3WR5A

Structural basis on the efficient co2 reduction of acidophilic formate dehydrogenase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
401
structure length
401
Chain Sequence
b'AMGSMAKILCVLYDDPVDGYPKTYARDDLPKIDHYPGGQTLPTPKAIDFTPGQLLGSVSGELGLRKYLEANGHTFVVTSDKDGPDSVFEKELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHVDLQSAIDRGITVAEVTYCNSISVAEHVVMMILGLVRNYIPSHDWARKGGWNIADCVEHSYDLEGMTVGSVAAGRIGLAVLRRLAPFDVKLHYTDRHRLPEAVEKELGLVWHDTREDMYPHCDVVTLNVPLHPETEHMINDETLKLFKRGAYIVNTARGKLADRDAIVRAIESGQLAGYAGDVWFPQPAPKDHPWRTMKWEGMTPHISGTSLSAQARYAAGTREILECFFEGRPIRDEYLIVQGGALAGTGAHSYSKGNATGGSEEAAKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formate dehydrogenase
molecule tags Oxidoreductase
source organism Thiobacillus
publication title Structural basis on the efficient CO2 reduction of acidophilic formate dehydrogenase
rcsb
total genus 137
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.2: Transferred entry: 1.17.1.9.
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A01
3U4HA 5GZ3A 3UFXA 3LC1O 3V2GA 1TVEA 4W9NC 2G5CA 4KMSA 3K2EA 2V6FA 2WE7A 2E37A 1KC1A 9LDBA 2Y1OA 3KOUA 4UULA 1RJWA 3AY3A 4CV2A 5DBGA 2JCVA 4YAEA 4XIYA 5JO0A 3HDHA 4XQEA 4MVJF 4MP6A 3P19A 1QXSA 5IDWA 2J3IA 4WUVA 5C7OO 5ADHA 1H9AA 4E5KA 1JKIA 1SPXA 3H2ZA 3FR8A 4KZPA 2OBYA 2O7QA 1PGPA 4YJFB 5JYDA 2UV8A 2CY0A 3G1UA 1DHRA 4J2OA 4URFA 5ENDA 3BHIA 1DIRA 5DT9A 1E6WA 3C85A 3I6IA 4J16A 3IJPA 4CMBA 4PIVA 4A03A 2JCXA 1P1RA 3DAFA 4ZVVA 2GGSA 1D4FA 2CDBA 4LGVA 5THQA 1BXKA 3R1IA 3NDJA 1G1AA 2A9FA 3H9EO 2P91A 1K2WA 2W98A 5B37A 3UOGA 4KUGA 2RH4A 3KSZO 4DGSA 3I9MA 3WS7A 1LDMA 1VKNA 3OECA 1EZ4A 3ZNOA 3AW9A 1QV7A 1VRWA 1YGYA 3ON5A 4FOOA 2AE2A 3PZBA 3WIEA 2OFPA 1VC2A 3JQ9C 2ZKLA 2C2XA 3GAFA 3W8DA 3AU8A 3KV3O 5JCXA 1PJ4A 1YBAA 4P4GA 2NTVA 1LC3A 4LMPA 5IDYA 4IIUA 1UR5A 3GA0A 1RYDA 2EEZA 2VZ8A 3JQAD 3HB5X 4FOSA 4DLLA 1I5RA 4J4BA 2UVDA 3JQDA 4UVHA 1FDWA 1PX0A 2EKPA 4UVIA 3W4JA 3H65A 2EGGA 2HAEA 5L7YA 4N54A 3WFJA 1UZNA 1B2LA 2Y67A 1KVRA 5C7LO 5DBFA 3CMCO 1ZCJA 5EIOA 3BYZA 3OIDA 1JTVA 3OIFA 5CEJA 1PL7A 1XELA 4FJ2A 2OXIA 5ITVA 2YQ4A 3ADPA 1DOHA 4YR9A 1TT5B 4CM1A 2XXBA 1PS9A 2VT2A 1MFZA 5DN9A 5A9RA 1PJ3A 2X0RA 5KJ6A 3GH3A 4A7PA 3LF2A 1DEHA 4IJUA 3R0IA 4CMHA 1PSDA 2YV2A 4LW8A 3AY7A 1DLJA 1DRVA 2R2GA 4YQYA 5HWSA 3QY9A 1KVTA 4M55A 5BSHA 2HU2A 2ZB3A 4Y6SA 4AJ1A 4GQAA 3UCXA 5BR7A 3JQAA 1D1SA 4IS3A 3NJ8A 1SEVA 5BNTA 3SVTA 1X13A 2JFHA 3SXPA 1X14A 2BELA 3ETDA 3G79A 2AEMA 1U5AA 4DWVA 2E4AA 3S1LA 3ZHYA 1JQBA 3NEPX 3WQRA 2WYUA 3WNQA 3AI2A 5KVVA 4YAKA 1U3VA 2ZK7A 1LSSA 3I5MA 4B3JA 4PLZA 1K6XA 3HG7A 3L4BA 3HN2A 4BNYA 3EK2A 1OFGA 2DC1A 3GN2A 3GZ4A 3UW3A 4U0KA 3NDRA 4CM3A 1GAEO 3KYCB 4AJ4A 3GNQA 2AQHA 1D7OA 4L75A 1KOLA 4U0JA 2Q1TA 3U62A 4YYZA 3Q2IA 2AQKA 3UKOA 1BVRA 3WLFA 2Q2VA 5CG1A 1UP6A 3GDGA 1NPTO 2YHIA 1PL8A 5T8KA 5KKAA 3C3XA 1ZUD1 1BWSA 2Y0DA 1F14A 4IZHA 4NMHA 4OO3A 1NQTA 2FWMX 4TRMA 4GKVA 4OXKA 4FC6A 5K9ZA 4TMFA 2NTNA 3GMDA 3OQ6A 1O0SA 1R66A 3DHNA 4ALNA 3HUDA 3FTNA 1NHWA 4XCVA 3BMQA 3TZQA 4IDAA 1IPFA 1ZZEA 2YW9A 4TROA 1I36A 2CVOA 4MVJD 3K96A 3RBVA 4CL8A 2I66A 4DPLA 1NXQA 3RUEA 1WDMA 3U0BA 2NACA 3JQ8A 3JQEA 5KOIA 3DDNA 3H5NA 1VKOA 2A4KA 2W2KB 4D44A 4D79A 4MVJE 4BO7A 4HV4A 3JYLA 2NVUB 3AK4A 1HYEA 1LSOA 3EZYA 1VJ1A 5IXYA 4L4SA 1WZEA 3HNPA 2NV6A 4OGWA 4IINA 3GC6A 4BNHA 2B37A 1OMOA 1HSZA 1D8AA 2NTJA 1GTMA 2DTEA 5FFFA 3W1VA 1ZXLA 3AUUA 3IL2A 2GCGA 2QZZA 4PGFA 2GNAA 1QYVA 2P68A 3BXXA 1C0KA 3FPLA 4NFYA 3RU9A 2PWZA 2VWGA 3L4SO 1JVSA 5DCWA 4IDBA 5L95A 2B0JA 1MGOA 1R37A 5COBA 2PZKA 4CV1A 3OMLA 1YONA 2BI8A 2PGLA 3PIDA 2CDAA 2VRCA 3EYWA 2Y05A 4I9UA 1GY8A 4XYEA 4JBGA 1HKUA 2D4AA 1QP8A 4XEHA 3P2YA 4Y67A 3DQPA 1P45A 5J23A 5A06A 1P0FA 2DAPA 2HRBA 4AJOA 5KJEA 1G0NA 4P4LA 2GERA 3R3JA 5G0UA 1ENZA 2Z95A 2QRJA 1E0DA 4PVCA 3DBRA 4RORA 1P44A 1UXJA 2X5KO 4XX0A 4II2A 2X0NA 1QORA 2IEDA 2WYWA 4WECA 3L6OO 5I7VA 4MKZA 3EAGA 1E6EA 3JQFC 2DTXA 2VHVA 1T2AA 4QECA 2P5UA 3QSGA 4PN3A 1SZJG 1PQUA 2RAFA 1QLHA 2Q1SA 1DBVO 5I8WA 2E48A 3IJRA 3LT0A 3OF2A 1PU2A 1H6DA 3MWDB 4JGBA 4ZD6A 3A4VA 2HMSA 3GEGA 1QMGA 2DQ4A 4UUPA 3NTQA 5FWNA 2ZTLA 3ZNQA 4DIBA 2YDXA 3GT0A 2HK9A 5JBIA 1P1IA 1F06A 1RWBA 4FW8A 1WDLA 4E5YA 4J1SA 1XWFA 4PLPA 3CMMA 5ER9A 3EUWA 4XGNA 4Q3CA 1T2DA 3TJRA 1ZK4A 3MCVA 1GYQA 2FPPA 2X8LA 1E3SA 1Y81A 1TA4A 3IIEA 4OKNA 4PLHA 2X6TA 3FSRA 2O4CA 3WOHA 4R5HA 1QYCA 3BHJA 4YVFA 5ENVA 3LZ6A 2DBRA 2QX7A 3JQ8B 1ISFA 1WVGA 4KP7A 2EP7A 1GFSA 2PTGA 1C1XA 3QIVA 3LVFO 1B0AA 1D1TA 1W6UA 1DB3A 3ST7A 5AVOA 3QRWA 3ZU3A 4E33A 5IDQA 2JHFA 1X1EA 3IAHA 5BT9A 3TF5A 4ALIA 3PYMA 5TF4A 2JKVA 4BNJA 2R00C 4CUKA 5KVCA 4NK4A 1YB4A 4O6VA 3JQAB 3GRKA 3ONDA 1AGNA 1DIAA 1HYHA 2QW8A 1JW9B 4ZQEA 1O94A 2E82A 1XIVA 5TT0A 3I6QA 2ET6A 2X86A 3I3OA 5DF1A 5C5IA 4CQLB 1HT0A 1C0LA 3O8QB 4JNKA 4CV3A 4BVAA 4UVDA 1HWYA 1R4MA 4ND2A 1E3EA 4R5MA 5A5FA 1M2WA 4A2CA 4JK3A 3JD3A 1EQUA 1U8XX 1UXIA 2EW8A 4F45A 3QVWA 1JVBA 4R68A 2AEJA 2GUGA 3KETA 2IZZA 1P77A 2B5VA 1E3IA 1LTHR 2VTEA 5KWEA 1GUYA 1ZJYA 1E92A 4CL3A 3NUGA 1PGNA 1FMCA 3O8QA 1LC0A 1MC4A 2VWHA 2YHIB 5FF9A 4QEDA 3QVSA 3QJ5A 1GV0A 3PLNA 1GZ3A 3H7AA 1E5LA 2HQ1A 3CZMA 4HNHA 4DREA 5B4VA 3GGGA 1IB6A 4LISA 3GGOA 4KWIA 4CMCA 3DMTC 4J7CA 1I3NA 1I3MA 4ZU3A 3IKTA 3WICA 2I5PO 2UUPA 4A73A 3M1LA 4Z9FA 4J9VA 1UDAA 3D5QA 3ROPA 5K6AA 4BIIA 2PK3A 1ZJZA 3P2OA 4W99A 3FNFA 3F5SA 1AE1A 2NADA 5EQFA 2OGUA 1FDSA 1BDMA 2LDXA 1PGQA 2EG9A 2NSDA 4BO9A 5ER6A 1Y8QA 1PEDA 4CM6A 1IPEA 1YQXA 4E5MA 2NUAA 1LI4A 4BGVA 5H83A 2Q4BA 4CR8A 2A35A 4RO0A 1H6CA 5LDGA 4DBVO 2D1YA 4YJHB 5EQDA 4QUKA 1E3JA 1K89A 4M54A 3JD0A 3KLPX 2PH5A 2Q2WA 4GMFA 3VVBA 3M2PA 1D3AA 2Q46A 4PLGA 1A27A 2X22A 2HO5A 1OAAA 1V0JA 3VTFA 1X0VA 2UAGA 4EUEA 3NT2A 1F12A 3BMNB 1P74A 4J7XA 4WNCA 1B8VA 4J0FA 3KM0A 4GX2A 1R4NB 1ZBQA 4FBGA 5KKCA 2WE8A 3GVHA 2O3UA 3PIIA 1DAOA 3QWHA 2JCYA 3C7AA 1YOVB 4Q39A 4R1TA 2A92A 4K9DA 4BQPA 5B4TA 4BNWA 4A27A 3WGYA 4IQ0A 3BAZA 3VAZA 4LVUA 4MVJA 4BKPA 4L4XA 1UP4A 5EL0A 4XDYA 1VSVA 2IODA 4U7WA 2OHXA 3PRJA 1HZZA 3TWOA 2ZATA 5EN4A 5KVQA 1CJCA 2BFPA 4S3MA 4W7IA 3I52A 4GH5A 1HEUA 5JYEA 1BTOA 2X7HA 3DZHA 5I9MA 5HTOA 2OZPA 4PZCA 4OHUA 5MDHA 5BSEA 3JD1A 1U7HA 4YT4A 3DZGA 3I83A 4YT2A 2J5KA 3AUAA 4ZJUA 4TKLA 4BOYA 3JQCA 4RLHA 4CMAA 2DFDA 3QLJA 4XYBA 3IKVA 1E7SA 1I0ZA 4E5PA 5CFZA 4N5LA 1EDOA 1GCUA 1O6ZA 2X5JO 2XPCA 3GNTA 2YYYA 3HE3A 3OP4A 4O63O 4Y98A 3PXXA 2WEKA 4AG3A 6LDHA 2D59A 3FWNA 4DBZA 4B3HA 4M87A 1UJMA 1FXSA 3PJGA 3EZLA 4A5OA 4KTVE 4BV8A 4UEOA 3OBBA 5JNLA 1P1HA 3MTGA 2O3TA 5I9NA 2Q50A 3IOYA 3COSA 4RF5A 3D1LA 1TB4A 2PR2A 5L51A 4R01A 3F6YA 1B3BA 4IQ8A 1H94A 1NFFA 1E7MA 5IZCA 1WAMA 2X9GA 2HRZA 1SOVA 2YV3A 1U2DA 4Y6PA 3H9GA 5AXBA 1Q1NA 4EEXA 3OH8A 1NM5A 2FPGA 1YWGO 4ZQHA 4BGEA 1M67A 3DWFA 5CDUA 3MEQA 4IDFA 1YBMA 3HHPA 4WLNA 3QWFA 1MXFA 2VOJA 4O1MA 1BMDA 1JAYA 2Q1WA 3D3WA 3DO5A 2C54A 4D3FA 5DNAA 4PG5A 1MA0A 3JQFA 2GLXA 1LEHA 1LQUA 4MVJI 5F5NA 4KOAA 5G0TA 1HLDA 5A3VA 3VZSA 4ZICA 1ONPA 1HDGO 2EKLA 5JCJA 3F1LA 3FD8A 1P1KA 1CEQA 1T1SA 3E1KA 3GUCA 1A9ZA 4YQZA 4GKBA 5JS6A 2QHXA 5A1TA 4DMMA 1PZFA 5IXSA 5HBRA 4IPTA 1YH3A 5JAIA 4CM9A 3ZWYA 3ULKA 1M75A 1HL3A 3D7LA 1BG6A 3MJCA 2GN8A 4F6CA 1C0PA 4AJKA 4CLEA 3QWIA 1LDGA 3HQ4O 4AJHA 1ULSA 1IHYA 4QFCA 3OIGA 5HS6A 2GASA 4OIMA 2PV7A 4QSMA 3AUSA 2HDHA 4D45A 4EJ0A 3GY0A 2UDPA 4GLOA 2EW2A 1PWZA 1AUPA 2R00A 3CXRA 3P7MA 2BGMA 2WTBA 1XEAA 3JQ7A 5DDIP 1BXGA 1T2CA 4HY3A 2E6UX 3DOOA 1HE4A 1XG5A 4XYGA 4YJGB 3RWBA 2BGLA 1WMBA 4CM8A 2WD7B 4Q3NA 4GVXA 1PR9A 3DMTA 5GZ1A 3LT1A 3RCBA 5GMOA 2Y68A 3B6ZA 3DAPA 2D2IA 4ID9A 1PTJA 2D5CA 2H9IA 3VC7A 5KIAA 3GUYA 3MTJA 1PJLA 1S7CA 1LLQA 1XU9A 3AUTA 3KHUA 4XYMA 5G0WA 3DHEA 3S2IA 5HM8A 3TFOA 4YJHA 2OL4A 1KVQA 3QP9A 4CUJA 2IZ1A 4MKXA 3PFWO 1PZEA 5CDSA 3ZW9A 1DLIA 2X0IA 5COQA 2P4HX 2W90A 2G82A 1GADO 1M76A 2D5AA 4O0LA 4CMIB 5A02A 3RUHA 4H7PA 1UDBA 1KIFA 3JQBC 1XDWA 1VL8A 4B7XA 4E0BA 1RM0A 4J43A 1Y1PA 4M89A 2O48X 2B36A 1EUZA 5ITWA 5L4SA 4GSLA 5JY1A 1R15A 2HK8A 4E6PA 2HMUA 3A28A 4OQZA 4E2ZA 4IGFA 2GD1O 4G2NA 4D0SA 4GPD1 2ZJ0A 1ISIA 4DVJA 4TKMA 5A3JA 1UXHA 3SJUA 4W9NA 4Q3AA 3Q9UA 1YVEI 3GPDG 3F4BA 1TLTA 1IOLA 2NVBA 5JPIA 1NQOA 4CM8B 3F47A 3OEWA 2IRWA 3IS3A 4PLYA 4DIFA 1DC4A 3JV7A 5A04A 3IDSA 2HCTA 4XKJA 1Y8QB 5IAAA 4QO7A 3ENNA 1WZIA 3QQPA 1WNTA 3NT5A 1KVSA 3RUIA 3D64A 4AJ2A 2HSDA 4BKRA 2E49A 2JAPA 1IULA 4CM7A 2VUUA 1WDKA 2I76A 4I1IA 1A71A 3NGLA 4XIJA 2H6EA 4JXKA 2X9NA 1MP0A 1OI7A 3CZRA 3IC5A 1EVYA 4GX5A 2IXAA 3A9WA 1LDYA 3CH6A 4NBTA 5FI3A 5JAMA 1MXHA 3U5TA 5JCJD 3PZRA 5BQFA 1QSGA 4Z3DA 1GZ4A 1LLUA 3GR6A 4CMGA 3DL2A 2G17A 1QG6A 1X7GA 2ZTMA 4J3FA 1DXYA 1I32A 1KYQA 3F3SA 5CG2A 1O9BA 3G17A 2GR9A 3C1AA 4JQCA 2VTDA 3DBHA 1E7WA 1LDEA 3KSDO 4MDHA 2ZJ1A 4M8SA 3ZZNA 3PYLA 1ZKMA 2EP5A 1HF3A 5IN4A 4D0RA 3VOSA 5IN5A 4FC7A 1E3WB 5U1PA 3WYEA 2DPGA 4U5QA 3QVXA 4GWGA 5JDIC 2NM0A 3MJSA 1GDHA 4DMLA 3WGOA 5CHEA 1A7KA 3GZNB 2QZ9A 2D3TA 3JTMA 4DPKA 1U3UA 2ZYAA 3ENKA 4QO8A 3OSUA 1GZ6A 2VHZA 2WYVA 3L77A 4FR5A 4KUEA 3BIOA 2Q49A 2OBNA 3FHLA 3INTA 1F8FA 1NPDA 2B5WA 4E32A 2Y1CA 5TJHA 3GDOA 2C29D 1YXMA 2Q45A 1Y5RA 4B79A 2ZTVA 1B26A 2YJZA 4J90A 1XU7A 1LX6A 2NU6A 1DFGA 4ALMA 1JN0A 3KO8A 1HSOA 3MJVA 4G5HA 1KY4A 1H6AA 3GRPA 3C8MA 1HE2A 3L6DA 4GGOA 2HJSA 3DR3A 2BRUA 1RM3A 4NFSA 5CDYA 4MP3A 3RFTA 2OO5A 1T24A 1Y7TA 4CQMB 4PG4A 3WLEA 4K28A 4OM8A 3ZWPA 3HDQA 4YA6A 4BMSA 4EBFA 3WFIA 2O3RA 2PZLA 2VUTA 4DQUA 4KDEA 1P1FA 3DZIA 4NJOA 5TJ9A 3WDSA 4H15A 4PLTA 3LC2O 4NBWA 2JFGA 3F1KA 4EUFA 2CMDA 4C4OA 3E03A 2BH9A 3RROA 3D4NA 1V3VA 3Q9NA 3SBOA 2YDYA 5L4NA 2D0IA 1PZHA 3JQBA 1LNQA 3RVDA 3QVOA 1Y6JA 3VH1A 4EJMA 4ZA2A 3ZCXA 3FN4A 4R1UA 3OM9A 3ZV3A 1NVMB 2YFHA 5JO9A 2WMDA 3DOCA 3OQ1A 4OYRA 1U2GA 2F00A 1A7AA 2W4QA 2HJRA 3NRCA 2CVZA 3Q2KA 3AWDA 4MIYA 2X9VA 3BMCB 5L40A 3RI3A 1QLJA 4OJNA 3DZBA 1J6UA 1DJNA 1U1IA 2V6GA 3JYOA 4YRBA 4ND1A 3W6UA 3BMNA 4B4OA 2BFAA 3WR5A 2B4RO 4CMEC 3DBLB 3KYBA 3BTVA 2Y1DA 3WMXA 3C1OA 3EY4A 4M49A 2EF1A 3OJFA 1PJ2A 2FN7A 2OP0A 5TS3A 4BMNA 1QKIA 5CDGA 1I3KA 1L1FA 5A9SB 1YL7A 2AMFA 5F1KA 2I3GA 4Q3DA 4LN1A 4RZIA 3UCEA 1AN9A 1F0YA 3ZHXA 3Q0EA 4J1NA 1T4DA 3FF4A 1MV8A 4JBIA 1FJHA 4YRAA 1HTBA 5G0VA 4ND3A 1UP7A 3DXFA 3ZWMA 3TFQA 5I7FA 1EE9A 1UH5A 5F1PA 3PJEA 4HX5A 1NP3A 2VYVA 4Q3EA 3S2GA 2I65A 1E1KA 4U6QA 4W4TA 5FI5A 4GWKA 4NIMA 5KJCA 2PGDA 1HYGA 1YKFA 4NPCA 1X15A 4RPGA 4E12A 1Z6ZA 1V3TA 3WQQA 4TRNA 3I9LA 4XB2A 1PS8A 1YL6A 1NAIA 1H2BA 1B3RA 2O7SA 2ZYDA 3TZ6A 3H3FA 1GL3A 1UZMA 4IQGA 3RASA 4BO5A 4CODB 3H2SA 4MPDA 1E1NA 3UH1A 1NTOA 3ITKA 3M2TA 3FNEA 3C24A 1X7DA 4LK3A 4Z0PA 1PJBA 1JWBB 3JQ7B 3K8ZA 4FFNA 2H1SA 3LT4A 3NV9A 1I2BA 1JA9A 3CE6A 5C3MA 1OOEA 3Q1LA 3DZFA 3VVCA 5JLAA 3VH3A 3DBRB 3W8FA 2PKQP 3WJ7A 1ISMA 4TVBA 5ICSA 3ZNPA 1E77A 3ZWXA 1EEHA 4ESOA 1DHTA 3DFZA 3DOJA 3FTPA 3NDIA 3DHYA 3IUSA 3RU7A 1O8CA 2Y1EA 3OJ0A 5JDCA 4DYVA 2HMWA 2CUKA 3QWBA 4YJDA 3RBXA 4IDGA 2P9CA 2I99A 3ZH2A 1BRMA 1HDZA 1XHLA 4D42A 4TSKA 3DZJA 1DDOA 4KQXA 1J4AA 4KTTE 4ZQFA 3UCFA 2X58A 4W6ZA 4Y6RA 5T57A 2VHWA 3SLGA 1U4OA 3TN7A 1I24A 1E3WA 2EGHA 3GVIA 1EBFA 5JDIA 1QYDA 4FD3A 3V5NA 4NFHA 1ZSYA 9LDTA 2HLPA 1SCUA 3WGGA 4CUZA 3E48A 4NG5A 3ZI0A 2VOEA 1E1LA 1KETA 3NTOA 2AEFA 4RLSA 1NBOA 3IUPA 2NNLD 4BO8A 2RH8A 4EJ6A 1FDUA 4NK5A 4HFNA 4IY1A 5B4UA 4TRJA 4PFJA 1A4UA 3RUCA 5IZCC 2VT3A 1GUZA 3N58A 4B7CA 3KB6A 4R4JA 2CF5A 2J5RA 3GDFA 3ADOA 4BNIA 1LRKA 3PTZA 4J0EA 1ADCA 2PD3A 3VDQA 1JKJA 2Q1UA 5DP1A 1FF9A 4PG7A 3TZHA 1PZGA 1EVZA 1PQPA 4LVCA 1ZK2A 1H9BA 3ZWNA 4LCEA 4RVHA 5A9TA 3O26A 4B4VA 1I30A 1XR3A 4CR7A 2Y0CA 5IF3A 1DIHA 4E3ZA 3OEYA 3WBBA 3U9LA 1ZO8A 3PQDA 4YEDA 2JD1A 3EC7A 1I8TA 1VPDA 2DT5A 1YO6A 3LLSA 3STHA 1AHIA 4CQMA 1TXGA 4JLWA 2PZJA 4HWKA 1N92A 3Q3CA 1EMDA 3JYNA 4TZTA 3CTMA 4WASA 4FDAA 5TLSA 1NQAO 4LCJA 4ND4A 3ABIA 2AE1A 1C3VA 4ZRNA 1XCBA 2I6TA 4K1LA 3MZ0A 4MO2A 3ZV4A 2OP1A 1Z7EA 4MKRA 3AFNA 4OSPA 2CZCA 5G2OA 3RQSA 2FZEA 4PZEA 2BI7A 1MG5A 1GUFA 3ETEA 4BO1A 1T25A 3D3WB 3PP8A 4HADA 4Q3BA 5DCUA 5HS4A 4BNMA 4F3YA 1J0XO 3UGKA 2R6JA 3KRTA 1C0IA 4FFMA 4OKIA 3DB2A 3GFGA 5CAEA 4BNNA 1GEEA 3GG9A 4BL5A 3E9MA 1P1JA 3WTBA 4LRTB 2V7PA 4N5MA 4BKQA 4H3VA 1B7GO 1T4BA 3KSUA 3GAZA 3TSCA 1AXEA 2GPTA 4Y8VA 4IJKA 1ARZA 1DJQA 1PJTA 4J49A 3TL3A 2VQ3A 2DKNA 2C20A 2JFFA 3JD2A 1KC3A 4FGWA 4D43A 1Q0QA 3H8VA 1ISHA 1YL5A 1YS4A 3K30A 2F1KA 4TQGA 5ES3A 1MFPA 3WMWA 1PJQA 4CMEA 4WEQA 7MDHA 2VN8A 2DUUA 4MVJH 4NJMA 1GD1O 4AJPA 3ETGA 3JQGB 3K92A 1BHSA 4R1SA 4XZ3A 1I01A 4RCVA 4J1TA 3PI7A 3W4IA 5KNLA 2W2LA 2Q2QA 5I9LA 2RCYA 4YXFA 1ZK3A 1XQ6A 4IM7A 1DSSG 3EVTA 5AXCA 4M1QA 2XXJA 1QV6A 1SNYA 1SOWA 2ILTA 1WP4A 2AW5A 4E30A 1M6HA 2BKAA 3KYDA 1XGKA 4ND5A 2C5AA 4NDNE 3VZRA 2WD8A 2DBQA 4MIEA 1HDYA 3GHYA 2J3KA 5EMHA 5A05A 2TMDA 1BVUA 3S8MA 2QG4A 4CM4B 2W8ZA 4L9RA 1HE5A 2VRCD 4UEKA 4XRGA 4XJSA 1ZFNA 2EJWA 1C14A 5I7EA 1F8GA 1YOVA 2Q99A 1YRLA 4ONEA 2VHYA 4ALKA 3ZV5A 3VKVA 1MC5A 3HN7A 5DP2A 3WQSB 1B15A 2Z1NA 4WK6A 1GEGA 2ZB8A 5TGDA 2NU7A 4DC1A 3DTYA 3ICCA 1R0SA 2O2YA 3WWYA 4BGUA 3E8XA 4BV9A 2AA3A 1N5DA 4I08A 3GVPA 3WG9A 1GV1A 3LT2A 2P4QA 3ONEA 4FN4A 1E7RA 5AXAA 4I5FA 3RUFA 2AQ8A 2BF7A 2C2YA 4ZQGA 4OMUA 5G4KB 3ROQA 2C82A 2W2KA 2X0JA 3FNHA 4OSOA 1SC6A 5ILGA 4LMRA 3EDMA 4L8VA 4NR0A 1LXCA 2BFOA 3L4BC 4BNXA 3BTOA 1SB8A 4X54A 1BW9B 3SJ7A 2PA3A 3GZNA 3E5MA 4MINA 5TQVA 3WIDA 3ZGYA 3PDJA 4BB6A 3TZCA 3VPSA 1P33A 4ZQBA 3WNVA 2QRLA 1GPJA 2JL1A 3KZVA 4JIGA 4IDEA 3VKUA 5JFOA 1NFRA 5JAQA 1Y9EA 3PWKA 2POQX 2YZ7A 4E13A 1N1GA 4M86A 4IBOA 4Q9NA 1NAHA 1ENPA 4DRYA 4KDFA 3H4VA 1E5QA 1P9LA 3G1TA 4XQ9A 3VZPA 4PCVA 4D46A 4RJTA 4ALLA 4GAEA 2Y1FA 2FOIA 3RD5A 4DUPA 2VNSA 3AU9A 4N7RA 1N1EA 3RKRA 1RM5A 1VL0A 3CINA 3ANNA 1ID1A 4I9NA 3ZN2A 3G3EA 1R0KA 3B20A 1N2SA 1U5CA 3A14A 1NYTA 4XDZA 1GQQA 3B1JA 1H0KA 3ZU2A 3A06A 4BQRA 3V2UA 5DZSA 2YY7A 3H5AA 2W2LD 1WMAA 4WCFB 3S55A 5G4LA 5L45A 4OXNA 3AI3A 3V8BA 3GNSA 5T5QA 1CERA 2DBVO 3BTUA 2O4UX 4AFNA 4J4TA 4FQ8A 2NQTA 4XR9A 5IJZA 2ZTUA 1DRUA 3RC1A 1QYXA 2LDBA 1GQYA 3DEYX 1ADBA 3JQ6A 3CPSA 3IP3A 1NNUA 1I33A 1ONOA 2VNAA 3JD4A 4NU5A 2DVMA 2DM6A 4Z0TA 1Z75A 3SEFA 1YJQA 2RIRA 2P2SA 1HDXA 1Q2XA 3E5RA 1G0OA 2IDZA 1U3TA 4I5DA 1ISGA 5L7WA 1YE3A 3L6EA 3NKLA 3GG2A 4PLFA 2VWQA 3HADA 4RF2A 2FRDA 2DTDA 4NJMB 2J3HA 1ZH8A 3X2EA 5FYDA 3ZWBA 2B69A 1QYWA 3O38A 5TIIA 2EJVA 4BMVA 1IYZA 1GCOA 4JBHA 2DU8A 5CPFA 3GFBA 3WGZA 1GR0A 4DTIA 1ZMTA 2B4TO 2YQ5A 5EERA 1P31A 1UXGA 3ZWVA 4GX1A 4F6LA 3C7CB 4WCFC 3WYCA 3ZNNA 3KVOA 1O89A 4MJLA 5TNXA 1C1XB 2Q3EA 2VWPA 1T1RA 3KYDB 2PY6A 4NBUA 2DPHA 4YAIA 5KTKA 4LSWA 1AHHA 2FR1A 4L4RA 4AL4A 2CSUA 3WX0A 3MJTA 2BFMA 1YB5A 4B8ZA 1ZXBA 4PRKA 2GN4A 4HKTA 1DIBA 4WCDA 2BLLA 4QXMA 3VDRA 3B1FA 4RPKA 4PLCA 4WNIA 1CDOA 1JDJA 2IYPA 3TOZA 3PJFA 3MOGA 3C1TA 4LSMA 4R9SA 1M66A 2FMUA 3ROMA 2P9EA 4RVDA 3G0OA 1GQ2A 4A0SA 1BGVA 1WW8A 3TPCA 4J4HA 5BNIA 3OA0A 3IMFA 4BNTA 2FZWA 3D4OA 3L9XA 2YV1A 2RBEA 2FR0A 2O3JA 1JLLA 1IE3A 2C7GA 2JD0A 3E18A 4NHEA 5KJ1A 3F46A 1YB1A 3RFVA 5AOVA 1LU9A 2FSSA 3HFGA 4YCAA 3WWZA 4EZBA 4ZN6A 5TT1A 3ZDFA 2CNBA 5C37A 3LQFA 2B83A 3ZHBA 3HWRA 4XGKA 2ZCVA 1MLDA 5JMWA 4UAGA 3PQEA 3OA2A 3AM3A 3S2EA 1PGOA 4GBJA 3KTDA 1NX6A 3ITDA 2QYSA 2HKIA 3EVNA 5EPOA 4P38A 4RPLA 4HNGA 1EDZA 2AHRA 4P4NA 3T4XA 1Q7GA 4BO6A 1VSUA 2Y93A 4XYLA 1HXHA 4CLHA 2CD9A 4AICA 1BXZA 2IZ0A 4F46A 4YBZA 5CEFA 3A1NA 4U6SA 3KUXA 3KXDA 3RFXA 2VYVD 2O3QA 5IDXA 4DIOA 2XOXA 3T7EA 3HZZA 2PD4A 3PGXA 1PQWA 4ALJA 3ZU4A 3AOEA 3PEFA 3H6KA 1KBZA 1PIWA 1EFKA 1VJTA 1R0LA 4OOFA 3KLMX 4ROSA 3JCZA 2VZ0A 3INRA 1H93A 3H9JA 4JJFA 3UUWA 3UVEA 3ZWOA 5U4QA 2BHLA 2GZ3A 1HETA 2X5OA 4XQCA 1CRWG 5G4KA 3JQ9A 1N7HA 1V8BA 4FFOA 1SAYA 3ASVA 3FNGA 4NH4A 4YWJA 5HRUA 1TT7A 1JAXA 2IYOA 2RHCA 4XRRA 3OJOA 4BNUA 3V2HA 4R69A 3CSDA 3BMOB 3D3EA 1VE9A 3BMQB 5KJFA 5I8ZA 1CETA 4HBGA 4YACA 3WB9A 4AJLA 4RVSA 2UUOA 4NU6A 1SO8A 3HB4X 3QW2A 1ULUA 4PG8A 3LC7O 4NQZA 3I1JA 4J9UE 4Z3KA 3FCOA 1DO8A 2O3SA 2OMEA 4J91A 3DAGA 3R6DA 4DXHA 3BMOA 4E2XA 1JU9A 4OXYA 4O59O 4XB1A 1LDBA 1V3UA 4R3WA 3RJ9A 2C59A 2WWRA 4CMIA 2H63A 1GYPA 2GRAA 3WYBA 1EFLA 3KYCA 1HRDA 4DLBA 5JW6A 1EVIA 4EYEA 3OHSX 4XQGA 4OOEA 5BSFA 5A4DA 1XA0A 4RPJA 2NQ8A 1ZSVA 1PL6A 1YQGA 4FGSA 1LRLA 2I9PA 2EIHA 3JYQA 3DONA 4IXWA 1H5QA 4RV9A 2BGKA 4UUOA 1ZK1A 1B8PA 3W8EA 1VL6A 5AXDA 4IMPA 1A72A 2X1HA 3PFFA 3PYXA 1ZIDA 3AOGA 2X23A 3E82A 4FPXA 3TDKA 2VHXA 1A9YA 1HZJA 4RVGA 5CP8A 4CM4A 1ORRA 1T2EA 3ANMA 5THKA 2QQ5A 3AJRA 4IS2A 1NWCA 1GYRA 1LUAA 1LSUA 4KQWA 3FI9A 3E9NA 5ICMA 1UZLA 1KEUA 1CWUA 3VZQA 1NVTA 2NVUA 2EV9A 4B4WA 2DLDA 3GEMA 1E7QA 1J5PA 3TL2A 2CVQA 3R3SA 4BNVA 3D5TA 3FPCA 4Z9XA 3DBLA 4K6FA 5DOZA 5T8KC 4I5GA 1U3WA 1U8FO 1ZEMA 1KY5A 1OC4A 3ZWCA 3GVXA 1EQ2A 4EDFA 1W8DA 3IQDB 4PRLA 4AJIA 2C0CA 3W4KA 1WWKA 4JROA 4DQXA 3RC2A 1QRRA 4YDRA 3GVCA 5BSGA 2PH3A 4MVJP 3D0OA 1V6AA 1EUCA 4OH1A 1LA2A 4ILKA 4MIOA 5TSDA 3SX2A 3B70A 5GY7A 1LSJA 4G65A 4NBVA 3NJ4A 1DFIA 2TMGA 3DZKA 1YDWA 2G76A 4BNLA 3QHAA 3GEDA 3GGPA 4WLFA 3WGIA 2O2SA 3K31A 1YDEA 2DFVA 1IUKA 4L0QA 3UF0A 4DLAA 4IMRA 3CKYA 1R4NA 1IZ0A 4CQLA 3MWEB 2I67A 5F21A 4L73A 1EBUA 2HK7A 4GI2A 4QFDA 4QX6A 3W6ZA 1R4MB 1CF2O 3PHIA 1IZ9A 5K0ZA 4XD2A 2AG8A 3VHRA 1BDBA 1XYGA 2Y0EA 3K2BA 4RDHA 4ITUA 4BNZA 2CFCA 4GMGA 3BZUA 1EE2A 3HDJA 3PQFA 4I9HA 4AJEA 3QV1A 5H82A 4FB5A 1WXDA 4EITA 2QIOA 4IZIA 1I3LA 5A03A 1K5HA 1LBEA 8LDHA 1YBVA 3GOHA 1LLDA 1HLPA 1T2FA 3CIFA 4PLWA 4XWYA 1KEPA 2ZCUA 5EINA 6ADHA 4RDIA 4B7UA 4YJFA 5H81A 4PVDA 3ZWWA 1U4SA 3O4RA 4EI2A 1E1MA 1K6IA 1WPQA 4OL9A 2NVWA 1MUUA 4N5NA 3U3XA 1ZNQO 3OQBA 3AM5A 2YHUA 4XJTA 1H6BA 4BO2A 3DTTA 1CIVA 4PZDA 1N8KA 1OBFO 3FRJA 5MGBA 3TRIA 8ADHA 3FR7A 3PPIA 2C07A 4HFJA 3JYPA 4PG6A 1EVJA 1LDNA 2VZ9A 4QQRA 2EKQA 4YJGA 3TNLA 4WE3A 4RVUA 4DYDA 5L3ZA 4HP8A 1DC3A 5JSFA 1N9GB 1VI2A 4MOWA 2G0TA 1Y8RA 2EXXA 5A5EA 1ZVMA 4J7UA 1OC2A 1T26A 2QYTA 2GN9A 4JN6B 4K26A 3BMCA 4FJ1A 4YT5A 2IXBA 3UN1A 3VPFA 5CEEA 2GSDA 1E7YA 3GLQA 1SEPA 3AY6A 1IL0A 1Z73A 4GL4A 4HFMA 4CQMD 2BMAA 3GN1A 1N9GA 3WBFA 1ENYA 3GHHA 1UUFA 3PVZA 1NR7A 1NVGA 5JY6A 4CLOB 1Y8RB 4CM9D 4EUHA 4P22A 2JD2A 2JJYA 1YQDA 2P9GA 1XKQA 2GDZA 1NASA 2HUNA 3FWZA 3V1UA 4E21A 3T7CA 4RZHA 1R12A 3LU1A 1VM6A 4XR4A 2AXQA 5LC1A 1FK8A 3L07A 4R51A 4BKUA 2PD6A 5JDCC 1HDOA 3UHAA 4RVFA 3DFUA 4E2YA 5JC8A 4IXTA 1U28A 2QRKA 3C7DB 2VRBA 5LCXA 5JXWA 2WJPA 3M6IA 2JHGA 3AFMA 1ZW1A 4FS3A 1GPDG 1Z82A 1L7EA 1CYDA 3PWSA 4BNKA 4E5NA 3SC6A 4FFLA 3LLVA 4NI5A 5COAA 3P5SA 1ZSNA 4GVLA 4QT0A 3V1YA 4YTEA 3QWAA 2FR8A 4K6CA 2ZQZA 1I2CA 1ONNA 2O23A 4WEOA 3VPXA 4YAJA 4BGIA 2B4QA 2PZMA 3ONFA 1LRJA 2GYYA 1ML3A 2ZYGA 1FDTA 3FBGA 2P5YA 3GMSA 5TRTA 4C7KA 4BO0A 4H16A 2C7VA 4RQUA 1DPGA 3OFSA 4YAGA 2V65A 3M1AA 3U09A 1XLTA 2OUIA 3I9NA 1P3DA 1Z74A 4E2WA 4B8WA 3L0DA 3L9WA 3LSYA 1O95A 2WDZA 4R16A 4BS9A 1IY8A 5AYVA 4J6FA 4RF4A 4YPOA 4WLEA 1RKXA 3EHEA 1VLLA 4WLOA 4AJNA 2HMVA 3WXBA 3VH2A 4ZGWA 3I23A 2Z5LA 4FIZA 1K0UA 4TVOA 4CV0A 1B8UA 3HSKA 4L76A 4B4UA 3ZHZA 1V9LA 1DIGA 3VH4A 1NWHA 1DC6A 3I9JA 4YT8A 3JSAA 1BW9A 4R41A 3N74A 3ROKA 4UREA 2J6IA 2GO1A 4Z6KA 1ENOA 1UXKA 1I10A 1VJ0A 2RHRA 2VYNA 2ZIZA 4I5EA 4BNGA 4BUCA 4INAA 2A94A 1KVUA 4BO4A 4YRDA 1KEVA 1XSEA 4UEJA 3WGQA 4Z9YA 1CQIA 4W7HA 3BA1A 4XGIA 4BB5A 4D7AA 3DBVO 4CMKA 1JWAB 2O50A 4DC0A 3OJEA 5K6AC 2WM3A 4N18A 4L74A 3UAGA 4WLVA 2NWQA 4IGEA 1K6JA 3PDUA 3UXYA 4CLRA 3WSWA 3H3JA 4XA8A 3KBOA 4QTZA 1X0XA 2SCUA 3ANLA 3GK3A 4NZ9A 4KWHA 2G1UA 4U8GA 3T4EA 3WJAA 4DA9A 3MJEA 1AXGA 1R6DA 2AQIA 4RGBA 3ICPA 4CLDA 3V1TC 2OORA 2J5QA 1EK5A 7ADHA 4Z0HO 2J8ZA 3Q11A 2IEBA 1DAPA 2OOSA 1CQJA 3E9QA 3DBHB 2GZ1A 3QA9A 4A10A 3VPHA 1Y9AA 1PS0A 4II3A 2V6BA 5I7SA 5IG2A 4CLRB 1O5IA 2WSBA 4CPDA 3GF4A 2NLOA 5TX7A 4TWRA 1LLCA 3GQVA 3ASUA 2VCYA 3SC4A 2Y1GA 4R1NA 3CUKA 3U4IA 3VTZA 2FY8A 4DL9A 5GZ6A 1E6UA 4OQYA 3I9KA 3NGXA 2PKQO 5JE8A 5BNFA 5L53A 1PGJA 2NU9A 4R54A 1LJ8A 4J2HA 3VPGA 1U7TA 3PLRA 1DFHA 4W82A 1SB9A 4I8XA 5T67A 2FHSA 2GZ2A 3S2FA 4WOKA 3BTSA 4CLOA 1Z7BA 5T64A 2Y66A 2VYND 1Y5MA 4IIVA 4IJWA 1OZAA 4GGPA 4JJGA 3WGHA 4GSKA 3UICA 1E3LA 3IP1A 3OETA 2UYYA 4CR6A 4TZKA 2V6MA 3N7UA 1ZK0A 1UAYA 1B14A 5G0SA 3H5RA 1TI7A 2X4GA 1PWXA 3K6JA 3ORFA 1FDVA 1N7GA 4UUMA 3QVTA 3PWZA 4HFRA 4NBRA 2EERA 4D3SA 1HDRA 3EMKA 1RYEA 5A9SA 2IE0A 2DUWA 3EW7A 5B12A 2PGJA 1H2HA 2H5LA 2PNFA 2ZB4A 5EESA 1V35A 4KUHA 1K3TA 3U49A 3I9OA 5FEUA 1NR1A 4WLUA 3HJAA 5JAZA 3I4CA 1KEWA 4BKOA 1W73A 3RBZA 4GX0A 3FBTA 3Q6IA 4JCOA 3WGTA 5DCYA 1F17A 3TQHA 1KERA 4JX8A 4JP2A 1PJCA 1M6WA 3LK7A 1HDCA 3O03A 3K73O 1ADGA 3JQGA 4FCCA 5T6BA 4NNJA 4UUNA 3X2FA 5AQ1A 4D3DA 1NQ5A 4WKGA 2AG5A 3PGJA 1DRWA 3WTCA 4EEZA 2I3AA 3AOEC 4UVEA 4CM5A 4WCFA 3PHGA 1QR6A 5ILOA 3NYWA 2Y99A 4IDCA 3E6AA 3NX4A 4IUYA 4ZHSA 4HXYA 4HUJA 3WSVA 3O9ZA 4FFPA 4YB8A 4Y9DA 2EWMA 3K5PA 3AI1A 1A4IA 3QE3A 4JJIA 1JKFA 2BD0A 1P0CA 4E4YA 3MJ4A 4IDDA 2Z1MA 3K9QO 2FSVA 3DMYA 4TRRA 1TT5A 4BHTA 4RL6A 5DOVA 4IJVA 1EK6A 1SMKA 4AJJA 5B1YA 2FP4A 3NTRA 5L9AA 1ISJA 1HE3A 2YUTA 4MVJG 2PKRA 3EGOA 3PHLA 4EW6A 1ADFA 2XF8A 4O5OA 1C1DB 3ZU5A 3MOIA 3F5QA 3H9QA 1TEHA 1BXGB 4FFRA 5L7TA 5TC4A 1BSVA 4G81A 3ZWAA 3GPIA 3AM4A 4R9RA 1X1TA 1G6KA 4D41A 4DQVA 3ZV6A 1RPNA 3B1KA 4C7JA 3LYLA 4WOJA 4MP8A 3INGA 4CMJA 2D8AA 2Q4EA 1KS9A 1NPYA 4JP3A 3RUAA 3PJDA 3PHJA 5JMPA 2FPIA 4FSHA 3SLKA 1A5ZA 1YJ8A 2NU8A 4J1QA 3RKUA 4R3NA 1XQ1A 2GN6A 3RIHA 1Q7BA 1ZMOA 2PFGA 4OAQA 4S1VA 5DULA 1X7HA 4AVYA 5U9CA 4WPGA 1NHGA 1Z45A 4ZRMA 5JC1A 1MG0A 1R16A 2CF6A 3RAJA 4BO3A 1GU7A 1PR3A 3PK0A 2C5EA 5IZ4A 1S6YA 1LQTA 2GF2A 3OJLA 5CDTA 2WD7A 5EJ2A 1Q0HA 3NT4A 4EGFA 5IFLA 1B16A 1WLYA 3KEOA 4MVJM 5CPBA 5HA5A 4A26A 2VUSA 2HMTA 1UAGA 2B35A 3RSHA 4RQTA 1RM4A 5F3RA 3U4CA 2DBZA 5DBIA 4CLXA 1I2ZA 1ZEJA 4P8RA 1J49A 2XAAA 2YFQA 3RJ5A 1Q7CA 3D4PA 1C1DA 5F1OA 3ZW8A 4DPMA 3H9UA 2EHDA 3KEQA 2PLAA 3RUDA 1MB4A 1L7DA 5LDHA 1MX3A 5C7IO 1PJSA 3HDYA 3TOXA 2ZQYA 3LF1A 3RC7A 4FJ0A 3I4FA 3F9IA 1EUDA 5L4LA 2CDCA 3F4LA 3BHMA 3NAQA 1NFQA 1UDCA 3U4DA 3PHHA 4LRSB 3DC2A 2J3JA 3LDHA 4GLLA 4PLVA 4CJXA 2JAHA 3HFSA 3CEAA 5KCZA 4WJZA 3OICA 4WGGA 1W0CA 5F5LA 5KVSA 1W4ZA 4RF3A 2ZB7A 4BNFA 4E31A 3G49A 3RC9A 1IHXA 4B3IA 4UVGA 3TZKA 4RPHA 1SBYA 1Q0LA 1U9JA 1DC5A
chains in the Genus database with same CATH superfamily
4QGSA 2FPLA 4MW5A 2YYSA 1R10A 1NU8A 1UBOS 5C8YA 1G8MA 1TVEA 3S2YA 3NORA 3IDQA 5I5EA 5TPWB 1XD2B 2XYPA 4MW9A 4QAJA 2IBSA 3GNLA 3K2EA 1P9NA 1ZNWA 1WEKA 2WE7A 4IV0A 4ZEMA 5CLGA 1KC1A 1YZTA 3B6EA 4BOYA 2XKAA 2HCRA 4UULA 4JKOA 1D5WA 2G8NA 4CV2A 3OMWA 5G53C 2YW2A 1AGRA 2JA2A 3DKRA 4I6EA 3HWSA 5ILQA 4JP8A 3TZBA 5IUKC 2DHRA 5E3HA 4OJMX 4XQEA 3GEBA 2R7LA 4EMTA 4MVJF 4UEQA 4N12A 2F3QA 1JFFB 1QXSA 4CL0A 1P19A 3CR8A 5FQNA 3URKA 2J3IA 4V1CA 3ZHQA 3C3DA 1H9AA 2YIDA 3Q8XB 3H2ZA 5BVGB 2YMPA 3FR8A 2RMKA 2IS2A 3B9PA 2VUHB 1FYDA 5IYZB 1I2AA 3PDHA 4J2OA 2K2WA 1NR5A 1U90A 4URFA 1GIAA 3K4PA 3HCOA 1QIEA 3OZRA 2ODWA 5K3SA 3I2JA 4NYIQ 4A03A 4NNOA 3O90A 2G9ZA 1X9IA 4DQ0A 3KEGA 5THQA 4NOKA 1BXKA 3RDPA 1DTWA 2RGXA 1G1AA 2A9FA 3NDJA 4KAFA 3T3EA 3ZDRA 3MWEA 3WA6A 4YCSA 1ZM9A 2QN7A 1S2GA 3U80A 1AS0A 2FPWA 2NZXA 3CRZA 3UB3A 1MT3A 2EL7A 2P3QA 1JSXA 2FX3A 3Q88A 4KVFA 3WS7A 2ZE8A 1Z8DA 1EZ4A 5F7XA 3AW9A 3V42A 3MCTA 5H68A 3BA6A 2R60A 4CIYA 5FOTA 3RFUA 1DL5A 1QGUA 5CFRA 1NP7A 1V8DA 4KKXB 4C43A 3VR3A 3W8DA 5JCXA 2ACVA 4NU8X 3ZY5A 2OR3A 3OHMA 1BDHA 1AURA 1UKAA 2NTVA 3NKFA 2PXAA 1D2CA 1LC3A 1WX1A 1WQ4A 2Y9MB 3EIUA 3W6OA 3EEYA 1UR5A 3CZCA 5DM1A 4OK5A 3ZVNA 3HB5X 5FOVA 4FOSA 4P7BA 2AHOA 2EYQA 1JR3D 1E0AA 1I5RA 3JQDA 2FSHA 1FDWA 1H2YA 1KDRA 2EKPA 4J0IA 3SKYA 5BW8A 2ZWPA 2MYTA 4UVIA 2YNMD 5L7YA 1NZFA 4N54A 3WFJA 1S9HA 1EHYA 1M34B 2GEUA 1L5OA 3DE4X 1UZNA 1MO4A 2WWFA 5REQA 5C34B 5LP6F 5C7LO 3OEEA 4Q18A 5DBFA 1UK6A 1UEXC 5EIOA 4KPUB 3D8TA 1JGTA 4EPRA 2JGJA 2I6GA 3DXZA 3D8NA 4MS3B 1XELA 3ABOB 4E15A 2YQ4A 2BT4A 3LC0A 4X20B 1ACLA 3KSRA 3R3HA 3TTSA 2VT2A 4U2CA 1PK8A 4IO0A 1MFZA 4KFRA 2PBFA 5DN9A 1XDDA 5KJ6A 1IAQA 1FPQA 2C9ZA 3LF2A 1DEHA 2RJ3A 4ASUD 1DLJA 4PGGA 4LMBA 4OI1A 4EFLA 3U7QB 4YQYA 4EARA 3ESXA 5H3HA 3QY9A 2WTXA 3JR7A 4M55A 1FDOA 3I28A 3ABSB 4I4TF 4JL5A 4Y6SA 2DPLA 4JLJA 4PCLA 1D1SA 3U7FB 1KRWA 3OFJA 3Q7SA 4JB2A 1X13A 2LCQA 2BELA 4COKA 2ZR8A 4M7RA 2AEMA 1FX1A 1U5AA 2V96A 1AKEA 2RH5A 4GPAA 4DWVA 1KMMA 5K3BA 2DR0A 4LXYA 3AF3A 3WRVA 3WQRA 3LDFA 2CK3A 4EG3A 5KVVA 1IATA 3C70A 3I9V1 3Q7EA 3UW1A 1C3JA 3M33A 1PR4A 1U2SA 2ZK7A 1XQ9A 4GRDA 5HVNA 2CXNA 4QBIA 5JJBA 3I5MA 1BDIA 3FPHA 3AP3A 1OYVA 4MQFB 3EWAA 4PLZA 1K6XA 4D9NA 5C46F 4BWYA 2A0XA 3EK2A 3PICA 3PVSA 2FWIA 5KPDA 4LIPD 3GN2A 3GZ4A 3PRYA 3VBCA 2JGMA 1X2BA 2RHBA 1XPRA 2CKMA 1GAEO 1XZBA 3M8KA 4IO1A 2XA9A 4GYKA 3UV3A 2B1GA 4AJ4A 3GV0A 3NEAA 4JU9A 1FY2A 2AQHA 5BR1A 1SQ0A 3CGWA 3CVXA 4AN0A 3ESDA 2ENUA 4TL7A 4U0JA 4ZOEA 3E5NA 4YYZA 3Q2IA 3UKOA 2BL4A 5D3KA 5DYIA 1EIWA 3KT0A 1V11B 2Q2VA 4NBNA 2LCFA 4PTLA 2EZ8A 2PKXA 1C3OA 1NPTO 2VEOA 2GXQA 1J9ZA 1PL8A 2LBPA 3H99A 4G1BA 2EZUA 3HHEA 5KKAA 3RS9A 4E5DA 3TRKA 1BWSA 3IUYA 2CW5A 1F14A 1NF8A 2I8AA 4IZHA 4ZDKA 4KRFA 1NQTA 2QVXX 2FWMX 3HY4A 4QE3A 2AUMA 4TRMA 2Z2IA 1Y4SA 2I33A 2NTNA 4CKBB 1XZPA 4JYAB 3S4YA 2OD9A 1I7PA 2YXNA 1DUSA 3FTNA 4RHTA 5DTRA 1YKGA 1ZGZA 3JATA 5AK4A 1JDBC 1ZZEA 2YW9A 3GPBA 2CVOA 2CT8A 3A0RB 5HF8A 5AK6A 1EUCB 5CT6A 1C41A 1FMJA 1MAUA 4HN4B 1TE2A 1JTEA 3RUEA 2P67A 4CRWB 2B1IA 2NACA 3JQEA 4Q7LA 2H2GA 4ACAA 5F9MA 5L3SB 3GA5A 4HDKB 1VKOA 1ORIA 1W9MA 1QO9A 2I0FA 2SKCA 4JQSA 4LDRA 3H5LA 4DRZA 1WU7A 3EGDA 4TKVB 1S8FA 1US8B 1GAWA 2OCDA 3KK0A 3WGNA 2VQ6A 2G9QA 1TAQA 3AK4A 1UBSB 3NG1A 2NVUB 3W3AH 4GHWA 4FHFA 1IXRC 1XLWA 5FTLA 2FSIA 3HM2A 1VJ1A 3A2NA 4JGIA 4L4SA 2CHEA 4R2XA 1XTTA 2GBCA 4G4SO 5DNEA 2QMYA 5B1HA 3U44A 3LZCA 3PXUA 3RC8A 2NV6A 4OGWA 3T35A 2AN3A 4JR0A 1G9XA 2B37A 3E15A 1D8AA 4NZZA 5FFFA 1L4GA 2DTEA 4QTTB 3ZW7A 1RRGA 1AK9A 1KTVA 1TTHA 3LHSA 5KWIA 4R7ZA 5JJ5A 4KO3S 3FLMA 1OTYA 2Q3HA 3EPPA 1P5RA 1WD5A 2QUJA 3EE6A 5BVHB 3R8XA 2FN3A 4PAMA 5EVCA 3PF8A 5DTIA 5EMLA 4F2PA 1TZBA 1EIZA 1C0KA 3E8SA 3FYUB 3D2CA 2W48A 1ZVQA 4IHAA 4RWZA 2PWZA 2QW0X 2VWGA 3IQWA 5F23A 1KEEA 3PFCA 5DCWA 3U9SA 4UTNA 5L95A 3BS4A 2XW6A 4DHEA 3WNZA 3CF6R 4AMUA 4URWR 4HB3A 3Q5DA 4TS9A 1YONA 4NZMA 3PIDA 2CMFA 2MIIA 4KR2A 3WK6A 3EYWA 2Y05A 4DCNA 4XYEA 1V7QA 1UJ4A 4NWIA 2P11A 2RAVA 4FR0A 4WI1A 3GFRA 1TYEB 2FVYA 1U2DC 3DQPA 3GPLA 3EZ6A 4NDZA 1NYLA 2EATA 2XLBA 3FVVA 2IUSA 1HY3A 4JLNA 4XI9A 1P0FA 4A16A 5SZHB 3RGGA 4FDTA 4AJOA 3C3JA 1ULTA 2X5NA 3OKFA 3P2EA 1UMKA 3R3JA 2IH5A 3L7LA 3OZUA 4OHMA 2QRJA 4RORA 3V4LA 1YB2A 2YS7A 3U4QB 1FFHA 4HUQB 1ONBA 1GAQA 2WYWA 4WECA 3S28A 3U3KA 2CVHA 3H8SA 1T2AA 1JKMA 4GI5A 2PLFA 3MK31 4MWCA 4QECA 1SZJG 3EWSA 4XFJA 3KFVA 1QLHA 3BK1A 4GXNA 1FFEA 2Q1SA 1DBVO 1Z2AA 3GJXC 3BRWD 2D00A 4FFSA 4B35A 5K6TA 5AD1A 1P1CA 4KBFA 4EY3A 5CB4A 1WPGA 5B58C 1CW2B 4JGBA 5AI9A 4ZD6A 5HRAA 5IANA 1V9CA 4D4KA 1C30B 3EQ6A 4NABA 3UATA 1O97D 2IHUA 3NHZA 1ZIYA 3KOOA 1NE2A 3OZTA 4DIBA 1YOBA 1PW7A 3GT0A 1L3IA 3TB4A 5JBIA 1CE8B 1P1IA 2NAPA 4FW8A 4ZEOA 1ZN9A 1JU3A 4C04A 1Q0TA 4KO8A 4PLPA 3FTDA 5ER9A 3EUWA 3FCYA 1U02A 4XGNA 1ZK4A 1L5ZA 1GYQA 1UMBA 2FPPA 2X8LA 1E3SA 3D8UA 3GZJA 4DJFC 1TA4A 4QREA 1UXOA 2XF2A 4OKNA 1ZOOA 4H1TA 1T8UA 5JRZA 3FSRA 2BDEA 3K0AB 4R3UC 3WOHA 1E98A 3DBIA 4KR3A 1LVGA 3MTAA 1MRNA 4MYCA 2YYAA 5E0OA 5ENVA 5IMBA 2IS6A 1JXAA 4EY4A 1ISFA 1MZVA 1WVGA 3D7KA 3WLRA 5HILA 1DRJA 1GFSA 2PTGA 3QIVA 4PC6A 1TCAA 2MSWA 5JZBA 1UDXA 5DI3B 1D1TA 4CGYA 1PZNA 2BM8A 2ZRQA 4AP6A 5KQSA 3IAHA 3NOVA 1C3LA 1XJ5A 3T8YA 4KPGA 4ALIA 1F7VA 2VK8A 1Z06A 2JKVA 2AYYA 3N6VA 3ISVA 2R00C 1M2HA 2BZGA 1YB4A 3KUCA 1B74A 2C0PA 2BHNA 3JQAB 2NYAA 3RIGA 3UB2A 1HNWB 5G1NA 1AGNA 2NYUA 3H5IA 5BNZA 5CFOA 2YCLA 1O94A 4DY6A 1ZN8A 1U63A 1EFRD 1NQUA 2R11A 4IFEA 3BWXA 1XIVA 2IV7A 3I6QA 2ET6A 2C3OA 2QL9A 3N2YA 5L8VA 3SAJA 4PC7A 5G40A 5C5IA 2WF8A 3GUUA 5TVGA 1BDJA 4MUEA 2FG5A 2B20A 2J3MA 5IKEA 1S96A 3LIIA 1R4MA 1MAHA 2RGNC 5EUCA 4DWOA 5I47A 1E3EA 4MI9A 3V7WA 3A6KA 5HK8A 4EZEA 5A5FA 5C1DA 2HXYA 4JK3A 3ZKAA 4G97A 3T3NA 1EQUA 1G5FA 5D7BA 2FUG6 3GEEA 5WRFA 4CKEB 5K7SA 1X3LA 1OLUB 3FF1A 3ZU6A 4AS2A 4A8JC 2ZRNA 1H0RA 3IESA 4ZP1A 5EP3A 5KQMA 6YASA 3VUEA 4L3OA 1R88A 2G9NA 5DXFA 2JFXA 5UKDA 3R5XA 5BXQC 5LWQA 1E92A 4CL3A 3NUGA 3BREA 5IAOA 4GF5A 1G20B 1PR1A 3U13A 1UIRA 1TEZA 4E11A 1UC4B 5BSWA 3ZHOA 1MC4A 3KEMA 5CTAA 4DR2B 2VWHA 4AM8A 2WFAA 5LXTA 3IR6A 3QJ5A 2OXTA 1WVMA 1GV0A 2XX3A 2FMIA 2QMZA 3IAAA 3H7AA 2HQ1A 3UPUA 1GN9A 3NETA 1VFPA 4HWTA 4BKMA 5D5QA 5B4VA 1GKIA 3ND6A 5KMGB 1J9EA 4HQKA 2HNAA 1AZWA 1P7ZA 2A1IA 4YRPA 4E1VA 3DJYA 1Q6YA 3HI6A 3DMTC 1DRKA 5EP4A 3TR6A 4OXQA 2B7BA 1XA3A 5CVVA 4W5JA 4UU8A 4F84A 4RACA 1EWYA 3B52X 3D5QA 4NCIA 4B5KA 5K6AA 1YIDA 3E35A 2D2XA 3B85A 2QPOA 5A5DA 4YXWD 1O58A 2FU5C 1JHUA 1VBNA 3I37X 3P9QA 1V3QE 3DTVA 4IYJA 4KEAA 1W2WB 4QL3A 5EQFA 1AMUA 1FDSA 2VJYA 1BDMA 1PGQA 2COEA 3DNMA 2EFDB 2NSDA 1XMPA 2G83A 2NTYC 2HPAA 1VPVA 3I2GA 1PEDA 3L7CA 3N39C 3NEYA 4FYMA 4IGIA 4RM2A 5JADA 1FTQA 1RQ2A 2JEOA 4E5MA 4M8IA 4BGVA 3W6NA 3NCTA 3CRQA 1YK0A 3JAKB 1RLOA 5B1DA 1T4CB 4DBVO 4YJHB 1VIVA 2AVNA 5EQDA 5JU6A 4HR7A 4QUKA 2NPFA 5IFKA 1U8UA 4D9IA 4M54A 5LQUA 3JD0A 4AP5A 4F5DA 2PH5A 2Q2WA 2JFYA 3DYBA 3KALA 3W90A 2ZYWX 3OPYI 3R74A 4PLGA 3W2EA 3P9CA 1OAKA 5JWOA 2UAGA 1LH0A 3VR5H 2PG3A 3BMNB 1Z2OX 4LDNA 2FJUA 1B8VA 4MRSA 2OGZA 1L7OA 2JF0A 3TNJA 5KKCA 3SICE 1Z36A 2OCIA 2I1LA 4IIJA 1SUBA 2LKDA 3D4IA 2EFEB 2ZYSA 3TUZC 3A9SA 1CY0A 2VKQA 3C7AA 4K3VA 4RA6B 3O2QB 4R1TA 4BJHB 4DA6A 5KSWB 3U56A 3DF9A 2A2ZA 1RXCA 3ACBA 3BAZA 4IQ0A 4MVJA 4URUR 4HRYA 4BKPA 3A2MA 4IV5A 2SCUB 2WUVA 2VCEA 1BD4A 3C5VA 5FBLB 1NDQA 4DUYB 1F5SA 4QG7A 5EL0A 5EUMA 2OHXA 3PRJA 3HTXA 4OBWA 3NBYC 4YP5A 2YXLA 5IAEA 2Q0QA 5EN4A 1BROA 3Q3HA 5KVQA 1ULBA 1GRVA 1QS0B 1DEXA 1CJCA 2W7TA 3IFSA 3RH0A 2REOA 2ST1A 1NBME 1WHSB 3DTNA 3I52A 4KK3A 4NFLA 3DZHA 2JB9A 4IXMA 1U8AA 4M3NA 4AT1A 5HTOA 2OGWA 2I91A 3HXKA 4KLAA 5MDHA 3P20A 1ORWA 4X24A 3I42A 3DZGA 1T3HA 3AUAA 4GMXA 4EKNB 2DQZA 1KYTA 2PS9A 4RLHA 2P2LA 2RAUA 2DFDA 3L5OA 4XYBA 2AFIE 5E1DA 5ADVA 1FDRA 4KR0A 4OYLA 5GOTA 4U2BA 1YCGA 3HXPA 1EDOA 4E5PA 1JAHA 2QLTA 1E2FA 1EGAA 4IRMA 4ZO9A 5EWJB 2WWVD 4CG1A 5IJ0B 1X1QA 1PF7E 1X1AA 4AZVA 4OYYA 3FWNA 1IOVA 1CR1A 5DLQC 4DBZA 1Z7YA 2VK4A 1RHJA 3NBAA 3EFOA 3SVLA 3K0FB 2W6JA 2HXGA 2IPOA 1RZ3A 2G40A 2P27A 1FXSA 3HBNA 3WWOA 5LLTA 3QI7A 4BV8A 3T1VA 4F5WA 4RZ3A 3ZKWA 2WVHA 3HY6A 4OGFA 1P1HA 3MTGA 1F51E 1KORA 3ZE8A 5JARA 3NHJA 4ZU6X 3PEWA 2O8EA 5IUJC 3WP0A 4AG5A 5L51A 4L4UA 2QV0A 5LMCA 3L1JA 4MVXA 1H94A 1GJRA 5IZCA 2LD4A 1UBMS 2HRZA 1KPHA 1OWOA 1U2DA 2R4QA 2I2XB 1ST2A 3QSYA 4QYMA 2I29A 2FPGA 3A27A 4CBVA 1M67A 2GMWA 2ORWA 2PX5A 3DWFA 4Z9AA 4ER0A 3UWOA 4EX6A 3OQJA 4FGLA 3QWFA 3BIJA 3SMVA 4O1MA 1N5LA 4K2AA 3K53A 3EOZA 1JJAA 4OKSA 5KYXA 2Q1WA 1C9MA 1XRPA 1Z16A 3MINB 4D3FA 2KW5A 4F9TA 4UCXA 1MA0A 3UTCA 1XB2A 1LEHA 1LQUA 2C7BA 4P80A 4GO1A 5C1BA 3QELA 4P5DA 4OV6B 2FA9A 1W25A 2H8GA 4Z51A 3F1LA 3T1YB 1ZH6A 1YQQA 5DI3A 1T1SA 5EQTA 3K15A 1GPMA 2ZBDA 3GUCA 3MM4A 3VVMA 2G04A 4FQ5A 3SQOA 2IOHA 4YCJA 3R7BA 4GKBA 5JS6A 2W6CX 1JA1A 1M8GA 3CLTD 2GCOB 4NULA 4WZ6A 4YDQA 3I5AA 4UQPA 3VZDA 4PXSA 3H16A 1FFAA 2CHVA 3JSXA 4YJ2B 1C5KA 2IYYA 2OESA 2WAAA 5IXSA 4WZBE 5T6MA 3GOQA 4NRDA 1KH3A 5F2KA 1YH3A 5I7AA 2HEGA 2PV0A 4J0DA 4M0MA 4Z2YA 3V8RA 4ILEA 5T7BA 3DEKA 2D7JA 3ZWYA 1ZP6A 3ULKA 4BRZA 1MOSA 2YWXA 2FRDC 3D6UA 1JEDA 4ZOAA 3B6KA 1BG6A 3PFKA 4XVUA 2WSMA 4DV1B 4XUCA 4J07A 1LDGA 2LE0A 4WBNA 4QFCA 1MJ5A 2PQMA 3KWMA 5FX2A 2W6MA 1NZJA 2HL6A 3BGIA 1AGXA 1CUJA 3DKVA 2HCBA 5BUSA 2C94A 3AFHA 3TQOA 4C2AA 1SXJD 1M2NA 3G9ZA 4KV7A 4Q48A 3VFDA 1JZSA 1CF9A 1FFXA 4D8YA 1DX6A 3NCHA 1KFJB 2R00A 3CXRA 3P7MA 1CNEA 3A8TA 4WZBB 5DHAA 2WTBA 2WJWA 3EUAA 2NZ8A 1J00A 1RYNA 1YKSA 1O5OA 2OHHA 4OGLA 1T2CA 1YAJA 4HY3A 2E6UX 1S9DA 3HDTA 3AM1A 4GC5A 4OL0A 3RWBA 1WXXA 2I3ZA 2BGLA 1CJKC 4CM8A 2BH2A 3REQB 3DE5X 4GVXA 2ID8A 2J9YB 4H6XA 4C3VA 5GMOA 2V7GA 4X7PA 5EZYF 2H2FA 2CZQA 1KF0A 1FYXA 3AR6A 3QQ5A 4C6TA 1L2TA 3MLAA 4KMMA 4ES6A 4S2EA 3IP7A 1XD8A 1YAHA 1QAMA 1EVQA 3QPVA 4EI7A 1SQSA 2X7XA 4NY1A 4BN5A 3GUYA 3MTJA 2FZVA 2P6NA 4R05A 1JIUA 1S7CA 1XU9A 3AUTA 3KHUA 1NKSA 3NBXX 4XYMA 4BLOA 3TFOA 2AW3A 4QGGA 2OHIA 4WDQA 2A7XA 5HKKD 2I7XA 1BMFD 3T3IA 4CUJA 3EEFA 3JVDA 4MKXA 3PR2B 5TQ0A 4A92A 2R2AA 2ZVPX 4BU1A 5KBYA 5KU1A 1QP0A 1O5TA 2P4HX 2G82A 1M76A 3BZWA 3CYFA 3NXKA 4H3KB 4OXRA 2PYIA 4WKOA 5LZ8A 1FTGA 2IK8A 5CFMA 1XRSB 3PTLA 2F8MA 5KOHA 5EZSA 1HI9A 1T8SA 4E0BA 3IVRA 2YHSA 3JQBC 3MCWA 4HPJB 5FV7A 5LQCA 1IMJA 1NVAA 3QUSA 3LA8A 3ICOA 4J43A 3KJNA 1Y1PA 4R1QA 3SU8A 2MINA 5I01A 5I7WA 1Q21A 1EUZA 3O1IC 3H11A 5JY1A 5DNUA 3M6XA 4B09A 3EVEA 5AT1A 1QO0A 5FL3A 1H42A 2WU0A 3D02A 3OLYA 4DSOA 1YASA 2BISA 3HKDB 4GPD1 5K8LA 3VV2A 4R8VA 3ZBUA 2GN2A 2J5BA 2K7ZA 2E4WA 2P35A 4LOIA 2VQFB 5EHGA 1GA4A 3SFVA 5FPSA 5CB0A 2O0MA 3Q9UA 3NBZC 1Z0SA 5MHTA 4LKOA 1IOLA 2NVBA 4QPNA 5F2EA 2A88A 3EYAA 3F47A 4KXUA 3TMYA 2IRWA 5K5EA 4PLYA 1LJLA 4LPSA 4XD7A 3THRA 2G1AA 1DC4A 3VTKA 5A04A 2AVDA 1QIHA 3BE8A 3MUOA 3IDSA 3PDWA 4H6WA 5K4GA 3OTIA 1G1MA 1Y8QB 2MU1A 4QO7A 5IAAA 1Q50A 1WZIA 5CW1A 1WV1A 1WNTA 3PUWA 1KVSA 1QVVA 2GK7A 4MGIR 3VNSA 2IBTA 1SY7A 1U2TA 2CNNA 2FW1A 2E49A 4OATA 3FCCA 2JAPA 1IULA 4NCNA 4RIIA 2PPVA 2B9EA 1DZIA 3C6QA 2JZNA 4I1IA 1A71A 1CX9B 2PEZA 1SUAA 1X7WA 4XIJA 1JE0A 3FVWA 3FUWA 3ZQ4A 4CTKA 4XIIA 2H0QA 3DEFA 1OKKA 5NULA 2LXNA 3CZRA 4OJQA 1XP5A 4EWLA 1JDPA 1LDYA 3A9WA 3D81A 1VCIA 3MGBA 2ZBUA 2F64A 5BPHA 1MXHA 1SUWA 3FMIA 4CI9A 4PC3A 4HDNB 4Z3DA 2HA4A 5DW0A 1VYHA 2WKRA 4K5QA 1Z62A 3IVAA 2EJCA 1X7GA 1VG8A 2ZTMA 4J3FA 2PQ6A 4BJ1A 1I32A 1KYQA 3G17A 2CJYA 2ZJYA 3LTEA 5C35A 3L4EA 2VVTA 4EW2A 5KSPA 3DBHA 1XE3A 3K4HA 5ETJA 3PYLA 4IJ5A 4DSZA 1VYTA 2Z57A 1G18A 2WZDA 1E20A 3DNPA 2QY9A 1SBQA 2YIVX 1R5NA 1Y89A 1E3WB 3T3HA 3VOSA 4BEVA 5JH7B 1H4SA 4MITA 5U1PA 3LP8A 4HDOB 3WYEA 1UM9A 1O9GA 2NUAB 1I7QB 5ALVA 1Y82A 3GUZA 4GWGA 1W88B 3MJSA 3TLCA 1UJ6A 3FSEA 5MF6A 1O95C 2GK6A 1IN8A 2NN3C 2D5LA 4AECA 1A7KA 2FFQA 4DMLA 3S8EA 3EGEA 1GR1A 2QTTA 1X7YA 2QZ9A 1KXJA 1MQAA 1ZZGA 1WG8A 1HTTA 3AVVA 1AS3A 4YAFA 1GZ6A 1MORA 3BJIC 4IQFA 3I53A 5YASA 2C97A 2IIBA 4D4IA 5AJTA 2Q49A 2VHCA 4MS4A 4D26A 1ZAKA 1XCPA 3CO0S 4G0NA 5E1OA 3SF8B 5BN3B 1MC8A 2IPNA 2NGRA 1EFPA 1TU4A 2OCKA 4QUJA 5CUQA 4A2PA 1U8YA 4UQOA 1N3IA 2QUZA 3TW4A 1YXMA 2Q45A 4K9LA 4B79A 3BK7A 2ZTVA 3OD5A 4RTOA 3COPA 4PR3A 4RPIA 3CE9A 4AKSA 1YMQA 1Y37A 2J6CA 3AZPA 4JZKA 3L92A 3QG5A 1DFGA 1JLRA 3TOSA 1ZGBA 5FAKA 2OCAA 4QQFA 2PBLA 3GEHA 5JXIA 4WGFA 3DE0X 4F5ZA 1MO6A 3OIVA 3PJRA 4XX0B 1A8IA 3SGLA 3DDHA 4IKPA 3AMVA 3V7FA 1DMRA 1EM8B 3UFBA 4L02A 5CDYA 2WNIA 3RFTA 2JATA 2QPAA 1AC5A 1YQWA 4K28A 2NP7A 3HCBA 3QVLA 3ZWPA 2GPNA 2ZZNA 1QH1A 2C2OA 2W2NA 4PHTA 4KQEA 3HDQA 1T29A 4RFLA 5FEMA 3HA2A 3P9SA 2VP0A 3FSGD 3USCS 4BMSA 1NE7A 4JLVA 4PNPA 1L7BA 3R7LA 1ZICA 3OCWA 5DJ5A 3AERA 3BXGA 1MENA 1T5OA 2J9FB 4JP1A 1SVLA 4PLTA 4RAQA 4NBWA 2M1XA 3F1KA 3F9RA 1CZUA 3N8GA 2CMDA 5CT5A 3E03A 4RESA 2A4MA 1BX1A 4JGGA 4Q0MA 1I4WA 4FKZA 3SBOA 2IXTA 3ZCVA 4JT4A 3ZDBA 2ZRHA 3OLQA 1JHRA 2WJAA 3RT1A 1VCHA 3KJEA 3E8MA 4M98A 4EHLA 3MRVA 4BYGA 1LY1A 4YQEA 4EJMA 2O0HA 3I01M 3N05A 4R1UA 3CX3A 2WV7A 1K27A 4RENA 4ARZB 2XXAB 1MPXA 2XQKA 1XXLA 2YFHA 2ANCA 2WMDA 2YN2A 3MOSA 3TXXA 2OFFA 3AEQB 1WKCA 2CVZA 3Q2KA 3O2JA 2RKBA 1L4KA 1Z4MA 4OLFA 3T3GA 4MIYA 4UTPA 4HHEA 1NVVR 2ENWA 1QIGA 1V8OA 2FLKA 3QE4A 4KWTA 3UMCA 1A88A 3RI3A 4O4HB 3FA2A 4N8EA 3DZBA 2IEYA 1J6UA 1DJNA 5K0SA 1CQPA 1EGMB 2JK1A 3QUAA 2FWBA 4ND1A 5K05A 3G8BA 3NWPA 4X00A 4H7KA 2BFAA 3HM9A 2B4RO 3D2LA 4CMEC 1F20A 1G7RA 2BIFA 1CNFA 3RVQA 1JZTA 4YJ2F 4XWTA 3T0FA 2EF1A 3FPAA 1V6SA 3DV0A 2FK8A 2YBDA 3L6RA 3OP1A 1B93A 3MJDA 4L51A 4WT7A 4KW7A 4CIAA 1QKIA 2EW1A 1QG2A 5ALTA 3O3MB 1SVKA 5CDGA 4LTMA 1KH2A 1Z26A 2ZSKA 3PXBA 4WXPA 2PZAA 2JLWA 4QBFA 4NOMA 3UCEA 1ULZA 4IV8A 2VZEA 3C6ZA 3FF4A 4C0HA 4OHYA 3PQ5A 3KSAC 1MV8A 2OV3A 4R2KA 1FJHA 1RDFA 5DIZA 2PFSA 1UP7A 3LFUA 3EXHC 4JLMA 3SN6A 1NW6A 2PSSA 2WVAA 4LJ8A 4WFKA 1UH5A 5A4KA 1TUEA 1ZITA 3LKDA 3I72A 1NP3A 1T13A 4DMUB 5JD4A 2C9YA 1ZQ9A 4QDOA 3S2GA 3FPKA 2NU6B 2I65A 2PN1A 5FCDA 3K2QA 4ZI7F 1F1BA 1T1JA 3KQMA 5FI5A 1JEYB 4P98A 2P6PA 3I64A 2DWPA 4GWKA 4KE7A 2PGDA 4N3CA 4CG3A 1YKFA 2JEZA 4NPCA 4RPGA 3RTCA 4E12A 1R5JA 1Z6ZA 5A1JA 4L8WB 4YY3B 4TRNA 3VX4A 4LJ9A 4XB2A 4ZOBA 4IIJF 4OXIA 1NAIA 2O7SA 1RWVA 3SHTA 2ZYDA 1GNSA 3FCEA 1C8LA 4FDUA 1JIIA 1MX9A 5LQJA 3H3FA 2Y1KA 1UZMA 3ZHCA 2IWHA 3L49A 4PIMA 4MQMA 4F7DA 3UH1A 4EMUA 3OTOB 1L5SA 1NMEA 4QOEA 1H2ZA 2VF2A 3D7MA 4JJAA 3JQ7B 3UWMA 1N2CE 2J41A 4C0BA 4R9UC 4R84A 5C3MA 2XA2A 3N1UA 2JJMA 2WT8A 4F7WA 1PLLA 3E7WA 4GU5A 4B3CA 2XNSA 3M3PA 4FX5A 4ZO7A 5JLAA 2VQEB 3DBRB 1ZAYA 1CDEA 3W8FA 2PKQP 4JYMA 4F4HA 3VR6D 5ICSA 4TMXA 3DLAA 1YQ9A 4ZAZA 3IQIX 5HJEA 1R5BA 3NHKA 1VCOA 1DHTA 1LBTA 2UVPB 1P72A 2XE6A 3DFZA 3DOJA 3NDIA 3PE6A 3IUSA 1C7QA 3A6EA 3O8LA 4OP2A 3L0SA 1VE3A 1FMTA 2BN4A 2OGTA 2Y6VA 1KAOA 4KB5A 4ENRA 5BWOA 5IJ9A 4WIAA 3GJ0A 2ZR0A 1E2KA 2GKGA 3D6NB 4MUFA 4DF3A 3KG2A 2GN0A 2V7QD 2I99A 4MGYR 5DHSA 3C6YA 4TTPA 3ABRB 3DZJA 4KQXA 4KTTE 3ZQJA 4I1OA 1ABFA 3TK1A 1YJ5A 2QX8A 3UCFA 1PNRA 3AO0B 1NSYA 4W6ZA 1IEWA 3QU4A 3SLGA 5T57A 4EK9A 2QF7A 2EGHA 4KLNA 3TIGA 3WKAA 3PC3A 1EBFA 2YR0A 2EVWX 1J1ZA 4FD3A 1DJLA 2XNCA 3IV6A 1CR4A 3ERCA 2HLPA 3LGAA 1N2GA 4S1OA 2WTNA 2ZIXB 4NG5A 3RSFA 4KQGA 2J45A 3ZI0A 2GARA 2AKEA 1NJ1A 4KRYA 1XZHA 5KYKA 4HATA 2GN1A 2WSLA 5HSGA 2ZS8A 2OENG 3C97A 1G3QA 4PFJA 2ZJZA 4Y18A 5IZCC 2C4TA 3N58A 4FWTA 2AL7A 5GGYA 3QMPA 1UK9A 4LJKA 3LW7A 4BMXA 5I45A 1ZR2A 2OC9A 1QFMA 1B8OA 1PBTA 2FW7A 4A8TA 1M2GA 5CLQA 3V4PB 3VHXB 5BMVA 5M04A 2PD3A 4AZ0A 3VDQA 4KGZA 2OO3A 2C2MA 3EZ2A 4HQ6A 1TMOA 2Q1UA 3F2VA 3U48A 1OXUA 4ZOQI 1ZD5A 2QWXA 3FVRA 4MWGA 1DJPA 2RIPA 4LDJA 4LCEA 4P86A 4RVHA 3F8WA 3ZWNA 3AF5A 1UPBA 1C8VB 3MB8A 1RRVA 4B4VA 4CR7A 1C3XA 2BSXA 4HGNA 4LNUA 4RL4A 4OI4A 4REQA 4U7PB 3TIXB 2AEEA 1DIHA 3K16A 3B8HA 3I32A 1E1CA 4E3ZA 3OEYA 4L9SA 3U9LA 3VR5A 2QN2A 1YFLA 3MFYA 4G6ZA 3NRBA 4YAIA 1FS6A 4YEDA 3EC7A 2GM9A 4Q03A 3UK6A 3X2SA 2QPTA 4LZPA 1YO6A 2C9MA 1AHIA 2FFRA 1OH5A 1WUKS 1EP2B 1JR3E 1N92A 3A6JA 2DX7A 3K2IA 4TZTA 1R8SA 1IHPA 1QIMA 3CTMA 1NXPA 4WASA 4RULA 1M33A 5EEGA 4Q4AB 1QRAA 5FTNA 2AE1A 1CT9A 3QU5A 2I6TA 2IX9A 1CJSA 3GFVA 3NNSA 3MZ0A 4MO2A 4BLVA 4P33A 4MKRA 1ZWLA 2IY9A 4OQNA 1DO0A 3AFNA 4OSPA 3OOYA 1JDVA 4RTJA 4HMOA 4C3UA 2G9RA 1K1EA 2BI7A 2GKOA 1MG5A 2OD2A 3KC2A 1JXMA 1I4LD 1F2VA 1SA0A 4FHGA 4I6GA 4TGLA 2Q0SA 3KHSA 4F3YA 3OKPA 4FFMA 3NKVA 5C1PA 1GEEA 4WOCA 5JCPA 2ZU6A 4ZO8A 5A2QA 3QF4B 2PKEA 2QMHA 1KYWA 1W94A 2X8AA 1WD7A 1WABA 3OY2A 1T4BA 3R5HA 2AX3A 3TSCA 3HVHA 1JVNA 5FUVA 1KI8A 1JZQA 1G4AE 3DGFC 2X5XA 1W5EA 3AZOA 3FROA 1P7VA 4J49A 2C20A 4A0FA 3C43A 2FTKE 4EUNA 1U7XA 4GRAA 5EJ9A 1K68A 4NE9A 1Q0QA 3H8VA 1ISHA 5G1PA 2PSEA 3B36A 4IRUB 5FI0B 1TADA 5E0KB 2F1KA 5C4IA 4FYKA 2BFBB 4TQGA 5IMSA 1L7RA 1OUMA 4S12A 4ETNA 3SXUA 2PLWA 1XRNA 4J29A 3WMWA 3CT4A 4HUQA 3SHOA 2WAOA 2A9OA 1CFJA 1T3TA 1KI9A 4WEQA 7MDHA 3IMCA 2BZSA 4IX9A 3KAQA 4R1SA 3L0BA 2XQFA 4RK4A 1I01A 2ECPA 2XMRA 1G5PA 3GO4A 3PI7A 3L7BA 3SSOA 3W4IA 1BMFA 1GAJA 5KTYA 5I9LA 5KNLA 2GLTA 2AXPA 4J03A 4MLDA 4AZ3A 1N2ZA 2GETA 5IWAB 1ZK3A 3MTIA 1PEAA 4UUAA 3RV4A 4L78A 2VRWA 4M1QA 2XXJA 3WIOA 1QV6A 2J4DA 1SOWA 2WJZB 4B9AA 1AD2A 1WP4A 3QE9Y 4PPNA 1RI4A 1M6HA 4JVOA 4ND5A 3EHDA 2C5AA 5FPTA 3EIQA 3UJDA 1OZHA 2DFPA 2EFCB 2GF0A 2WJGA 4IH9A 1JHMA 1HDYA 3EIHA 3Q5EA 5A05A 2I3BA 4EM6A 1P2FA 2QG4A 4BB0A 5J59A 1UQTA 2WR8A 2W8ZA 4FXOA 3QY0A 1GZ7A 1UBNA 2PMKA 2VRCD 4O8CA 4XJSA 1L7QA 4XTRA 4XRGA 5ELLA 1JIQA 4G4GA 3K1AB 1F8GA 2WHEA 1YOVA 1X6VA 4RSHA 1X7XB 3IUBA 1F1JA 4AY3A 4CTJA 5K8UA 3IVGA 4MWEA 4ECAA 4CTMA 3HN7A 3U31A 1A9XB 3L0YA 1FNNA 5JNUA 5DP2A 1Z34A 2ZUSA 4JKIA 1E4OA 3ZD7A 4DBLC 4JAVC 2OSVA 4WK6A 4PS1A 4HH1A 3VYSB 4D4LA 2NU7A 1R5OA 3HEBA 2BMFA 3V1MA 3QTBA 2V98A 1NXSA 1KYIA 3FKQA 4GZ5A 4JI2B 3WI7A 2HT6A 1M2EA 3RFVA 4I66A 5KYYA 3RYIB 3BWVA 2P4QA 3LT2A 1HORA 3RK1A 3RJZA 2J30A 4I5FA 3RUFA 3SC2A 3W5VA 4ZQGA 3EH2A 1OLXA 4JODA 3ROQA 4GKAA 4WOPA 3VJRA 4M21A 1K3UB 4OSOA 3HZRA 1P73A 3U39A 3AESB 4DV4B 1YR3A 3IMEA 4P31A 5C32A 1R8YA 2AWNA 1QGYA 2ZAIA 1QF7A 3LDUA 3TRFA 1SB8A 2F8SA 1SXJA 3N2KA 3H1PA 4JCCA 2ZUTA 4W8HA 2ZXUA 1PP4A 5BWLA 1WSBA 3PDJA 2QVGA 1P33A 4ZQBA 2Q5HA 3GBPA 3OMXA 5EXXA 1T6NA 1K6EA 1JR2A 1JILA 2QRLA 3UWKA 3WNVA 1GPJA 3E27A 3KZVA 4X9XA 3RHFA 4AUMA 2F3RA 3ZVRA 2WILA 3T1HB 1NFRA 4W8OA 4P7JA 5JAQA 3FMOB 3QM1A 3NATA 1SD5A 1C1HA 1FRVA 2QLBA 3PWKA 4MV6A 1N1GA 4E13A 4ZTZB 1FRZA 2I80A 3Q3EA 1XNJA 3KD2A 1N2IA 1SBZA 2JI6A 3ZCTA 4HCJA 5IC6A 4D74A 1YR9A 4DAOA 4RJTA 2R85A 3GDWA 3DP9A 1E1DA 3CXUA 4HG2A 2Y1FA 4JMPA 5IS2A 5JD6A 4OBEA 3AU9A 4N7RA 1DCKA 1N1EA 2C2WA 2FMFA 3B7GA 1VL0A 4C07A 1K8YB 1USUA 4LVNA 3ANNA 3K72B 4KXQA 1VGRA 1L8XA 4MV8A 3QPAA 3KE8A 1R0KA 2CKDA 4GPEA 1C7RA 1R8QA 4UC0A 1KYVA 4XJVA 5AUOB 2EKDA 3BXOA 3ZU2A 3T6KA 1DT5A 2QGFA 1JSRA 5DZSA 1DUIA 1PFVA 2JJ8A 2W2LD 4WCFB 5G4LA 1JMYA 1EG2A 3RC3A 5L45A 1NTRA 4CEIA 1RLTA 4AMYA 2PQ0A 4OHPA 5FYQA 2D7CA 3EA4A 4DIKA 4F96A 6REQB 4PQGA 1OROA 2VJCA 4GZ6A 3ETCA 4ZAGA 1TYDE 3P71T 3ASYA 1IXSB 2KMLA 3CNOA 1W85B 2OCXA 4WERA 4D8TA 4US0R 5IJZA 5IASA 4R2JA 5KREA 1K7EB 3JQ6A 2P7IA 3CPSA 3VYWA 3KWFA 1NNUA 2D62A 1ONOA 5C7YA 2IZ5A 3LHFA 4JC8A 1Z75A 4Z0TA 2P5SA 2ZIAA 5SYNA 2P2SA 4MWSA 1NY6A 1Q2XA 4AY5A 3E5RA 4MHSA 4MVWA 4ND6A 3UG7A 2ZRAA 4I5DA 2XVAA 1UPAA 1VE7A 4RXTA 3PEYA 1U0BB 2FUG1 1GUBA 1X9GA 5AUPB 3RT7A 1ISGA 4UBLA 3PGMA 4GZLA 5L7WA 2PZEA 3NKLA 5EKXA 4CKYA 2VBIA 3W78A 4IILA 2FRDA 2PVPA 2DTDA 4TTIA 3ZWBA 5KTOA 1HMYA 1HNNA 2A9PA 4JYZA 8AT1A 1SVWA 4BMVA 3IEUA 1IYZA 1GCOA 1YC5A 1YSCA 2WHQA 2DU8A 1P6UA 3B1VA 3GFBA 1NYRA 3WGZA 4EJ2A 5LIRA 5AVUA 1WUJS 2RGCA 2YQ5A 4R8KA 3VZBA 2QTV