3WR5A

Structural basis on the efficient co2 reduction of acidophilic formate dehydrogenase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
401
structure length
401
Chain Sequence
AMGSMAKILCVLYDDPVDGYPKTYARDDLPKIDHYPGGQTLPTPKAIDFTPGQLLGSVSGELGLRKYLEANGHTFVVTSDKDGPDSVFEKELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHVDLQSAIDRGITVAEVTYCNSISVAEHVVMMILGLVRNYIPSHDWARKGGWNIADCVEHSYDLEGMTVGSVAAGRIGLAVLRRLAPFDVKLHYTDRHRLPEAVEKELGLVWHDTREDMYPHCDVVTLNVPLHPETEHMINDETLKLFKRGAYIVNTARGKLADRDAIVRAIESGQLAGYAGDVWFPQPAPKDHPWRTMKWEGMTPHISGTSLSAQARYAAGTREILECFFEGRPIRDEYLIVQGGALAGTGAHSYSKGNATGGSEEAAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formate dehydrogenase
publication title Structural basis on the efficient CO2 reduction of acidophilic formate dehydrogenase
rcsb
source organism Thiobacillus
molecule tags Oxidoreductase
total genus 137
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.2: Transferred entry: 1.17.1.9.
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A01
1QYDA 3QQPA 1N7HA 1EFLA 2GGSA 4OJNA 4CMCA 2NU8A 1NVGA 1K6JA 1JA9A 3PJFA 3GC6A 2PZMA 4XD2A 1KYQA 1SAYA 3V1YA 4BGVA 1H6BA 4EBFA 5ITWA 3GRKA 3QHAA 3PEFA 4JBHA 3ZNNA 5EESA 4R54A 1HRDA 4BO6A 3BHMA 1MXHA 2GN4A 4D43A 4R1TA 4HY3A 4I9NA 3L0DA 3OIGA 3NTRA 1U7TA 2YHUA 4XQ9A 1CIVA 4FPXA 3E82A 1H9AA 3WYBA 2B83A 1R4MB 4YJHA 3G3EA 1N5DA 3NTOA 3JQ9A 4CODB 1WPQA 5EL0A 4B4VA 1E7RA 1V3VA 1NR7A 1WP4A 1GPJA 1OOEA 1I5RA 1X0VA 2GD1O 1NQAO 4YCAA 5DOZA 2EP7A 1W8DA 1NXQA 3AJRA 1LLQA 3OIDA 2GLXA 4E4YA 1XSEA 3EZLA 3WSWA 2O2YA 4FFOA 1IYZA 4BO5A 4CQLA 5A9SB 4I5DA 4E30A 1X7DA 4CR7A 3DFUA 3WLEA 4B7UA 3IOYA 4E32A 1M6HA 1PZFA 3F5QA 1E3EA 3QA9A 1NP3A 2C5AA 4HFRA 1LQTA 5AXAA 3S55A 1JU9A 2CFCA 3OEWA 2I65A 5F1PA 3W1VA 2PV7A 3BTUA 2QYSA 3TPCA 4LRTB 2DPGA 2Q3EA 2QZ9A 2Y99A 3FI9A 2PK3A 2WE8A 3DZKA 2I66A 4BO1A 3S8MA 1IZ9A 1HF3A 1LC3A 3R6DA 5JCXA 5F21A 3N58A 2HK7A 5A04A 1R6DA 1OMOA 3F4BA 4CMAA 3KEQA 2D2IA 3H6KA 4KWIA 1HE3A 1PL8A 3FNEA 1UUFA 4L76A 1EQUA 3OQ1A 4YB8A 4M89A 5L3ZA 2DUWA 4NH4A 4AJ2A 1DC5A 1I3MA 3JCZA 1FDVA 2FSSA 3WWYA 2GSDA 3M2PA 5L7WA 1XCBA 3EZYA 3X2EA 1XDWA 3HN7A 1DBVO 3NKLA 3PHIA 1RJWA 3TZ6A 2PKQO 2EHDA 3ZWXA 4P38A 4XEHA 4KTTE 4RPJA 2PZLA 2HMTA 4ITUA 2FPGA 5TGDA 2EGGA 4DYVA 1PJ2A 4OSPA 4ZQGA 3GNTA 1KEWA 4PLYA 3Q9UA 2FPIA 5JC1A 1IHXA 1JVBA 1YQDA 3PQDA 2VYNA 4A7PA 1O6ZA 1LSOA 1A4UA 1VJ1A 2Q99A 4MIOA 1HZZA 1Y8RB 2IXBA 3H9UA 4CV2A 1TI7A 5GZ1A 2DLDA 3OECA 5COQA 3E5RA 2R00C 3V2HA 4M8SA 5L95A 1K6XA 2W2LA 3KUXA 4O59O 3ZHYA 4M49A 1E77A 3I5MA 3LK7A 5FFFA 4L4SA 4GVLA 4BL5A 2GUGA 3IL2A 3WJAA 2P9CA 1LLDA 1ISHA 3AY3A 4OMUA 5DNAA 3BMCA 5L9AA 5C5IA 2O3JA 3QWFA 2XXJA 5AXBA 2UAGA 2HDHA 2D8AA 2WMDA 2ZTMA 2O3TA 3PLNA 2PH3A 4RF5A 2NQ8A 6LDHA 3DMTA 3MJCA 5T8KC 4CM9A 5CDTA 3RUDA 5L4NA 4DBVO 1GD1O 1E1KA 4FFPA 4IDBA 4BNMA 3B1FA 2Y1EA 1RWBA 1U3UA 4IJUA 3TNLA 3INRA 5I7SA 3FCOA 1ADGA 2ZTVA 4WPGA 2B36A 2Z5LA 4YXFA 1ENZA 3INGA 1IZ0A 3EYWA 1P1IA 1QV6A 2GZ1A 2VOJA 3JD1A 1PGJA 1V0JA 4NBTA 2IEDA 4E0BA 4CUJA 4E5NA 1EK5A 1O9BA 5HRUA 1U8FO 4II3A 4CV3A 2Y66A 3ZU3A 1JN0A 1SCUA 1VJ0A 1CDOA 2Z1NA 2JCYA 4PFJA 3OIFA 1R0KA 1DHTA 5L7TA 1EMDA 4A03A 3GDFA 3NRCA 5JDCC 3BMNA 3JSAA 4PG4A 2WTBA 2HJRA 3EHEA 3Q2IA 1U4OA 4KQXA 4BNFA 4B3JA 3RU7A 3L9XA 4NR0A 2ZCUA 4H15A 1P9LA 3DOOA 4OM8A 3TL2A 1N92A 5ENDA 1XR3A 2BFPA 5EINA 4YA6A 3EK2A 5FI3A 1R4NB 4ALKA 2BH9A 4MJLA 4MVJD 4TRRA 3FPCA 3ONEA 3HDHA 2QRKA 4N5MA 1EK6A 3JQAB 3JYNA 4E2WA 4CLXA 4YEDA 4LVCA 2H5LA 2X9NA 4JQCA 3K96A 4F6CA 2JL1A 1C0LA 2DBZA 4CUKA 4QT0A 1EUZA 1NWCA 3I4FA 5IG2A 3OJ0A 2DVMA 4E5MA 1R66A 2OP1A 4RF4A 4GKBA 2R2GA 4NBRA 3RKRA 3U4IA 4QO7A 3EGOA 3H2ZA 3CMMA 3NDRA 3L77A 3WB9A 3C7DB 1NAIA 1GZ4A 3GPDG 3TF5A 5BSHA 3JQ7A 3E1KA 4HKTA 3WR5A 3D3EA 1E6EA 2CVOA 4H7PA 1HYGA 4BKPA 1WZEA 4PLHA 1R16A 4IZHA 3JYPA 3MTGA 1C1DA 1KEPA 3NYWA 4M54A 4FD3A 4IMRA 1ARZA 2GR9A 3OHSX 2JD2A 3S1LA 4B79A 3RBZA 1PJLA 3RUAA 4AVYA 4DTIA 4D44A 1PL6A 4ZN6A 2A94A 1PEDA 4IBOA 1C0IA 4D3DA 1N8KA 3UCFA 3I9MA 2NTJA 3ZH2A 3SJUA 1CWUA 5F3RA 3GHHA 1SMKA 4AJPA 4BVAA 1ZSYA 2JHGA 4LGVA 3H3FA 3H65A 5DULA 1NQ5A 1ZMTA 3PTZA 4EJMA 3A4VA 1QYXA 4UVEA 2IDZA 1QMGA 1DIRA 4MVJP 3WFJA 2WYVA 1PJ3A 9LDBA 4ZJUA 2ZJ1A 4O5OA 5B12A 1U9JA 4LCEA 1P77A 3UW3A 1JAXA 3PFFA 3U4DA 2EF1A 2VN8A 1K5HA 1U8XX 4XCVA 4R5MA 4GLLA 5THQA 1NQOA 1ADFA 1E3JA 2AG5A 4GQAA 3PYLA 2NM0A 5DDIP 4A73A 1C14A 5IDQA 2BRUA 1NVMB 4CV1A 3T7EA 2E82A 3WGZA 2DKNA 2XAAA 3BMOB 4D79A 1DC6A 1GU7A 3K5PA 1IE3A 2HU2A 3BTOA 3CMCO 3VZRA 3AM3A 3GDGA 1EDZA 3TL3A 2JFFA 3TZCA 5A9RA 1XA0A 4R51A 1GL3A 3HDYA 3RIHA 2ET6A 2HAEA 5BQFA 3FWNA 2EIHA 2QW8A 4FGWA 4F45A 3WFIA 1EFKA 4EJ0A 2C29D 1BXGB 4OXYA 4AJEA 4RF2A 2AEMA 4CMIB 3MCVA 4Z9FA 3U62A 3CKYA 4JXKA 4HUJA 2C54A 3RBXA 2VQ3A 4NJOA 4J0FA 2ZCVA 4UUNA 1FMCA 3DHNA 1ZK4A 3ZDFA 3HB5X 3WMWA 3FR7A 1NHWA 4IY1A 2OFPA 5JAMA 4J4BA 4YT4A 4OXNA 1D7OA 2PKQP 3RUFA 1Z6ZA 3ZU2A 1PS0A 1XKQA 5B4VA 1WDKA 2AEFA 4YPOA 1PJBA 2YHIA 3GEDA 3JQGA 4YQZA 2EKQA 3LYLA 4LMRA 2NVUA 4OYRA 1OBFO 2D4AA 5I8WA 1TEHA 1T25A 4YAIA 4HBGA 3PVZA 1HYEA 4EYEA 4PZCA 3HSKA 3CH6A 5LCXA 5TIIA 1IPEA 3DC2A 3GZNB 3DBRA 3JQ8B 1KIFA 1VC2A 3V2UA 1LUAA 4FS3A 4DLLA 4LISA 5DF1A 4WLUA 2B4TO 4J9VA 2V6GA 3ZWVA 3WSVA 3ABIA 5HA5A 3UFXA 1Q1NA 1L7EA 4R9SA 3DFZA 3WJ7A 5CFZA 2C7GA 4YAKA 4ZA2A 5EQFA 3ZW8A 1QYVA 1UR5A 4AICA 4BKQA 3JD0A 1P1KA 5CPFA 2PNFA 2J3JA 1YJ8A 3PPIA 1BDBA 1D3AA 1Y6JA 1FDSA 3CE6A 4DYDA 3DZJA 4BKOA 2VZ9A 3C1TA 5CP8A 2JD0A 4CL3A 1ZCJA 3ETEA 1SC6A 4S3MA 5TS3A 1NPTO 1J0XO 1P33A 5C7LO 3Q0EA 3E5MA 3AM5A 4JCOA 3L07A 3ZI0A 5CAEA 1Y81A 4WJZA 1SEVA 2VNSA 3QY9A 3NV9A 2ZB3A 5JCJD 1BXZA 1YONA 3IMFA 3DAPA 1LSSA 1QP8A 3PWZA 5EIOA 5JE8A 3RU9A 3UKOA 1NVTA 4IDFA 2VUUA 4PLPA 2XXBA 3GVCA 3ZWWA 3D0OA 5JPIA 1HDXA 4RPLA 2FR1A 2EV9A 1ORRA 2O50A 4HX5A 1Q7CA 1FDTA 1XHLA 4TVOA 3ANNA 3FPLA 4J0EA 3GA0A 4AJLA 4W82A 1KS9A 1XELA 1PQPA 4QQRA 4NJMB 4GMFA 2HSDA 4R5HA 5KOIA 5KJEA 1B15A 4UEOA 4D41A 1NPDA 4R4JA 3U5TA 3FHLA 5BSFA 1HZJA 2D3TA 1WWKA 4J1TA 4GGOA 1T26A 3OQBA 3GAZA 1G6KA 3WG9A 2J3HA 2JHFA 3JD2A 1HSOA 4MKZA 3TZKA 1ULSA 4BGUA 1CERA 2RAFA 4ILKA 4PVDA 4UUPA 3I52A 4XIYA 5KVSA 2HMVA 4OHUA 4OO3A 2V6BA 5COAA 1V6AA 4BMNA 3H9JA 5TLSA 5I7VA 4RVGA 3OH8A 2C20A 2ZQYA 1UZNA 4B7XA 5C3MA 2VCYA 5ES3A 1H6AA 3SEFA 2FY8A 3ICPA 3SLKA 1B16A 2HCTA 3EC7A 2CZCA 4J7XA 2J5QA 2V7PA 3PHHA 3I3OA 4EEXA 5F5LA 5JS6A 3RWBA 4AG3A 2G0TA 4BNJA 4JX8A 1VL0A 4P4GA 1C1XB 4FCCA 1GY8A 2PGLA 5T8KA 2YY7A 1FK8A 1PU2A 1DIBA 3DAGA 4DMLA 5F1OA 2W98A 3S2FA 1YB5A 3TOXA 3D7LA 4UUOA 2P2SA 4CMEC 2YUTA 1E3WB 1YBMA 4PG7A 1ZJZA 2OUIA 2PD3A 3AUTA 4WECA 3DZGA 1E1NA 2P91A 3QWAA 3AI1A 1VKOA 1BGVA 1Q7BA 1M6WA 2BGMA 3OEYA 4Q39A 2O7QA 2UUPA 3VAZA 4N18A 1DEHA 3WOHA 2XPCA 1R4MA 2E4AA 5COBA 1PWZA 2UDPA 1EUCA 5BT9A 3RUIA 1PJQA 2HK8A 3WBBA 1AE1A 3DXFA 4DXHA 1LRKA 4GX5A 1UXJA 3VPXA 1IOLA 5I8ZA 3UVEA 3ON5A 2R6JA 1MC5A 3NDIA 2BGKA 3ADPA 4N54A 3ZNPA 2WD8A 3I4CA 3G1UA 3SXPA 2GN8A 2X0JA 2YZ7A 1E1MA 5A06A 4GI2A 3UHAA 1AHIA 2B0JA 4J16A 1PL7A 4CLHA 4CV0A 1Z74A 2GCGA 1L7DA 2CDAA 5A9SA 4RQTA 4S1VA 3QVWA 2Q1WA 3PJGA 5IFLA 2GRAA 5MGBA 1QORA 3GAFA 4P8RA 4Z3DA 1C0KA 1CQJA 3ETDA 4DL9A 2VRCD 3GNSA 3GGPA 4ZU3A 3PZBA 2FMUA 1BDMA 1B8UA 1DXYA 2X23A 3E9QA 2GZ3A 2JD1A 1J49A 3T7CA 2H6EA 5JFOA 4UREA 4Y6RA 3OA2A 2DBRA 4BO4A 2Q49A 3DAFA 1IULA 1UAGA 3JQBA 4FC6A 4CQMD 3FNHA 3HDJA 4W4TA 1AUPA 1E0DA 1PS9A 3KZVA 3ONDA 4XX0A 2GASA 3UICA 5A9TA 4JJGA 4IGFA 3GUCA 3RC7A 4BNWA 5IN4A 2PY6A 2VHXA 4IS3A 3UXYA 1CF2O 4WEQA 3IKTA 4BQRA 3K73O 2OZPA 1IB6A 1GUFA 3BHIA 4GWGA 3VC7A 5KVQA 4CLOB 4X54A 1B8PA 4OAQA 4NBUA 5T64A 3GR6A 2P68A 4Z9YA 1LJ8A 3P7MA 2I6TA 1M76A 2DFDA 3RASA 4CMKA 5HS4A 4XWYA 4ALMA 1MUUA 3JQFC 4XIJA 2NUAA 1EDOA 3OFSA 3DQPA 3KBOA 1S6YA 4XR4A 5G0UA 2NU6A 1Y8RA 2TMDA 2X0NA 5KIAA 1LDGA 1YWGO 2VWHA 4FFLA 3H4VA 4IUYA 3L4BC 2VT3A 4O1MA 2X0RA 2EJWA 4RLHA 3VZSA 3RBVA 1NQTA 2E6UX 1LA2A 3E6AA 3IDSA 1P3DA 4W99A 1U4SA 1XG5A 3D64A 3RJ9A 3ROKA 4BQPA 1KETA 1I3KA 1NWHA 5TSDA 2O4UX 1ZK0A 5U4QA 3EDMA 4NDNE 3T4XA 3PDUA 1YXMA 4LRSB 2VHYA 3H9QA 3I9JA 2IZ1A 3TFOA 4NPCA 4DRYA 4FJ2A 4MIYA 3LQFA 3LT1A 2QRLA 1HEUA 5TF4A 1VJTA 4YACA 4R69A 4FSHA 2I9PA 5JO0A 4E5KA 2DUUA 3WWZA 4E13A 2ZYDA 2HO5A 5CDUA 2B4RO 3NT2A 4C7KA 1P1FA 3F9IA 5TNXA 1LLCA 1HE5A 3GPIA 5KVVA 1M75A 3NT5A 3BMQB 2CMDA 2NSDA 1ZZEA 4ALJA 4D7AA 3A06A 2WE7A 3D4NA 5ENVA 3E03A 4IIVA 4CUZA 4XRRA 1EQ2A 2RIRA 1PZEA 4NMHA 1TT5B 1MV8A 2AQKA 2EJVA 3EY4A 1QXSA 4W7IA 4BB6A 1ONNA 3ETGA 1ZNQO 2WD7A 5IXYA 5K6AA 2DQ4A 3RUHA 2O48X 4LK3A 1MXFA 1Y5MA 1LDMA 4CMBA 5TJ9A 3FNGA 4PLZA 3JQ6A 3NGXA 3RVDA 4DREA 1O95A 4Q3BA 2HMSA 3AOEA 4DC0A 2P5UA 4J1QA 2B37A 4J3FA 1C0PA 1RYDA 2C0CA 4WLOA 1R4NA 2EP5A 4GLOA 4AJHA 4CLDA 1EZ4A 2Y1OA 4Q3EA 4AJ1A 4LVUA 2YV1A 3JQAA 4HFMA 2A9FA 2P9GA 2C2XA 4ND5A 1TVEA 2IEBA 4Z6KA 2RHRA 3QJ5A 2Q1SA 5TT0A 3QWBA 5J23A 2PA3A 3ZV3A 3VDRA 2PD4A 2B35A 5IZCC 5FF9A 1JAYA 1LQUA 5B37A 5JAZA 3QV1A 2YJZA 4AJJA 4CMJA 5JXWA 1RM3A 3KYDB 4Q3DA 4JROA 4BUCA 4CM4B 3WNVA 1VSVA 2IZZA 1KOLA 3PHLA 1HDZA 3W4IA 1F12A 1I10A 2RCYA 4Y6PA 4U8GA 3I6IA 1J6UA 3RCBA 4YRDA 1UDAA 1VE9A 3LT0A 3KXDA 1SOVA 3TJRA 3KO8A 1LXCA 2VYVA 5G4KB 4D46A 3PHJA 3EAGA 2CVZA 2QHXA 1PJCA 4J91A 1W73A 4XYGA 5TQVA 2BD0A 4ROSA 3DO5A 4TZTA 4CM8B 3F46A 1WNTA 2OOSA 3B70A 1E7WA 4R9RA 4CM5A 1P1HA 5TX7A 1XLTA 2FN7A 3FTNA 3M1LA 2X58A 4PLGA 4R68A 4GL4A 3B1JA 4NFSA 2NTVA 3DOJA 3F47A 1CEQA 2RH4A 1JDJA 1LSJA 1X14A 2FR8A 3C8MA 3PIDA 4R3NA 4U6QA 5JY6A 4BNXA 2JAPA 5BSEA 5EN4A 4U0JA 1Y9AA 5KNLA 4FC7A 3DWFA 5TJHA 4PIVA 1HTBA 3KVOA 4MIEA 4A2CA 4XZ3A 3ONFA 2NVWA 2VOEA 4ZRMA 5CDSA 3LF2A 1RYEA 4NIMA 4WNIA 4A26A 2VUSA 4DLBA 3HUDA 3QVXA 4UVGA 3F4LA 1ENOA 2DTDA 1ZK3A 1T1SA 3G79A 2Y1GA 4ND1A 5AQ1A 2B5WA 4F3YA 2LDBA 1HL3A 4J7UA 1UXKA 4BS9A 2Y1CA 3BMOA 1B0AA 3LZ6A 4JN6B 4NQZA 5AYVA 3WGIA 1K0UA 2Y0CA 3O38A 4BB5A 4BNUA 2I5PO 2EKPA 4MVJA 5FYDA 4QFDA 1M2WA 3RFVA 4LN1A 4PLVA 3UOGA 3EUWA 2VYND 3BYZA 3I9OA 1P0FA 4L74A 5CG2A 1HYHA 3HWRA 1ID1A 3WBFA 1IUKA 2FSVA 4B7CA 4I5GA 1BXGA 2ZATA 3PYMA 4BHTA 3DONA 1NHGA 4CMIA 3TFQA 1E6UA 2F1KA 1T4BA 1UZMA 1ENYA 4TSKA 1EE9A 1DPGA 1L1FA 1I0ZA 4UEJA 2DPHA 4IGEA 4WK6A 1DDOA 1GYRA 1V3UA 1AXEA 2ZJ0A 4IM7A 2P4QA 2XOXA 2QG4A 2NWQA 4UVIA 3OF2A 5BNTA 1Z73A 5DOVA 1BW9B 1TT7A 2BLLA 1E7MA 4Y98A 3MOGA 3FBGA 3PZRA 5GMOA 3IUSA 4BNNA 1HSZA 1ONPA 4CM9D 1R37A 1DIAA 2FR0A 4TKLA 3MJTA 2IZ0A 3GZNA 3JQ8A 3O9ZA 1JLLA 4K1LA 1Y9EA 1Z7EA 1E7QA 2NLOA 1GQQA 4M1QA 4NZ9A 5ITVA 1ISFA 2TMGA 1KC1A 2CVQA 1DAOA 4WCFC 3UUWA 4PLTA 4B4WA 1Z7BA 4RZHA 1YL5A 3MTJA 1DIGA 1XU7A 3U4CA 2YFHA 5LDGA 1VL6A 3STHA 3QVTA 4BKUA 3KYCB 4GX0A 1I3LA 3QW2A 1J5PA 5U1PA 1M66A 2IRWA 3BHJA 4FQ8A 4JLWA 4M87A 4BNKA 4FJ0A 2Y1DA 3JYOA 1ZXBA 1GZ6A 4K26A 3CZRA 1D8AA 3ZGYA 5T6BA 5THKA 3IC5A 3WGGA 4B8WA 1Y1PA 2YDXA 2O23A 4WEOA 4FBGA 3RSHA 2VWPA 1GDHA 3UCEA 5DP2A 4ZD6A 3GDOA 2PFGA 2Y05A 4BKRA 1NM5A 3PP8A 4TQGA 4B4UA 3I9NA 3GG2A 2QX7A 3PI7A 3GEGA 4XDZA 1YL6A 7MDHA 3FF4A 2NACA 3KHUA 4BO7A 3LU1A 1Q2XA 4Z9XA 1GEEA 2BGLA 1VLLA 4L4XA 2VUTA 5CDYA 1GAEO 5LDHA 2AQIA 4E6PA 1A7AA 3VPFA 5ADHA 3WQQA 1E5QA 1ZEJA 3C1OA 3DBLB 1VL8A 1ML3A 5KJCA 3JQEA 3NX4A 4YWJA 3BZUA 4KWHA 2E48A 4NJMA 4L73A 1FJHA 3NEPX 2Y0EA 5DCYA 3DL2A 2VHZA 2GF2A 1ZVMA 2QZZA 4OXKA 1YOVB 5B1YA 3F3SA 2CDCA 2ZTUA 4NK5A 2VWQA 4D3SA 1U3TA 4D42A 1CRWG 5TT1A 1XU9A 2HUNA 2HJSA 3MJSA 3QSGA 2ZYGA 3H9EO 5HS6A 3Q9NA 1PJ4A 5A02A 1A72A 2P9EA 5KVCA 3R3SA 1HDOA 1HDGO 3K31A 4YQYA 3TSCA 4UAGA 4A0SA 1ENPA 4EJ6A 2ZB4A 3GF4A 1WDMA 3O03A 3GN2A 4XJSA 4YJGB 2AQHA 1ZIDA 3VKVA 3WICA 5KJFA 1PGNA 2OXIA 5CDGA 4YT8A 4A10A 1M67A 2Q4BA 4OQZA 4I9HA 1DJQA 2B4QA 4RF3A 1OC4A 1I8TA 4YR9A 3UH1A 4ZVVA 2VZ8A 4BIIA 3F1KA 3IQDB 3WTCA 4FJ1A 2UVDA 5DBGA 4PG5A 4IXWA 4W9NA 3PLRA 1C1XA 5IJZA 1G1AA 4ALLA 1H2BA 1MP0A 1FF9A 1HLDA 4MP8A 3IUPA 3JQ9C 1E7SA 1ADCA 1ULUA 4OIMA 4ND3A 2AHRA 2O7SA 1E92A 2YDYA 3UGKA 4TZKA 2OBYA 2O3SA 1XQ6A 3HFSA 1E3WA 2HKIA 4TRNA 4Q3AA 4Q3NA 1XQ1A 2W2KA 1ZEMA 4NK4A 3C7CB 3Q2KA 4CM6A 2G76A 4GWKA 2CD9A 1IL0A 4BGEA 4FN4A 1PTJA 3EVNA 5BNIA 1E3LA 1VRWA 4ID9A 2CF6A 4DIOA 2AEJA 2ZB7A 1DSSG 3C1AA 3C85A 3HQ4O 4RPGA 4CR6A 4NFHA 3OM9A 5EJ2A 4ESOA 2GDZA 1N9GB 2NADA 3K92A 5LC1A 1EVZA 3E18A 4PN3A 3ZWNA 2QYTA 3K8ZA 4QTZA 1DO8A 3V5NA 4CPDA 4IXTA 1E3IA 4L0QA 1RPNA 2JCVA 4FR5A 4BMSA 1QSGA 1WXDA 4AFNA 1R0SA 3KLPX 2FPPA 5T67A 3VVBA 3DTYA 4HFNA 4OGWA 4XGIA 5AXDA 8ADHA 4RORA 4CMHA 1NNUA 1U2GA 2BFAA 3M6IA 1MC4A 1PZHA 4DLAA 3VH3A 2W8ZA 2VRBA 1R12A 4E12A 3U49A 1TB4A 2X7HA 3ZWAA 1YBVA 3S2GA 1WMBA 5HWSA 2VHWA 4JJFA 3HG7A 3SLGA 4CMGA 2X4GA 4OOFA 1Z45A 5IZCA 1MG0A 1H6DA 2WDZA 3TZHA 4ONEA 3QE3A 1BMDA 2CY0A 1I2CA 3Q11A 3JYLA 1KC3A 1I33A 2DAPA 2P4HX 4IPTA 3WGYA 3VH1A 4IJWA 4GPD1 4CLOA 1NFFA 1LRJA 3GQVA 2C5EA 3FSRA 4YJFB 4E21A 1MFPA 1JQBA 3PK0A 4Z0HO 3TQHA 2J3IA 1X15A 2DTEA 2FWMX 2X86A 3WQRA 4EUHA 7ADHA 4NNJA 3GRPA 1ZO8A 4J1SA 4IQ0A 1I01A 3L6OO 4J1NA 1IPFA 1DC3A 1H9BA 1T2CA 4HFJA 1HT0A 1DLIA 3IAHA 1GR0A 3ENKA 2NV6A 4FFMA 1PGOA 4FIZA 1QV7A 2FOIA 2OGUA 3DMTC 3DHEA 2X1HA 4DIBA 3B1KA 4YT2A 2PWZA 4J7CA 5DT9A 2Q50A 4R16A 3ROQA 1KVUA 2R00A 1PSDA 5JYEA 4QO8A 3VPSA 4Y9DA 4NU5A 3NT4A 3G1TA 5ICMA 1RM5A 1Z75A 3K2BA 3RFTA 1YKFA 3BAZA 5GY7A 2BHLA 5JBIA 4NI5A 1LDNA 5BSGA 2O4CA 1LDYA 5KCZA 4FOOA 1OAAA 3W8FA 1H6CA 2Y0DA 5TRTA 2DBVO 1LU9A 3OSUA 3VKUA 1DRUA 1Z82A 4P4LA 4GSLA 4XKJA 2FZEA 3RI3A 1GYPA 1OC2A 3B6ZA 5G0SA 4WLEA 5B4UA 1FXSA 3KRTA 4J9UE 3ZNQA 3ASUA 3W8EA 3BMQA 3JYQA 2VRCA 3DB2A 1DFGA 2AXQA 3WGQA 3AUAA 3JQCA 1YL7A 4JK3A 1ISJA 3AFNA 3I23A 1A7KA 1KY5A 3JD4A 3KSUA 4C4OA 4UEKA 4ALIA 3O8QB 4XQCA 1JVSA 1TT5A 3A14A 3RKUA 4CQMA 2Q1TA 2EG9A 1T24A 2C2YA 3RC1A 2YQ4A 3I1JA 2V65A 1Y7TA 1ZSNA 2X6TA 1YBAA 3U0BA 3MJEA 5JDCA 2PTGA 1T2DA 5FWNA 4NU6A 1HE2A 3WGTA 3LSYA 3NDJA 1V3TA 2WJPA 4LSWA 3KETA 4WLVA 2JFHA 1DLJA 5KWEA 1QG6A 3F5SA 1HETA 3C24A 1E5LA 4E3ZA 1D1TA 1DJNA 2C59A 4WUVA 2CNBA 5DN9A 5KJ6A 3PJEA 4OOEA 1BSVA 1JTVA 4AJKA 3KSDO 2Q46A 1YB4A 4JBGA 2HLPA 3PFWO 1KVRA 4JIGA 3OA0A 2HQ1A 3W6UA 4CL8A 3WS7A 4O0LA 5ER9A 1JWAB 2X9VA 4PRKA 1WLYA 4RZIA 3WIEA 1YB1A 3Q6IA 4DA9A 3KYDA 4CM4A 4E2YA 1TLTA 4DPLA 1WZIA 3E9NA 4TMFA 1PIWA 3LLVA 1N1GA 4KOAA 2HRZA 4CM1A 1YE3A 1UDBA 1DOHA 3WYCA 1B7GO 3U3XA 3PJDA 1C3VA 1PQWA 2BF7A 3RQSA 3PGJA 3VZPA 4EUFA 1YVEI 2DFVA 4ZQBA 3BA1A 4UUMA 2EXXA 3CZMA 2G17A 4IQGA 5G4KA 3NAQA 1HDYA 1LNQA 4PZDA 3JV7A 1P45A 4J2HA 4JP3A 1ZK1A 4IDEA 3QVOA 4P22A 3LC2O 4CM8A 1UP4A 4DPMA 3BIOA 3SX2A 2PGJA 4DQUA 1WDLA 4EI2A 1KY4A 1GV1A 3VOSA 5IDXA 1GQ2A 4BO9A 2ZK7A 3H7AA 4BGIA 3HE3A 1WAMA 1KEUA 1QYCA 2PLAA 3N7UA 4H3VA 5DBFA 3QLJA 4XQEA 4EZBA 3HFGA 1MFZA 3GUYA 5JMPA 1B26A 1PGPA 4YT5A 5A5FA 3DR3A 4DIFA 4HWKA 4R1SA 1K6IA 4URFA 1RM4A 5EERA 3GHYA 1BHSA 5JMWA 3FBTA 4BNZA 3QWHA 1PZGA 2IODA 1WMAA 3HHPA 4YYZA 1DC4A 1HDCA 2Q2WA 3K30A 4Y8VA 1K2WA 5DZSA 5GZ3A 5ICSA 4DBZA 5L53A 4BNVA 1V8BA 1FDWA 1T1RA 3CTMA 4E2ZA 3GVXA 4R1UA 3RC2A 4A27A 3S2EA 4GX2A 3MOIA 3MJ4A 4MVJM 2DBQA 5EPOA 3V1TC 4DPKA 5F1KA 2DM6A 2PH5A 2J6IA 1CETA 3VDQA 4QX6A 2X5KO 2YQ5A 4MKRA 2BI8A 3KB6A 1B14A 3LDHA 3CEAA 1WVGA 3UAGA 3EW7A 3OJLA 4TVBA 4GX1A 5F5NA 4B3HA 3R1IA 1SO8A 5DP1A 3G17A 4LSMA 1AXGA 1UH5A 2ILTA 2BI7A 2Y67A 1ADBA 3T4EA 4UULA 4ND2A 2OBNA 4G81A 4N5LA 4HP8A 4XDYA 1LEHA 4RVSA 4WE3A 1LRLA 3A28A 3FWZA 4PVCA 2WYWA 3QWIA 5JW6A 1EBFA 4FFNA 1NFRA 1W0CA 4J4HA 2VNAA 4FFRA 1BW9A 3D3WB 1PWXA 1LI4A 3AFMA 1JW9B 3SC6A 1D1SA 2WSBA 3AY6A 3DEYX 3PXXA 3R3JA 5JDIC 5H82A 5FEUA 4NFYA 4O6VA 2V6FA 4Q9NA 1N1EA 5CHEA 1HDRA 3V8BA 3GVPA 1LBEA 3K6JA 3TDKA 2O3UA 1PJSA 2AA3A 4B4OA 3VHRA 3W8DA 4MKXA 5IXSA 5L40A 4B3IA 2ZB8A 3UCXA 4FB5A 1U3VA 5L51A 2WWRA 1JKFA 4KQWA 1QLHA 4R41A 5L45A 3GNQA 2Q4EA 4BNYA 4HV4A 3L6EA 2LDXA 1ZK2A 3QVSA 4UVDA 3R0IA 4WCFB 4EW6A 3KYCA 1G0OA 3IS3A 2PKRA 1XWFA 4RVHA 1ZH8A 2YYYA 3U4HA 4OL9A 4F6LA 2NQTA 2YV2A 4JJIA 2J5RA 3OMLA 4IJVA 4I08A 2H9IA 2PD6A 3NJ8A 3HZZA 1P1RA 4NG5A 3I83A 3ZHZA 1BVUA 1LDEA 4DMMA 1A5ZA 3BXXA 4Z3KA 4NHEA 5BNFA 4KUEA 5CEEA 4RVFA 4QFCA 3AY7A 1MG5A 1EE2A 4L9RA 2AQ8A 3WX0A 1H0KA 1KEVA 3KTDA 3PDJA 3ZWYA 2A92A 4ZHSA 1YQXA 1PGQA 5G0VA 2YW9A 4K28A 3JQAD 4ZQHA 4ZRNA 2HMUA 3PWSA 1PS8A 3HJAA 3NUGA 1GZ3A 3L6DA 3ZNOA 4BNIA 4CLEA 3LT2A 2FHSA 3ZCXA 1J4AA 4AJIA 2FP4A 4I5FA 1P1JA 4FOSA 5JY1A 1YDEA 3OJFA 3FNFA 4IMPA 3W4KA 4BOYA 2EW8A 3HN2A 1ZW1A 2ZTLA 3DBLA 4Z0PA 4CLRB 1Y8QB 1LX6A 2NU7A 3DZFA 1DRWA 2Q1UA 4E31A 4BV9A 4XB1A 1YOVA 5CEJA 4PRLA 4IDDA 3DBHB 2GN6A 1CQIA 4RCVA 1SBYA 5I7EA 4I1IA 1B3RA 1NX6A 1AGNA 4HNGA 4OKNA 3GEMA 5IN5A 2B69A 1T2AA 3AW9A 3ZV5A 2VYVD 1MA0A 2I76A 4W6ZA 1VI2A 4YJGA 2D0IA 1X13A 1ISGA 3GFBA 1SPXA 3FR8A 3KM0A 1RM0A 3SVTA 4OQYA 1K89A 3ORFA 4KMSA 3FTPA 4PCVA 4GMGA 3RAJA 4XGKA 4D45A 1NASA 1V35A 2HK9A 2PZKA 1KBZA 2Q2QA 4R3WA 2O3RA 4YRAA 1QRRA 1UXHA 3LF1A 2W2LD 3DOCA 3Q1LA 4Q3CA 4AJ4A 3CIFA 4MVJI 1KVTA 2G1UA 2WEKA 3C3XA 3LLSA 4RL6A 4RLSA 2C7VA 4XRGA 2Y68A 3DTTA 1X1EA 1O94A 1PJTA 2I67A 3U9LA 4IS2A 5KTKA 2EKLA 3A1NA 5G0TA 2DU8A 1YGYA 2UYYA 4RJTA 5CEFA 4YJHB 3ST7A 3FRJA 1K3TA 3LC7O 4WASA 5G0WA 3WQSB 2D5CA 4YJDA 4XQGA 1UZLA 2WD7B 1JKJA 2GERA 4CQMB 1GUZA 1CYDA 1ZXLA 4CMEA 3EVTA 3ZWOA 1YJQA 5ILOA 1SZJG 2FZWA 3DZIA 3NGLA 1A9ZA 1BVRA 5A1TA 4OKIA 1EVIA 1X7GA 3RROA 1OZAA 2Q2VA 4CQLB 3P19A 3C7AA 3L9WA 3P2YA 3AU8A 3PRJA 4IINA 5JAQA 2X22A 2JFGA 1PR9A 3AM4A 1VKNA 2OO5A 2QQ5A 4J4TA 5I7FA 3ITKA 1N9GA 5A03A 1KVQA 3PYXA 3JQBC 2WM3A 2UV8A 3K9QO 1I2ZA 4DVJA 3OICA 4P4NA 5KJ1A 2Y93A 2E49A 1P74A 4WLFA 1GQYA 1WW8A 2QIOA 4WGGA 1DRVA 3HDQA 5TC4A 2CF5A 4ALNA 1MLDA 4IZIA 1I30A 3WXBA 1U7HA 2Q45A 3SC4A 1ISIA 4HXYA 4MP6A 8LDHA 4BV8A 3IJPA 1HXHA 3AUUA 3H3JA 3INTA 2ZQZA 1I24A 5IDWA 3VPGA 3O26A 2IYOA 2BFOA 5C37A 1N2SA 4M55A 3TOZA 5EQDA 1R0LA 3AI2A 2DC1A 2NTNA 2VTEA 3DMYA 4BO0A 5I9MA 5CPBA 1ZFNA 3I6QA 5AOVA 4BO8A 3I9LA 4K6CA 3PIIA 2IXAA 3BTVA 3S2IA 3GFGA 3B20A 1BWSA 1I2BA 3FD8A 4RVDA 5I9NA 5U9CA 3OETA 4DQVA 1I36A 1OFGA 4YJFA 1TA4A 5AXCA 4LCJA 2A4KA 1E6WA 1KVSA 3NTQA 1SOWA 1UXGA 3VTZA 3GMSA 5JAIA 3HNPA 1F8FA 2EEZA 2G5CA 4ND4A 5JO9A 4XJTA 1Q0LA 1NBOA 3AWDA 3KSZO 3JQFA 3RUCA 3IP3A 1YQGA 1BRMA 3OP4A 5AVOA 3O4RA 4II2A 4FGSA 1B3BA 3BMCB 3P5SA 3LT4A 4XYBA 3WTBA 1Q0HA 2C82A 1S7CA 4GKVA 3D1LA 2J5KA 3L4BA 1MB4A 1YH3A 1BTOA 4JP2A 3DBVO 3GG9A 3ZV6A 4KZPA 1SB8A 2PR2A 2ZKLA 1UP6A 2CUKA 2ZYAA 2O2SA 5A4DA 1XEAA 4JBIA 3V1UA 2GNAA 4AJNA 5A5EA 3H2SA 2VHVA 3MZ0A 4W7HA 1W4ZA 4BO2A 1EVJA 3E48A 3OBBA 1SNYA 2SCUA 3CSDA 1A27A 4NBWA 5HBRA 4U6SA 2O3QA 1X7HA 4ZQEA 4G5HA 4J2OA 3GMDA 3EMKA 4YAEA 4AL4A 3PQEA 5IAAA 5MDHA 2W90A 4IDAA 1U5AA 1ZSVA 3RUEA 2X5JO 4MO2A 1AHHA 3IP1A 1EEHA 3M2TA 4GGPA 5A3VA 3E9MA 3DDNA 4MDHA 4MINA 5H81A 5K6AC 4N5NA 2EERA 3PGXA 1CJCA 2P5YA 4QEDA 3JTMA 4R01A 4RDIA 1NTOA 1A71A 4MVJG 5CG1A 2VZ0A 3GT0A 3GGOA 3COSA 3BMNB 1EUDA 3F6YA 5HM8A 2AW5A 3QP9A 5I9LA 4PLWA 3GVHA 5K0ZA 4I5EA 2JAHA 4I9UA 4MVJE 3AOEC 2BMAA 1YO6A 2GN9A 5JSFA 4BNGA 4MVJH 3O8QA 1DHRA 1G0NA 1X0XA 5JLAA 1LSUA 4XB2A 3ZWMA 2OL4A 3N74A 1T2FA 2I99A 5K9ZA 4R1NA 2GPTA 5JCJA 1GV0A 1UJMA 4RPKA 2UUOA 4INAA 4NBVA 4C7JA 1H2HA 1QR6A 1AN9A 3OQ6A 1P44A 2HMWA 4FW8A 2AMFA 2DTXA 5L4SA 4HADA 1TXGA 3ZWCA 3ROMA 3MEQA 3ZN2A 1E3SA 3ULKA 4YRBA 4BNHA 3IIEA 4L75A 1U5CA 4YDRA 9LDTA 1EVYA 5IF3A 4DWVA 4GBJA 4MPDA 4XA8A 1GFSA 4ZGWA 1A9YA 4YBZA 1E1LA 2NNLD 1H5QA 1UXIA 2NVBA 5GZ6A 3JQ7B 5JDIA 2POQX 2D59A 2F00A 2OHXA 4J6FA 1Q7GA 1F06A 3WNQA 1MGOA 2WYUA 4U5QA 1P31A 4TWRA 1BG6A 1NAHA 3KEOA 2X8LA 4IJKA 1H94A 3G49A 1C1DB 4RQUA 3OJEA 4KTVE 2YFQA 1QKIA 4B8ZA 3D5TA 2C07A 2HRBA 3PHGA 3BTSA 4F46A 4MOWA 1LDBA 1XIVA 3QIVA 3QRWA 4IQ8A 1W6UA 4ZQFA 1DB3A 4KDEA 3ZV4A 4EITA 4RV9A 1DFIA 4YAJA 1I3NA 1ZKMA 2J8ZA 4RPHA 4UVHA 4TRMA 5T57A 2FRDA 1F0YA 4U0KA 4G2NA 3ITDA 3W4JA 2V6MA 1F17A 4OH1A 4I8XA 2BKAA 3H9GA 1GADO 4PG6A 1JWBB 3D4OA 4BNLA 4PGFA 3ZZNA 1ONOA 3ENNA 3ZW9A 1PR3A 3ADOA 5G2OA 1EBUA 1V9LA 5C7OO 4PLCA 3W6ZA 4N7RA 4D3FA 3ZHXA 1R15A 1KERA 1GYQA 2H1SA 3WGHA 3X2FA 3KOUA 3H5NA 3F1LA 4LMPA 4K6FA 1F14A 1DFHA 3GOHA 3CXRA 1I32A 1RKXA 2X0IA 3A9WA 2AG8A 2X9GA 2EW2A 1PX0A 1QLJA 4TRJA 5G4LA 4EUEA 3E8XA 3LC1O 4HNHA 4M86A 5A05A 3D5QA 4EEZA 3HB4X 5KKAA 4CM3A 1OI7A 2AE1A 3MWEB 4KUHA 1Q0QA 3TRIA 4Y6SA 4WNCA 3TZQA 5DCWA 2YV3A 1ZMOA 1JKIA 4BNTA 3TN7A 4D0RA 1XYGA 2QRJA 1ZJYA 4GSKA 1MX3A 1PQUA 4GH5A 2PGDA 2RBEA 4Z0TA 3FN4A 1SEPA 1O0SA 1IHYA 3ZHBA 3MWDB 4L4RA 4A5OA 5IZ4A 1A4IA 5DCUA 1DAPA 2XF8A 1U1IA 3AK4A 2JKVA 4WKGA 3WMXA 1QYWA 1E7YA 1SB9A 1T2EA 2NU9A 4J49A 2Y1FA 3CPSA 5FI5A 4DQXA 4XR9A 1LLUA 4WOKA 3RD5A 4WCDA 2RHCA 3VH2A 4GVXA 4K9DA 4YVFA 3ZU5A 4U7WA 1T4DA 4DUPA 2GYYA 4CJXA 5BR7A 3VVCA 4KP7A 2YHIB 3JQGB 3AI3A 1YDWA 2NVUB 3ZWBA 3GVIA 3VH4A 2IYPA 4L8VA 2W2KB 1F8GA 1UP7A 4XYEA 5C7IO 1ISMA 4BO3A 3H8VA 3KV3O 1GPDG 5JYDA 3D3WA 4LW8A 3PQFA 2E37A 3DBRB 4JNKA 1N7GA 5H83A 3AU9A 3IKVA 5DBIA 4EDFA 4KDFA 3LVFO 4PLFA 1NYTA 4TROA 2G82A 4E33A 3RC9A 3H5AA 2EGHA 3HADA 4TKMA 4DC1A 3AOGA 3GGGA 1O5IA 2D5AA 1U3WA 3L4SO 5KKCA 1HLPA 1DIHA 1BXKA 1ZBQA 2VT2A 2BELA 2I3AA 4GAEA 1B2LA 3ZWPA 3KYBA 3RJ5A 2GO1A 2CSUA 3CINA 2BFMA 3IJRA 4Y67A 2VWGA 3H5RA 3ASVA 4RDHA 1B8VA 1GEGA 1UDCA 2JJYA 4CM7A 3WIDA 4EGFA 1LC0A 5EMHA 3VPHA 3Q3CA 3GH3A 4WCFA 4PG8A 5T5QA 3K2EA 3SJ7A 3ROPA 5HTOA 4QXMA 5JC8A 1U28A 4J43A 3NJ4A 3GLQA 3D4PA 3WYEA 3DZHA 4MP3A 4WOJA 3UF0A 4E2XA 4H16A 4BMVA 3ICCA 3PWKA 5A3JA 2ZIZA 3TWOA 1P0CA 3DHYA 3M1AA 2AE2A 6ADHA 3WDSA 3JQDA 4D0SA 1HE4A 4RGBA 2PZJA 4OSOA 4RO0A 3VZQA 4XGNA 4IDGA 3GK3A 3KLMX 4FDAA 4O63O 2OP0A 1O89A 4AJOA 5JNLA 5L4LA 1GTMA 1GCUA 3DZBA 4RVUA 4IIUA 4JGBA 3AUSA 3V2GA 4WLNA 5ER6A 4CR8A 3U09A 3JD3A 2IE0A 3WLFA 4XYMA 4E5YA 1YS4A 2Z95A 3OJOA 1LTHR 2A35A 4DGSA 2EWMA 2J3KA 5L7YA 1X1TA 1HWYA 1VPDA 1NFQA 3GZ4A 4G65A 2GZ2A 5IDYA 1XGKA 2CDBA 2OMEA 4ZICA 4QECA 4CLRA 3ANMA 3G0OA 1Y8QA 3GY0A 1U2DA 3RFXA 2X5OA 1NPYA 3MJVA 5ILGA 3UN1A 1YRLA 2W4QA 5B4TA 3DBHA 1D4FA 1ZUD1 3CUKA 2JCXA 4XYLA 2I3GA 1H93A 1UAYA 4KUGA 1VSUA 2Z1MA 4MVJF 2B5VA 4YTEA 2VTDA 3GN1A 1O8CA 3P2OA 3ZU4A 4QSMA 1GCOA 1HKUA 3VTFA 1VM6A 1FDUA 3I9KA 4QUKA 2D1YA 1GUYA 2H63A 1Y5RA 2RH8A 3SBOA 4PZEA 4W9NC 4YAGA 1NR1A 1IY8A 2DT5A 3WGOA 2OORA 3ANLA 4J90A 4E5PA 4IDCA
chains in the Genus database with same CATH superfamily
3P9YA 4KPYA 3QQPA 1N7HA 4WGFA 1EFLA 2KLHA 2C96A 2NU8A 5JS8A 2KS6A 1M9NA 2AVDA 4P2BA 1PUJA 1J8YF 1XHFA 4XD2A 4DEVA 1ABBA 3OHMA 4BGVA 3WK8A 1Z63A 3HU1A 3QHAA 4JBHA 1MHPA 4N4AA 3ZNNA 4HDCA 2BMDA 4H1VA 1FFWA 5C1BA 2NTEA 3IXMA 1XMPA 2CMFA 4X1KA 4ZAXA 3TQRA 3VISA 3U7QB 1HE8B 3VSDA 4PZPA 1UQRA 5AKLA 3NEJA 4U7TB 5FTWA 3BD6A 1VA5A 2QN3A 2HCJB 2IPXA 2YHUA 5CTAA 1CY6A 3WNDA 4XQ9A 1Y1TA 2C4NA 4TTIA 4HMOA 3G3EA 1EUCB 1WPQA 4L8LA 1IN5A 4B4VA 3A1VA 4ZT2A 2DSNA 3AVPA 2HTEA 4URXR 4FKBA 1GPJA 1OOEA 2CGEA 3OFKA 4BWGA 1UC9A 1NXQA 2VJPA 1U1FA 5BRNA 3EXIA 4DE5A 1FSZA 3DEJA 3C3EA 2O2YA 3CJQA 1RWMA 4FFOA 1SXJD 4I99A 4O4LA 2BUAA 3GO4A 3AF5A 3O8CA 4EH1A 4I4TF 1EX1A 2B3DA 5AJXA 5B1DA 4O4IF 1JAIA 1RD4A 4QL3A 5DEOA 3PTAA 1QTIA 1YB7A 1Z6QA 3IOYA 1ZONA 2RGBA 2YWRA 1YHYA 1PZFA 4RADA 5HIMA 4KU4A 2C5AA 4YC7A 1S9DA 2JFWA 2CD7A 1T10A 5DGIA 4LBVA 4UE2A 3UKDA 4Y9UA 2FZVA 2SICE 3RTDA 1NBWB 2W43A 3OPMA 2IP4A 1SH7A 3HVIA 3IURA 1FXWA 4LRTB 1YRWA 2Q3EA 2MSCB 2QZ9A 3BBPA 5LQAA 4P54A 1PN3A 1OH5A 2W6MA 5EE3A 5LLDA 2W8BB 3K9LA 3R6LA 1EINA 4OM7A 5JI2E 4IJMA 1H23A 1KDRA 1R6DA 3FOWA 1OMOA 3F4BA 4TQAA 2XECA 1E2KA 2CVPA 4XX0B 5L3RA 4AY4A 2ZSFA 3JZFA 4MS4A 1QHEA 1P4JA 1EFDN 5BNZA 1VL2A 5JZOA 4YDSA 4DV2B 1D04A 2VDVE 1UUFA 4L76A 1VPTA 3KC2A 1O95D 2X1MA 1ECFA 3CWZA 2OGWA 3KYJB 5IUJC 4G63A 3JRXA 3SNKA 4ETIA 1W0KA 2X6QA 3NIFB 4AJ2A 3JCZA 5JH7F 2FSSA 3BSSA 1XCBA 5AMXA 3X2EA 6NULA 1OH8A 3PHIA 3QLUA 3TZ6A 3SBXA 2H7VA 1RQRA 2PKQO 1ZHFA 4P38A 2PJZA 2PZLA 4F12A 2FVXA 2HMTA 3L0BA 1EG2A 3H1TA 2DX7A 4ITUA 2Z2KA 4BB0A 4DM4A 5HHTA 2EGGA 3P45A 4GI7A 2ACKA 4OP1A 3UV3A 3GNTA 3OPYB 1HT2E 2FPIA 2F8MA 4Q03A 1B6RA 8ATCA 3I2JA 4F8JA 3SHOA 1BIFA 3KG2A 4YRFA 1YS9A 5GV7A 4I4CA 3VR3D 4QTXA 1XD8A 3ZG6A 5DHQA 1LSOA 1A4UA 3UOAB 1M6VA 4A15A 1UMCA 5KC8A 2IXBA 3KB1A 2B1QA 1LPNA 1GAWA 4A0RA 1U80A 3QXXA 4YBRA 2KPOA 4LF7B 3KFVA 3E5RA 2RGCA 2R00C 1T3SA 4M8SA 3WGMA 3AKYA 5FUVA 1Y9DA 3VU0A 2WPDA 3KUXA 4ZV7A 4N47A 4IRXA 4C0XA 2IT1A 3GP3A 2GVZC 4BL5A 4DIUA 1QOZA 3N3AC 1ESMA 3AY3A 4X8OA 4AUKA 4QBHA 1YIAA 4ID3A 3FMPB 5E6RA 5L9AA 4GE3A 2O3JA 2XXJA 1NIJA 4KNYA 2D8AA 5DTIA 3MUFA 2IVFA 4PFSA 2O3TA 5K2MA 3TAUA 5K20A 1F5NA 3HVUA 4RF5A 1XL0A 3RYIA 4CF5A 3FUXA 4LXTA 4HYTA 3FPEA 1X7XB 2Z43A 3LPAA 2XQFA 2BPOA 4Z9AA 1V7QA 1E1KA 4UBLA 4BFSA 4Q00A 1GCGA 1N9ZA 1SXJB 1U3UA 2WIBA 1RC8A 4IRUB 1RABA 2MSEB 3INRA 4Q02A 1ML4A 3S7TA 5AVRA 2CWDA 4DSAA 2ZTVA 3EXHA 4WPGA 5IAEA 2Z5LA 2GESA 2E4XA 3BXHA 1W88A 3FGPA 3INGA 1AA9A 2OGTA 1DC8A 1VQ1A 5EZSA 2HR1A 2C0PA 1V45E 2IX3A 3IDFA 2HF9A 4E5NA 3CWQA 1W8IA 1UK8A 4I3GA 4WK0B 4TYMA 2JGIA 3OZIA 2Y66A 2BMFA 3I6MA 1G2IA 1R00A 1VJ0A 1SXJE 4Q4DA 1N6IA 4MVWA 4EOGA 4PFJA 5KYUA 3I0NA 2QMHA 2QGNA 3BK2A 4LV6A 4HX2A 1Y6ZA 4COOA 2CC2A 2M98A 3MMNA 2HJRA 1KXZA 3EHEA 1U4OA 4B3JA 1JEQA 5KHOC 4RUKA 3AVUA 1SHZA 2IUTA 3BE8A 3L9XA 4MQMA 2ZCUA 3RU7A 5AK5A 3DMRA 2H4HA 1PFGA 3DOOA 3I28A 4ZC8A 2AZMA 3C5EA 4OHRA 4BUJA 5H9WA 1C4XA 5FFMA 3ETLA 5SY4A 3TL2A 1N92A 4OJKA 4HJXA 3T7DA 1E9FA 1OW3B 5EINA 2IY9A 3CV3A 1HRKA 2WU8A 3LZDA 1O6GA 3H4IA 1L7MA 1BE1A 3GLHB 3K0EA 4TN5A 2DMRA 2OB2A 3PKZA 3TTUA 2LCFA 3JYNA 1NXWA 1J97A 1OZGA 3IP8A 4QPJC 4CLXA 2F1RA 3N2GA 5B3JC 2X9NA 2BFNA 3EXG2 4MS1B 4YJKA 2JIRA 5K3FB 4QT0A 3VO9A 1A4XA 1E9DA 4AYTA 3I4FA 1YZLA 1Z8HA 2YWXA 2BGGA 2B8EA 4BASA 3CPEA 4HXFB 1R66A 3E1SA 3BBLA 1L4YA 4NBRA 3IKLA 1XZDA 2Y71A 3H2ZA 5FHQA 2IYZA 2NXNA 4F3KA 3ASYA 5A0VA 1V7CA 4EENA 1I1QB 2XE8A 3C7DB 4MV9A 3ZLVA 4CVNA 2Q5OA 1T36A 1O94D 5AK4A 3ER6A 4UFNA 3D3EA 1E6EA 1KF0A 1U6IA 2YJTD 1QHSA 3IIIA 1N2BA 4OI0A 3K4HA 1WZEA 4LWZA 3FB4A 4X65B 1R16A 3IUNA 4IZHA 1WKCA 3MTGA 4M54A 1SKMA 4JKOA 3Q3IA 4FBMA 4EKEA 2UYOA 1XKXA 2JD2A 5L3QB 3RBZA 6AT1A 3RUAA 4HDKA 3IMGA 4DTIA 1PL6A 1CDDA 2A94A 2JDID 4IBOA 3R0QA 3D8HA 3TBKA 2P9QA 2C9BA 5LL6P 3E22A 1V48A 2NTJA 1BXRA 4GL2A 2FLKA 3A0RB 1ZL0A 4MYDA 1LVHA 5IKXA 3ZGZA 4XD7D 3K0AB 5H59A 3AP1A 1DWPA 3C7TA 4L22A 4TYPA 5BUCA 1A9QA 3THYA 5ITZB 3GHHA 1YK0A 1XNQB 3ZGOA 5BSRA 3OX3A 3DFIA 3CUWA 1LBSA 1ZSYA 1ZZGA 2OCIA 2R96A 4BVAA 4LGVA 3SJCA 3I2HA 1EP9A 3OZDA 3B9PA 2FZCA 1KAHA 3BFKA 5DULA 1UMDB 2A0KA 3OKFA 2I8CA 3BF8A 2WWIA 3A4VA 4LOKA 3CN9A 1OKKA 1P9WA 4WVFA 2IEIA 5CB4F 3R3UA 1Q77A 1QCDA 2HWUA 2UVPB 4JSTA 3W9BA 4XM2A 1H42A 3I1YA 2VO1A 4BY9E 1Z68A 1ISSA 5B12A 4GU5A 4EFDA 1H8HA 1VLVA 3B3QA 1IEQA 3KK0A 3PPXA 1RE1A 2JH9A 4LCEA 5HILA 3ZXIA 4DCMA 3S2UA 3OO0A 2BN4A 2OBBA 3DT8A 3OMWA 2VN8A 3RS3A 3U4DA 4DCPA 1K5HA 1MC8A 1RXWA 1ORHA 1D4OA 1QVVA 3FTDA 3ZI4A 4R5MA 4F84A 3WLMA 1E3JA 3ICVA 2GWHA 2AG5A 2VDMB 4TV8F 3PYLA 1DBPA 5FBVB 2UZ4A 2QMOA 1QPBA 1RYYA 5IDQA 2ZBDA 2PNJA 1L4MA 2XUDA 4BQQA 3UJBA 2BRUA 2N1BA 2G8LA 1NVMB 2CVFA 3T4UA 2E82A 2BM8A 3H6GA 3D31A 3OY7A 3QXCA 2F43B 1F0PA 1NJSA 1X80B 4PTLA 4F5WA 3KWMA 1IPHA 4L50A 3RVNA 1L9KA 5FORA 1U81A 4LRUA 4E22A 4F2HA 1SUWA 4MEJA 3GFPA 1B0PA 3HEMA 3UYKA 4CIDA 1QFXA 3CBGA 3TL3A 1XA0A 4W1RA 2G9VA 1GUDA 2Z2JA 1GL3A 3HDYA 5E6UB 4WT7A 5EHGA 4G25A 5TPWB 2ET6A 2IV7A 1QH1A 1RI4A 4BC1A 3ONNA 3SX4A 3R5HA 4F45A 5AVWA 1YR3A 3GOQA 4EJ0A 1G2PA 1KDOA 2PLFA 2REXB 4REQB 4JUFA 1CUCA 1IWOA 1AXRA 2AJBA 2QZSA 4OXYA 4N7MA 2AEMA 3QI7A 4F3RA 1E2NA 1E1CA 3GZJA 1P7WA 4HUJA 4JXKA 4LKOA 2JFVA 4NE9A 1KMHB 3QSYA 4IOKA 2VQ3A 4G6ZA 1WETA 2XWSA 1EJ2A 1FMCA 2HV9A 4G1BA 3U7GA 1NMZA 3V4RA 1NJ8A 5EP2A 3FR7A 1XKTA 2A9OA 4J4BA 1XEXA 1XZLA 3NCHA 1Z7GA 5BYKA 4OXNA 3QEOA 2PKQP 5F76A 2ZRIA 4GZLA 2Z6UA 4HZUB 5D5HA 2DUNA 3BFVA 5CK5A 4A8JC 3I61A 4AQ7A 4KFUA 4YQZA 2CEKA 4LMRA 1RAIA 1TKCA 2NVUA 1TYBE 2QRMA 4PQYA 1OBFO 2WFLB 2D4AA 3KCNA 3NWJA 1GL7A 4YAIA 2J48A 4I50A 3SIPA 1X77A 1HMPA 4B47A 4N1AA 4OGKA 4QHTA 4PC1A 3CH6A 1KFKB 3A36A 1IPEA 1VYHA 2CJWA 2QT0A 3DC2A 4AIRA 4BQFA 1FU8A 4CIAA 3GZNB 3JQ8B 5MFZA 4HEA1 5BYJA 4V24A 5A71A 2AZDA 4G1MB 1TZ2A 3DE2X 3QELA 1L5OA 3IIJA 1MEJA 3NBAA 4FFBA 2MHCA 4MQLA 4DLLA 2ODEA 4FHFA 1ODIA 3ZLUA 1I7PA 1E9AA 4BQOA 4M1WA 1VZ2A 2VDQB 3TNYA 4R9SA 4PW0A 2KJQA 3DFZA 4TS1A 3OCYA 3PFGA 3WJ7A 4FQ7A 4L0DA 2GJ4A 3B9RA 3NDPA 1T2NA 2I4NA 4TSFA 3R7WA 3WB0A 1P1KA 4EMSA 2NZWA 3LX6A 2VPXA 1R18A 3CNBA 3PPYA 4DYDA 1H9CA 4GYYA 2Z08A 1E9SA 5LD2C 2X2FA 2F90A 2NPIA 3RODA 3DOUA 4RFSA 5CP8A 1EHIA 3SX0A 2AC7A 1E58A 1QHYA 3A6HA 3OO1A 3ETEA 1SC6A 1BZYA 3HL0A 1MF7A 3ILSA 4MPPA 4DXDA 4KOEC 1XJ0A 3I34X 5HTKA 3R7AA 1SULA 4LYEA 1YT5A 3KD2A 1WV1A 1ZOOA 4J0QA 4NZPA 3ZI0A 1JDPA 5KDLA 1T35A 4WJZA 3EQ6A 3CLUC 4EG0A 3I04A 1NVVR 2EW1A 1JSZA 2P6NA 3FHOA 5D3QA 1QP8A 4U1RA 5EIOA 3RU9A 3W3ZB 1NVTA 3R5XA 3E3AA 3VNVA 4PLPA 4H6PA 2P41A 3T5DA 1PZMA 5JPIA 1G19A 1BE6A 1B76A 3QJGA 3RT9A 3UAZA 2CXUA 4WL0A 5CA0F 2O50A 1T9ZA 5AKIA 4N3NA 2PV0A 2G9ZA 2RK6A 4G5FA 3SQLA 5HJEA 4U39A 4YCNA 1PD0A 2EWWA 1P5RA 4HWSA 5FUMA 5IULC 2OKGA 3ANNA 3NONA 4YIHA 3B48A 1YKSA 3ZDQA 2ERYA 4BIMA 5KYXB 1XELA 2X0FA 4YUWA 4EHJA 1FRVA 2PQ6A 2B8NA 4KAAA 4NJMB 4BE4A 3GLVA 5IM4A 4IHJF 3TPFA 3KYIB 4LF6B 1KQ3A 2J41A 1B15A 1JHVA 4FFDA 1IJEA 1QRDA 1NPDA 2O1EA 2WM2A 3QFHA 3SF8B 3GIDA 2W6CX 4X9XA 2JLYA 1G6KA 5DXJA 4FINA 1QAQA 3KAKA 2HHJA 3B82A 4HS4A 1VLQA 1CERA 3R09A 2R3SA 3NHWA 1Z06A 1L3CA 4UBOA 4PVDA 2PIAA 1QP4A 3FPKA 1WR8A 5BSKA 4OHUA 5AKJA 4FDMA 3EFOA 5JANA 1RRPA 3EC2A 4XVHA 5LZ9A 5TLSA 1V8FA 2C20A 2V59A 4ZOLF 2YUIA 2PU5A 2LIPA 2XMBA 2KWIA 2BCGY 5CLLA 1MBZA 3FTQA 3ICPA 2PT5A 3ODPA 4M21A 3D54D 4PQEA 2J0VA 3R77A 3SLKA 4EY4A 3NRJA 4M76B 4IO0A 2OG1A 1QFSA 2HLDA 3I5YA 5LMNB 3T3HA 3M3PA 2IUSA 4EMUA 3FAZA 3I8SA 4TT8A 4DA6A 5JHGB 4IHQA 3GFOA 3LUHA 1C1XB 4ZRDA 4FCCA 1GY8A 2PGLA 2XNDA 5T8KA 5GONB 3L0OA 3VZDA 1HI9A 3DAGA 3TD6A 3FFWA 3WLTA 1VFNA 3N75A 4H7FA 4MLDA 5BPHA 1XRSB 1XI2A 2HC9A 3S2FA 2BKLA 1YB5A 4N01A 1M7GA 1DBIA 3PGMA 4BX0A 4GEGA 1KSGA 3KLNA 4UUOA 2P2SA 3AUKA 4BE7B 4MUMA 2PD3A 2IYWA 3L0ZA 3DZGA 3U7QA 4BN5A 1JMKC 3GJ4A 4HH3C 1VG1A 4BAZA 1I5EA 5FTKA 2UUPA 4Y2XA 4DCNA 4IXNA 5ANRB 1DEHA 3GRZA 3JARB 2OHGA 5DKFA 1REQB 4NE7A 2IH5A 1AB6A 1EUCA 2NSLA 3NUQA 4HNSA 1AE1A 3CLSD 4XGQA 3PRKE 1UXJA 2XGMA 5I8ZA 3DD1A 1DEKA 4FGUA 3NDIA 4GPEA 4NMMA 4WFIA 5FHRA 4EG7A 1O3YA 4YJ2B 3G1UA 2GN8A 5DGCA 2YZ7A 1U0SY 3PSHA 1N3BA 4PS0A 4DNXA 1Z74A 1VCMA 1ZQ9A 2ZYWX 3PE6A 4MAAA 2B0CA 1WS6A 3KUDA 2D5IA 2OLEA 5AM0A 3QVWA 3AV0B 4JS0A 3PJGA 2A67A 3AJ8A 5HK9A 5IFLA 5F78A 3ISJA 5IBCA 4AS1A 4X41A 2AVNA 2BY4A 2WK1A 3GAFA 3R4CA 2H5EA 5D6NA 4Z3DA 2FPPB 4H6WA 3MSXA 4A5SA 3GGPA 4CFYA 4JEMA 1B8UA 3BD8A 4TPKA 3VA7A 3ZD6A 2VEOA 1H05A 1CJUC 2NZYA 2WT8A 2C00A 4Y6RA 1YQWA 2BGTA 1P7CA 1IMOA 1FDIA 2WIKA 3PEEA 4NCHA 5WRFA 3RHZA 1IULA 3RW9A 3JQBA 2GPAA 1HNZB 4Y6OA 3P9QA 3V6MA 5C7YA 1YZYA 1ISPA 2W8BA 5T4FA 1JI0A 5KS2A 1T8TA 2LKCA 4XX0A 3P2IA 3ZXXA 3R3WA 4GR5A 2HXYA 1T9CA 2RARA 3KAPA 1JHAA 4U2BA 3TG2A 1J24A 1J1UA 2HNBA 4DEXA 1HQDA 2PL1A 2W2OA 3LJKA 1VL1A 2I6QA 5F52A 4UTRA 4JLSA 2JVKA 3V1LA 3UWKA 4BQRA 5CFOA 3HCWA 5AOCA 1G2QA 3BHIA 5HF6A 2XWJI 4CLOB 3L0YA 4KXVA 4OAOA 2BM1A 4EA8A 2R47A 4YAOA 4B84A 4OAQA 4NBUA 4H3KB 4HF7A 5T64A 3FOFC 3ZVLA 4RHFA 3KIPA 5TMPA 1O6BA 5LA6B 2JLZA 1N3IA 4RTJA 5IPFA 2CBZA 4PM4A 2B1GA 2I91A 4IMIB 3RASA 1YZVA 1ZCFA 3OPYA 4MUHA 5HIAA 4XB6B 1NATA 3KTFA 4D9HA 2D5BA 4M2LA 2FWNA 3OFSA 1QDLB 3DQPA 3KBOA 3WGUA 3MIIA 5H5JA 1UBGA 1XL1A 1W5SA 2YIDA 4C2AA 1ZGGA 5G0UA 5A3RA 4Z8YA 2TMDA 3SSOA 2JA1A 3OZUA 4GW3A 1XRJA 2VWHA 4XFKA 3DQQA 2XMDA 3KL4A 5JWRA 3FKJA 1RHJA 2VT3A 4XLLA 3VZSA 4B46A 3RBVA 4FNAA 3ANTA 4BUZA 3QH4A 2QROA 4F4DA 1EUYA 3C70A 4N0DA 4ZEMA 3K53A 1U4SA 3D64A 1KETA 1NWHA 5CIYA 2KLBA 2O6HA 3EDMA 2VDUE 3ZCPA 3T4XA 1TZCA 2HX1A 3GELA 1Z6GA 1YXMA 4LRSB 5M3BA 4K3UA 2HEIA 2OCKA 2VHYA 3AEQB 2QW0X 4C2BA 5I7RA 1SFRA 1T91A 3LP5A 1FP6A 5G41A 4DRYA 2ZS7A 2XMRA 3LQFA 3QU2A 5KQSA 3AVOA 3K0SA 5FI0B 2QRLA 3HYTA 1PRYA 2EX0A 3PDHA 5TF4A 4Y1GA 5JNSA 1X7XA 4A4DA 1VJTA 3AGPA 5EQTA 5DVZA 1ANKA 4B3BA 2JC3A 4JXXA 3O47A 3K6RA 2BR5A 1SXJA 1I1NA 3TTYA 3OZAA 4E94A 3SJAA 1JHDA 3OZTA 4OLJA 2NQ2C 3WYAA 5FV4A 5CDUA 1UCFA 3QX7A 4BRSA 4C7KA 4E4RA 4YRJA 4YRNA 1MABB 4KBYA 4AP9A 1NOIA 3DMNA 4XIIA 1Q57A 5TMEA 2DPMA 2A0XA 2CMDA 2IIBA 2ZITA 2ZRNA 3PQ5A 2P3QA 1YGPA 1DKLA 1QX4A 2VNIA 2NO1A 3E03A 2BE7A 4HGQA 4D4JA 4IX9A 3CU5A 2DOKA 3I2IA 3ZGVA 4MGYR 4CNBA 1IUOA 2Y3IA 4GICA 4EKGA 1JIIA 2F1OA 1Q14A 4NMHA 2VDKB 3I73A 4YUXA 2E87A 3F90A 2AQKA 3G7UA 1JU3A 1QXSA 1NNI1 2FZ5A 1IVNA 2WD7A 2WIAA 4KR9A 2ZB2A 3TQSA 3RUHA 3EQ7A 2O48X 3PFIA 3HCAA 1SVWA 4D92A 1MXFA 1YC2A 3QW4B 4OATA 1Y5MA 1G4HA 2GVDC 3AEYA 2ODQA 3JQ6A 2NP7A 2VAPA 1YNSA 2W2PA 1O95A 3FKSA 3M4JA 2HSJA 3R5FA 3RVDA 4DC0A 1YCFA 4DV7B 4J1QA 2AG6A 1XE3A 2OCGA 4LOAA 4Q9LA 3CTPA 4IH1A 2F3RA 4WLOA 1ESEA 2PZFA 4AJHA 5HZKA 5H4GA 1AU9A 1EZ4A 2Y1OA 3GLHA 5AJWA 4LVUA 4WBXC 4AJ1A 5LWQA 1TIKA 3P20A 2Y77A 4HFMA 3STVA 4FHCA 5A5VA 1W34A 4EFLA 1M2GA 4P3NA 1K7CA 3DE6X 4MS1A 5K3FA 3TJZA 1USWA 2FZGA 4FGJA 1GSHA 3QJ5A 3EODA 2Q1SA 4TTQA 3HBFA 3RNOA 1X94A 3FTFA 5J23A 3KT3A 2PA3A 5CNIA 5IAKA 2QR3A 3PQ7A 3WMRA 3VDRA 1AGRA 1C9NA 2B35A 2G1AA 1Z36A 3M1YA 3OZBA 2AJCA 4PZLA 3U2QA 4EW2A 1UZUA 4G0ZA 4MCIA 1JR3D 1EPUA 2ZJ6A 3BERA 2R7MA 3UQZA 5JAZA 3QV1A 2VHJA 2CLOB 5CT6A 2QP9X 2YJZA 4LIPD 2WSSA 1E8DA 2ZE7A 3M5WA 3ZCTA 4CMJA 4WJLA 1JR6A 1RM3A 4BUCA 1C8VB 1WX1A 4D8VA 4GLJA 3UPUA 1VSVA 1XTVA 1EA5A 1TLFA 2IZZA 2HT6A 2ZXEA 2DCUA 1THGA 2R6AA 3G7NA 1YMVA 4RLFA 1K06A 4NICA 5ENZA 4E15A 4K40A 2IYEA 4RIHA 1P2TA 1QX3A 2EQAA 3TOSA 4PNZA 4LJAA 3I6IA 4U8GA 4MW4A 4DQKA 1J2TA 1PT6A 3RCBA 3CNLA 4CG3A 4EMBA 1PWEA 3JWHA 3UK1A 3PEWA 2AB0A 2QMUA 4INJA 3HUFA 4KSCA 4RZ3A 3T3MB 2XMQA 4PO1A 1GPBA 4JBXA 2IXFA 3HXTA 3K94A 3HJFA 5HQTA 2VJCA 3LBIA 4WW0A 2CMGA 2R7LA 5G4KB 1Q3TA 1R2QA 3QYAA 1YR8A 3PHJA 3GUUA 1FBNA 1SZPA 1E89A 3V1MA 1ZRMA 3DSRA 3K0AA 4QC2A 5ALJA 3RFCA 1EXVA 5ALSA 4TZTA 4JHLA 4CM8B 3H3XA 4OLFA 5ITZA 3F46A 2OOSA 3PNBA 1E7WA 3WK9A 1EIZA 4G0PA 4FP9A 1IN8A 1NY6A 4BZXA 3FJYA 3THRA 5CNMA 4DLYA 4ENQA 1EP3B 4ER6A 1UMDA 2D7CA 5CTJA 5TX7A 2FN7A 4MKHA 3M1LA 2BW0A 4FHZA 4PLGA 4R68A 4GL4A 4URWR 2V0CA 5LUBA 3RPEA 4NFSA 2UVPA 1TZMA 1OQAA 2R2AA 3CVXA 3EMDA 2UVQA 1E63A 2RH4A 1X14A 4R3NA 3C8MA 4RFVA 4FMDF 1SUDA 2C8VA 3RFUA 4EUKA 2RGYA 4U0JA 3B38A 1GL6A 5JYCA 4E09A 5BWCA 4MIEA 2HA3A 3KVOA 2QRUA 2VOEA 3LDUA 5A3QA 1RXIA 3M6LA 1B43A 2QKYA 4NIMA 1HV8A 1TIBA 3G68A 2HXGA 3AQ4A 3CNHA 4A26A 1D4ZA 1EFRD 4UCFA 1N8TA 1Q22A 4YV2A 1ENOA 3H2YA 4A1OA 3ZDEA 1O87A 2AWNA 2X0KA 1HNXB 1CP3A 3CLUD 4LDNA 1XNRB 1XLWA 4R1PA 4V39A 5DHRA 4Y6LA 2QD4A 5J63A 1OFVA 3EHDA 4EFMA 4F6RB 5JU6A 2FUNB 2LDBA 4NONA 4CTJA 3FDFA 4C4RA 1NUHA 2F43A 2Y1CA 3H75A 1X80A 3LGSA 4JQZA 5HDQA 4AX4A 4BS9A 4D5EA 3LW8A 5J4KA 1NJ6A 1QIJA 2JIZD 4NQZA 1LY1A 5AYVA 2LKDA 2CL7X 3WGIA 5J4VA 3LRPA 4QGGA 1K0UA 3JSXA 3O38A 5FPTA 4AMZA 3S0JA 5CR9A 4GVPA 1HOXA 2PU7A 1UBHS 1KQPA 1ZD2P 4NZNA 5FYDA 2Y1XA 3EEIA 5F51A 3K70C 3EUWA 4FYJA 5E6UA 2VYND 5TPWA 1AC5A 3BYZA 3E5NA 5KOHB 4L74A 1LF5A 4JI2B 2JZNA 5D1NA 3Q8MA 2XX3A 1K4KA 3IBCA 1ID1A 4G1EB 4M7OA 4X1IB 3EH1A 3WBFA 2HSWA 3NH9A 1R50A 3U7RA 4FNGA 4BX3A 1DAIA 4REQA 2ZATA 3VYVA 2FW7A 3HV0A 2QVYX 3CVWA 2QRPA 5JCOA 2OQRA 2XNSA 5DNVA 1A5TA 1KMHA 4QYTA 1XK6A 2HHCA 3K0CA 3CWCA 2PTHA 3FUWA 1L1FA 2HQRA 4WK6A 2Z4RA 1GYRA 1WY7A 3BB3A 4IM7A 1F7VA 1GO2A 2V96A 1GARA 4HQ0A 1BX3A 2QG4A 2ZAMA 1BCRB 2B1JA 2GMWA 4HZUA 4UVIA 1Z73A 4KGVA 3HCBA 2HIAA 2HFKA 2ZAOA 3SM9A 3EUFA 1D2RA 1CULC 4FHDA 4Y98A 2RHHA 1QH0A 2GVNA 1JG4A 3G9UA 3MOGA 5DBOA 3TLKA 3NFRA 3PUIA 2WFLA 4ETMA 4JZYA 2B5OA 1VPEA 1JR3E 4A8JB 2IKQA 3HZHA 1ONPA 1WMFA 1MIOA 4HUQB 4CM9D 5ALNA 1WTAA 3QLTA 4F92B 2QJTA 2YH2A 3H1GA 1L8QA 2OVBA 1S2DA 3HBAA 4KQ1A 2JDIA 1CUDA 5D3ZA 1GPYA 3MJTA 4WZ6A 3BZBA 5H0IA 3ZYZA 3EA5A 3GZNA 3JQ8A 2KYRA 4ETWA 1RW4A 1RR6A 4OVKA 1Y9EA 2EFJA 2ST1A 2NLOA 2R6R1 4IRMA 4NZ9A 4Q7JB 1HNWB 4KPUB 4XD7A 1OA0A 2JFZA 5ITVA 5IYZF 1A8HA 2XB6A 3GJ7A 1SCQA 1USGA 2WMNB 3J7TA 2PUEA 1SXGA 4RMGA 2WSYB 1DAOA 3SXJA 2W4IA 3DULA 3MXOA 3OE4A 4GOMD 4X71A 5TQ2B 3UUWA 3DDWA 4R0MA 3I5UA 4EO4A 2E0IA 1DIGA 1ECBA 4OXRA 4NYJQ 4CW7A 4NOJA 5JARA 3DS8A 1VL6A 3DDSA 5LDGA 1VIAA 4H0NA 4GX0A 3TEJA 5M7EA 3LQ1A 4Q7QA 1QB8A 1M66A 2UZIR 4M87A 5TDHA 2X3FA 1ZXBA 1GZ6A 1FEZA 3K1JA 3KZOA 4O4HF 1GTG1 2P40A 3CZRA 3TIIA 5BRAA 5LD2B 1D8AA 2HA5A 3SZRA 3ZGYA 3SE0A 4YUZA 1JLKA 2NXJA 2WJVA 2CYAA 1UKEA 3WGGA 4KE8A 4IEFB 1XB2A 3R44A 4IXDA 5DM1A 3ITNA 5EHZA 3A1SA 1CDEA 2FJ0A 1X3LA 4UXIA 1GDHA 1F60A 1RYNA 1SRRA 1Z6TA 3X1MA 2RHGB 1Y7HA 2PKCA 3X0DA 3ZH9B 1W4RA 1P0PA 5DLYA 4Q6BA 2DH6A 3ACDA 3LKZA 2QGFA 4DG5A 4TVSA 2AYZA 2PX5A 4XVUA 1TGVA 4XDZA 4DQDA 5JNVA 7MDHA 3RRJA 1WBDA 3LU1A 1M8FA 2QY9A 1YRQA 3FOAA 1U3GA 2W6JD 2WZBA 1GEEA 1GAEO 5HKAA 1TYZA 1YCHA 3W0LB 2QXYA 3B7GA 3VPFA 1U2DC 4V0NA 1TOAA 1ZEJA 4WI1A 3C1OA 3RHSA 4QUIA 3RH0A 3JQEA 2QSJA 3BIWA 3AMVA 4KWHA 4YWJA 4EA9A 3ANSA 5JVDB 1ZY2A 5KYXA 4NJMA 2B78A 2HCRA 1FJHA 2ORIA 3BXZA 3NEPX 3DL2A 4JLDA 3P9XA 1IZYA 1N7JA 1ZVMA 2DQZA 2RAPA 5IUNC 4DR2B 4PGMA 4NK5A 3P2JA 1Y1QA 4PAOA 4GI3A 4LC0A 1LPMA 2IYYA 5EMNA 1CQIB 4D42A 1K8RA 2REBA 4QEKA 1A3CA 5HS6A 3X1JA 3SF8A 4MJ7A 4UFPA 2HEGA 3VR5A 5KNCA 3M3DA 3Q9NA 5GM1A 1PJ4A 2P11A 3SSNA 3U1VA 2C4VA 2FP3A 1FLVA 4QRIA 5KVCA 1NDHA 4EJFA 1HDGO 4YQYA 3F7NA 2Z9BA 1Z15A 2I8AA 1ZRNA 2IYTA 2QJFA 2ZB4A 2FEOA 3CNNA 3MMZA 3D3JA 1WDMA 2P79A 4J2TA 4YJGB 2LCQA 1HDEA 1ZIDA 1RQ7A 5KJFA 3I6ZA 4M46A 4IV5A 5IKOA 4A10A 4YT8A 5JMTA 1JHQA 1B73A 2KB0A 2G0AA 2X4LA 3GJ8A 2AXNA 1H1DA 1TO2E 4MV8A 5K0CA 4ZANA 3DH0A 3EXAA 1EAYA 4KYTA 3GFRA 2QXUA 1Z33A 3OE1A 3T1YB 1OC4A 2IS4A 1JYFA 4ZVVA 3ZBUA 5ICCA 2BKUA 3F1KA 3IQDB 3ZJ4A 3FDZB 4FJ1A 3U16A 2VJLA 3L04A 2WYHA 3GJSA 1UPTA 4DDMA 1UPBA 4PQGA 4D9NA 1F4VA 1C1XA 2P65A 3O0TA 4XFDA 4ZVOA 3OKCA 4BEWA 4P0QB 3N53A 5GONA 1H2BA 1IDN1 1HLDA 1BA3A 1UFOA 2FQ1A 3UWSA 5M5BA 4OIMA 1Q1EA 1GNRA 1Z6YA 1NXVA 2YDYA 1U8ZA 2H52A 3WNBA 4EYGA 1NJ2A 2WHXA 4PFKA 4DRZA 2VL7A 3UKJA 5JZMA 2CLIB 1HFKA 4UNNA 3PI6A 3EVGA 3UMGA 3O9MA 3FROA 1CKEA 1XQ1A 2R5FA 4Q3AA 4Q3NA 4TLAA 1GIAA 2W2KA 1XZMA 2QENA 2IWRA 3V80A 4NK4A 3Q2KA 3WJ1A 4BTVA 4P7KA 3JR3A 2PKYX 3NW9A 2IEYA 1OXSC 1TU0A 4GWKA 1IL0A 2QT9A 3JARA 1REQA 3HLTA 3H2IA 3TTVA 1E3LA 1VRWA 2RGUA 4ID9A 2WFZA 1OUMA 1XJQA 1T1IA 4KXQA 2LPMA 5E2AA 3C85A 1M34E 3HQ4O 2ZJ3A 3GARA 1W49A 4RPGA 1ZDMA 3F6PA 1B41A 4C0JA 4YJ2A 4WA7A 3K92A 5H70A 5LC1A 1TM4E 3V33A 5JNUA 3A2MA 4V0KA 4F3NA 1H5UA 3ETHA 4KWCA 4IXTA 1MNQA 5KREA 2JARA 2HGZA 2JCVA 2BFCB 5B57C 5JPCA 1WXDA 3M89A 1AGYA 1R0SA 5FB3A 3ZY6A 2FPPA 4RWZA 3VR2D 2P67A 1H4TA 1NT2A 3ORYA 5C51B 1H8ED 3EGWA 2QM7A 3EUAA 5AXDA 3ZJVA 1NNUA 1YBHA 1AQ6A 4FMBB 2VXOA 1MC4A 1PZHA 2BL4A 3M1IA 4RY0A 3UT5B 3VH3A 5TARA 4D9JA 1AQIA 1CF4A 5LM3A 1U1EA 1DAEA 4BQSA 1P4HA 1AZLA 1YB6A 3MHTA 2Z98A 3P9ZA 2BC9A 4HNAB 4RPIA 3ES9A 2QL6A 3KQHA 1VLHA 4NMXB 3SLGA 4CMGA 4EJSC 1L4UA 1E9CA 3EIXA 5IZCA 1SKAA 1UBSB 1MG0A 4YUVA 3T5PA 2QTAA 4ZT7A 5EXTA 2JIOA 3O4GA 1BMDA 3U7IA 2OA0A 1I2CA 2R6FA 5TXGA 2AT1A 4KH0A 1KC3A 4GWLA 4KRFA 4WOPA 1O97C 3WGYA 3VH1A 2PWYA 3F9CA 3O5AA 1CUXA 2VSQA 4IJWA 4D3ZA 4CLOA 1OWOA 1Z4MA 3U7JA 2ZJ2A 4XE5A 2FW8A 4EHIA 3VDNB 2PGAA 3SU8A 1YF3A 3RK1A 4MUFA 4X60A 3TBFA 4NCKA 5LA6A 3UTCA 2J3IA 1X15A 1GKIA 1L7AA 2YHAA 2FWMX 1J56A 3CT4A 3JVVA 3OX2A 1FP2A 1W2HA 4I81A 3WQRA 1W1UA 4XARA 3IVMA 8MHTA 1PNRA 4MSUA 1W93A 4ECAA 1ZO8A 3VAAA 5DI3B 1BMQA 3ZHOA 1U6JA 5AIAA 5DLQC 4IQ0A 1JZTA 1UKAA 1I01A 1V39A 4BFUA 1RVV1 4D56A 2D74A 2GZSA 4EYKA 4ARIA 2D2XA 1HT0A 1T5TA 3MJRA 2R97A 4JGGA 3ZY5A 3FFAA 3QBEA 1GR0A 2DUJA 2W2QA 2XTAA 3KSMA 4TLLB 4FW9A 1PI3A 1PGOA 5HFNA 3T1NA 2ZREA 2FOIA 3DMTC 3DHEA 2X1HA 3BRSA 4YT2A 1GVHA 4J7CA 1FTSA 3EPLA 2R751 2Y6VA 4R16A 3ROQA 2R00A 1VYUA 1PSDA 4DNFA 2JGEA 1M2OB 3EIEA 4DR7B 1R0RE 3U80A 5AFSA 2YJ5A 3WZMA 1JE1A 3AEQA 2GRUA 2Q0XA 3BAZA 5GY7A 3SF0A 2HB6A 4NI5A 3V8QA 4DM3A 4TWAA 1LDNA 4GR9A 1AS2A 2BTEA 4BEVA 2B1IA 4PPFA 2J7PD 2O4CA 3AYXB 5HG0A 2WQZA 4D25A 1X42A 2A5GA 5BUSA 5I7HA 1KAQA 4C43A 4L3WA 1Q50A 1V41E 2GEFA 3D0RA 1H6CA 1FJGB 4GC5A 1RZVA 2YWHA 2EZ4A 1E6MA 1GNSA 1LU9A 2NO5A 3OSUA 4FU0A 1G4AE 1K9VF 2PUVA 2FZEA 3WP1B 3RI3A 1GYPA 2BCJQ 4N7BA 4B87A 3FLMA 3JWGA 3M4YA 1AKVA 2FG6C 5B4UA 3ZNQA 1WMDA 1MABA 2UZAA 3ASUA 1A88A 2V45A 3CONA 2HWKA 3QV2A 3STWA 3CPJB 4BBAA 3W8EA 2E5LB 3LLMA 3S5JA 4F85A 1IK6A 1VZ3A 5ALQA 2RMKA 3DB2A 1X87A 1G64A 2F3UA 4QXQA 4U7PB 3TH5A 2OO7A 3V3KA 1AQJA 1XPRA 2ENUA 3AUAA 3JQCA 4IIGA 4BV2A 3IOEA 1WP9A 4LS3A 1Y82A 3ZI7A 221PA 3I23A 3V8RA 4B81A 2YOGA 3KSUA 2IBSA 1JHPA 4UEKA 2WFAA 4J0DA 1NT4A 3IPCA 5DX1A 1ZD3A 4DBLC 3CKLA 4O4LF 3RTCA 3WRXC 4DSUA 1XDDA 1BMFA 4JJ6A 3KAJA 4M1KA 2PVPA 3U0BA 3MJEA 1NQVA 2C3UA 3I5AA 2E2WA 1CZUA 4NOLA 1T2DA 3DG9A 4FGZA 5FWNA 1W36C 2PFSA 1JR4A 1X38A 1Y3DE 3MCAA 3ANYB 1ZJ4A 3LSYA 4ME6A 4LBZA 1V3TA 1XZEA 3MIZA 4U3JB 3WFZA 4YROA 3KETA 4WLVA 1XROA 3G8DA 2JFHA 5REQB 1EJBA 3I45A 4TVKA 4C03A 1IBKB 1XQYA 4BX9A 1HETA 4JODA 1RC1A 3C24A 5BN3B 3QIAA 1FXWF 3OD1A 4E3ZA 2C59A 2ZYUX 2X0DA 3PJEA 4ZREA 3OZSA 5JXJA 1QNFA 2IHKA 1BGXT 3LPLA 3FPFA 1JG1A 2KBEA 3N2LA 1YB4A 4OTZA 1WD7A 3HY6A 2R6CA 2PUJA 3O94A 5B3JA 4MDYA 2ATVA 3BQ9A 4BVGA 4EG1A 4EAQA 2VK1A 2H2WA 2AFHE 3PC7A 2CN1A 5E95A 4LJ4A 4DJ5X 4CL8A 1G5IA 4KG7A 3WS7A 3A6PC 5ER9A 3DV2A 5A62A 1QVZA 2XRFA 2C4TA 3G0DA 5ECGC 4JFAA 3Q6IA 4GPTA 1WCWA 2Q07A 2QN2A 4RZUA 3ZTWA 1BS9A 4RBNA 1TLTA 4OHZA 5ULLA 3BAFA 3H7IA 4JOCA 3A7EA 4RVOA 5AKZA 3WBJA 2BEKA 2PZEA 3AFIA 3HGMA 4GI5A 1WOMA 1GAQA 3RQSA 1H0SA 5F7ZA 4LZLA 1XXHB 1FFHA 5HYVA 4MMYB 4KYVA 1XDBA 3PGJA 1YVEI 4HDAA 5F2NA 2GZDA 2GTIA 3L7KA 5HOEA 2JI7A 1G8SA 1DDIA 2HIHA 3CH7A 1C50A 3V2IA 4UUMA 4UUQA 3OCWA 3ZJ5A 5G4KA 3CZMA 4JI6B 5DTEA 1I7LA 1ZP6A 1W4LA 1HDYA 2FRXA 2R9VA 1P45A 3P52A<