 4D8AA 2EPOA 3B0PA 3B0XA 4ZQNA 1WDRA 4H04A 3W2JA 4HBKA 4J2MA 4CKQA 3WQEA 1OIFA 1NOFA 4CCDA 2ZX9A 5JBFA 3ANVA 4LUJA 3BTNA 2CLIA 1JAEA 2IXUA 3R2GA 5DT5A 1KQYA 3PZIA 3FAWA 5D9OA 2Y7EA 4L4LA 3LU2A 4DM2A 3E38A 4KWWA 4URIA 4QG6A 4BY3A 1RH9A 1U2YA 3TN6A 1O5KA 4PUUA 1UUQA 2I14A 2YZRA 3XIMA 3WY1A 4ZO6A 3NVDA 1J0YA 2XSBA 1UD8A 5HWJA 2A0NA 1IF2A 1FWAC 3LOTA 4S3DA 1E6RA 1UA7A 2BXYA 3QW4B 3IIXA 5G2HA 4TTUA 1S39A 3HURA 1FY6A 4TV6A 1XLIA 4GYJA 3C2OA 3WQVA 3AWNA 1O5QA 5FACA 2OSXA 3INPA 3ERPA 4R33A 4HMNA 5C55A 1XLHA 4QLJA 3UP8A 4LB4A 3O9NA 4C1NA 1JPMA 3N9KA 4YLWA 1VFMA 2QDHA 4DZ5A 4MPQA 2QQ6A 1TR1A 3M7SA 2J66A 3WNKA 3R58A 1F3TA 3N2MA 4DX3A 5BCAA 4P8XA 1TTJA 3CLMA 2D23A 4QBXA 5L9FA 4HQVA 3QZEA 1IEXA 3GHTA 1VENA 3A3XA 1DJQA 2CYGA 4KETA 3VNIA 5CH9A 1ZU8A 4NNCA 1SM9A 2PDKA 3K5XA 3VYLA 2XH4A 3L66A 3B0VC 4PTVA 2QIIA 3IVSA 1FXPA 5U7SA 3NJ3A 5M1TA 3TZNA 3ARXA 3P14A 1A5LC 4DF0A 3ZM8A 3LUTA 3OVRA 4EPDC 5BROA 1XJBA 1L0PA 5HNUA 4JKKA 4BK9A 2UV8G 4RV3A 3FKKA 4HN8A 2WLZA 3T4WA 5E6ZA 5JVLA 1OYCA 1T96A 3EDFA 3FA4A 3VFCA 3PBUA 1UBPC 3BGJA 3NQGA 1I60A 1US2A 4C6DA 4MWAA 3VNDA 1EA0A 3KTSA 3AYTA 1OFBA 3MO7A 4J7RA 5FL0A 5CJMA 4UTTC 5D38A 1Y8BA 5C0QA 2VENA 2UBPC 3W25A 1UG6A 4MTVA 5M03A 3WD2A 1WKEA 4PUEA 1DJZA 1RJQA 3S83A 2WC4A 3BH4A 1NDZA 3TYZA 4DO7A 1B3YA 2PGFA 4ZEPA 4RDZA 4WF7A 3AOFA 5D05A 4KWUA 1IHIA 4RNFA 5A6KA 4GY1A 2V68A 3R0KA 5BXSA 1ZCOA 5D8WA 4HU4A 2F6XA 2QJIA 3LTYA 5HUOA 3ICJA 2FTPA 3WNLA 4H19A 7A3HA 1JD9A 3BLKA 2NUYA 1M1BA 3GIYA 4UTWA 1A3HA 4Q32A 4V15A 1UKPA 3IGUA 4CD6A 3Q94A 2WXDM 3ARSA 3MKKA 3W01A 5E0KA 4XD5A 2D3NA 4TVCA 1RLCL 4XK2A 2Y61A 3CTTA 2OGYA 4LBSA 3AUJA 3PANA 4AB4A 4KW2A 1TV7A 3VDHA 1PZ0A 1N8FA 2BVDA 7XIMA 1J2WA 4ZR8A 2ZUSA 3U9IA 3AIBA 3NL6A 1FWIC 3ABOA 3VVGA 3LZ3A 2BGQA 4GJJA 2J7DA 4MKSA 5K4ZA 3O1NA 3E0IA 3NA8A 4PH6A 2ZXBA 3HQNA 4JNZA 2JIEA 3GR7A 5F7UA 5GPRA 1SFJA 1H7XA 2QCDB 1PZ2A 3ECQA 1I1XA 3DENA 4NXSA 3T07A 4J3WA 2LLEA 3FFSA 2VC6A 5TIMA 1UIPA 4AZBA 4YWSA 4NJKA 2YDRA 5K9XA 5LNWA 2DT2A 3S4TA 2GUUA 3N4AA 3NOEA 2CETA 2V5DA 4IICA 1CLVA 2ZRWA 3AI0A 3HGJA 3EX1A 2WZHA 1CXEA 1Y5XA 1H5VA 2PBGA 4AY1A 2IPGA 5T8GA 3SCQA 4HA1A 4IFOA 3TMQA 3WFZA 2GSHA 3EA1A 3S0CA 1X6LA 3GG1A 2PUZA 2FVMA 4CD4A 4BI5A 5I3JA 1GOWA 5HNRA 3M41A 4RKAA 3VKDA 1X7FA 4DLMA 4JTJA 4OGZA 4HJFA 4LJ3A 4LVDA 1J9YA 1PX8A 4MWAC 2WZIA 2PRMA 2CLHA 4U33A 1DXEA 1JUBA 2J9ZA 1OX4A 5F4XA 4UFJA 2PU0A 2PTDA 2BNJA 3OG2A 1GNXA 5EPDA 3TJLA 4HMEA 1MUWA 2YYUA 3QC3A 3CUIA 3AJXA 5FJPA 4Q3MA 1ZAIA 2Z1XA 1ZP4A 1KFCA 3ARYA 4ZQPA 2WMIB 2CNCA 3S2NA 1W1YA 5D02A 1P0DA 3VNYA 3EWWA 1XIHA 3GXMA 5KEZA 3GBDA 5E0CA 3LXBA 3DFHA 3FY1A 4U28A 2VEKA 1TR9A 1VB9A 4WKFA 4C6CA 5DCDA 3GW0A 3NSMA 4F9DA 4G8TA 3DFOA 1B2YA 3A23A 4PCSA 4ZQCA 2Z24A 2XTKA 3PJWA 1SW7A 3S2LA 1V3JA 3W3OA 1Z48A 4ADTA 4NZ5A 4DUOA 2OKOA 4J3ZA 1Z9AA 1G7VA 3RPDA 2A3EA 4N02A 4DN1A 4NY2A 3BLLA 4P7LA 3MP5A 5TF0A 1ME9A 1AFSA 4KIRA 4DLFA 5FF7A 1I9CB 2E5BA 6TAAA 4E3VA 5E93A 3QQWA 1WBJA 3LCXA 1CGTA 2Z1KA 1H41A 2PGWA 5KINA 2AQOA 2W79A 1ADOA 3T40A 1RLDA 3VIMA 1V6UA 4JD4A 3EMQA 1AA1B 1ZQ5A 3AHZA 3NWRA 3W7EA 4WR3A 4FX8A 1B3XA 3N12A 3OU8A 3PSVA 3V0TA 4QLLA 1PXGA 4O0ZA 4L9XA 3I7RA 3LA4A 1TUFA 1E4IA 3CMJA 3QC0A 2ZX8A 3EXTA 3Q37A 2VFFA 1RV8A 1W1B1 4IWWA 1V02A 1YE6A 2HSAA 2NX9A 3DESA 4NYUA 4G7EA 2G37A 5BNKA 4LV9A 1LRTA 2AL1A 1QOXA 1CB7B 1UBSA 1XIIA 3DBPA 3TK7A 3GZ3A 1UWQA 1W5PA 4K7VA 1BVWA 5KZ6A 2NW0A 5BWAA 5FCZA 1E5NA 1S2WA 1O94A 1DQXA 3DFNA 5LGXA 2J9YA 2VCCA 1A4LA 4IISA 1R2RA 2WZTA 5IFPA 2QNEA 4DXXA 4REQB 2A7RA 1US3A 1J5SA 1TPWA 1ZNNA 3A6OA 1P6CA 4NU7A 3RK8A 2H8ZA 1XL9A 4FALA 5E9AA 3E0LA 3VM7A 1XYLA 3KTCA 4LYQA 3PBWA 3KUMA 3LLXA 5D2XA 2D2JA 2EO7A 3PVFA 3H23A 3SCUA 3LNMA 3IEBA 1GHRA 5CC5A 1ZL1A 3L9CA 4F79A 1DWHM 1AJ2A 5GNYA 4JQ1A 1XYFA 3NGJA 4ICCX 1ODUA 1PTGA 1VFTA 1JFXA 3XISA 1DXFA 1WOBA 2J79A 1LORA 1Q6CA 3K2GA 4UTIA 1AUSL 1SJDA 3CJPA 3TTQA 4YTUA 1EH9A 2Y8UA 5CBIA 1XG3A 3W74A 4B5SA 1VC4A 4TX6A 3ZR5A 4OBRA 4ZVJA 1WA3A 1VPQA 3DHUA 2J7FA 4PL2A 3THUA 3RM8A 3WQ5A 3P7YA 2YLAA 1OC5A 3V75A 5HULA 3G22A 3HJZA 4IL0A 1VRXA 1SU5A 3VCCA 2W62A 3VINA 3DAQA 4GUGA 1RCQA 3PZQA 2E8YA 1F74A 1PYFA 2FPVA 2WWDA 2FH6A 4ASTA 3H26A 3S5YA 3A3HA 3EGJA 2XFWA 3GVVA 4U2ZA 2FQIA 1ZALA 3LCGA 2J7CA 5CEWA 2NUWA 8CGTA 4UTUA 4O14A 1XP3A 1GOKA 1E6PA 1TPDA 3N9SA 4JTSA 1DIEA 2X1TA 1NIUA 5E1QA 1JQVA 4HPGA 3REQA 4DWSD 3LEPA 3TFCA 1Q8JA 3QHOA 1UR8A 3MS8A 1SFTA 3PG8A 1FHVA 3HJEA 3WF2A 1YYAA 1CWYA 3BARA 1ZHAA 3ZSTA 4RPPA 3PBMA 4FEZA 2E6FA 1MW2A 2WV8A 4B2DA 1G01A 4U5KA 4GIEA 1UUOA 4JQAA 1XH2A 3UJ2A 2VR5A 1ITXA 3B03A 1LLOA 4UR9A 4M82A 1KCZA 4LVBA 3I10A 1GZ1A 4LUSB 2JKEA 1NSJA 5FSDC 3W02A 2OYMA 1W1PA 2J47A 4CN6A 2DZAA 3SUSA 5C71A 3IARA 3CT7A 1UH4A 4Z0SA 4NZ4A 1E0VA 4UFMA 4L1WA 5A2CA 3LCLA 2EPMX 2Q8ZA 1XV8A 4IOTA 2VMFA 4UB9A 3RX2A 2Z28A 3AAMA 1TIMA 2PMQA 3B9NA 4W8LA 1JZ3A 2CKRA 3B06A 3UPBA 4Z42C 1CGXA 2YGYA 1OX5A 1KB3A 4JIRA 3VXGA 1HP5A 1IE7C 4DAFA 4AAJA 1KBIA 4ALDA 2P0OA 3QLLA 3OW1A 2PWGA 4FPSA 3PPHA 3ITGA 4JL1A 4YYFA 4GK8A 4DNHA 3GNDA 5M5DA 3NUKA 1WB0A 1A47A 1MFVA 2FVLA 2YA1A 3A64A 2JALA 4FLRA 4UTFA 3B8DA 2PB1A 3VD5A 4Z2HA 1POJA 4P7OA 2XPKA 4Z2GA 1UD2A 4IX0A 3GXDA 3TV8A 4C6IA 4AVFA 1Q6FA 3KW3A 3TYEA 3G8EA 3CAWA 1KD0A 1SO4A 1E9IA 1ZFJA 3JW7A 1OY0A 3TN4A 3HTWA 2WVTA 4PYSA 3ARPA 1NARA 4M1BA 2PDJA 4KWVA 1JYVA 4H9TA 2XWDA 1JF6A 3CASA 1H7OA 4CD5A 4QDWA 4JN8A 4XSLA 2PCQA 4EPKA 5MF5A 7CGTA 5FA5A 1FWJC 3NDYA 3LPPA 3KDOA 4YU1A 2DSZA 1UKOA 1RCXB 3M0IA 2XZ7A 3KL0A 4O0KA 2YCLA 1EHAA 4DYEA 4RPQA 4A4AA 1SMAA 1MQPA 3H2AA 1RBLA 4G1KA 3C0JA 3RJYA 3UJRA 2PSNA 3L68A 1V0MA 1TWZA 2ISFA 1A5MC 2Y7GA 4F0MA 4TMCA 2PTWA 1T0OA 4Q4KA 1G9HA