3WR5A

Structural basis on the efficient co2 reduction of acidophilic formate dehydrogenase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
401
structure length
401
Chain Sequence
b'AMGSMAKILCVLYDDPVDGYPKTYARDDLPKIDHYPGGQTLPTPKAIDFTPGQLLGSVSGELGLRKYLEANGHTFVVTSDKDGPDSVFEKELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHVDLQSAIDRGITVAEVTYCNSISVAEHVVMMILGLVRNYIPSHDWARKGGWNIADCVEHSYDLEGMTVGSVAAGRIGLAVLRRLAPFDVKLHYTDRHRLPEAVEKELGLVWHDTREDMYPHCDVVTLNVPLHPETEHMINDETLKLFKRGAYIVNTARGKLADRDAIVRAIESGQLAGYAGDVWFPQPAPKDHPWRTMKWEGMTPHISGTSLSAQARYAAGTREILECFFEGRPIRDEYLIVQGGALAGTGAHSYSKGNATGGSEEAAKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formate dehydrogenase
publication title Structural basis on the efficient CO2 reduction of acidophilic formate dehydrogenase
rcsb
source organism Thiobacillus
molecule tags Oxidoreductase
total genus 137
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.2: Transferred entry: 1.17.1.9.
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A01
2B4RO 4FFOA 4M49A 1MG5A 3F6YA 3OA0A 5HM8A 1E7SA 2OP1A 3BHJA 3FD8A 2W2KA 4UVDA 1YVEI 1Y8QB 3H9EO 5DULA 4CUJA 4CUZA 1HE5A 3WIEA 1D8AA 4LISA 2FRDA 1SCUA 3DBRB 3JQ8B 3KOUA 2AQ8A 5I9MA 3HHPA 2NQTA 1VL0A 2Z1NA 4M54A 3RSHA 2E48A 3PK0A 1ENYA 1I30A 1SAYA 1MC4A 4Z3DA 4YYZA 2D0IA 4QEDA 3ABIA 1N1EA 1PX0A 5KJ6A 2VRCD 3S1LA 4GSKA 4YAKA 2OFPA 3E9NA 4CQMA 2CD9A 3CTMA 1F14A 2OHXA 3D3EA 3UCEA 1H2BA 1UR5A 1T4BA 3ICCA 1E5LA 1GADO 1R37A 2GO1A 5KWEA 1CEQA 3WGOA 3TN7A 5IN4A 4ND3A 2VHVA 4XCVA 2JL1A 4W99A 3LC7O 3IDSA 2JD0A 2JHFA 1PGOA 3ETGA 4DGSA 1U2DA 3PWZA 1PS8A 1RM4A 3KEQA 1YDWA 2GUGA 3EVTA 3O4RA 4J1SA 3ROQA 1YS4A 2W2LD 4D7AA 3B1FA 2X7HA 1SO8A 1JWAB 3HUDA 1EQ2A 4OOFA 4CQLA 3K92A 3ZWPA 2UDPA 1PWXA 4FFRA 3CINA 2FSSA 3NGLA 4R1SA 4PRLA 4RVHA 3D4OA 3GY0A 3WGYA 4G2NA 3I9MA 4E31A 1GD1O 4BQRA 2DFDA 1N7HA 3I6QA 3MJTA 5A02A 4AJIA 5KVQA 4CJXA 4KUHA 1DEHA 3GDFA 1B3BA 5KJFA 1EE9A 2O48X 4BO7A 5IDWA 5BR7A 5CP8A 1OFGA 2QX7A 1IUKA 1YE3A 3PQEA 3JQAA 2P91A 3DZBA 4J90A 3RBZA 1Y8RA 3GHYA 4YWJA 2DUWA 4BHTA 1PJLA 2EIHA 1NBOA 2VOJA 4YVFA 2G82A 1K6XA 2I76A 3VZSA 3K73O 4BNFA 4D45A 2EP7A 2BFAA 5JLAA 1EUZA 4MKRA 1EUCA 2PA3A 5FEUA 2BI8A 3IKTA 3I9JA 1P33A 4EBFA 3FWNA 4MPDA 4Q3NA 1LNQA 1X1TA 4EUEA 1DPGA 3MJSA 2W2KB 4UREA 4J4BA 4XWYA 3RC7A 3DZJA 5CDYA 1Z74A 3GR6A 2G17A 4BGVA 1R4NA 4H15A 1WDMA 3WYBA 3RUDA 3PVZA 2VYVD 3FBTA 2PD4A 4MP8A 1Q7BA 4GBJA 3OQ6A 1Q0QA 2ZCVA 4E21A 4OYRA 4BNHA 1H9BA 1B7GO 1PR3A 5A4DA 3GPDG 1CQJA 2ET6A 2I6TA 3GMSA 4IJKA 2P2SA 4P4NA 1IULA 4CQMB 3DB2A 3HE3A 3GOHA 4HNGA 1V3UA 4PCVA 4L8VA 3KB6A 5G4KA 1JDJA 2P4HX 2D4AA 3PYLA 4J2HA 1NAHA 4E5KA 1K2WA 5CEFA 1B8VA 3DQPA 4R9SA 3AUSA 2IRWA 3JQ7A 2Q46A 3GQVA 3ITKA 1RPNA 3E6AA 4NJMA 4W9NA 2P9GA 4U8GA 5COQA 2QRKA 3VHRA 1GDHA 3FN4A 4NFHA 1DLJA 4GI2A 4YRBA 4MO2A 5AVOA 3INGA 5JXWA 1C1DA 2D1YA 1UXIA 5A1TA 1ONPA 2EF1A 2V6FA 4CQLB 2DTDA 2R00C 2EG9A 2ZYDA 4GX2A 1M2WA 1EVIA 3W6ZA 3KSUA 4P38A 3KYDB 4M55A 5BNTA 5JMWA 1EDZA 3L6DA 5JAZA 1ISMA 3RC1A 2X9GA 2OXIA 4P22A 2PY6A 1DAOA 2CFCA 3AK4A 4R5HA 4TSKA 5IFLA 1FDUA 5T8KA 2EJWA 4LSWA 4XGIA 5DOVA 1I24A 1K89A 3PHLA 2YQ5A 5EQDA 1Z82A 4HX5A 4RPJA 4ALIA 4CLOA 4RDIA 1NFRA 3PIIA 5L7YA 3GGGA 1NQAO 3JQAB 4E2XA 2DVMA 4B4UA 1Y8RB 1CDOA 4AFNA 1LSOA 2YV3A 1QYDA 3OA2A 1PIWA 3HZZA 3OM9A 3W8FA 3F3SA 4KTTE 2OBNA 4CODB 1GYPA 4J4TA 4DXHA 1ISFA 1BMDA 1EFKA 4IMRA 1QXSA 4MP3A 2HJRA 3FBGA 4EJMA 1E1MA 2HMVA 3ZU5A 1ARZA 3S55A 1OOEA 4GPD1 4G5HA 4FGSA 3ZHXA 1AN9A 2QW8A 5IZ4A 4BO4A 3T7EA 1WLYA 1C1XA 4NK4A 1P1IA 3ZDFA 3FNGA 4LN1A 1GZ6A 1Q0HA 2HK8A 1UP4A 3IC5A 4WNCA 3ROPA 1DIHA 2AQHA 1PR9A 1PGJA 4LCJA 4ALMA 4BUCA 4WLNA 2QRJA 2GN9A 4AJKA 3PDUA 1KC1A 2FPGA 1D7OA 3PZBA 4TWRA 4XRGA 4MOWA 3Q11A 2PGLA 1OZAA 4LCEA 3DL2A 1DIRA 1PJQA 5G4KB 3L4BC 3L77A 2EW2A 3F47A 1Z45A 5IAAA 3F46A 4OKIA 1ADBA 2JHGA 4Y67A 5IDYA 3QWBA 3WQQA 5U1PA 9LDTA 3JQ7B 3KM0A 1BXZA 1ZK3A 1MB4A 1MFZA 4E32A 1T2DA 1Z75A 4NJMB 5TGDA 4JJGA 1LLUA 3DZIA 1LSJA 5DZSA 1EBFA 4GKVA 3ADOA 4ZQFA 5TS3A 1C1DB 1HYGA 3CE6A 5JAQA 3C8MA 3D4NA 1QMGA 4BMSA 2ZCUA 4KP7A 1Y5MA 5IXSA 2J3IA 3IQDB 1M6WA 2A94A 1R66A 3OICA 5IJZA 4RQUA 4OMUA 4XYMA 3WGIA 3E9QA 1P77A 3QLJA 3MWEB 1DIAA 1E7QA 2J3KA 1ID1A 4AJPA 2X1HA 2BI7A 2PNFA 4JBIA 4BNMA 3TZHA 1D1TA 1XEAA 4XQGA 1EVYA 3DDNA 2VRBA 3VTFA 4WUVA 1WP4A 1H93A 3DMTA 1YOVA 2E49A 4CLOB 4I1IA 1A4IA 3EYWA 5ILGA 4XZ3A 1A5ZA 1NAIA 3G1TA 3T7CA 5H83A 4IDFA 1EMDA 5DBIA 4IXTA 4ZRMA 5TNXA 4OJNA 4YJGB 4IZIA 1SOVA 1IZ0A 4L75A 3GVHA 4PLTA 5DNAA 3TPCA 4NH4A 1PJCA 3ZWVA 1LEHA 4AL4A 4BO0A 5KKAA 3LF2A 4F46A 5L40A 1DJNA 2LDXA 4PZEA 1VL8A 3Q9UA 3PGJA 4PGFA 3O38A 2Y0CA 2PZLA 2Y99A 4BMNA 1P1KA 3MJ4A 4YT5A 1EZ4A 2VYNA 2HMWA 4B3IA 5ES3A 3ZWYA 2Y93A 4PLCA 9LDBA 1NWHA 5IZCC 3WWYA 4BQPA 1L7EA 2HSDA 4Q3EA 4R4JA 3RKRA 4ZGWA 4DYVA 1DC6A 1N92A 1A71A 3R3JA 1TT5B 1LLQA 3I1JA 4FS3A 3I9OA 4I8XA 3G49A 3IP3A 4I5GA 1VKNA 3DHYA 4HUJA 3IKVA 1I3MA 3CIFA 1VE9A 3PHJA 2I3GA 4JROA 3GHHA 3KO8A 5A03A 4CM3A 1JTVA 3OIFA 2WJPA 3DR3A 1IOLA 4ONEA 1H6BA 3JD1A 1GCOA 2OBYA 5L53A 3NDRA 3LLVA 3NT4A 3V1TC 1IYZA 1GEEA 3ZNNA 3Q9NA 1C0LA 4TRRA 3WICA 4D42A 5JO9A 1GAEO 1BGVA 4NHEA 1EK5A 2J3HA 3W4JA 4J91A 1LC3A 1KVQA 2J5RA 3GFBA 2EGHA 3SXPA 3ZNQA 3Q0EA 4A7PA 5JY1A 2B0JA 1X13A 3SEFA 2EKLA 3FF4A 4IY1A 3ZU2A 3KV3O 3VKVA 2RIRA 1RM3A 1EVJA 5G4LA 1K6JA 1EK6A 5TC4A 4J49A 3O8QA 1R15A 2Y1CA 4B7CA 2FR1A 5F5LA 2NSDA 5K6AC 2BF7A 2FP4A 1BHSA 1HSZA 2GN8A 3ASVA 3AY3A 3FI9A 4HBGA 3ZHZA 4Z0HO 1ZK0A 2QRLA 1YOVB 2X5JO 4XIYA 5AXCA 3JYQA 1B14A 3BZUA 4DBVO 3IJPA 2Y1GA 4Q39A 1UJMA 4E2WA 4D3FA 4XDZA 4ZA2A 5I7SA 2VHYA 2HUNA 4RPGA 4WEQA 2O3TA 3V2HA 4F3YA 4Q3AA 2PGDA 2CDCA 1CYDA 1NHGA 2HJSA 3AWDA 3PZRA 5B37A 5ICMA 3A4VA 1H0KA 3EC7A 1L1FA 1A72A 1ZSYA 4J4HA 5FFFA 2VOEA 5TX7A 3Q2KA 2GD1O 4YCAA 2BFPA 1T2CA 4ZQGA 5TLSA 4B4OA 1SOWA 4B3JA 4O59O 4E33A 4JLWA 2FN7A 1HETA 3VPGA 1YH3A 4AG3A 2C29D 2O3UA 1HZJA 3GVXA 4DUPA 3INTA 1MUUA 1GR0A 3LLSA 1O0SA 3T4XA 4GWKA 2ZTMA 1QG6A 3MTJA 4NDNE 5JMPA 1ZXLA 5K0ZA 1WAMA 5DOZA 2CUKA 3PHIA 1JN0A 1OC2A 4J0FA 3K31A 3R0IA 4MKXA 4FCCA 4E12A 1BXKA 1VC2A 5AXBA 1C0PA 3OH8A 2O4UX 4RGBA 1W0CA 5ITWA 3UXYA 3MOIA 1I2CA 3QA9A 1V35A 4YQZA 1IZ9A 2VWPA 1ZNQO 3AUAA 3MJEA 4U0JA 2VTDA 4GSLA 4AJLA 2X9NA 4CQMD 1QYXA 2IZ0A 3ICPA 5C3MA 3U0BA 2Q1WA 5EN4A 1IHYA 1XGKA 2PH3A 5JY6A 4J1QA 4NBWA 4RPLA 2Q49A 2CDBA 4L0QA 1VJ0A 1B0AA 1T1RA 3KZVA 2JJYA 3INRA 3WQRA 2O3RA 4IIUA 3GEMA 5CDGA 4QO8A 3VDRA 3O8QB 1DLIA 1I3NA 4NPCA 1KVRA 2GGSA 1TXGA 1D4FA 4L76A 4B8WA 2O2SA 2UYYA 4NBUA 5GMOA 3AW9A 3PQFA 1LDEA 1QYCA 1SMKA 4JX8A 3ZWCA 2G0TA 4YEDA 2B4QA 2PZKA 2ZKLA 4GX1A 1UDAA 1ZJYA 4EDFA 2Q45A 1RM0A 4HP8A 1BDMA 5KCZA 3ZN2A 1SNYA 1PSDA 5B4UA 4C7KA 4OXNA 3FCOA 4YJHB 3ZWNA 3BMQA 4Z6KA 3MEQA 4DLLA 2A92A 3DOCA 3STHA 1ML3A 4BB6A 4D0RA 2OP0A 3PJGA 3ADPA 4XQEA 3JQFC 1WDLA 5DF1A 4WPGA 4YTEA 3WOHA 3D64A 4EZBA 3I5MA 5CFZA 5K9ZA 3U09A 3CH6A 3RUCA 1LDGA 2G76A 3JQAD 2H6EA 4ZQEA 4EEZA 3PEFA 4MDHA 1JLLA 3GEGA 2Q4EA 4BIIA 3A28A 2CNBA 1GZ4A 1V0JA 5KJCA 4LGVA 1V3VA 4MJLA 2X23A 4BNUA 3I52A 1ZFNA 3JV7A 4FOSA 3RUFA 5JW6A 2GR9A 2RH8A 2FPPA 2QQ5A 3WG9A 3GAFA 3ZH2A 3H6KA 5EL0A 1XU7A 1AGNA 3GVPA 3GF4A 1HDXA 1HDYA 4MIYA 2Y68A 1BWSA 3NDJA 4I08A 4KTVE 3F5SA 4XEHA 3KSZO 3O26A 4I9NA 1TT7A 5H81A 1CIVA 2CSUA 4IM7A 3JQBC 4DPLA 1O89A 1PGNA 3HN7A 2GSDA 3RWBA 1P1JA 3RCBA 3VTZA 4RVUA 1XSEA 2E6UX 1QV7A 4A5OA 5ILOA 5G0WA 1C3VA 3HFGA 1NQ5A 4J6FA 2HMSA 1HF3A 2D3TA 4XX0A 2BH9A 5DP1A 1DSSG 4EJ0A 5TT1A 1ADCA 1GZ3A 4D3DA 3O9ZA 3TZQA 5KVCA 3CUKA 3WGTA 2J3JA 4PG4A 3MJCA 4A73A 2ZYAA 3D3WA 3NEPX 3GVCA 4IS3A 3ZU4A 4B4VA 3UKOA 2H5LA 4O5OA 3AUUA 2JKVA 3LF1A 3ULKA 4RORA 4EYEA 4BNTA 3DXFA 1LLDA 1E77A 2PZJA 3H2SA 4FOOA 3M1AA 1CRWG 1P9LA 3JD4A 2GLXA 5HS6A 1FDVA 4OKNA 1PJSA 1O94A 2YDYA 4FFNA 3KYBA 3NJ8A 1ONOA 5LC1A 3ZHBA 2OL4A 2RAFA 2BRUA 2XAAA 5DCYA 2IE0A 2GRAA 1U2GA 3QHAA 1PJ3A 5EINA 5A3VA 3BMQB 4FB5A 2EKQA 3VC7A 4FQ8A 3EZYA 2W90A 3G17A 1ONNA 3GG2A 3OJ0A 3E03A 1VL6A 2C54A 3WTCA 3LVFO 2CVOA 5CHEA 3FTNA 1XQ6A 2X5KO 3RJ5A 2NLOA 1OAAA 2I3AA 2WYVA 4KDEA 3ONEA 3QSGA 3UW3A 3B1KA 3V1UA 1ZMOA 1LDYA 1FDTA 5L3ZA 1LI4A 2PR2A 4DPMA 1PL7A 5CG1A 4NBVA 4Z9YA 3DONA 2HMUA 4WEOA 3BYZA 1SPXA 3WYEA 4K28A 2VHZA 3TFOA 3GLQA 2PD6A 5JCXA 1VLLA 2EEZA 3LDHA 1JU9A 4BMVA 4A10A 2R00A 4BNZA 4CMGA 3FSRA 3DOOA 1TA4A 2X9VA 1E3IA 4IDAA 2WM3A 2ZJ0A 2PGJA 4AJEA 4DRYA 1UXJA 4QX6A 3I83A 2CVZA 2YUTA 2ZYGA 4XQ9A 4F6LA 1PGQA 4FC6A 3WIDA 2NU8A 3QRWA 4GL4A 4RPHA 3VH4A 1HDZA 3Q2IA 5DBFA 5TJ9A 4PLYA 2ZB7A 1NHWA 1B3RA 3DAPA 1CF2O 2FMUA 2H63A 4JNKA 1E1LA 4PVDA 1NM5A 3ETDA 1AHIA 4R41A 1U8FO 3ENKA 2X86A 4CMAA 1ZEJA 3R1IA 3D3WB 3JSAA 3SLGA 4E5MA 5T5QA 5IDQA 1R6DA 4ESOA 2Q2VA 5F3RA 4PVCA 1MGOA 1JVSA 4ZQBA 4JQCA 1LX6A 3C7CB 2JAHA 5FI3A 4J7CA 3WX0A 1K5HA 3EW7A 2O23A 1C14A 2CF6A 1E0DA 1XKQA 4XYGA 1NPDA 4B3HA 3QP9A 1MP0A 2B5WA 4CPDA 3NAQA 4E5PA 5A3JA 3AY7A 3WFIA 3P19A 4I9UA 1P1FA 1LJ8A 4IDGA 1V3TA 3K9QO 3AOEC 4Q9NA 2D2IA 1U8XX 5EIOA 4DIFA 3JQCA 4J7XA 2C2YA 1DIBA 1XDWA 4XA8A 1LU9A 4D44A 3A9WA 1PZHA 2PKRA 1UDCA 4AJ2A 4NBRA 5DCUA 4HFJA 2VT2A 4DLBA 1PZGA 4DMLA 1C0IA 1B8UA 4JBHA 3HB4X 3SJUA 4RZIA 4DA9A 1NPYA 3L4BA 3JTMA 1U5CA 4GLLA 2YHIA 4KQWA 3CEAA 2YV2A 1KVTA 2Y67A 3OEYA 4W6ZA 4AJ4A 2OOSA 1CJCA 2WE8A 3PXXA 3WNVA 3PJFA 1R4MA 4NBTA 2EWMA 3EMKA 4BL5A 2VN8A 4BOYA 1PQPA 2HDHA 1XA0A 3AM4A 2X58A 1GEGA 1T1SA 4PLHA 3I9KA 5B12A 3N74A 2BGLA 1XWFA 2IZZA 4ZD6A 5MGBA 1UZNA 1UZMA 2VYND 2BGMA 3BXXA 2EW8A 1G0OA 2DQ4A 4TKMA 3UH1A 2FZWA 2Y05A 4UUPA 2O3QA 4GKBA 3H2ZA 4CMIA 4RPKA 3GRKA 5FF9A 4J9VA 4OM8A 3V1YA 3LC1O 3H9GA 5EERA 3SBOA 2PKQO 2P5UA 1W73A 2FHSA 5JAIA 1DBVO 2AE1A 4ALJA 5I9NA 1E92A 2O3JA 1F06A 3LU1A 3TWOA 3V2GA 4A0SA 3LT2A 4PLVA 3IMFA 3CPSA 2CF5A 1ZUD1 1B26A 4CV2A 4BB5A 1D3AA 1I2BA 2BFOA 1Y1PA 1VJ1A 2XPCA 2HK7A 1J4AA 2GZ3A 4BNJA 4DIBA 2GDZA 4D0SA 4CMEC 4CLRA 3AOGA 4H3VA 1YQDA 3IUPA 4GGOA 1HLPA 2WDZA 5EPOA 2GASA 1WW8A 1YBAA 2GF2A 2WWRA 3DZFA 3NKLA 3QVOA 1SEPA 4LW8A 4NG5A 1KETA 3VZRA 4CV0A 6LDHA 4HWKA 1AE1A 4H16A 4BGUA 1SC6A 4L73A 5G0TA 3W4IA 4EGFA 4UAGA 3EUWA 1AXGA 2AXQA 1ENZA 1E3JA 2VT3A 5IZCA 2G5CA 4XQCA 5F1KA 4BKQA 3PFFA 2FWMX 1J49A 1Q2XA 3D0OA 1JKIA 1O95A 1WNTA 4IUYA 4JP2A 4YA6A 4RVFA 5F5NA 1MC5A 4RZHA 1R4NB 2J5QA 2Y1DA 3ZWXA 2OUIA 5EJ2A 1P31A 3CKYA 5TSDA 2XXBA 5A9RA 2XXJA 3PGXA 4H7PA 5L9AA 2YHIB 4ALKA 2X0JA 3E82A 3G3EA 3L4SO 3L6OO 1FMCA 5CG2A 5BT9A 4YT4A 7MDHA 4J1NA 4CM7A 4PLPA 2W4QA 4ZJUA 2VHWA 3GG9A 3PLNA 4CL8A 3D5TA 3ON5A 4DWVA 1J6UA 1R4MB 4RF3A 5T6BA 4L4XA 1LA2A 1E3EA 2HK9A 4R69A 3H5RA 2IXAA 1PJ4A 4II3A 2YZ7A 3W1VA 1A7KA 5H82A 1BVUA 3GK3A 3QE3A 4CV1A 2QYSA 1A27A 3NTOA 3FNHA 4A2CA 2D59A 2AG5A 2DPGA 4CUKA 4RF2A 4TZKA 4R5MA 1TB4A 4BNNA 4GQAA 4BGIA 2UAGA 3GNSA 2ZJ1A 4CMIB 3C24A 3WXBA 2C5EA 4CM9A 5TRTA 3PJEA 1I3KA 4OXKA 3DBHA 2XOXA 3EZLA 3PWKA 4KUGA 5IN5A 4CV3A 4UEOA 5G0SA 5K6AA 3U4CA 4FFLA 3UVEA 1T25A 3VOSA 1A9YA 1GV0A 2GYYA 1GUFA 3OHSX 4I9HA 2F1KA 4E5YA 5JS6A 4J0EA 2AEMA 3LZ6A 4WCDA 1HYEA 1GL3A 3ZI0A 4CLRB 2I9PA 4U6SA 5JNLA 4RF4A 4YB8A 1EDOA 3GZNA 3OIGA 3IAHA 1Z7BA 4QTZA 5DDIP 4W9NC 4CMCA 2R2GA 3EK2A 4JJIA 3VPFA 1LDBA 1HE4A 4GVXA 2JCYA 3DAFA 4K6CA 2AA3A 1E7WA 3GDOA 2AHRA 1UP7A 2HLPA 1H9AA 1YL5A 3AI3A 1M75A 3PJDA 2YQ4A 3I9LA 2NQ8A 4RLSA 5A9SA 1JWBB 4ZVVA 3CSDA 4S3MA 1OC4A 2NACA 4BO8A 2NVUA 3DTYA 3ZWAA 4CM8A 3RU7A 1PTJA 1X1EA 5T8KC 2BGKA 4ND2A 1C1XB 2HQ1A 4OOEA 4XD2A 1GQYA 4EW6A 2Q1TA 3BTUA 4I5DA 2JFHA 5HRUA 1PWZA 1PS9A 1PQUA 3E5MA 2Q1SA 3UGKA 3C7DB 3M2PA 5HTOA 3UCFA 1VM6A 3WMWA 3DZGA 3TZCA 1YL6A 2NVWA 3LQFA 3WLFA 2DFVA 1UDBA 3B1JA 3EGOA 3MOGA 4YQYA 3TQHA 2PLAA 4UUMA 3OBBA 3HDYA 3IS3A 1DHRA 4Q3DA 5TT0A 1H5QA 3ZV5A 1A4UA 1P0CA 3ROKA 1HWYA 3MWDB 4MVJI 5FI5A 3JD3A 5BQFA 3KEOA 1H6DA 2ZTLA 1GV1A 1QKIA 2HAEA 2Z95A 2NU9A 3NT2A 3JYOA 1MX3A 4OXYA 3ZWOA 4CR8A 8ADHA 4YAJA 4HNHA 1M6HA 3DBHB 1M66A 4YBZA 2VUTA 4IS2A 4TRJA 2Y1EA 5ENDA 1NXQA 4QO7A 1FDWA 1JQBA 1X14A 4OHUA 3N7UA 5BNFA 5LCXA 2DUUA 3H7AA 4YACA 3QY9A 5CEEA 3RAJA 2J5KA 3I9NA 5C5IA 3E5RA 3PHGA 4IDCA 1RJWA 1YWGO 2WMDA 5CPBA 3VDQA 2OGUA 4BNIA 3PI7A 1F8FA 4IDDA 4AJJA 3GZNB 3Q6IA 3KRTA 4UVEA 1I32A 1HRDA 1DRWA 2C07A 1YO6A 3F5QA 4IQ8A 4ZHSA 3D7LA 2B83A 3JQFA 1EEHA 1U1IA 1UAGA 2DBQA 3KLMX 3PHHA 3HADA 5AOVA 3KYCA 1W4ZA 4BNXA 3DBLA 5MDHA 1KY5A 3GC6A 4N18A 4DQVA 5L4NA 3RU9A 4FFMA 4P4LA 5A9SB 3NYWA 2J6IA 3JQ9C 3HDQA 2HRBA 1Q7GA 4MVJH 2I65A 2VUSA 4TKLA 1TI7A 2NNLD 2NVUB 1YL7A 4OSOA 2C2XA 2Y0EA 4Y6SA 4ZQHA 4A03A 4PIVA 4CM8B 4CLDA 3BTVA 4TRNA 1PS0A 3RFXA 4WCFC 3RUEA 3WYCA 2R6JA 2V6MA 3OJEA 2GPTA 3H9UA 4N5LA 4DL9A 2QHXA 4EI2A 4ZN6A 2DC1A 2P68A 4OIMA 4W4TA 4UVIA 3ONFA 4L74A 2V6BA 3LC2O 3JQBA 3VAZA 2PFGA 3CZRA 4Y9DA 3DZHA 4QFCA 1NFQA 1XG5A 1F17A 2IEDA 3K96A 4RLHA 1BRMA 4NU5A 2YYYA 1NTOA 3BMOA 1GQQA 2VHXA 3KVOA 4M87A 3DFUA 4XYEA 1JAXA 1YB1A 3L0DA 2GN4A 2NTJA 1EFLA 4RDHA 1ULUA 3UOGA 4N5NA 2XF8A 1T2EA 4IIVA 4B8ZA 4GMFA 4UVHA 3ZV4A 5ENVA 1DC5A 3JQ6A 3PTZA 3K2BA 2EP5A 3RFTA 3OQBA 2BMAA 3VZQA 2WD7A 5KVVA 2IDZA 1UP6A 2IODA 2JFFA 2Q4BA 4M8SA 5JBIA 4XB2A 1G6KA 5TIIA 1ZEMA 3R3SA 4J7UA 1E3WA 3A1NA 1CERA 3E1KA 3PDJA 4HFMA 2OMEA 4E3ZA 4W82A 2DPHA 3H9JA 1NWCA 4FFPA 4CM4A 4MVJE 4RVDA 4DC1A 1DIGA 4O63O 3S2IA 4K9DA 3VZPA 3FR7A 1RKXA 2Y1OA 4LVUA 2P5YA 2AQIA 3EHEA 3OP4A 4BNLA 5JFOA 2YFQA 1YQXA 1HE3A 2PK3A 2DT5A 4MVJM 3CMMA 4BS9A 1HDRA 2YJZA 3LT0A 1PZFA 1ZXBA 4NU6A 1JVBA 1IB6A 3GMDA 5BSGA 4R68A 1UXHA 3P7MA 3WQSB 1VJTA 4O0LA 4B4WA 5BNIA 3NT5A 3PYXA 1ZJZA 4MVJF 3RFVA 1T26A 4R16A 3V2UA 3X2FA 2ZK7A 3MCVA 4AJOA 3OJFA 5A04A 2UV8A 4BNWA 1SB8A 3GUCA 4CLXA 4ND1A 3LSYA 3KYCB 3H65A 3WDSA 2FR0A 3DBLB 3JQDA 3S2FA 4U5QA 1BSVA 1X15A 3COSA 2DBZA 1DHTA 4OL9A 3ZU3A 3RKUA 2Q2WA 4JCOA 1Y5RA 3HN2A 4PLGA 2O2YA 4KWHA 2FSVA 2HCTA 1NVTA 2VNSA 2FPIA 5B4VA 1EBUA 1JKJA 2A9FA 2BELA 3NUGA 4BO3A 1TLTA 4XB1A 5I8WA 2B36A 5C37A 4UEJA 4CL3A 2BKAA 5I8ZA 1PZEA 3DO5A 1WWKA 1QP8A 1PJ2A 1NX6A 1Y8QA 5BSFA 5CDTA 3M2TA 1HDOA 2NM0A 1HDCA 4K6FA 4Z9FA 3JQ8A 3RC9A 3P5SA 3PRJA 3OSUA 3FHLA 2PZMA 1DC3A 1N7GA 3GGPA 2JD1A 2NVBA 5G2OA 3UN1A 2FZEA 3BMOB 3MTGA 4R51A 5AXAA 3ZZNA 3FWZA 1HXHA 5A5FA 2G1UA 1NR1A 4BGEA 3ZWBA 4FBGA 1ISJA 4ROSA 4OQYA 2EV9A 4PLFA 4FR5A 2EJVA 4ND5A 2IEBA 2Q99A 4BKUA 2QYTA 2QG4A 1GPJA 1IPEA 1HSOA 5F1OA 3WWZA 1RYEA 1WZIA 4RF5A 1HL3A 4A26A 2FY8A 1XQ1A 1H6CA 3QIVA 1G0NA 3QJ5A 3UFXA 3U4DA 4FJ1A 1BDBA 4NFSA 2Q50A 2Q3EA 1E3WB 2E37A 2GERA 4IJWA 5U4QA 1KEVA 1BW9A 4HY3A 1WMAA 4RVSA 3ENNA 4CM4B 1XLTA 4PG5A 4XDYA 5JSFA 4Z0PA 1UXGA 2ZTUA 1GUYA 1R0LA 1N2SA 3KBOA 3QWAA 3BAZA 3GAZA 4GAEA 1LRJA 1V8BA 4YJFA 3H5AA 4J3FA 4G81A 4B7UA 5CPFA 3W8DA 1LRKA 3AOEA 4M1QA 3W4KA 5AQ1A 1MG0A 3TF5A 3KETA 3FNEA 3VH3A 1D1SA 1YB4A 1KEUA 1Y9AA 2C0CA 4GH5A 4ALLA 3ZW9A 5L7TA 1KEPA 1WVGA 4BNYA 2TMGA 4RL6A 1H6AA 1FDSA 3VPHA 1A7AA 3X2EA 3ASUA 4QECA 1GYQA 4URFA 2HU2A 1KBZA 3LK7A 5L4LA 1YQGA 4XKJA 1H94A 3SX2A 4I5FA 3IIEA 1QR6A 3AI1A 4LVCA 2RH4A 4XR4A 5HWSA 3JD0A 3QV1A 4BNKA 4MP6A 2NADA 4DYDA 4C7JA 2CVQA 1A9ZA 2X22A 3JCZA 2Z1MA 5EQFA 1S6YA 1U4OA 3TL2A 1P44A 1PQWA 4TMFA 1DFIA 1B8PA 1P45A 3OMLA 1IPFA 1Z73A 5DBGA 1E3LA 2CMDA 1SZJG 1YBMA 2WEKA 5EESA 2YHUA 4D79A 7ADHA 4CLEA 5C7LO 3FRJA 4R3WA 4JJFA 5JCJA 1I2ZA 2X6TA 4ID9A 2ZTVA 1NP3A 3DOJA 1LRLA 2WE7A 4J43A 3IOYA 2BD0A 5JDCC 1ZSNA 2PKQP 3TOZA 3HFSA 5TJHA 2E82A 4WLVA 1EE2A 4E4YA 4L4SA 2ZIZA 3TZ6A 4CR7A 5BSEA 1DB3A 5JE8A 3ZNPA 1P74A 4FPXA 3M6IA 5U9CA 4LMRA 4DPKA 5ITVA 5KIAA 4OGWA 2QZZA 4OO3A 1M76A 2AEJA 2PTGA 1VKOA 4CR6A 3U49A 3VVBA 4TRMA 4U0KA 2JCXA 1YKFA 1DO8A 2C7VA 1O6ZA 3I6IA 1HT0A 2POQX 4QT0A 4CMEA 1E6EA 1YGYA 4JK3A 4CM6A 3RUAA 4KUEA 4HFNA 2RCYA 1BW9B 5HA5A 2ZB3A 2O50A 4C4OA 4YAEA 2X8LA 2EERA 3QWIA 4KWIA 3EY4A 1MXFA 1O5IA 4IZHA 3UHAA 1J0XO 3F1LA 4YJFB 3WGZA 3ETEA 4WNIA 4U7WA 3TZKA 4DREA 4B7XA 4OAQA 4Z3KA 4PLZA 2RHCA 2D5CA 3KYDA 2X0IA 4CM9D 1PL6A 3JQEA 1IY8A 1KOLA 1QLJA 3OECA 2X4GA 3JYPA 3S8MA 1BTOA 1JKFA 4RCVA 1NQTA 1AUPA 2GZ1A 3DTTA 4LSMA 2X0NA 3GDGA 1I33A 1DOHA 3OJOA 2J8ZA 3R6DA 1I10A 3QWHA 3ZCXA 2NTVA 3I3OA 4FW8A 4PG6A 4NZ9A 4DC0A 4E2ZA 4HV4A 3KHUA 1Z7EA 1KY4A 2NTNA 5JC8A 2WTBA 3DBVO 4S1VA 3TDKA 1FK8A 5TF4A 1LUAA 3D4PA 5BSHA 1VRWA 3NTRA 3VH2A 3ZWWA 5FYDA 3AY6A 4OSPA 1DFHA 2B69A 3ROMA 2EGGA 4KZPA 4J2OA 4XGKA 4CM1A 4BO6A 1Y6JA 3Q3CA 4L4RA 4CMHA 5JDIC 1T4DA 3K5PA 1ISGA 1ZVMA 1X7HA 4M89A 4R9RA 4R54A 3BA1A 5CDUA 3QVTA 2W8ZA 4R01A 4BNGA 4FDAA 5IXYA 3UCXA 5JYDA 4BNVA 2GCGA 2PD3A 2Q2QA 2CDAA 2DBRA 1XCBA 3WNQA 2I99A 3I23A 4FC7A 5B4TA 1SEVA 4LMPA 2H9IA 3A14A 3DWFA 1UUFA 3B6ZA 4XGNA 5G0VA 5GY7A 1NPTO 1CWUA 1KC3A 4BO9A 3HG7A 5TQVA 4Z9XA 1N9GA 3GA0A 3ZHYA 2B4TO 3H4VA 1XELA 1O9BA 2OO5A 4DLAA 4G65A 4E6PA 5C7OO 2O7QA 3E8XA 3JD2A 1LBEA 2AW5A 3ITDA 2DKNA 4DQXA 1K6IA 3V5NA 1GFSA 4GGPA 4J1TA 1QYWA 1YJQA 2C59A 5JYEA 3DEYX 4MVJA 2V7PA 4UULA 3ANLA 1GYRA 3VVCA 1KEWA 5KOIA 4BKRA 4DIOA 4NK5A 3M1LA 2IYPA 1NVGA 2PWZA 1ISHA 1YONA 2VNAA 4RV9A 5ER9A 3C7AA 1S7CA 3S2GA 5T64A 3H3JA 1KS9A 3BMCA 4KQXA 4RQTA 4K26A 3ANMA 1WDKA 1LXCA 3KLPX 4TQGA 1F12A 1ZMTA 2DAPA 3E9MA 2YW9A 3BHMA 3ZW8A 3RBXA 5KTKA 2CY0A 5I7FA 1LSUA 4FGWA 2Y66A 3ZWMA 1ZK4A 4ILKA 1R16A 3C1OA 3UF0A 5DT9A 4IDEA 3HJAA 3TSCA 4HKTA 1FXSA 2PV7A 3RROA 4R1TA 4YT8A 4MIOA 3QWFA 3C1AA 2FOIA 2VRCA 3HWRA 3AFNA 3HQ4O 3OETA 3DMYA 4YJGA 3G79A 6ADHA 4IINA 2ZATA 1KERA 5C7IO 2O3SA 2LDBA 4YT2A 3OF2A 1U28A 1YB5A 2IYOA 4BO1A 4HXYA 1PEDA 3WFJA 3WS7A 1ZSVA 1E6WA 3NDIA 4JP3A 2E4AA 4NI5A 2C20A 3U62A 3QVSA 4AICA 2JCVA 4UEKA 4QUKA 5L4SA 4UUNA 3IL2A 1U4SA 1SB9A 1VPDA 3DFZA 3WR5A 2JAPA 4PG7A 3W6UA 5KNLA 3I4CA 3BMNA 1X0XA 2W2LA 2OORA 1B15A 3PYMA 4EJ6A 1LDMA 3K8ZA 1Y7TA 3DAGA 3KSDO 3NJ4A 1Y9EA 1J5PA 1UH5A 4BV9A 3GPIA 1QYVA 3E48A 4E0BA 4OQZA 1RWBA 1HDGO 1Q7CA 3RUIA 4XYBA 5AYVA 2UUOA 1TT5A 2VZ0A 4N5MA 3PIDA 4L9RA 1ISIA 2X0RA 3CZMA 3H8VA 3PFWO 1I0ZA 2O4CA 4AJNA 1ZO8A 1MLDA 1N9GB 3WBBA 1ADFA 3WLEA 3RD5A 1U9JA 5CEJA 5G0UA 4WOJA 2VWGA 2EKPA 4BVAA 2HMTA 4NR0A 3Q1LA 4WLOA 1NQOA 5FWNA 5ER6A 1ORRA 1N8KA 1HZZA 4E2YA 2NV6A 1OMOA 4ZRNA 4BV8A 4WJZA 5IDXA 5IG2A 3RASA 3NV9A 1QORA 4D46A 5DCWA 1U3UA 1GUZA 1NASA 3NRCA 3W8EA 3P2OA 1PU2A 1U7TA 1E7RA 4IMPA 4LRTB 5GZ1A 4KOAA 1IE3A 2D5AA 1VSVA 1EVZA 4WECA 1LC0A 1ZKMA 2AMFA 3AFMA 3JQ9A 4GX5A 5EMHA 5ADHA 3BMCB 4Q3BA 4GVLA 1TVEA 4FN4A 3AM5A 1MA0A 4WGGA 3GGOA 2V65A 4JIGA 1I3LA 3C1TA 1LQTA 3G0OA 4RVGA 4WCFA 1U3WA 1XR3A 2Z5LA 3FTPA 3GNTA 1ZK1A 4YDRA 3JQGA 2VYVA 1R0KA 4FSHA 3BIOA 4PG8A 2A4KA 1P0FA 1KYQA 5T57A 3RIHA 3SJ7A 1JAYA 4E5NA 3U9LA 2AQKA 1NR7A 3U3XA 4NMHA 4DVJA 4HADA 2C82A 1MFPA 3FPLA 4NIMA 3PWSA 2P9EA 4CMBA 1R0SA 5THQA 4WE3A 5I9LA 2HO5A 1WZEA 3G1UA 4XIJA 4YXFA 3DHEA 3JYLA 1CETA 3NX4A 4QSMA 4DBZA 1U7HA 1Q1NA 1PL8A 2AEFA 4GMGA 2OZPA 3P2YA 1KVUA 3CMCO 1DXYA 3EVNA 1KIFA 1NFFA 4LRSB 1Z6ZA 4E13A 1E7MA 5JPIA 1P1HA 1LLCA 5AXDA 2RHRA 4PRKA 3BMNB 3H3FA 4GX0A 1LQUA 3B20A 4BKPA 1ADGA 4WLFA 1U5AA 1FF9A 2DTXA 3SC4A 2BLLA 4MINA 2VQ3A 3V8BA 3WJAA 5JC1A 2GZ2A 1IHXA 3GFGA 3BHIA 4UUOA 3UAGA 1UAYA 8LDHA 1HLDA 3VPSA 2DM6A 1ENOA 3QVWA 1B16A 4Y6PA 4O6VA 1Y81A 1E5QA 1ZIDA 3B70A 4WLUA 4CMKA 4DTIA 2NUAA 3EAGA 4AJHA 1X0VA 5KJEA 4PFJA 4PZCA 3PP8A 5A5EA 5IF3A 4TVBA 1MV8A 1R12A 2C5AA 4IJUA 3TL3A 1QRRA 1XHLA 3F4LA 4KDFA 4IDBA 3WGQA 1N1GA 4ITUA 3GVIA 1LTHR 1HYHA 3AU8A 3RUHA 3ZGYA 3UICA 2F00A 3NGXA 2DBVO 3GNQA 1SBYA 3KTDA 5GZ3A 1P3DA 3WB9A 1Q0LA 3D5QA 3WBFA 3RQSA 4QXMA 3WGHA 3OFSA 5CDSA 5COAA 3SC6A 4IQ0A 1BXGA 4J9UE 3C3XA 4JN6B 4EUHA 3N58A 2ZB8A 1X7DA 4XR9A 2V6GA 4WCFB 3JYNA 4NNJA 1AHHA 1K0UA 2UUPA 2JD2A 3JQGB 4BO5A 3K2EA 1C0KA 4FJ0A 2UVDA 5DP2A 2I67A 3GH3A 1RM5A 3GRPA 2VCYA 4R3NA 4II2A 3LT4A 2ILTA 2BHLA 4XJTA 1W6UA 4RJTA 1QSGA 1BG6A 5JO0A 1ZZEA 1HEUA 3U5TA 3WMXA 1N5DA 1UZLA 3VH1A 3I4FA 4ZICA 3GUYA 4WOKA 4Y98A 1V9LA 2ZQZA 4YJHA 1OI7A 1XYGA 3L9XA 3ORFA 3DMTC 1WPQA 2YV1A 3TRIA 1EUDA 1WMBA 1I5RA 1YXMA 3GZ4A 4TVOA 3H9QA 4A27A 3DC2A 1DRUA 1DFGA 5A05A 3S2EA 4RO0A 1I8TA 4HFRA 2JFGA 1GCUA 4JXKA 1B2LA 3GN1A 4LK3A 4IJVA 4U6QA 3WGGA 5I7VA 1I01A 3KXDA 3L07A 3U4HA 3IJRA 4N54A 1PJTA 4P4GA 4WLEA 4IPTA 4W7HA 2HKIA 4I5EA 2Y0DA 4WK6A 4ALNA 3TOXA 1O8CA 2QZ9A 3O03A 3AUTA 3C85A 2W98A 2B35A 4PZDA 3F9IA 3HDJA 4BO2A 2B37A 3FPCA 1CQIA 4OH1A 5HBRA 2TMDA 1HTBA 3H5NA 4Y8VA 3L9WA 4YJDA 3WSWA 2DLDA 4D3SA 5JAMA 5JCJD 3LYLA 2X5OA 4J16A 5L7WA 3FR8A 5KJ1A 4NFYA 1DDOA 3TFQA 5I7EA 1E1KA 4KMSA 5DN9A 1H2HA 2H1SA 4TROA 1DRVA 5KVSA 3HDHA 3MJVA 4IBOA 1MXHA 2HRZA 4EITA 3K6JA 5T67A 1G1AA 1XU9A 2VZ9A 5J23A 3PLRA 1U3VA 1YBVA 1KVSA 3HB5X 5A06A 5L95A 3OIDA 1IL0A 4TZTA 3BTOA 4CLHA 2I5PO 1ULSA 2P4QA 2B5VA 3ZV3A 1EQUA 1TEHA 2SCUA 1E6UA 3GT0A 1PGPA 3DZKA 1NNUA 3QQPA 4XYLA 2WYWA 1JW9B 3AI2A 3F4BA 4FIZA 2EXXA 2NU7A 5GZ6A 4EEXA 4F45A 1BXGB 1GU7A 2CZCA 4N7RA 1F0YA 1ZH8A 2ZQYA 1YDEA 5KKCA 5ICSA 4F6CA 1L7DA 2NU6A 1GPDG 5F1PA 3RI3A 4K1LA 4IXWA 4UVGA 5COBA 3ZNOA 4FJ2A 1GTMA 3UUWA 3OJLA 1GQ2A 4MVJP 3E18A 3AU9A 3ONDA 4NQZA 2ZB4A 4JGBA 4QQRA 3QW2A 4PLWA 4YR9A 2VZ8A 5JDCA 1UXKA 1NYTA 4Q3CA 3ANNA 1E1NA 3NTQA 4P8RA 1U3TA 4IQGA 1QLHA 3RC2A 4PN3A 4MIEA 4YAIA 1E7YA 3GN2A 4E30A 3SVTA 1ZW1A 4IGEA 1LDNA 3WSVA 4AVYA 1T2AA 5LDHA 3IP1A 4WKGA 2GNAA 2AE2A 5F21A 1YRLA 2A35A 4M86A 3DBRA 5L45A 2AG8A 2D8AA 2VWQA 2IZ1A 2P9CA 1K3TA 1T2FA 1RYDA 4NJOA 1DAPA 2Y1FA 3U4IA 1DC4A 1I36A 3BTSA 1X7GA 4ND4A 1DJQA 1NVMB 4DQUA 3PQDA 2VWHA 1XIVA 3MZ0A 4GLOA 3L6EA 4X54A 1OBFO 4YRDA 5HS4A 3A06A 3TJRA 4WASA 4MVJG 3HSKA 2DU8A 2VUUA 3QVXA 1BVRA 1PJBA 1V6AA 4QFDA 2WD7B 3KUXA 1ZCJA 3OQ1A 1E3SA 2RBEA 1VI2A 2WD8A 4IGFA 2YDXA 3LT1A 2I66A 3OEWA 3VPXA 4YAGA 5L51A 3WJ7A 1F8GA 2O7SA 5THKA 2GN6A 2YY7A 1HKUA 4R1UA 3T4EA 3TNLA 2FR8A 3AM3A 4O1MA 1M67A 4D43A 3HNPA 5LDGA 4XJSA 2VTEA 4DMMA 4BKOA 1VSUA 2Q1UA 2YFHA 2WSBA 2EHDA 4YPOA 3AJRA 3SLKA 4MKZA 4EUFA 3VKUA 4INAA 1P1RA 1WXDA 5A9TA 1LSSA 3EDMA 3F1KA 3WTBA 4CM5A 3CXRA 3DHNA 1AXEA 3D1LA 3K30A 1ZBQA 4W7IA 1W8DA 4XRRA 2QIOA 4FD3A 3ST7A 1QV6A 3PPIA 2NWQA 1ZK2A 3GEDA 3RJ9A 4JBGA 2DTEA 4YRAA 1JA9A 4R1NA 1ENPA 4Z0TA 2C7GA 3IUSA 4CMJA 3RBVA 1GY8A 1YJ8A 4MVJD 5B1YA 5CAEA 3FNFA 4ZU3A 3RVDA 4AJ1A 2IXBA 2WYUA 4Y6RA 1HE2A 1FJHA 3ZV6A 4B79A 5JDIA 2PH5A 2BFMA 4GWGA 4D41A 1T24A
chains in the Genus database with same CATH superfamily
4BU1A 1XDZA 3K0HA 4FFOA 4M49A 2Z9BA 2ZYTX 2JFPA 3L41A 3ZDRA 2R6R1 4GOKA 4Q7LA 1YVEI 1Y8QB 3IB3A 3NHFA 3TNJA 421PA 4CUZA 5L45A 3WIEA 4CEIB 4MS1A 2R6GA 3WISA 4U7FA 1BS2A 1FTQA 3FRIA 5KDLA 5L6MB 3K4HA 2JLAA 2Q5IA 3JQ8B 5LLSA 2AFIE 1QONA 5I9MA 3HB1A 2H4HA 4QM7A 4M54A 3RSHA 4BN0A 1XJQA 4OU5A 5FQNA 5IDVA 1ENYA 2ODPA 2ORYA 1SAYA 1MC4A 5EAIA 4YYZA 2DY1A 3S1LA 4GSKA 4YAKA 2HCRA 2OFPA 3QMWA 5CLGA 2BFBB 4FEAA 5TPZA 3A25A 1H2BA 1UR5A 5CCDA 1E5LA 3R8CA 1CHDA 3JWEA 2GO1A 3MCWA 1CEQA 1JL3A 1OH8A 2WSSA 1GZ7A 1M6NA 2P6UA 1Z2PX 3H11A 3JQQA 4IX9A 4YH1A 1Y48E 3BIFA 4FNMA 4G0XA 5JJIA 2B3TA 1V4NA 2IK8A 2WYHA 2JL1A 4KXLA 4QGBA 5J2UB 4DLNA 2JD0A 1L4BA 4LXYA 2ZBQA 1N5OX 3CEMA 2YJ5A 3SEQA 4XWOA 4DJJA 2ZCJA 3V4ZA 3EVTA 4P34A 2AZXA 2R48A 2B21A 5C34B 4GI1A 3QEOA 1FP4A 2QX4A 3K72B 4H6VA 3ENZA 2YZKA 2HF2A 3NYRA 5E1DA 3BWCA 1CUWA 1JWAB 3HUDA 3DTVA 5AVYA 5KQSA 2QS9A 4CQLA 3R23A 2CSXA 2UDPA 1GTRA 4QELA 4FFRA 1UJ2A 2IYZA 2RC5A 3CINA 2FSSA 4JMPA 3M3DA 3V9PA 1QNFA 3MQ4A 4QRIA 3C74A 3DHWC 1KPIA 3PNMA 5FAXA 2OCLA 4G2NA 2EX4A 4FMDF 2ON6A 3P9NA 4U9IS 2IWHA 1MDBA 2DFDA 3KQTA 5K6RA 1X7XB 4HXGA 4TKUB 3WRYC 4I8IA 4AJIA 5LMCA 2ZIXB 3RGGA 5AKYA 4URZR 1EFHA 2QVBA 2F1HA 4ZCSA 2FJPA 5ETJA 5KJFA 3CW9A 2O48X 1UBCA 2PZBA 4UTNA 5IDWA 5CP8A 2WTMA 2EQBA 1IUKA 1GRQA 1U5BB 3M6MD 1DI0A 3PQEA 2P91A 4J90A 2YWJA 1E2PA 1ESMA 2ZI6A 1CNEA 3GHYA 2CXTA 4ZVUA 3RBZA 4JI4B 1KTIA 3A1SA 5T3UA 1CRQA 2DUWA 4BHTA 1KZ7B 4YVFA 1HFKA 2G82A 3G9ZA 5C53B 5CTJA 2C7QA 2B78A 3BL6A 5JLAA 3IKTA 3A37A 1V37A 1EUCA 4PFSA 4TTQA 4I6JA 3I9JA 2QLJA 4REQA 4ZYTA 5IBPA 2V7QA 3A1FA 1LNQA 1ZJ4A 3EZ2A 1XLWA 3KQVA 3PNKA 3WKEA 4L3VA 3I2JA 4UREA 4XWYA 1RAAA 4NCBA 1D07A 5CDYA 3ZXSA 1Z74A 4MS1B 1UJ5A 3BL8A 4NMMA 1NX9A 4G5SA 3U4MA 3D8BA 2BRUC 2X6QA 1WDMA 3WYBA 4DLZA 3UTDA 3JWIA 2VYVD 1OXTA 1UBGA 4ACAA 2L42A 4CDNA 1Q7BA 1XVTA 3B1VA 4WINA 2ZCVA 1YJAA 4LVNA 4N9WA 5EOVA 3ZLTA 4FIDA 1WTCA 1XJCA 4X1OA 3PR2B 4OYRA 2RK4A 3TR5A 1TGYA 2H51A 2Z4RA 2OV6A 2ID4A 1MOQA 4CIWA 1J7JA 2WVHA 3MAJA 1IULA 1MPTA 1RYYA 2V98A 2GPAA 3CRMA 1FU8A 4F9FA 3EH2A 3AJ9A 4PCVA 1C4OA 2RIPA 1Z29A 4L8VA 1JDJA 2WC1A 1S2GA 4OMFG 1PRYA 3H11B 1U99A 4ZP1A 2IFTA 2CEAA 4IWXA 3N5CA 1FQWA 2R87A 4NXNB 3OF5A 1R9JA 3HZHA 3CISA 4OAPA 4DV7B 2GPSA 4BQEA 2AJBA 1B8VA 1L7PA 4R9SA 4EHNA 4IEEA 3OTGA 2BGWA 3BREA 4G8CA 4AULA 3QBEA 3WB1A 4CCSA 1H3FA 2I54A 4ZEWA 4W9NA 4JP1A 4F4UA 1CR0A 1GDHA 4B84A 5FOQA 2DR3A 5I7OA 1UJNA 3VSDA 1E4EA 2E5WA 5JXWA 1C1DA 3KB1A 2H4WA 3JATA 4XJXA 3RHSA 4EHBA 2E5LB 3RV3A 1ONPA 2C03A 3DTVB 2ZSJA 4CQLB 2V7BA 2QZ4A 2R00C 3R4CA 2QD3A 2VAVA 1L5RA 2XUPA 4OXXA 4LZLA 4AECA 3K0KA 3W6ZA 1O6BA 1QQBA 2DF8A 2C0QA 3GJ7A 3ANXA 3KYDB 2JW5A 5JMWA 2QVXX 3L6DA 5JAZA 2NTYC 3RC1A 1S9DA 1SUAA 2FUEA 1MJGM 3CGGA 3TNYA 2ETXA 3FWHA 4X3CA 4R8SA 1YIOA 1E2UA 3BZWA 3BCSA 1N77A 7ABPA 5K3FA 1FDUA 1DUIA 1ZYUA 2FPRA 5T8KA 1Z56C 5K4HA 1TEZA 4HX9A 4W8GA 2DLCX 4WERA 5CIWA 5DOVA 3DSRA 1RAEA 2YX1A 2A86A 1K89A 2BOVA 3MWYW 4LWOA 1MV5A 1TAUA 1M2KA 2CD7A 2H1HA 3L1UA 4HX5A 3TI7A 2I7XA 3K15A 1TC1A 5KQPA 4P92A 3WGVA 3GGGA 3NORA 4K2HA 3H0KA 1W1IA 4R05A 2VHUA 4E2XA 3E35A 4AFNA 2NW6A 2YV3A 5IASA 1JZQA 3WKBA 1G291 1PIWA 4D5GA 3HZZA 3MQ2A 4A4DA 2P79A 3KAKA 1GYPA 1ISFA 1BMDA 1EFKA 4YLGA 4BE9A 4MP3A 3A2MA 4NYMR 1II8B 1EUCB 2HJRA 4C05A 1A2QA 3HA2A 4REQB 3ZD8A 2R5NA 3A04A 5CFRA 10MHA 1ODJA 3ZU5A 2ORED 3NC0C 2J0UA 2GN1A 3I1IA 4MI3A 5IKEA 2FRVA 2C4UA 1JQ3A 1XKTA 1WUKS 3JTEA 4FGSA 4GPD1 1AN9A 5IZ4A 4NQRA 2H9AA 1S2DA 1OBOA 4YAWA 4UHHA 4INZA 4P5DA 3DDZX 5FCDA 3QX3A 2Y1KA 1AK2A 2PRIA 4M36A 1IN6A 1Q0HA 5JH7F 3ELWA 1SIUA 3ROPA 4WNCA 4ALMA 1DIHA 1M1UA 1KI2A 3L02A 3UMRA 3LGXA 2HSZA 4D9MA 1KC1A 3Q2OA 4KITB 2HLNA 4TWRA 2OCXA 1I4WA 3PE4A 2G4LA 1AY0A 3KB2A 5IJWA 4L16A 1DXOA 2HWXA 2ZT7A 4CNBA 3A2KA 3C41J 3U44A 4IOLA 3OAAD 4MQ6A 1N3LA 1Z45A 1GQOA 4LHEA 3F46A 4IMIB 4PGHA 2EJBA 3O4FA 3QFCA 1BN6A 3AF5A 3FOWA 2C5SA 3G5TA 3IODA 4O4HA 4AKTA 5KB3A 4JL6A 1ZNYA 1UOEA 3AMVA 3IUJA 3KM0A 3IHLA 4POOA 4ENTA 1ZK3A 3EGEA 5ALIA 3U48A 4G1VA 4ZT7A 3H6GA 2Z2JA 5KINB 2GD2A 1NRXA 3HJGA 2PPVA 2HTEA 1GFWA 4V0ME 4GKVA 1E4EB 1A88A 3ADOA 1YT5A 1T8WA 1CY8A 1C1DB 4LXHA 3JATB 2O2HA 1NXSA 4PYMA 3D4NA 2YRXA 1SCJA 1E89A 1NN1A 2ZCUA 4KP7A 5IXSA 1AQYA 3X0DA 2O1WA 4HAUA 4CF4A 4KGVA 2NZ8A 3VNVA 2EWWA 3L93A 1R66A 1OXBB 5IJZA 5EIEA 2AF3C 1AC5A 4XFDA 2KM1A 3HEMA 4M9UA 1NN3A 4F1JA 2QLNA 3BORA 2ZBGA 1XOIA 1E7QA 3PX3A 5FT9A 5K3FB 3CR8A 3VYVA 3PQ5A 2V55B 3G7SA 4YGXB 2X1HA 2RHJA 5CHYA 2HXGA 4JBIA 4P3KA 2JBWA 3TZHA 2E7ZA 1M8FA 1D1TA 1XEAA 4HN2A 3PNPA 2SICE 4RIGA 4UTZA 4Z8YA 2R44A 1EVYA 3AV0B 4DAOA 1SQGA 2J3MA 2F3QA 3H3XA 3OCZA 3UMBA 3DMTA 1H93A 2QYHA 3DV0A 4M1OA 4CKWA 1M7GA 1A4IA 5F2EA 4XZ3A 2X8BA 2Q8NA 4Q5IA 3G1TA 3T7CA 4A0HA 2J9RA 1WMSA 5DBIA 4DA0A 1GM5A 4OJNA 1ECCA 3BSYA 4QGAA 1IZ0A 3TPCA 1EZ1A 2XZDA 2CXUA 3HPQA 1PJCA 3IAXA 3TXAA 2ZKIA 3NATA 5KKAA 5GQSA 4YFVA 2VEOA 1DJNA 3LFUA 1TCUA 4FE7A 4PZEA 4EG5A 1QRDA 1VL8A 1XZDA 3PGJA 3Q9UA 4O5AA 5EI5A 1LH0A 5LZ9A 1AKWA 1E3TA 2J0UB 2PZLA 3CVWA 3P9RA 5JCOC 4YT5A 4DV1B 1YI8A 1SCIA 4MGIR 1YVDA 1SXPA 4TXNA 3NFYA 1YFLA 3R9KA 1VHJA 4HGOA 3Q9LA 3FSEA 1E8NA 1L7EA 3LAWA 3RJTA 2HSDA 4Q3EA 3RKRA 1N1DA 5FI0B 3TS1A 1E32A 2WOOA 4DYVA 1N92A 3LBFA 3WYNA 1DAMA 2WT9A 1I5EA 1TT5B 3H19A 3I1JA 4LDPA 3GEEA 3ZHUA 1PW7A 3QW4B 5TGTA 4X45A 4FDTA 4H7DA 4LJ5A 4F4DA 5IHPA 3U44B 4YUXA 5E0OA 2RC6A 1I3MA 3CIFA 1VE9A 3PHJA 1BHJA 4AKGA 4JROA 3GHHA 3KO8A 2QP3A 3R9IA 3UWKA 1CNFA 1UANA 4O4HB 1VDMA 1JYFA 4QD3A 3KAPA 2MSLA 4GOND 1JTVA 2PMFA 1G17A 2Q2OA 2QTRA 1GZVA 2XRMA 3KKOA 3N53A 1H6BA 2BBTA 4ONEA 3FTCA 1NR5A 4KI7A 1MOSA 2PWYA 2FCRA 3NDRA 3LLVA 1RRPA 1IYZA 3ZIAD 4MUKA 3ZNNA 3H05A 3WICA 4EARA 4YRKA 4D42A 1CDZA 1IXSB 1MX1A 2IXEA 1KE2A 1GRNA 3G5UA 4MA0A 4N8DA 4UZFA 2ST1A 4J91A 2X8WA 2JDIA 2LKCA 1NF2A 2ZVJA 4UMVA 2Z3WA 4LS3A 1S4QA 1L5MA 5JRJA 4KR3A 2J5RA 5D00A 4X92A 1W19A 5AKXA 4HTFA 3ZNQA 4D9IA 2PEYA 5DU2A 3ZU2A 3VKVA 2O9JA 2APJA 5G4LA 4D9GA 4D92A 2DPYA 2NNWB 3QMMA 3UOWA 5HDQA 4KHZA 3IUMA 1VJ5A 5I47A 2CHFA 2B7BA 4NX2A 4B87A 2Z56A 1U9IA 3ZVNA 1NT2A 1X1RA 2W00A 4D9JA 3LL4A 5GADl 1GP2A 1HSZA 2GN8A 3AY3A 2JGRA 4Z0HO 3K7EA 3LO5A 1Y4DE 4CKWB 1RJFA 3BN3A 1OFUA 1SXJA 1X9GA 3BWXA 1D03A 3WJ2A 4D1YA 2P3LA 4TM7A 3LGAA 3IAM6 4O29A 1B14A 3BZUA 4LRQA 4YP7A 5AXCA 1Z18A 4G0OA 4IVQA 4ISCA 5AVQA 1DVRA 1HV8A 4H7EA 4JEHA 4D3FA 1RJEA 4ZA2A 2PFSA 3ZKWA 2C0PA 4R3UC 5CFNA 2I7VA 1OLUA 1G7RA 2VNKA 2WYIA 3DMGA 3HSYA 1A5AB 3U39A 1P81A 1ODSA 3E05A 5HW0A 1ZC4A 4NE9A 2CDCA 3NB0A 2ZUUA 3RABA 1NHGA 2Z6AA 5G3YA 1H05A 3ICWA 2XOKA 4RYDA 3NGMA 4B47A 3I73A 3KKZA 1FXWA 5DHFA 2YJTD 2CBZA 2FPWA 3WAJA 2VOEA 5E4FA 1IY0A 1HC7A 2BGNA 2GH1A 2P0YA 3WNBA 2R86A 2FUG6 4OXQA 3JWGA 1S8AA 2V0CA 1E6CA 1M73E 1X2BA 1HETA 1X38A 1YH3A 2BFCA 4JLWA 4O59O 1WQ1R 4UBJA 1CUBA 1IEVA 3IBYA 3RIYA 3QI2A 2ZS8A 1AV6A 3KLNA 3BS4A 5T3YA 3E3MA 2ZRKA 3INTA 1GZSA 1AKUA 3E8MA 3THOA 2YVLA 3BB4A 3FIUA 4CBVA 2BLNA 1Y80A 1SUBA 4IUCS 4XD7A 4NDNE 3FKSA 1ZXLA 1YDFA 3S3TA 3MYYA 5G02A 1RCFA 4DV2B 1PDVA 2VDLB 3C3JA 3PHIA 1FSGA 4BMZA 1C50A 1VMKA 3OPYI 3ZWXA 2OCDA 2WJZB 3K31A 3R0IA 1YB6A 3O4JA 4MKXA 3ZZ1A 4ECAA 4UM5A 4YN3A 1VC2A 2DHCA 4E12A 1C0PA 1U1CA 3TECE 4IICA 2OBBA 3KC2A 4TTPA 1KSFX 2QT1A 3EQ7A 3OH8A 1W0CA 1L4LA 1MF7A 3AVOA 4KIGA 1NW9B 5ITWA 2QX9A 2XYHA 4FMDB 1O6CA 1HDIA 1CJMA 3HXPA 3QA9A 4N49A 3TIFA 4BVLA 4F71A 2AKEA 5EIXA 1IZ9A 2QD2A 2VWPA 1MU0A 3C97A 3RKSA 3E70C 1XDUA 3E81A 2VTDA 4WK0B 3FZQA 3QENA 1LK7A 2GXSA 3UMFA 5KWSA 2X9NA 2NT4A 3AVUA 3Q8WA 1PNOA 1H2FA 2X1LA 3ICPA 4OYLA 5ESDA 3AB7A 1QCZA 4W1QA 2F9MA 2Q1WA 3BDIA 1IHYA 1NUSA 2QAGA 3FSJX 4L85A 1XGKA 3RTGA 1GQFA 3VJRA 4TSFA 4NBWA 4HTFB 4RYLA 1QYRA 1Z6XA 2BN4A 3BK2A 3KV1A 4PYJA 3VVLA 2R68A 1VJ0A 5BVGA 1B0AA 1T1RA 1JVNA 2QNBA 3AGQA 4MYUA 4NTZA 1L5HA 2Q5JA 4ER5A 2ZULA 2CHVA 4IIUA 4U7TB 5CDGA 4I1VA 4YXWA 2O5CA 1XUOA 1DLIA 4X6UA 1V16A 2GGSA 1GNQA 1TXGA 2CK3D 3DZDA 3ED1A 4L78A 5LB2A 5JHHB 4LTNA 2UYYA 5GP1A 4B35A 1QIKA 3AKYA 3ZH9B 2A30A 3MUNA 4B3XA 3EB9A 3VNRA 1NYQA 4J0HA 4Z8XA 5HZHA 1SMKA 1SXJB 3ZWCA 3LRPA 4K3VA 3L4KA 3R0ZA 2R0QC 1P0MA 4KWCA 4RY0A 1HT3A 1DEAA 4KO1S 1P2BA 1COWA 3O8OA 1UDAA 4GX1A 4HWSA 2Q45A 1SNYA 2FFQA 4UBKA 3ZKWB 1AZTA 1PSDA 1OLUB 1KPGA 1TU3A 2A7XA 2OVFA 4ZKDA 1NV8A 5K0TA 3W9SA 3ZWNA 1E2FA 4ETWA 3I2HA 1H0RA 2ILVA 4LY6A 4HAWA 4LNHA 3STHA 5SY6A 1ML3A 1VE6A 4ZDJA 3K6RA 5AI8A 3HUUA 2OCAA 3JQFC 4GYWA 1WDLA 4N0MA 5DF1A 3HL4A 3B85A 2XF2A 4WPGA 4CKBA 4YTEA 4M21A 1NXWA 3D64A 4K05A 3SQOA 1EGVB 3L0CA 2I1QA 1QAMA 1EQAA 3RUCA 4IV0A 3AESA 5BW8A 4AZ0A 2BFCB 3H8SA 1O54A 4IDPA 1H5UA 2JA2A 1UKVY 3A28A 3FPGA 4UJ3A 1T1EA 2YZ2A 5K45A 2VH1A 3S2SA 4NMXB 5KJCA 1OCEA 1OIVA 1DADA 2K2QB 2QRHA 3KUKA 4IAOA 1G2QA 2Y2UA 2CWWA 1KI9A 4GQBA 5FOSA 4MKIA 1BNCA 2RH8A 2W5UA 1H69A 1T8UA 1HNZB 1U0RA 1EDEA 3BRWA 4QFBA 2NSLA 2F2TA 2Z8YA 1QHHB 2DMRA 1HDXA 3NHJA 2OCGA 3L1IA 4PO8A 4NZZA 4DNFA 5ADUS 3KSZO 3ND7A 1VFPA 4I9NA 2WF8A 5K20A 2DB3A 4RD6A 3DEZA 3T5MA 2AJ8A 1O03A 4DPLA 3EWIA 3RBAA 2OAEA 4AMVA 1KMHA 1USGA 5JNSA 1LFAA 1KH1A 2IPNA 1IAQA 4Y2HA 1E5TA 1OYOA 1CFJA 5KNBD 2JGFA 2G67A 2RGXA 4TLMB 4AU1A 1JFVA 3KDAA 5G0WA 5IUNC 1K0FA 3QLEA 1ZL2A 5KYNA 1NQ5A 1OXXK 1HF3A 2D3TA 2I22A 1KXJA 4N40A 2G5GX 2A33A 4JT9A 2V96A 1XZPA 1ZA2A 2I6SA 2QAGB 3QV2A 1M3SA 1FDRA 2XMPA 4ZO9A 4BP3A 4RL4A 4EBBA 5KVCA 1TIBA 3BD6A 3CUKA 2ZSAA 4PG4A 5ALYA 3PPWA 3WGTA 1J7KA 5BVGB 3MJCA 1DG9A 2QTVA 3D3WA 1L5HB 1OI3A 4G1EB 1Y8ZA 2FKAA 1X92A 1A69A 3LCRA 3GJ8A 1M1ZA 3ME5A 4FWBA 4V2UA 2F8LA 4FX5A 1G55A 3VR3A 4EYEA 1V16B 3MYRA 2HWYA 4BNTA 4F5ZA 3T99A 1CU1A 1Q2UA 1T34A 2VJAA 3HDVA 5LL6P 4FOOA 1YVUA 5PGMA 3UJPA 4OQDA 4RTLA 4OKNA 1PJSA 3E0QA 2VQFB 1YZFA 3KYBA 2WB2A 1ONOA 2OL4A 4BCCA 4LDNA 1QK4A 4HQ0A 1PR4A 4F91B 2BRUA 3O8OB 4WFKA 2HRRA 5EJ4A 4DDTA 4G9GA 2IE0A 4Y9RA 1K4MA 5EINA 4MUGA 4EHLA 4F56A 1SELA 1PZMA 3L46A 2A2ZA 5INTA 3HXTA 3M49A 3B51X 2EKQA 2BW0A 5JH7B 1Z6QA 3EZYA 4B5LA 2B8NA 1L5KA 3C6XA 3WY9A 3E03A 5JASA 1JI3A 1LK0A 4RPCA 2WTXA 1CULC 2XRYA 2YWRA 4DJAA 2XODA 1IQUA 1T9CA 1XQWA 3S5UA 2D1SA 3FTNA 1Y4UA 3FMPB 1J2JA 2C8VA 3IE0A 1YRWA 2WYVA 1MAWA 3AESB 4AZ0B 1PKXA 2YZMA 2Z5FA 3WMGA 2DQZA 3JR7A 5L3ZA 4AYWA 1RWKA 1XLUA 5I5GA 1YDHA 5LQKA 1JEOA 2I6XA 4PSAA 3QEBZ 5SZHB 4DPMA 4JJ6A 1DPFA 4PPNA 5CITA 2QW1A 3DVLA 1Y9DA 4NBVA 4DCOA 1OTHA 1VI5A 2RGBA 2BPOA 4YS6A 2JGLA 3HA5A 4AZ3A 5HK9A 1OASA 2XVZA 2WAYA 5DBEX 4K28A 4LVOA 3VU0A 3S7TA 1YKGA 3GLQA 1VLLA 1LB1B 4FQ7A 2P9FA 2VLBA 4UU0A 5EJ5A 4MQMA 4KXWA 4YUAA 3ZTYA 1I13A 2R00A 3VU9A 1JQAA 4JI1B 3FOEC 4EYGA 4BNZA 2ZPUA 5K3BA 4CMGA 2NZUG 5IM4F 4CF7A 1Z08A 1TA4A 2CE7A 1EZZA 2FWNA 4ZDWA 4IDAA 2WM3A 5CXUA 3EGXA 4LJSA 3KCNA 1HY3A 1KMHB 2P30A 2CVZA 3TBFA 5J4VA 3VI4B 1ZD8A 1XPUA 3DMDA 1UMDA 1M7BA 1WP9A 3PICA 5B6PA 4FC6A 3V48A 1E2KA 2X4DA 2NU8A 3WIDA 3A4NA 3QRWA 3VH4A 1COZA 1GU1A 1HDZA 2NO6A 5DBFA 3WV4A 1XP5A 1WZCA 3IRVA 2WFZA 3DAPA 4ASUD 2BONA 2C78A 1EFRA 2FMUA 4JUAA 2JJ1D 3THYA 2EZ4A 3ITEA 1Y34E 3MGKA 4BBAA 2MSWA 1U81A 5SZIA 5BXQC 1NURA 1AHIA 4Z4IA 4WOBA 1U8FO 3ENKA 4FCVA 2X86A 1YNSA 3VMMA 5H02A 3CF2A 2TRSB 2J7PA 2QTVB 3D3WB 3JSAA 1NZDA 5BQ3A 1I9GA 2JIMA 1KH2A 1OIWA 4KR9A 1EI9A 4RMIA 3GRVA 1ITZA 1ZR2A 2Q2VA 5F3RA 2D7JA 3KPWA 1SXJE 3N0TA 3D0RA 3NIBA 2W6JA 1KR5A 1AS0A 4J7CA 4MW1A 4FMBB 1SURA 4LHVA 4CF3A 3QOYA 2O23A 2CJWA 1C14A 4BUJA 1E0DA 3FFWA 2G25A 4XYGA 1NPDA 1ZU5A 1WO8A 4B3HA 2JAQA 4CN8A 1EFAA 2FX3A 3ZQUA 3PLAE 1I9CA 3KJEA 4GU5A 5FBWB 3WFIA 1SBQA 2JJQA 3P19A 1XFDA 1IXZA 1LJ8A 1TRKA 1L5VA 4IDGA 3EEYA 1Y1TA 4YMWA 2W2OA 2CL7X 5FA5A 1ZISA 1U8XX 4HMQA 2VK2A 4J7XA 2C2YA 1P39A 3N8GA 2GRJA 2WK1A 2YMMA 3TVTA 1KMMA 5DM2A 3EWAA 2IKSA 4KLNA 3QU9A 5M29A 1AOXA 1GGMA 1KYYA 2P5TB 4HFJA 1NP7A 2VT2A 4TQAA 5DCUA 4DLBA 1ZI8A 3BK1A 1B8UA 3RHTA 3R41A 3HB4X 5F9HA 1XTPA 4ODIA 4NZPA 2G04A 3JYHA 1FMFA 1EFUA 2XLBA 1KMIY 3R6LA 1C9NA 1V43A 2GWRA 3FMOB 3JTMA 2OHHA 1YK1A 1R9NA 5DKFA 1UWCA 4L4UA 5CCEA 1KVTA 3LOQA 4LYDA 4YCLA 4HQFA 1E9EA 3TZLA 2Y67A 4P7BA 4DKJA 5EE0A 5EQTA 3WNVA 4LECA 4UTOA 5ED0A 4M88A 2H2HA 3B3QA 4NKRA 2Z2KA 4JYMA 2CL5A 5L6LB 1HDEA 1VIYA 2RKWA 4PINA 1ABFA 4AZ3B 2C9ZA 3C5WP 3L8MA 5EJ9A 2P67A 3NMUF 3CRZA 4QQFA 1GDTA 3O0TA 4NS4A 4UHJA 2ZWOA 3HU3A 1Z34A 4DA8A 5C35A 5B12A 4N7MA 4B6RA 3CH7A 3N0RA 3VU9B 4OH7A 1EWRA 2VYND 5JS7A 4YROA 3GEHA 2CLSA 4LPSA 1IN8A 4PPGA 3OMWA 4TKMA 3UH1A 2Y05A 1CZUA 3EGXB 4B4DA 1CQPA 1WJGA 1Q83A 1YZVA 1BH6A 5E7MA 3GRKA 1ZM3A 1UMDB 2WPDA 2O2JA 4OM8A 5AOBA 3H9GA 4MQUA 3T1TA 3IP9A 4IFEA 2PKQO 1J8FA 2QY9A 2P5UA 4CT0A 1WCIA 3GZJA 1DBVO 3THYB 5DNYB 3UYKA 5JBQA 1E92A 2PKWA 3WGUA 3O2QB 1BFKA 1A5SB 2Y77A 3CPSA 3D6AA 2AIRA 3IMFA 3LT2A 4OK5A 4PLVA 5C0OE 2Q6KA 3I9V6 3SKVA 4BB5A 5CEFA 4RSGA 4CHTA 5EP1A 2BFOA 3IIJA 1KWGA 5KO2A 2WYOA 1A96A 1QFJA 2W2NA 3LECA 1J4AA 2GZ3A 4P0TA 5KTOA 2GDZA 1ABEA 1VHTA 4NEQA 4C2TA 2CV1A 4EX6A 4ZZ1A 3LX6A 2HK6A 4GGOA 1OGJA 1R8SA 3LHKA 2GF2A 2WWRA 3LX4A 4Q00A 2HBRA 4FMCF 3AUYA 3SKYA 2ZTHA 2JI4A 4MGHA 2A9KA 1XB2A 4CV0A 1IIRA 3GMTA 3TTTA 4HWKA 3ZK9A 6LDHA 2CJWB 4G5GA 3N8NA 1OIXA 4FUQA 3OE1A 2GBGA 3MRTA 1JIQA 3KDSE 1SC6A 4I4LA 4L73A 4LF9B 1P0IA 1F48A 4UAGA 3A1CA 4PS1A 1BOOA 1AT1A 1AXGA 3OQIA 1RBMA 1N2GA 5B2EA 1Z4QA 2G5CA 2V6IA 4XQCA 4BKQA 3PUWA 1J49A 1Q2XA 5DYYA 3ZGOA 3D0OA 4BVEA 1SCQA 2FH5B 4EAAA 4ZOBA 3PXCX 2E4ZA 2QLMA 2JH3A 3C87A 1VXOA 3CH4B 3FY4A 4QOEA 4GR5A 4RVFA 4MYRA 4WNAA 1WXGA 3C4VA 4R2JA 3SM9A 4E07A 5A62A 4OB7A 2XWSA 1E0AA 1M9NA 1K9SA 2CLMB 2DPMA 2J5QA 2Y1DA 3KVYA 1Z9BA 3O74A 1AD2A 5DYIA 1QPZA 2XDAA 5C2JB 2VDWA 1RT9A 5L3SA 5LWHA 3IAS1 4PGGA 5DGCA 3OTWA 4RJ2A 4RK5A 3B1YA 5L9AA 2MTBA 1NRJB 1EDBA 3L4SO 3G3EA 4B32A 2O7NA 1Z36A 3ECAA 5BT9A 4YT4A 1KJJA 3H1PA 4BMPB 4X8LA 2YUIA 1GPBA 3FYUC 1CQJB 4JT4A 3BB1A 5AK6A 5MN4A 3GG9A 3PLNA 4DWVA 1C3LA 3KAJA 2OKCA 3UJDA 4DR6B 4RF3A 2XA2A 4F3NA 2C7OA 3OZGA 1E3EA 2XCQA 4O33A 4L2IA 1N2JA 2IXAA 3E61A 1FFAA 1PJ8A 1QGZA 3LVQE 4W8HA 1SKMA 1BVYF 2YZ7A 5H82A 3FFTA 2I8CA 1K9VF 2GBFA 3VX4A 2LBPA 1NUTA 2JHAA 4A2CA 4M1ZA 1SVNA 1WUTA 3SIPA 3C6QA 3V4OA 3CZ5A 2H08A 1FFEA 2JIZD 2CLIB 2HQOA 3I4LA 2QB5A 3PCRB 1MIHA 1KDTA 3H9CA 4KI0A 4RV4A 4TZKA 4EVIA 5F98A 3WLSA 2YN2A 1CB7A 2I4RA 2UAGA 3NHMA 3NWJA 5DLDA 2XXAA 3C24A 3WXBA 2V45A 2C5EA 2BM8A 1R64A 4CRWB 5ITZA 1E2DA 2FI1A 4E7OA 5F2OA 5FB3A 2P1RA 2XOXA 4CKYA 4NAHA 1MORA 6NULA 5ICGA 3J81A 2YWEA 5CM9C 3H99A 1OWOA 3MTEA 1X8JA 5G0SA 2O8NA 4F86A 2ABWA 5H9VA 1UEIA 1WCIB 2OSVA 1XVVA 2H4JA 4YPFA 1YSCA 4FB4A 2M98A 2YL2A 1T9ZA 1T25A 1I1NA 4QZVA 4ZI7F 2ROQA 1NVUQ 2WV7A 2J9XB 4OHVA 1U7UA 1GV0A 3AF0A 4OCZA 4AC9A 1JSXA 4I9HA 2P9QA 3NCHA 1AZSC 3DFIA 4F5DA 3FSGA 5DM0A 1UC9A 2FW9A 2WKPA 1HYEA 1WVIA 1H42A 4D8XA 2Q0QA 4KGXA 2IUYA 3L8FA 3WGLA 2I9PA 1EWQA 3GZNA 3OIGA 3GFRA 1XD9A 1QQ6A 2R3SA 4FDVA 4HDKB 4QTZA 2AR7A 5IH3A 4ZI5A 2WHXA 2XNJA 5ALUA 4B46A 5AVKA 3A1WA 1RU3A 2Q28A 4CTKA 8AT1A 3IQEA 3TQQA 2AA3A 1ZN7A 1E7WA 2AFVA 1HT1E 1JQLB 2AHRA 2HLPA 4QAJA 5BWBA 1NXTA 1V39A 3OQIB 1LX7A 3ICQB 1SHZA 1YL5A 4WT7A 1FTNA 5IULC 2YQ4A 2AD1A 3QKSA 3I9LA 4BY9E 1UAAA 4I36A 1IMOA 4D97A 1JQEA 2G07A 3Q9SA 1IJFA 3IE2A 1WG8A 3KWMA 4WNAB 2IIBA 1P3Y1 1OC4A 2I4IA 2NUBA 1C7EA 1JDTA 1OD6A 2CJFA 3ZTTA 4CM8A 5IANA 5KNDH 1MNAA 2RE8A 4ZKEA 4N41A 1FMLA 1YR7A 1X1EA 4ZVKA 3J7AC 4PSCA 4ND2A 1JB1A 2VDWB 3LPCA 4XD2A 1GQYA 2ORVA 5L3SB 1PO7A 3PUHA 4R7GA 5JSYA 4JJ7A 4MWSA 2OHJA 1JHAA 3NLLA 1FZTA 4G5FA 1FP7A 3GP3A 1PNRA 3N76A 4I5DA 1CZOA 4QPPA 2JFHA 5FULA 1VCHA 5HRUA 2FLVA 3UGKA 3GLFA 1PQUA 3C7DB 3IULA 1E2NA 4I6EA 1VM6A 3IJEB 2G9QA 5IM4A 1RYHA 4GBGA 4IUBS 2PL3A 2PSEA 4BRUA 2D7DA 2BCEA 4DCVA 3B1JA 4DMHA 4U2DA 1QZTA 4L2IB 1Z2NX 4NP6A 4NY1A 2XMZA 4FZVA 3QA3E 1Z8HA 2IHUA 3WAGA 1U28C 1C7FA 2ZBPA 4G9EA 1FNSA 1MX9A 1SD5A 4B31A 5TT0A 3H84A 1ZOPA 1A4UA 5FIUA 1GKYA 1U8UA 3ROKA 5LZ8A 2ZLBA 4AIRA 4BFSA 1HWYA 3GMIA 2W83A 3MWDB 4OQMA 1UBRS 4CDRA 3JVDA 5FWDA 2BKUA 3CBQA 1QIEA 1JIKA 2Z95A 2NU9A 4DSZA 2P40A 3JQPA 3DKPA 3KHTA 4QDXA 3ZWOA 4CR8A 2XXAB 2OORC 4A82A 4B33A 5ITZB 3BK7A 4HH0A 4DQ0A 4JHXA 2OZEA 1MB9A 5HQJA 2A3NA 3N5KA 2VUTA 3HC7A 2Y1EA 3C45A 1VE1A 1E94E 3MB5A 1NXQA 4QVGA 4KQ2A 4RHEA 3PFBA 1FDWA 1C7IA 1JQBA 1X14A 5AJTA 1OXVA 2OO3A 3HNOA 1JTFA 3BQNB 3H7AA 2XLCA 1Y8AA 4JB3A 3I9NA 1CR4A 3EC1A 2JCBA 4MW9A 4JJKA 2J32A 1SQ0A 3E5RA 3KOXA 1YWGO 4Q03A 5CPBA 3VPAA 4X61A 1MA3A 4BNIA 1F8FA 1WZNA 4Q1BA 4AJJA 3GZNB 2A5FA 3WLTA 5BRAA 4G01B 1URPA 1TTHA 4HEHA 1I32A 3UWDA 3X1JA 3I72A 5A4KA 3F5QA 1V8FA 4B6EA 4ZHSA 3C16C 4F85A 2HBYA 4ZRDA 1V8DA 1XXHA 3TLMA 4WKBA 3JQFA 1RW4A 1WL8A 3D6NB 3HFJA 3QBTA 3KLMX 2ISCA 4OBEA 2IGTA 4A16A 3FCSB 2DEUA 2W42A 1KMCA 3HADA 4JVNA 1W4ZA 4BNXA 1TK9A 1FW6A 4PBRA 5MDHA 5EHNA 1XMVA 3KJNA 3QKSB 3BOSA 4FFMA 4P4LA 1RC1A 2J6IA 2GNPA 2DT8A 5JAOA 1SCAA 1Q7GA 2HRBA 2CXHA 4TKLA 3PQ8A 2XEDA 3B6IA 4X71A 1G18A 3SYRA 4CM8B 1BD4A 1IMJA 4CTNA 1YF3A 1R10A 2OO7A 3OTOB 2R6JA 5IC4A 1UODA 4UAUA 3SHOA 2V6MA 4W8OA 2WM2A 1SUEA 5HX7A 4N5LA 4NONA 1DKRA 4A15A 3C43A 1JHVA 5EHQA 1DUVG 2PKXA 3FPBA 3GLFB 5I3ZA 3GYBA 2UVPA 1BA2A 1TMYA 2IYQA 4FP9A 1XCJA 5CFMA 4HDNB 1KAOA 2Q3DA 1BYUA 1KK2A 2BGIA 1OT5A 2V7GA 4QFCA 2EFHB 2XE6A 1F17A 3FGPA 2IEDA 1D6MA 3C3DA 1OVGA 3LWDA 3OPNA 1GL9B 3V8MA 4BZXA 4NU5A 2AOWA 2FGJA 3EVAA 3NOQA 1FVHA 3VO8A 4M87A 3OQMA 3DFUA 2GYWA 2ZE7A 4FT4A 1K7EB 4LSZA 3TAXA 2W2PA 1ZGBA 1LPOA 1ULUA 3EMDA 3UOGA 4EF4A 3B7WA 4IIVA 4C78A 4F8JA 1N2CA 4N76A 2VJYA 3EULA 4N7BA 4UVHA 4FHZA 5ENVA 2NU9B 3ZV4A 1QF9A 4V1CA 1A2OA 3D1JA 3K2BA 3K0AB 4FR2A 3OQBA 3RT1A 3QEJA 3LZDA 5LMZA 2Q4BA 1XTQA 3C6YA 2EEPA 3C7TA 3NZEA 4GOJA 2WY2D 1VP3A 2KPOA 1JDVA 4CTMA 4E5SA 2WZDA 4YDSA 2P2YA 3PDJA 4BWGA 3JWJA 4NNOA 3CVXA 2DPHA 4AN4A 2FMXA 3H9JA 1K75A 1EHCA 1L4EA 2V9PA 2MR5A 4RWZA 4DC1A 2ZG6A 3LFHA 2JGNA 3K8QA 3FWPA 2NVOA 4BQFA 1IVSA 1RKXA 3HVJA 3IA2A 3KG2A 1RI1A 3NKVA 2P5YA 4NJEB 5IVKA 4ARIA 3EHEA 4BNLA 1KAHA 1YQXA 1QF6A 1QO0A 2RJOA 4CKEA 2HPVA 4EY4A 2G08A 1J0CA 1HDRA 4Q1AA 3V8PA 4UHEA 1N6HA 2FGKA 1JVBA 3WLAA 4IW3B 4EGAA 3O8BA 1JG1A 3N86A 3O93A 5DM1A 3P7MA 4DUGA 3S8EA 4O0LA 3W5UA 1K8YB 1T26A 2J09A 3Q4GA 1XXHB 1QWOA 1JDBC 4EPYA 3IT1A 2AWNA 4LOJA 2VXYA 2J3QA 5ALWA 4AJOA 2NUPA 3GUCA 5EEGA 3HBNA 3LSYA 1HG0A 3VYUB 3ZGXA 2GKOA 3MRVA 3ZK8A 1Z62A 2GF9A 1VBKA 5AR1A 2QP4A 4Y6LA 4V0RA 2BI4A 4D9HA 5KKNB 1PBTA 1LBIA 3NOXA 4WXEA 1M6VA 3KU4A 4MQFB 4ICIA 1DHTA 3EVFA 1FFGA 3HN2A 2UZ3A 4PLGA 1VKZA 2EBUA 2FSPA 1XEFA 3CA8A 2HCTA 3P0RA 1QHGA 3QPDA 4FS8A 2FPIA 4PX2A 1G63A 5TV2A 5B4VA 1UEJA 1JKJA 4ZVTA 2BELA 4I99A 2HPAA 4XB1A 1RVV1 4CHGA 5B7NA 4D8TA 1KJ8A 3JXEA 5BV7A 1DG3A 4Q4DA 4Y6GB 2O54A 2SNIE 1O0BA 1ODTC 1NBIA 1XRSB 4PNPA 3TNDA 3LS2A 4MZDA 1PZEA 5ADVA 3URMA 2IS6A 1WWKA 2AUNA 5LQRA 3TIGA 1NX6A 5J4LA 2BZGA 1W6RA 2UVPB 3IR5A 2FDXA 1MNQA 2OLJA 1NJ2A 4DQDA 5CDTA 3B53X 1WV1A 2YJ3A 3FYCA 4JFRA 4Z9FA 3RC9A 2PS3A 2JKZA 3OM1A 4HQOA 3OSUA 3RHZA 1U0GA 1JIJA 2PZMA 4YIHA 2CCJA 3GGPA 5G2OA 2COEA 2ZYWX 3UN1A 2A0KA 3OZCA 2GXQA 1HXHA 3MVEA 2G1UA 1RJGA 2I87A 4FHFA 1SCNE 4TXJA 3MBIA 5AI5A 3RS2A 3ZI7A 4BYMA 4QUGA 1J8VA 2IEBA 8ABPA 4BKUA 1JEYA 2HU5A 4KRYA 5F1OA 1IPEA 2QR3A 4MV6A 3W9YA 1JXMA 4PQYA 3WWZA 1RYEA 3HBLA 4UFOA 1Z0UA 3UB2A 4V1CB 3FPJA 4ZIRA 1T0IA 1M8KA 3BSSA 3BICA 2I7CA 3UFXA 3U4DA 4OATA 1PQYA 4FJ1A 2EBFX 4KDRA 3AP3A 4W1SA 1UPUA 2Q3EA 4IJWA 2GERA 1Z4JA 1F5NA 3SLRA 4US1R 5HCIA 3RSOA 1RYNA 4JZKA 5JWRA 4YMUA 1LPAB 4FMCB 2OD9A 4PG5A 5JSFA 1EIWA 2KMLA 2EHJA 4Z0PA 3KUCA 4U3JA 1O6GA 2SBTA 4KVFA 1MOPA 2PBLA 2YN0A 2WIGA 1U9YA 4NVRA 3QUQA 5HKAA 3BAZA 4EP1A 1J2EA 4GAEA 1DINA 1V8BA 3ND6A 3LZCA 4B7UA 3VR4A 4X8OA 3IUEA 4CKEB 2ZSE