3WR5A

Structural basis on the efficient co2 reduction of acidophilic formate dehydrogenase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
401
structure length
401
Chain Sequence
AMGSMAKILCVLYDDPVDGYPKTYARDDLPKIDHYPGGQTLPTPKAIDFTPGQLLGSVSGELGLRKYLEANGHTFVVTSDKDGPDSVFEKELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHVDLQSAIDRGITVAEVTYCNSISVAEHVVMMILGLVRNYIPSHDWARKGGWNIADCVEHSYDLEGMTVGSVAAGRIGLAVLRRLAPFDVKLHYTDRHRLPEAVEKELGLVWHDTREDMYPHCDVVTLNVPLHPETEHMINDETLKLFKRGAYIVNTARGKLADRDAIVRAIESGQLAGYAGDVWFPQPAPKDHPWRTMKWEGMTPHISGTSLSAQARYAAGTREILECFFEGRPIRDEYLIVQGGALAGTGAHSYSKGNATGGSEEAAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis on the efficient CO2 reduction of acidophilic formate dehydrogenase
rcsb
source organism Thiobacillus
molecule tags Oxidoreductase
molecule keywords Formate dehydrogenase
total genus 137
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.2: Transferred entry: 1.17.1.9.
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wr5A01
3B6ZA 1TEHA 5A1TA 3E18A 5IJZA 2HJRA 3KXDA 1C0IA 3QW2A 1PL6A 1ISMA 3LC2O 4OKNA 3DZIA 3JV7A 3ENKA 3ITKA 4E3ZA 2JAHA 3EUWA 2JCXA 4FFPA 4XQ9A 4W7IA 1WXDA 3W4IA 2JFGA 3DBRB 4CM4B 3L9WA 4U7WA 4IIUA 4WNIA 3A1NA 3VPGA 3MTJA 1SB9A 1U4SA 3OFSA 5IFLA 4IQ8A 4DYDA 1QYXA 4XB1A 1GUYA 3GUCA 5DP2A 1PS0A 2YUTA 4DIOA 2CY0A 5B4UA 5AOVA 3E1KA 1VM6A 2JKVA 2X0JA 3GDFA 5TGDA 2DFDA 3ETGA 3ICCA 2A94A 1MGOA 2Q46A 3QWAA 3ORFA 3MJCA 1ADFA 4ZQBA 1YL7A 1WLYA 1YOVA 2JJYA 3HE3A 3ZU4A 1WMAA 4TROA 3GH3A 3NJ8A 1R4NA 3B1KA 1R0KA 5A05A 3SC4A 1DAOA 1GYPA 4AVYA 4W99A 1JWBB 4CM5A 2FP4A 3S2EA 4E21A 4BNYA 2VTEA 1X0VA 1XDWA 4U6QA 5K9ZA 4RF5A 1U3TA 1EVIA 4A03A 4CQLA 2O7SA 4TZKA 2EV9A 1IOLA 3U4DA 3VDRA 3RUCA 3LF2A 4R9RA 2Q4BA 4H16A 2X6TA 3GGGA 2BRUA 1D7OA 3GDGA 4OOFA 2VHYA 4DGSA 3GVIA 1B3RA 4KTVE 4R01A 1HEUA 1U7HA 1ZZEA 2UDPA 5G0WA 3IL2A 1E3IA 3JYNA 4PVDA 3DZJA 4OM8A 4AJ2A 2D0IA 5TRTA 2X5JO 2X5OA 3ZWNA 4JX8A 1U5CA 1Y8QA 4E2ZA 4BNXA 4RDHA 1E1NA 2PZJA 3ZCXA 3LZ6A 4OO3A 3EMKA 1J6UA 4IMPA 3JSAA 3L6OO 5TF4A 1LLUA 3PGJA 5JYEA 2WMDA 1L7DA 4OXYA 3S8MA 1Y5RA 4UUPA 3GEGA 5JAMA 2B4QA 3PRJA 1FDSA 4IGEA 2G0TA 2VHXA 4RLSA 4CV3A 1LDEA 3Q11A 5TT1A 2YQ5A 1MXHA 4OGWA 1TT5B 3NAQA 3HJAA 4TVBA 3VOSA 5KJFA 8LDHA 1BSVA 1LDBA 4KTTE 2HKIA 3MTGA 2VUTA 3RASA 3STHA 4L76A 4WKGA 1QV7A 3R0IA 4CUJA 4YR9A 1SEVA 3DHYA 1JQBA 4FFOA 4PLWA 3HFSA 2OUIA 2FWMX 1NASA 5FWNA 1T1SA 5L40A 1JKFA 3GGPA 1UXGA 1RM4A 1K2WA 2PLAA 1CEQA 3R6DA 5H83A 4IDDA 4ZGWA 3QWFA 3RBZA 3QSGA 3HWRA 3M1LA 3PI7A 5BT9A 1MFZA 1SCUA 4PGFA 2FSVA 1T4DA 3U0BA 4J1SA 3VZRA 1UXJA 1E1MA 5THKA 2CSUA 5KVVA 4BO9A 2EJWA 4HFRA 3BYZA 2EHDA 1GYQA 4BO6A 1GU7A 1ZJYA 2Y0DA 3DTYA 5JC1A 1AN9A 1Q0LA 4EITA 2BH9A 1AXGA 1MG5A 4YJDA 3SBOA 3ST7A 5FEUA 5JO0A 2G82A 1O9BA 1KERA 1MV8A 2CDBA 4WGGA 3ON5A 1JKIA 3EVTA 4YTEA 4WCFB 3RC2A 4PCVA 1CETA 2R00C 1JVSA 3ZH2A 3WS7A 1E0DA 3WWZA 4JK3A 2O3JA 4I5GA 1KVRA 4UVIA 4GLLA 1I3NA 4HKTA 2A4KA 3W8EA 3ZWVA 3IOYA 1DIRA 2R2GA 2VHVA 4J16A 2FR8A 4MVJH 1V3VA 1SOWA 3KLPX 4L74A 4BB5A 5CDUA 1SBYA 3QP9A 4FN4A 3JQ9C 3E9MA 1M67A 1PJBA 4Q3NA 2VYND 5I7EA 3KUXA 2RHCA 3Q2IA 3UKOA 5IXYA 4NHEA 2NU9A 1I2ZA 1N2SA 3BMNB 3BMOB 4I8XA 5JPIA 1KVQA 5KVCA 1ADCA 3F5QA 4GSLA 2D5AA 1E6WA 3KYBA 2OBNA 3I52A 2HK9A 1I01A 3JCZA 3UW3A 3NT2A 3SJ7A 3H5RA 4ZU3A 1GEEA 1TT5A 5JE8A 1B0AA 1R0SA 4PLHA 4EEXA 3D5TA 4CMHA 2FR0A 1QMGA 2VYNA 3L77A 2Y1EA 4E4YA 4FBGA 5G4KA 3FPCA 2GGSA 1NM5A 2WD8A 4D3DA 1P44A 1AE1A 1EK5A 1DPGA 3NTRA 4KP7A 4DWVA 5A04A 3NDRA 4M54A 4TKLA 4TSKA 1MC5A 3D1LA 1IL0A 2P68A 1C1XB 4DLAA 3EVNA 2AW5A 2X58A 1PJCA 3OM9A 2DBZA 3MJ4A 1D8AA 2EGGA 1JN0A 2RAFA 5KKCA 3WGGA 2BELA 4TQGA 2I9PA 1GZ4A 3W1VA 4RPJA 3JQAB 1CQJA 2EKLA 4GWKA 4EZBA 1XR3A 2ILTA 2W2LD 3RC1A 2X9VA 2D59A 4PG8A 4Y6RA 5BSFA 1M6HA 2VYVA 5JCXA 2J6IA 3CXRA 4MPDA 3AM4A 1LA2A 4NBVA 4UVEA 3AM3A 3MJSA 4YXFA 1B8UA 2PD6A 4ZRMA 2YQ4A 3ZWXA 1OI7A 3WB9A 1B7GO 3JQEA 1F0YA 4WEQA 2IZ1A 3F46A 4GKBA 1HYHA 1CDOA 4BUCA 1VKNA 3TF5A 2DFVA 3K6JA 5TJHA 4WOKA 2I67A 4CL8A 4LMPA 3H3JA 1E1KA 1G0NA 2J5KA 3G49A 3GAFA 4K9DA 3L6EA 4IDBA 3VZQA 2B35A 3RUDA 2WWRA 4YYZA 1LSOA 4EYEA 3GVCA 4J7UA 3AW9A 3JQCA 4DTIA 3GVHA 2PD3A 2AE1A 4QO7A 5HWSA 2G17A 3CMMA 3GHYA 3WBFA 4E30A 6LDHA 4GL4A 3GY0A 3FRJA 4HV4A 3ZV6A 1ADBA 4MVJA 1HSZA 4EW6A 3VH1A 4ND1A 3ABIA 5L45A 3F4LA 3WNQA 4Y8VA 3D3EA 2DQ4A 2P4QA 3WJ7A 3H2SA 1LC0A 4MP8A 2ZTVA 1F8GA 3BA1A 4GX5A 3OICA 1I3LA 1GQ2A 3ADPA 1GR0A 2FOIA 1DEHA 3PPIA 4CLHA 2PGLA 5JAQA 4IDCA 1C1DB 3KSUA 4R1UA 3DL2A 2OO5A 5JLAA 4CM4A 1PJTA 2W8ZA 2OMEA 2JCYA 3SX2A 3RVDA 2QRKA 1TXGA 1WVGA 4RGBA 3RJ9A 3NT5A 4BL5A 3DAPA 1ZNQO 4IDGA 1UZNA 5C5IA 2J3HA 4OAQA 1Z75A 1BXKA 3VDQA 1EUZA 4XYBA 2BFPA 3WDSA 4I1IA 1VL6A 5CEFA 4Y9DA 2O3TA 1B16A 1ZCJA 4UEKA 1WPQA 2JAPA 4AJOA 1BVRA 1VC2A 1ENPA 1UDBA 3GMDA 1DO8A 3H8VA 5C3MA 5CDYA 1F14A 1XG5A 2AHRA 1GTMA 4OSPA 2B5WA 1PGPA 3CPSA 4PLTA 1O89A 4IINA 9LDTA 4RQTA 2V6MA 3ZU3A 1U2DA 1GV0A 3RI3A 3T4XA 1WMBA 1N1GA 2I76A 4FD3A 2BGKA 3RFTA 5A9TA 4A26A 3SC6A 4E12A 4ZJUA 2Y67A 1LRJA 3GZNB 2BMAA 3ROKA 2PZMA 3JD2A 5ILOA 1HF3A 1H9BA 2D2IA 2A9FA 3C1AA 4E5NA 3KM0A 1V6AA 3DZFA 2WD7A 1U3VA 5TSDA 1NNUA 4TKMA 5DNAA 4M49A 4BGIA 3JTMA 3AY7A 1KVSA 3PFFA 3P2YA 4E2WA 4DIBA 2YDXA 1MG0A 4Z6KA 3BXXA 2W2LA 3GG9A 4MVJI 4J7XA 2UV8A 4IPTA 1N9GA 2BKAA 4JN6B 3CSDA 4BNNA 1ARZA 1K0UA 1E3LA 2ZJ0A 2WD7B 4ND3A 4DL9A 1H94A 1BW9B 4RVGA 4XR9A 2RHRA 2ZTMA 4KWHA 1E7WA 1ONNA 3JD3A 5TJ9A 1FDVA 4NU5A 4B3HA 1WZEA 4BMSA 2GSDA 3RD5A 1Y9AA 4FQ8A 4B3IA 3C7DB 1Y8RB 1I32A 2O2SA 5ER6A 3ULKA 2RBEA 3WGYA 1ISIA 5TLSA 2C20A 2FR1A 3NV9A 4IDFA 5T8KA 5EQFA 3I6QA 2NU8A 4HP8A 3IUSA 2CVZA 2HSDA 4BMVA 4FB5A 5F1KA 1CIVA 5C7LO 2X22A 2RIRA 1BVUA 5KWEA 1N8KA 4HNGA 4O6VA 1NVGA 4CODB 4HX5A 3B70A 3R3SA 3AUAA 5C37A 4XIJA 4FFLA 1JLLA 2DPGA 4B3JA 3EHEA 3GVXA 1UZMA 5TS3A 4OQYA 3TZKA 3TPCA 1XQ1A 4KDFA 3S2GA 4PG6A 2B4TO 3U4CA 4AJPA 4R1SA 3QWIA 3KTDA 5DCWA 4CMIB 5BQFA 1FJHA 3ZWCA 3QVXA 4BMNA 4W7HA 5IDWA 1HZJA 3PDJA 3DBLA 4HFNA 3PVZA 2LDBA 4GI2A 2CZCA 3ANNA 2B83A 1AHHA 4YRDA 1GUFA 4IM7A 1MA0A 2GDZA 3GN1A 2DLDA 1PU2A 1XSEA 2NQ8A 4RF2A 3VTFA 3JD1A 3IP1A 4BNZA 1LXCA 4P8RA 3ZNOA 4BKQA 1T2FA 3RUHA 4JGBA 5KVQA 3OJ0A 3DQPA 1P1RA 1ZH8A 1D3AA 3ONFA 3U4HA 3AI2A 1PGQA 4GAEA 3IUPA 1EVZA 2NVUB 4ZHSA 1RYDA 3M1AA 1HXHA 3C1OA 5IN4A 2CDAA 3GFGA 3K9QO 2VN8A 1ORRA 2A92A 3ETEA 3VHRA 2GRAA 2Y1OA 4CLEA 3QQPA 4WLEA 4XYGA 3EGOA 2UVDA 4R3WA 3HDYA 4MKZA 4OXNA 5DCYA 3UN1A 1Y5MA 2FRDA 3SXPA 1DHTA 3PIDA 5IDQA 3O03A 3H9EO 1U1IA 1KC1A 1MC4A 5A5EA 3LLSA 1ZSVA 1ZK4A 1KVUA 3QRWA 4NFSA 4I5FA 5LDHA 4ND5A 2VWQA 3MOIA 2NTVA 4E0BA 5EESA 3WGQA 3DTTA 1I3KA 4PRKA 4CM6A 1DIGA 3DAFA 3V2GA 2F00A 2Q2QA 1EQUA 1VKOA 3KLMX 1U7TA 1N7HA 1SB8A 3LT2A 3CZRA 1EBFA 4J9UE 1YE3A 3ROPA 3CH6A 2BD0A 2NVBA 4XGNA 4DQUA 5CG2A 5I7FA 3FTNA 1Z45A 4AJKA 4BGUA 4RCVA 3FBGA 3H6KA 4R51A 1EEHA 1PZEA 5TT0A 3ZDFA 3WICA 1HSOA 2C82A 5HBRA 5L4SA 1E7QA 4FW8A 2OHXA 5HM8A 4BGEA 4QQRA 4QFCA 1PR3A 1W8DA 4QX6A 4YA6A 2G76A 5JW6A 4CMIA 1S7CA 2B36A 3N7UA 2C29D 3ICPA 3W6UA 1EE2A 3IIEA 1KS9A 2YY7A 4P4NA 2O3QA 2Y1FA 4BNKA 3GEDA 3HB5X 4F46A 5G0VA 2FPGA 4RORA 3GOHA 3X2FA 1ZEJA 1XU7A 5ENVA 2Q2VA 3QV1A 5A06A 2VHWA 3L07A 3LDHA 3WX0A 1NVMB 1GPDG 2O50A 3MJVA 1LLCA 4NU6A 1PS8A 2LDXA 4RVSA 1WAMA 1ZK0A 3PHJA 4BNTA 3S2IA 5L4NA 4Z3KA 4LRSB 4OMUA 1UR5A 3IS3A 1LLDA 1DDOA 1HETA 2PA3A 4J3FA 1T25A 1PJLA 3ZWOA 4BO4A 1IULA 1XKQA 3OSUA 4TMFA 3N58A 1IPEA 2ZCVA 4R5MA 1P33A 1N92A 4J4BA 1GFSA 4F3YA 1NP3A 4L9RA 2J3IA 2FZEA 4NZ9A 3KYCB 1I3MA 4N5LA 3AM5A 3KETA 4J90A 5DOZA 4BO5A 3NDJA 4BS9A 3ZW9A 3HUDA 1H93A 4CM8B 4XDZA 4BV8A 3GZ4A 1ONPA 4MDHA 4L4RA 2AEJA 4NH4A 2DM6A 2OFPA 3HG7A 4II3A 2DUUA 4J1TA 5GMOA 4BVAA 4EUHA 1P77A 1UP6A 2WE7A 2VRCD 2FN7A 3V1YA 3BMCB 1NQ5A 4BNHA 2X86A 1I2BA 1L1FA 1NFQA 3OF2A 3I4CA 4R41A 2BFAA 2I3AA 3KEOA 4WUVA 4CLOB 3IKTA 1DFHA 1W4ZA 1HE4A 1GADO 1BXZA 1X15A 1J4AA 2EW2A 2XXJA 4JXKA 3UOGA 2VYVD 3VPHA 4DA9A 2CFCA 3BAZA 4E33A 2B4RO 2ZYAA 1ISFA 4J2OA 2GZ2A 2QZZA 2WTBA 3BTOA 3H9GA 5LC1A 4ALJA 1NHWA 1X14A 4GX1A 2BI7A 1PQUA 4KMSA 2DBVO 2HJSA 4O59O 4GX0A 4DYVA 4JP2A 3PTZA 5JO9A 4ONEA 4G81A 1EE9A 2IODA 5JBIA 2IEDA 1W0CA 4YT5A 1VI2A 3AFMA 3I9OA 1DB3A 3FR8A 5JY1A 2YDYA 1PGJA 4C7JA 4DIFA 4HBGA 5EL0A 2V6BA 2H1SA 1ENOA 3KBOA 2VOEA 1IZ0A 3MZ0A 4PG4A 3FNFA 4AL4A 1KEVA 2H9IA 1IUKA 1NPDA 3L9XA 3DZGA 4JBHA 4N7RA 1H2BA 1PL7A 3PJGA 4N18A 1MXFA 2JD0A 4CMBA 1BRMA 1LU9A 4DQXA 3DO5A 3AUTA 5ICMA 1E3JA 4U0JA 1EK6A 3GPDG 4YRBA 4J2HA 1E3EA 4XYMA 1YJQA 2P9CA 1YONA 2ZQZA 3E48A 4U8GA 3HADA 4JQCA 3NT4A 1BXGA 3ONEA 4UVGA 4ALNA 1BXGB 4BV9A 4HUJA 2JHFA 5IDXA 4M89A 1OC4A 4MIOA 2GN6A 1P0CA 2QIOA 4R68A 4B7CA 3EDMA 4E5KA 5TX7A 4MO2A 1NR7A 1OMOA 3PK0A 3WGOA 2Y0EA 5TQVA 5MGBA 2Z5LA 2NVWA 1YS4A 2WE8A 3JQFA 3ROMA 2PWZA 2PD4A 4UAGA 2D1YA 1ZVMA 4E32A 2I5PO 4PFJA 2EP5A 3KYDB 3UVEA 1LTHR 1BGVA 1P31A 3OBBA 4YAEA 2OBYA 3OP4A 5G4KB 4Q3AA 3GFBA 1Q7GA 1H6CA 3D4PA 2GF2A 3NKLA 1JAXA 2W2KB 2ZYDA 4AJ4A 1NAHA 3C1TA 5GY7A 3U3XA 2E37A 2DTEA 3LC1O 2O3RA 4YVFA 2PGJA 4NFHA 2X7HA 1G0OA 4BO8A 3DMYA 4QSMA 2PK3A 3T7EA 3Q3CA 1BMDA 3ZU2A 1YB1A 3G17A 2YW9A 3AU9A 5L95A 4KUEA 3OQBA 4WCDA 2HK8A 3GEMA 1UZLA 3UUWA 3TJRA 3DWFA 2D4AA 2BI8A 3O8QA 4YAIA 4NNJA 2DC1A 3X2EA 2ZKLA 2JFHA 1O0SA 3BMCA 5AXBA 4BNUA 4F6LA 1R0LA 3KHUA 1GCOA 1GQQA 2VZ0A 2EXXA 5C7OO 2EEZA 1OZAA 3RJ5A 1DLJA 4WEOA 2Y0CA 1D1TA 4DPMA 1NQTA 4TRNA 4ZVVA 3VPFA 4DC1A 4L4SA 5MDHA 2B69A 1RM5A 2HRBA 5HS4A 1B8PA 2VHZA 3DB2A 1X1EA 4XGIA 3SEFA 4H7PA 3AK4A 3WYBA 3GF4A 4IQGA 4B8ZA 1R4MB 4UEOA 4J49A 4BKRA 4D42A 1C0PA 2IXBA 2VNSA 1V8BA 1YBVA 2PH5A 4GX2A 5JCJD 3DR3A 2ET6A 4JBGA 1QR6A 1CYDA 4ND4A 4K1LA 3A06A 4IUYA 1Z82A 3TSCA 2Q99A 4YJHA 1DRVA 3LVFO 4WK6A 1UUFA 3I9LA 2O48X 1PSDA 2X0NA 3IAHA 3BTSA 4NJMB 1EFLA 5IXSA 3WMXA 4O63O 2J3KA 4B7UA 1GY8A 3AY3A 3CTMA 1VJ0A 4MVJE 1LDMA 4NR0A 2VWGA 1T2EA 2X23A 3HZZA 4QUKA 1QLJA 4JJIA 4QXMA 3RUAA 1O95A 3L4BC 1T2DA 3JYPA 2P91A 1UAYA 1UXIA 1ZK1A 1UH5A 3ROQA 1PQWA 2VZ9A 3WQQA 3GA0A 3TZHA 2DTDA 2C54A 2NACA 5JYDA 4RPHA 1QXSA 5BSEA 1KEUA 3PWKA 4DC0A 4ID9A 3I6IA 3ZV5A 3GC6A 4YT4A 3ZHBA 1EDOA 3FNEA 1LDGA 2ZB8A 2ZQYA 3Q0EA 2GASA 4OOEA 2YHUA 3MJEA 1YDWA 1NR1A 1GPJA 4IJWA 4BKOA 1HL3A 3L0DA 2VRBA 1HLDA 4LCJA 3PZBA 5EPOA 4IIVA 2E6UX 3WLEA 3OEWA 5U1PA 1A9YA 1N7GA 3WMWA 3GHHA 4NQZA 4L0QA 2YZ7A 1ENYA 1H6AA 5I9LA 4L8VA 1ISJA 1MFPA 3EYWA 1LEHA 1G6KA 2EG9A 4GGPA 4JP3A 3AFNA 4Y67A 1WWKA 4CMEC 1B8VA 1PX0A 3IQDB 4CM3A 1PIWA 4XQGA 5B4TA 4CQMD 2Q50A 1A5ZA 4J7CA 4NBUA 1T26A 5G0UA 4M8SA 1V35A 4A73A 4BIIA 1LDNA 2GR9A 1NQAO 4KUGA 4NJMA 4BHTA 4UUNA 4II2A 1Z73A 3WLFA 1X7DA 4Z9XA 1J0XO 5U9CA 1SEPA 3GUYA 1WDLA 3H5AA 1VSVA 3EW7A 3AU8A 2IYPA 1UXHA 3H4VA 5JC8A 1ULUA 1DC4A 5DULA 1NVTA 1Q2XA 2I65A 2IZ0A 1JAYA 1VLLA 3JQ7A 1ID1A 1PTJA 1ZKMA 4ZRNA 1SAYA 3AOGA 4CUZA 4IDEA 3ZGYA 1YOVB 2C2YA 3BTUA 4ESOA 1C1DA 5COQA 5KJCA 5ES3A 3DFZA 1A71A 1E6UA 1PJQA 2X0IA 3AI3A 5H81A 3JQ6A 1J49A 3WGHA 2PKQP 3SVTA 2D3TA 1DIHA 1HE3A 3ZHYA 4DUPA 1AUPA 3WBBA 4QEDA 3H9UA 3W8FA 2IRWA 1I5RA 3K73O 1IYZA 4E13A 2X8LA 3NRCA 1FDTA 5L4LA 1JVBA 1ZSNA 4NPCA 3UF0A 2P9GA 3PHHA 5JNLA 4GMFA 3PQFA 2JHGA 1P1JA 3U49A 2AG8A 2B5VA 3NTOA 4WLFA 4ROSA 2W4QA 1WZIA 1HT0A 2C5AA 2W2KA 2PR2A 5ITWA 2QYSA 2YFQA 1H0KA 2XPCA 3CE6A 4RDIA 2PZLA 2HMWA 1YO6A 3KYDA 1NHGA 3VPXA 1VL0A 1Y9EA 5KVSA 4WJZA 3INRA 3HQ4O 1D4FA 3ZNQA 4RO0A 2O7QA 4YWJA 4FOSA 4Q3BA 4OIMA 5CDSA 3BIOA 1XGKA 3GNQA 3Q6IA 3M2PA 4WLVA 1MB4A 5A03A 1UAGA 3AWDA 1LSSA 3EC7A 9LDBA 2WDZA 2QYTA 1B3BA 1SO8A 5DN9A 1XHLA 3PJFA 1P74A 2AQHA 2BLLA 4YACA 4DRYA 4YT2A 1K6XA 1SC6A 4MJLA 4BO7A 1PZGA 5FF9A 2PTGA 5F1OA 4CMEA 2CUKA 3I5MA 3PJDA 4IDAA 4E5YA 5A9SB 1DHRA 2E82A 1BW9A 3QE3A 5FI5A 4A7PA 5CDGA 2UYYA 3FSRA 4CL3A 5A3VA 2E48A 4RPLA 3G1UA 1B14A 5EJ2A 2DBQA 3W8DA 2X9NA 1NX6A 3G1TA 3WR5A 3PYMA 3EAGA 3A28A 3OETA 4N54A 4IXTA 2QG4A 4ZQGA 4D7AA 5KOIA 4GGOA 4PG7A 3VC7A 4EI2A 2O3SA 3F4BA 4JNKA 4CMKA 3V1TC 2YYYA 4BO3A 3MOGA 2P9EA 4JBIA 2Q2WA 2ZYGA 2BHLA 4LGVA 2ZATA 5B37A 4DXHA 1DIBA 1ZK2A 2I6TA 3JQBA 3C24A 3TRIA 1PJSA 2PH3A 1N1EA 1UXKA 2V65A 5AYVA 3VZSA 3KEQA 4KOAA 4A2CA 3P2OA 1I8TA 4ZQHA 1J5PA 2DT5A 4CMJA 2W90A 5COAA 3BHJA 3MJTA 3JYQA 2RH8A 3ZI0A 4CMGA 3SLGA 1CJCA 3D7LA 1E7MA 3UGKA 5K0ZA 3GVPA 1DOHA 2VT3A 1B15A 2Q3EA 5HTOA 5CAEA 1S6YA 4O1MA 1DBVO 2X9GA 1IZ9A 2NV6A 1F06A 3AOEA 3U4IA 3TOXA 4XJSA 4PLCA 1Q1NA 2C0CA 1GAEO 4UEJA 2R6JA 3GRPA 3GN2A 1IHXA 4FJ0A 3O4RA 4BGVA 1EVJA 1XIVA 1HDCA 3LT1A 3PHIA 3ZV4A 2EW8A 1RWBA 1EQ2A 2BFOA 4R9SA 4UUMA 2WSBA 4EUEA 3NGLA 2JL1A 4ILKA 1UJMA 5IDYA 4DVJA 3PYLA 7ADHA 2H6EA 1JW9B 1HDRA 1I30A 4FGSA 3UFXA 4RZHA 1F8FA 2GCGA 3G3EA 3QJ5A 4JIGA 3WGZA 5IF3A 2YHIB 3RU7A 1VSUA 2YFHA 3JQ9A 4FGWA 2OGUA 3QIVA 3QWBA 2P2SA 3NDIA 2GYYA 4OSOA 3AJRA 4IGFA 5K6AA 4JCOA 4ZQFA 1CERA 1M6WA 5DBGA 1HDXA 5GZ3A 3EY4A 3H7AA 3W4JA 4AFNA 4OYRA 4R16A 3I3OA 1E6EA 2AXQA 4OL9A 4D3SA 3GNSA 4GWGA 3DONA 1YXMA 4YEDA 4B4UA 1C0LA 4NBRA 3T4EA 3RC7A 2G5CA 1HYEA 1WW8A 3PQDA 4LVCA 1DC6A 4QTZA 4WECA 2ZB3A 3OJFA 4CV2A 2PZKA 3FWZA 1RPNA 4INAA 4GVLA 4UUOA 4R4JA 2O2YA 3TL3A 1E5LA 4P38A 1X7GA 3IC5A 4H3VA 2GUGA 3OQ6A 3PP8A 5IZCA 5AXCA 1ENZA 3NGXA 2A35A 3Q9UA 1ZXLA 2Q49A 3GLQA 4R1TA 2AQIA 3PLRA 4K6CA 1TI7A 5DOVA 1LC3A 3E8XA 4J4TA 2IEBA 2NU7A 4ALKA 4B4WA 3OH8A 1KC3A 3K92A 4RVHA 3GMSA 4AJEA 4CLXA 5F1PA 5G0TA 3C8MA 4LCEA 4LVUA 3RUIA 4CJXA 5KJEA 1QYWA 5FYDA 1P9LA 3TWOA 1Z7EA 5DT9A 2Y05A 1GZ6A 1NWCA 4J4HA 4MVJP 1K89A 1IE3A 5BNIA 3HB4X 3WNVA 4JLWA 4XB2A 1ULSA 3OIGA 2Y68A 3WSWA 2AG5A 3LT0A 3KB6A 5T6BA 4CMAA 5A4DA 1A9ZA 1PJ2A 1T1RA 2OP0A 4DMLA 1T2AA 1QP8A 2E4AA 4FPXA 5AXAA 4G65A 2B0JA 2W98A 3U5TA 3QVSA 3QWHA 5HA5A 4TVOA 3RROA 1CRWG 1E7RA 1HE2A 2GZ1A 1PGOA 2P5YA 3O26A 3FI9A 3H65A 3BTVA 2HO5A 3VTZA 5BSHA 2CVOA 1FDWA 3U09A 2VCYA 3I9MA 5B12A 2GN9A 1E77A 4Z3DA 2AE2A 2YJZA 1DJQA 4URFA 1HDYA 3ZU5A 1U4OA 2HMSA 4AJNA 1YBMA 3JQ8B 1QYVA 4MVJG 3ZW8A 2GZ3A 2GNAA 1PWZA 1NTOA 2EF1A 2ZB4A 4FC7A 1WDMA 1Z7BA 1LSUA 4IJKA 4D43A 4JJFA 3F47A 1U2GA 1K5HA 1QLHA 5T67A 2NTJA 3JQGA 1HTBA 3BMOA 3LU1A 3GQVA 1HKUA 1ZK3A 2P5UA 3U62A 1KYQA 1OC2A 4B8WA 2OOSA 4NI5A 3WTBA 5JDCA 3MEQA 1XEAA 1KY5A 5CEEA 5JAIA 1PZHA 3WTCA 4D79A 5CPFA 3OEYA 1EBUA 4EBFA 3FPLA 3ZWMA 4G2NA 1TLTA 3GG2A 1C3VA 4IXWA 1F12A 1NYTA 4E31A 1W6UA 2ZK7A 3OJOA 3ZWPA 1U9JA 3WYCA 1P1IA 1QG6A 4FDAA 2F1KA 1G1AA 5DBIA 1SOVA 5F5LA 4EDFA 1Q7BA 2H63A 1Q0HA 3ANLA 3RAJA 3VH2A 2Q1WA 3I83A 4OHUA 1DLIA 4WOJA 4GH5A 4X54A 3W4KA 1BHSA 4HFMA 3P7MA 5B1YA 3TFOA 5IZCC 1P1FA 4R54A 3W6ZA 5ITVA 2EKPA 3GR6A 3VVBA 3HFGA 1GUZA 1MX3A 1E7SA 1YGYA 1WNTA 2FZWA 3D64A 2FPIA 4OKIA 2JD1A 1KY4A 3C85A 1H2HA 2Q1UA 4IJUA 5JS6A 1Z74A 4GSKA 3Q2KA 2B37A 4PIVA 2D8AA 1M76A 4TRRA 3WQRA 4XDYA 3DZHA 1DIAA 2HQ1A 3ZNPA 4DQVA 2J3JA 4DPKA 1A27A 1N9GB 4Q3DA 1QSGA 2QQ5A 2CF5A 3CKYA 1DFGA 1EFKA 1PR9A 4KQXA 1K6IA 2EKQA 4DBZA 1RJWA 3JYOA 2ZIZA 3D0OA 5T64A 1P3DA 3ASVA 1MLDA 2Q45A 3WG9A 1Z6ZA 1VJ1A 4WLOA 1A7KA 3LK7A 3H5NA 1DRUA 3S55A 5A9SA 2DBRA 1LJ8A 3PDUA 2RCYA 2RH4A 1TB4A 4MVJD 1QORA 5KTKA 2WM3A 3TZCA 2ZB7A 1ML3A 5JSFA 3TFQA 1RM3A 3O9ZA 3OMLA 4FOOA 4I9HA 4YAJA 3HNPA 2HU2A 1T4BA 4RLHA 4YQZA 1NBOA 1UDCA 4IZHA 4AJIA 3H9JA 4BNIA 4EJ6A 4YJFB 3VKUA 2YV2A 2NUAA 3NTQA 1JWAB 4PLFA 3F3SA 2VZ8A 2NTNA 4XZ3A 1O94A 1NFFA 1ONOA 2C5EA 3B1FA 3DFUA 4FJ2A 4MKXA 3TQHA 4BNWA 1YQDA 1U3WA 4WLUA 3ZN2A 3UCEA 1AXEA 5BSGA 5I9MA 3HN7A 4FR5A 3WGTA 3IP3A 5JCJA 5IG2A 3V2HA 3VKVA 3K30A 3DEYX 1FK8A 2YV1A 3U9LA 1XA0A 5I8ZA 4OXKA 5ICSA 3E6AA 2J5QA 4BO2A 3ANMA 3I9NA 4FCCA 4CPDA 3BZUA 3V5NA 3HHPA 5KJ1A 4W9NC 3CZMA 2OXIA 4L75A 3A14A 4E2XA 4N5NA 2X4GA 2EERA 4Q9NA 1XU9A 2IYOA 4IQ0A 2I3GA 4R1NA 2Y1GA 1NAIA 2FHSA 3EZYA 4XKJA 4YJGA 2HDHA 4M1QA 2VUUA 3QHAA 3SJUA 1HYGA 2X1HA 3DZKA 1U8XX 4NIMA 4PG5A 4PZEA 1YQXA 5FI3A 5F21A 2XAAA 2QW8A 2CVQA 1GYRA 4IS3A 1HDGO 2CMDA 4MP6A 3OIDA 2VRCA 3L6DA 4UREA 5B4VA 4OJNA 3DBRA 4S1VA 5L9AA 3DBLB 4J6FA 5DF1A 4ALLA 3D5QA 4EEZA 4A5OA 1L7EA 3DAGA 1F17A 3KO8A 4Z0HO 4NK4A 1SZJG 5C7IO 1P1KA 4PVCA 2TMGA 2AQ8A 3K96A 4HADA 4MIEA 4BKUA 5L53A 2NLOA 5I7VA 3QY9A 4LRTB 1DJNA 1LSJA 3COSA 2FMUA 4M55A 5I7SA 3TZQA 1CF2O 4ND2A 5DCUA 1LBEA 3IJPA 4MIYA 3D4OA 1H9AA 4P22A 2VWHA 1VL8A 4W9NA 3TNLA 1O8CA 3C7CB 1E92A 4E6PA 4RZIA 1GV1A 3PQEA 3IKVA 2OORA 1V9LA 5I9NA 4EUFA 1YL5A 4GBJA 3GT0A 3ZWWA 2Y66A 1D1SA 1YVEI 5F5NA 1B2LA 1Y8RA 1KETA 1VRWA 1NPYA 2QRJA 5A3JA 3VVCA 1K3TA 3T7CA 4TZTA 1YKFA 2GERA 5JMPA 3MWDB 4XR4A 4CM7A 1LNQA 3INTA 4GMGA 1ZMOA 3F1KA 4XEHA 4J0EA 1R6DA 4ZD6A 3DBHB 3E5MA 2NADA 4ITUA 4YJFA 3P5SA 3L4SO 4IMRA 2AA3A 2QRLA 4XCVA 4XRGA 4XA8A 3RSHA 4NFYA 4RVDA 3FD8A 2O4CA 2ZJ1A 3TL2A 4D45A 4EGFA 3QVOA 2HUNA 2OZPA 2V7PA 1C1XA 8ADHA 3P19A 3RKUA 3D4NA 1GCUA 1GL3A 5THQA 3ZWYA 4PLZA 1YDEA 4J43A 3GNTA 4HWKA 3GZNA 4I9NA 1PZFA 5T5QA 2AQKA 3LF1A 3ZHXA 2CDCA 1KEWA 1O5IA 5T57A 4QECA 3WFIA 1PS9A 3H2ZA 1R15A 1ISHA 3ZWBA 1PL8A 2Y93A 1BDMA 2VUSA 1H6DA 2X5KO 3PJEA 3OQ1A 5IZ4A 4GQAA 3DBHA 4BNLA 1YB4A 5I8WA 5JY6A 1V3UA 2PV7A 3N74A 4BNGA 1ZJZA 5JFOA 3BMNA 2BF7A 3LC7O 4CUKA 5EIOA 1ZBQA 2WYVA 3E5RA 3WOHA 1PJ3A 2GN4A 4R5HA 3K8ZA 4WASA 4Z0TA 4TRJA 3F5SA 3IJRA 3WSVA 3E82A 4RF4A 2J5RA 4FFNA 3V2UA 3VZPA 3B1JA 4E5MA 2WEKA 1I24A 2R00A 4C7KA 2WYUA 1H6BA 1VE9A 2D5CA 1A72A 4KUHA 4PZDA 4CQMB 2DUWA 2JFFA 2Z1MA 4YJHB 4LISA 4QO8A 1NWHA 2H5LA 3KRTA 4CM9A 4N5MA 2V6GA 5ENDA 3K2EA 4XYEA 2Q1TA 2DVMA 2EGHA 2FY8A 4Z9FA 3L4BA 2EP7A 1T24A 2UUOA 1FXSA 3RQSA 3O8QB 3HDHA 2NNLD 4I5DA 4DBVO 3ETDA 2E49A 1R4MA 5JDIA 1YL6A 4CLRB 4CV1A 4QT0A 2C07A 1VPDA 1IB6A 1GDHA 3OIFA 4TRMA 1LQUA 1VJTA 4J1NA 4CR6A 3NYWA 5LDGA 1HLPA 3UICA 5LCXA 3RUEA 3FN4A 4S3MA 3FNGA 1DSSG 4ZA2A 3M2TA 5CG1A 3NJ4A 2QX7A 1P1HA 1YB5A 4YJGB 5TIIA 2Q1SA 3ASUA 5KJ6A 3F6YA 3HSKA 3S1LA 3K31A 3SLKA 1Q0QA 3JQGB 1NQOA 1I10A 1XELA 5G4LA 1I36A 3WYEA 4ZN6A 1HRDA 4EJ0A 1IY8A 3KSZO 1RKXA 1NXQA 1Y6JA 5IN5A 3S2FA 4GLOA 4D41A 4LW8A 4DLLA 2EIHA 4Z0PA 1M75A 3INGA 5G2OA 1SPXA 4P4LA 3DHNA 3BMQA 4U5QA 4UULA 3FWNA 3I23A 4Y6PA 3HDJA 3JQ8A 1QKIA 1IHYA 4QFDA 3VH4A 4A0SA 3PYXA 3PEFA 5COBA 4IY1A 3D3WA 4RF3A 4WLNA 4I08A 1R16A 3ENNA 4J91A 4RL6A 2HK7A 2I99A 2Z1NA 3OHSX 5JDIC 3K2BA 4FC6A 4AJ1A 4AJLA 3V1UA 3AUSA 1UP4A 2Y99A 4BNMA 1ZMTA 3JQAA 2Y1CA 2CF6A 1Y8QB 1YH3A 1JDJA 3UCFA 3RU9A 3ITDA 5KCZA 5K6AC 2EJVA 5KNLA 1EUCA 4AICA 1XLTA 2HAEA 4MVJM 4XD2A 3RCBA 4L4XA 5L7YA 4J1QA 4Q3EA 2DU8A 4NMHA 2TMDA 5DP1A 3C3XA 1EUDA 2IXAA 3WFJA 1DFIA 3DBVO 4MKRA 1Y1PA 2AEMA 2GLXA 3EK2A 4DLBA 4BQPA 2DAPA 2VTDA 4IZIA 3JD0A 4LN1A 4NG5A 2IE0A 5A9RA 2Y1DA 3ZV3A 2VWPA 3R3JA 2HMVA 4GPD1 4RQUA 2IDZA 3B20A 3DDNA 3V8BA 1GD1O 2VOJA 3BMQB 4EJMA 1NFRA 3DXFA 1KBZA 2WJPA 3MWEB 7MDHA 5CEJA 5JMWA 1ZSYA 1V3TA 2VQ3A 1YQGA 4RVUA 2C59A 3PIIA 5AXDA 3CIFA 1BWSA 5GZ1A 4Q3CA 2VNAA 4U6SA 2HRZA 3AI1A 5CFZA 1HE5A 1LRKA 2NQTA 3I9JA 3RC9A 5AVOA 3WJAA 4BNFA 2P4HX 3PXXA 4CLOA 5IAAA 4DREA 3E9QA 4J0FA 4G5HA 2DTXA 1OOEA 4MVJF 1E3SA 3PWSA 4YDRA 5DZSA 1WP4A 4YB8A 3UH1A 1ZEMA 4O5OA 3G79A 2XXBA 1A4IA 4A10A 4O0LA 1HDOA 3BHMA 4U0KA 4RVFA 4WCFA 3KYCA 4HXYA 2SCUA 4KZPA 5J23A 3AY6A 5EMHA 2Z95A 4NBWA 3F1LA 1OBFO 3E9NA 4BQRA 4D0SA 2HMUA 1XYGA 4YRAA 1MUUA 2GN8A 3RBXA 1BTOA 3FCOA 2FPPA 3UCXA 4D3FA 3LQFA 1E5QA 2GO1A 2YHIA 1JTVA 1W73A 1DC5A 4CR7A 3JQFC 3TOZA 1T2CA 1KVTA 1FF9A 2OP1A 1SMKA 3PFWO 4B4OA 4PZCA 4PLGA 2PY6A 4CM8A 4CM9D 4CR8A 1JKJA 4BKPA 4LK3A 4XQCA 3JYLA 4DPLA 2JD2A 4B7XA 3ZZNA 4UVHA 3JQDA 2C7GA 5TC4A 1EMDA 4MP3A 4D44A 3I4FA 1X1TA 2CNBA 4K28A 5BNTA 1PEDA 1LLQA 1I2CA 1Y81A 4I5EA 4FS3A 1FMCA 4E2YA 4F45A 5BR7A 4FJ1A 4ALMA 2AEFA 1QV6A 3CUKA 4RV9A 4XIYA 4IS2A 3WXBA 3JQBC 1HZZA 1M66A 1H5QA 2BGLA 5EQDA 3MCVA 4FSHA 3BHIA 4W4TA 3NX4A 3UXYA 3PHLA 1IPFA 4XRRA 1XCBA 3I1JA 1LRLA 1A4UA 1LI4A 2C7VA 3RBVA 1CWUA 2POQX 3O38A 5CDTA 4PLPA 4AG3A 3UAGA 3UHAA 2ZTUA 1M2WA 4OQZA 1V0JA 3C7AA 4NBTA 2NU6A 4ZICA 2HMTA 1MP0A 3AOEC 2V6FA 5EN4A 3VAZA 4XYLA 5AQ1A 4M87A 2ZTLA 5ADHA 2X0RA 3A4VA 2GD1O 2J8ZA 1YJ8A 5L51A 1R66A 5EERA 4JROA 4ALIA 3TN7A 4OH1A 1R37A 1ZIDA 4BNVA 4PLYA 2O3UA 1N5DA 5GZ6A 1E3WA 2VT2A 2WYWA 3OJLA 3KVOA 1TT7A 3OA2A 4YCAA 5JAZA 4FFRA 3KSDO 5H82A 1ADGA 5L7WA 3KZVA 1X7HA 4P4GA 4H15A 4LMRA 3RFVA 1LQTA 3ONDA 5CHEA 4E5PA 1KEPA 1C0KA 3CMCO 2OL4A 2NSDA 3G0OA 1Y7TA 4Q39A 3WQSB 1XQ6A 2NM0A 4CQLB 1QYCA 4W82A 1BDBA 4AJJA 1EDZA 3A9WA 3D3WB 3ZHZA 1ISGA 3H9QA 4R69A 1X13A 3WWYA 1FDUA 1X0XA 2XOXA 3JD4A 5CP8A 1PJ4A 2EWMA 2PKQO 1ZO8A 5U4QA 2PFGA 4Z9YA 2UUPA 4D46A 1R4NB 3K5PA 3H3FA 4HFJA 1UP7A 4HY3A 4RPGA 3GPIA 3CINA 1K6JA 4PRLA 3E03A 4PLVA 4M86A 4NDNE 4WCFC 5BNFA 4A27A 1JU9A 1OFGA 4TWRA 4W6ZA 4KWIA 3GK3A 1LX6A 3PHGA 2JCVA 2AMFA 4CMCA 3EZLA 4XJTA 4KDEA 4D0RA 4IBOA 5KIAA 3DZBA 5EINA 4RJTA 3AUUA 1E1LA 2G1UA 3OECA 3DMTC 1R12A 4MOWA 4YT8A 2QZ9A 3GDOA 4BOYA 1HWYA 5ILGA 4GVXA 2NVUA 4MINA 3GGOA 4LSMA 1DRWA 3QVTA 4J9VA 2DKNA 4CLRA 2PNFA 3PWZA 3ZWAA 2PKRA 1PQPA 5L3ZA 3DOOA 1QRRA 4FFMA 1YWGO 3F9IA 3OJEA 2GPTA 4BO1A 1ZUD1 3WGIA 3PZRA 2Q4EA 1CQIA 4YPOA 1TA4A 2XF8A 4Y6SA 2O4UX 3QLJA 4YBZA 3RWBA 4I9UA 4CQMA 3ZNNA 1GQYA 5A02A 3KOUA 1DC3A 2IZZA 3JQAD 3I9KA 3JQ7B 4IJVA 4YAKA 4XGKA 3FF4A 1SNYA 3LYLA 4YAGA 1O6ZA 5T8KC 5TNXA 1EVYA 2HCTA 4L73A 5HS6A 3FBTA 3DMTA 4KQWA 1YBAA 4PN3A 1QYDA 3GAZA 3HDQA 4JJGA 4AJHA 1A7AA 2CD9A 3FR7A 4Y98A 4WPGA 3RKRA 1KIFA 1EZ4A 4BB6A 3GRKA 3Q1LA 3LSYA 4XWYA 1DXYA 1E3WB 1NPTO 1U28A 2QHXA 5F3RA 2O23A 4CV0A 5JDCC 1UDAA 3M6IA 1ZFNA 1E7YA 4GKVA 1U3UA 4HNHA 4RPKA 1RM0A 2FSSA 1AHIA 1XWFA 3PGXA 1JA9A 1PGNA 1Q7CA 2NWQA 5HRUA 2I66A 1B26A 2BFMA 4FIZA 4NK5A 5JXWA 3TZ6A 4F6CA 1OAAA 5G0SA 1C14A 1P0FA 3Q9NA 5A5FA 3VPSA 4ZQEA 4K26A 5DDIP 3LT4A 1HDZA 4XX0A 3TDKA 2YV3A 1KOLA 3ADOA 1WDKA 1BG6A 4NJOA 1GZ3A 4K6FA 6ADHA 3FHLA 4CLDA 1GEGA 1DAPA 1TVEA 1RYEA 3VH3A 4WE3A 2PGDA 3IDSA 1LDYA 3WIEA 4UVDA 3RFXA 5CPBA 4XQEA 4WNCA 1I33A 2UAGA 4B4VA 4BNJA 3KV3O 4R3NA 3WIDA 1LUAA 1PWXA 5FFFA 2DPHA 5L7TA 1ZW1A 4YQYA 5KKAA 1U5AA 5DBFA 3RIHA 3IMFA 3QVWA 2C2XA 3NEPX 1ZXBA 1YRLA 2ZCUA 3CEAA 3DHEA 3FTPA 1AGNA 4C4OA 4B79A 3DOCA 3QA9A 2HLPA 4BO0A 4LSWA 3HN2A 3NUGA 3R1IA 4CM1A 3FNHA 3DC2A 1I0ZA 3RUFA 1P45A 3DOJA 2BGMA 3OA0A 5ER9A 3LLVA 3PLNA 4DMMA 1U8FO
chains in the Genus database with same CATH superfamily
3BD8A 4LXQA 1TEHA 5F76A 3IMKA 3FOZA 5A1TA 4EF5A 3M4NA 1J8YF 3KXDA 4FR0A 4G8BA 2DZDA 2FEMA 4XAQA 1IH8A 1QVAA 3QW2A 1Q6YA 1OCEA 3NYRA 1ISMA 4FP9A 4XE5A 3M3DA 3ZE9A 5CXXA 5A4FS 3BXHA 3JV7A 2CCJA 3EXFA 1VE3A 3HBAA 2CJYA 3ITKA 1KAEA 3EUWA 1J1ZA 3GQBB 4L2IB 2XVZA 5KNDH 3KQVA 1CTQA 4YRFA 2JFGA 2IL1A 3P5BA 5JCZA 2JI7A 2B2XA 2EC5A 4MDYA 4MWGA 4IIUA 4WNIA 1XZHA 5EY5B 2FSIA 1VE5A 3TRJA 1IFXA 3R4VA 3LQQA 1F0KA 2YFKA 1S2LA 5L3SA 2B8WA 1C8BA 2VHQA 4IQ8A 4DYDA 5IFLA 5JH7A 3TGLA 1QYXA 3P97A 4LTMA 2W37A 5GM1A 2QRMA 1IOVA 3PEWA 1U0GA 5FUXA 4MS1B 1PS0A 4C1NA 4MV7A 5FPQA 4ER6A 3E1KA 5TQ0B 3BD9A 3FTQA 2Q7DA 4CKYA 3THXB 2ZBUA 1XNJA 1N2GA 2R3SA 5TGDA 3WRVA 4NCAA 1WVMA 2IUSA 1T2UA 5F5XA 1T8YA 2Q46A 1XAHA 1X6VA 3RS8A 2G8NA 3ETJA 1ADFA 1Z0FA 1YOVA 2E3JA 4GOJA 4QASA 2DWCA 3NWOA 2QUKA 4TROA 5DSTA 3B1KA 1R0KA 2X1LA 5HEKA 1GYPA 1MVNA 3T3GA 1TAQA 4DA7A 4EABA 3EUFA 5JFGA 2VPQA 3K9NA 5FWYB 2ZUVA 4IIEA 1Z6AA 1K4YA 4U6QA 1OAKA 1U3FA 3A8TA 2FPUA 2QOEA 1U3TA 1EVIA 2PMDA 3ROZA 2QG9A 1NXPA 1UXOA 2ADFA 1DARA 2FMIA 1XCMA 2JGJA 2IVZA 2QAGB 2Q41A 3VQTA 1V16A 3B51X 3PCRB 2Q4BA 4O4JA 1U7UA 3FGPA 4P82A 2IOHA 1N5LA 3UWDA 3SNHA 4EZEA 1E2BA 3R6WA 2IF0A 4YO7A 3F2VA 2ZWMA 3GVIA 4LYYA 2P27A 1FLAA 3NHAA 4M8NE 4R01A 2EFEB 1HEUA 5DNCA 4QPZA 3P4XA 4CGZA 5A4AA 4Q6WA 2A5JA 1DCTA 1E3IA 3R6LA 4PVDA 4ZVUA 1EYZA 3D31A 3HSSA 5SICE 2D0IA 2YWEA 3AILA 4FEYA 2X5JO 4HH3C 4BFSA 3GMIA 3CEJA 4WN9A 3F6SA 1R27A 2MTBA 2XBLA 4MRSA 1Z4KA 1Y8QA 4WIAA 4E2ZA 3CEPB 4BNXA 4JU8A 4HNUA 2QQEA 3UTCA 4MGHA 3ZCXA 3LZ6A 5C8ZA 4PONA 4P9NA 1NP7A 2PRKA 3EMKA 5KSOA 3JSAA 1OV4A 3N6XA 4IOLA 1L7OA 2C2MA 4RENA 1LBTA 4B73A 3RNOA 5JYEA 5DIFA 3DDSA 3LL4A 1QC5A 4L8YA 5FUYA 3WZMA 2PGXA 2R48A 3GEGA 2YXNA 2B4QA 5KX5F 1FDSA 1Z13A 1XHFA 1H1TA 3SXUB 2GRUA 5TT1A 5AW0A 1E0SA 1JF8A 1MXHA 2YQ5A 3HY6A 4LXTA 4OGWA 1XL1A 1D4OA 4XUDA 1TT5B 2IZ7A 2E4XA 1E69A 3NAQA 3K6RA 3WLAA 1WU8A 4HQOA 4BTEA 4D97A 4EHLA 5B30A 1FJXA 1O87A 1E1QD 1RHRA 1C3OB 2IHKA 4IH1A 5IC4A 3B5JA 5J58A 2AF3C 2HRQA 3MTGA 1R00A 1JQAA 2TSYB 3ISJA 1ZGHA 2V74B 1G2QA 4J0CA 3TXYA 3K70C 1K8ZB 5KNCH 1U0RA 3JTEA 1UBJS 3MF4A 3R0IA 3DHYA 5HJEA 4FFOA 3HFSA 1PK8A 1SXJD 5HGJA 1JEQB 5FQOA 4AYTA 1DV2A 1T1SA 1XMVA 1WSDA 2R8BA 3GGPA 1PR0A 4RA9B 1ZVJA 3GCZA 5CXSA 1RFLA 3DMGA 3H5WA 4NVRA 4LY9A 4C1BA 5H83A 1QK5A 3Q5DA 4EFNA 4EQZA 1RZRD 2QK4A 3QEMB 3QSGA 3IPCA 1PYOA 4H0FA 1EFRD 1MFZA 1RP7A 2Y1XA 3GRRA 1B76A 1SCUA 1ZM2A 1EX6A 2ZAMA 4PGFA 2J0UB 4J1SA 3VZRA 1E1MA 1MTOA 1CDEA 2CNNA 1D07A 2EJWA 3JATA 5LQCA 1RJ9B 2EHDA 2HCFA 1CHNA 2KYRA 1DOAA 1AQLA 2GZMA 1GU7A 4LECA 3N0VA 4KQ1A 3BUSA 4C07A 1H3NA 5K0JA 5A3SA 3NB0A 1BMFD 3GCDA 4WBNF 2H57A 3TTUA 2P0YA 2IXFA 2V5AA 4WWHA 1GKIA 3IXQA 3ISTA 2FA9A 3DFMA 1MV8A 1LFAA 3LXUX 2CDBA 4WGGA 3A31A 3U3DA 3CTPA 4RK0A 1T3ZA 1M9NA 1ZU4A 2BDUA 2XGMA 4WK0B 2A1TR 4YTEA 2PSHA 1E4EA 3V34A 1Z37A 3CH4B 4PCVA 3WS7A 1OSNA 1JVSA 4JGIA 3L7AA 3ZJTA 4TS1A 1YZUA 1PFKA 5D3ZA 4KXVA 3L7IA 2A4KA 3KR1A 1Z56C 2J3QA 2VH5R 4F5WA 1EXMA 2JHAA 4A6EA 1C8KA 1QZZA 1J39A 1YIOA 1OYOA 2VHVA 2JI6A 4J16A 3UB2A 5HX7A 4MVJH 4ZTBA 4C04A 3E84A 2GFQA 1UC8A 1IZ8A 4MW6A 4TV9B 1SBYA 1VZ3A 2G3YA 4FN4A 3RC3A 1Q20A 1PJBA 2WTUA 4BPBA 4G86A 4C4PA 2PV0A 2QW1A 5I7EA 3KUXA 2RHCA 4QJBA 3QI7A 1ISSA 1W48A 2NU9A 3ZEAA 3U7FB 2OSVA 1N2SA 3QXHA 3NXKA 2HBRA 3X3HA 3HVIA 1Z6YA 2WJZB 2F48A 1E6LA 1I3OA 1USKA 3MTBA 1WCYA 4YJKA 4R81A 4EB6A 2D5AA 1CR4A 1Q0RA 2ZUUA 4O1IA 3I52A 4HWTA 4WBNA 2BGUA 3UW3A 3OPMA 1AUQA 2Q1YA 4A8TA 2XCOA 1Z5NA 4KE8A 3IVMA 4ZU3A 4TXJA 3PX7A 5EJ8A 1B0AA 2W6JD 2LRHA 2ORVA 4FE3A 3AUKA 3JALB 3D5TA 5JISA 5AFSA 2FR0A 1QMGA 2H4FA 2VYNA 2WSMA 3O2JA 4IP0A 4L7QA 4FBGA 4E4YA 3J81A 2GGSA 2PRJA 2WD8A 3R5JA 4FYWA 5A3RA 1JIKA 2H2AA 4I4NA 2PQ6A 1TW2A 4CIYA 1EK5A 3HCAA 1TRKA 4HMQA 3U44A 4LMBA 4HAWA 4P1ZA 3NDRA 4M54A 2IUEA 4U8HA 2DQZA 3ME5A 4RFLA 2MCFA 4GP9A 1O9GA 2KS6A 3D6JA 4OMFG 3RHZA 3PC4A 4DLAA 3MS7A 3OM9A 5IBCA 1M74A 3MCAA 5EI5A 3KL2A 2GPSA 2RONA 4INZA 4QWMA 1X7WA 3KOMA 2BPOA 3A1UA 3OM1A 4P36A 5F78A 5EJ5A 1S9HA 4S12A 4I4TA 3UBTA 3RS5A 3WGGA 2BELA 4R1MA 1SELA 4TQGA 2HFJA 1BYIA 4N7JA 1L1QA 2MYUA 4N3CA 2PYDA 3HL4A 3MFYA 3BXOA 3QK7A 2J4CA 2B2CA 4JBLA 4ENUA 2VJAA 3MM4A 4FHDA 5B7QA 1XR3A 3DUFA 1XTRA 4W6QA 3EZFA 3OZGA 2W2LD 1GIAA 3OX2A 5C31A 1D0SA 3RC1A 3VU1A 4PG8A 4Y6RA 5BSFA 1DWOA 1X8LA 1HDIA 4HNAA 1P91A 2VSXA 2AG1A 3TQCA 4NZYA 1C7RA 3AHCA 4NBVA 1LA2A 2VJPA 4GWLA 3T15A 3AM3A 5B6PA 2VP3A 5LD2C 1B8UA 4HEA6 4UJ5A 2YQ4A 3ZWXA 4NJEB 3AR7A 4K7JA 3AKDA 2C96A 5JBQA 5FWXA 3JQEA 1F0YA 4P83A 3S29A 5CW1A 5L3QA 1QIFA 2IZ1A 4KNWA 1YJXA 3DVQX 2XDQB 1CDOA 3HPRA 4GKBA 1C4KA 1PFYA 3IOCA 2DKFA 3N8IA 4Z4CA 3RRNA 3IB6A 3R5XA 2QV7A 4AF6A 1FIUA 2ACEA 3H1PA 4BMPB 3RK4A 2WP0A 3OE4A 1W4BA 4EVQA 3RT7A 4KFSA 4M21A 4M9QA 5LUAA 1THTA 3RSCA 1G20E 3N70A 4K9DA 3TGWA 3L6EA 5ALIA 2JFNA 3MELA 3EGVA 3VZQA 3RUDA 4D9NA 3I64A 3NCHA 4UTNA 2H0RA 2NX2A 2WLTA 2XR1A 3DZDA 2QTMA 1A88A 4UQLA 2R7MA 2V7WA 3U1BA 2WU1A 4JI7B 2AE1A 2G17A 4E30A 6LDHA 3JVVA 3BWBA 3NIWA 5LOVA 1GM5A 4W5TA 5IAKA 5DN6A 4BWGA 5F7XA 3PHBE 4EJSB 1FMFA 2X0EA 1ADBA 1N2XA 2PUTA 2ZRJA 3NVDA 4EW6A 2PSDA 5L45A 1H2RS 4IHKA 3F4LA 2PEZA 2VJYA 3D6FA 3D43A 3T7IA 4LHZA 3WNQA 1T35A 2P4QA 5EXTA 2DWPA 3V33A 3GLIA 2MYPA 3WISA 3WIVA 5FOWA 1XJ0A 1YR1A 2YUIA 3LYUA 1UJ2A 4IILA 5SY4A 4B45A 2EWVA 4MW7A 3RGWS 2UUCB 1UPUA 5JBNA 4QUDA 4A0QA 3ADPA 3KPWA 1B73A 5ERGB 2ZBGA 2ZIUB 2A9PA 2W4IA 1T5DX 4R1UA 5IH7A 1J9GA 1S0UA 1YKGA 2JCYA 1EG7A 3SX2A 4BEJA 2FKNA 3B6JA 1AGXA 2B1IA 2XTMA 4MV5A 1E2NA 1ODLA 2Q5EA 3NT5A 2QY9A 4RNCA 2NNWB 1THMA 3DAPA 4KODA 1Q16A 1FRFS 3GD5A 3ZLUA 3WDMA 4UPEA 3VR5H 5FR1A 3W2EA 3FVWA 1UZNA 2WWWA 3PGLA 1Z75A 1FB5A 4NY1A 3PFNA 4KVAA 1EUZA 2H7YA 3SVLA 4JI2B 1JLLB 2CK3D 3T99A 5LQSA 4PC3A 1E2FA 2OLKA 2F8SA 2JAPA 3BZBA 3PVCA 4C3UA 4OHPA 1GGVA 2QA5A 1VOTA 3P9CA 3IBFA 3AIKA 5JXIA 1NXXA 3CN7A 1GA1A 4OUKX 1F14A 4AMBA 2GWRA 5C3MA 2AHRA 2FPOA 3O2NA 3IIJA 3G1WA 4PLTA 4BV3A 3AXTA 2WJYA 9LDTA 3Q40A 2WTEA 2X5NA 1YU6A 4QDOA 3K9BA 3HJHA 3WO0A 2R0QC 1HY3A 2HA6A 1FEZA 4OHRA 5A4KA 1GV0A 1IIRA 3RI3A 3DFKA 4LXXA 3ASYA 5A9TA 3EXHC 4E12A 2J41A 1EFDN 4KGZA 1AF7A 4FMCF 4M8IA 2CDRA 2C7QA 3TX6A 1XMOB 4BBAA 1P4SA 1T6YA 2O06A 4MQUA 6ABPA 3E70C 4IWXA 2X3YA 3KM0A 2XE6A 1NMEA 1CCWA 1X42A 3DZFA 2HGSA 1DQZA 2WD7A 3L7KA 4TKMA 5DNAA 1AS0A 1Z0ZA 3A1CA 3JTMA 1JHAA 4H0NA 5FI0B 3SJCA 1L8XA 3KZNA 2C8VA 3FYUA 3IBSA 4HDSB 4DIBA 2ZRNA 5HMMA 3W1EA 2V97A 1MG0A 1U1DA 4Z6KA 4JODA 3DAHA 2ZTHA 3K0AA 5LZ7A 4KXFB 2HDNB 1ARZA 1ONSA 3P8ZA 3DMFA 4US2R 3BK1A 2JGNA 1TKRA 1H94A 4XR9A 2QSUA 2RHRA 2VJOA 4MQFA 3SJBA 4OI0A 1ZOPA 1CJUC 1M72A 3V4SA 3V1MA 1ESCA 1UJCA 2C88A 4KI0A 3SQLA 1YQQA 2AMVA 3KHKA 1VPEA 1S3GA 4BMSA 3G6WA 1BEUB 1VCIA 3HKDB 3IAM1 4XCQA 4FQ8A 3C8HA 5JQWA 1GA4A 2HGZA 1QGUA 2O2SA 4DGQA 1FW6A 5B1DA 2DB3A 5TLSA 1SC3A 4X97A 1WBDA 4HRVA 4ISCA 1JBEA 2Z3WA 5F1KA 5DHTA 3UGTA 2X22A 3VU8A 4Q7QA 2X4IA 4WKCA 2V45A 2EP8A 3WKAA 4B6GA 4DXDA 5HJ7A 1N8KA 4HNGA 3RRXA 1ZVQA 3HGQA 4YRKA 5CB4B 3B70A 1KI3A 4C22A 3AUAA 3ZKAA 2LR0A 2HR1A 4X1IA 1UBRS 3LTEA 2DPGA 3S68A 4FILA 4OSEA 4BMZA 4D1YA 1VKJA 1PL0A 3FRHA 1S8FA 2CVHA 5BQ5A 5TS3A 3B7GA 2OECA 4L4ZA 1YRWA 2ES4A 4XFJA 3S2GA 2I1VB 5MGNA 1VDMA 1G38A 3DOEA 2B4TO 4R1SA 3QWIA 3KTDA 5DCWA 2ZPTX 2ZQ5A 4ZALA 1QQAA 3EULA 1Y8CA 1V6SA 5JPDA 1J00A 3MB5A 1UWLA 1GDDA 3FKSA 1HFJA 3C3CA 5TQJA 2R8XA 2RHHA 4D4LA 2LDBA 3PDIB 4EJ2A 2ZPAA 1YIAA 5JROA 4Q4DA 3IQFA 3HYSA 2QX8A 4YRDA 4RFVA 3CV3A 2ZAYA 4HAOA 4C2TA 1MA0A 1OA1A 2N1BA 3OEHD 3GN1A 4JKIA 5EMJA 3G9XA 1XMIA 2DLDA 1PU2A 3GRAA 3QELA 2IOFA 4RF2A 1KJ8A 3JD1A 1C50A 3EN0A 3VTFA 2BHTA 1GU1A 2QL9A 4IJ6A 1VKRA 3MGGA 3OLQA 2NG1A 1G5FA 2I6UA 4BKQA 1YI0A 1ZH8A 1JAIA 1CXZA 3ONFA 1MH1A 3F4KA 5AW5A 2B9VA 2I54A 3AVYA 5DV9A 4ZO6A 4EFKA 1VE1A 3RYCB 1RYDA 3MLBA 1T8RA 5JCPA 1EDEA 1EZ1A 3C1OA 5F52A 2CDAA 1PV4A 1ORRA 4X3OA 5I7HA 2FZKA 4ZO9A 3VHRA 2GRAA 4KX3A 2R6CA 3DS8A 3X1WA 1CDDA 3QQPA 1Z6QA 1S2MA 4MV8A 4WLEA 4RU1A 1JDSA 1LQ2A 2J3MA 1F3OA 2ZZKA 3FJOA 3M9XA 3NHMA 1X77A 4XYGA 2IEZA 3T3OA 3THWA 4ARSA 4HGOA 4Y1RA 1RJEA 1XP8A 1CY4A 3HBFA 4Q01A 3SXPA 4MUKA 1SXGA 3BEOA 4G5SA 2HYDA 4AMGA 1I94B 1U6JA 1ACJA 1P3Y1 2DCMA 5CB6A 2M2IA 5CB4A 5H9VA 3FMVA 1P17A 3ICOA 1ZK4A 1W1WA 3T1TA 3P32A 3VGJA 1PCXA 1W5TA 2HOQA 1VBNA 3MOIA 3U39A 4BQEA 2NTVA 5CFPA 2XKKA 3SQMA 4H7HA 5EESA 2A9QA 2XQFA 2C7RA 3R0VA 4JEMA 2G1PA 2J33A 1FFXB 1XI2A 3DTTA 4PRKA 2XECA 3R5TA 1CUXA 3V2GA 3NETA 2P5TB 2NO7A 4R2WA 4EHAA 5AHXA 5HTKA 1V47A 1SB8A 2C99A 2J5BA 3EGEA 2JDID 3GLRA 3ND8A 4ZMSA 1XEFA 2GWHA 3GFPA 4J9UE 5K0LA 3ROPA 3CH6A 2BD0A 3FX2A 1DEOA 3KZ1E 3QUSA 5CG2A 5I7FA 5FJIA 2XA9A 3FTNA 3UY4A 1G18A 4AJKA 5KNBH 3FBGA 4Q5IA 2HPVA 2RGCA 4Q9DA 5GWXA 4PNZA 5TT0A 4DLVA 1VG1A 5E1OA 1YA6A 3MN1A 3MWKA 5L4SA 3R41A 1BN6A 2WQ6A 3AX6A 2OZLB 4COKA 4L50A 2VLIA 3NEYA 5HM8A 2G40A 4Q34A 1PR3A 1W8DA 4LEIA 1LF5A 2G76A 3AFOA 3F8TA 4CEHB 4KO1S 1K68A 4WT7A 4EG5A 1E3TA 1RI2A 4ACAA 3ICPA 2YXDA 3W6UA 3OOSA 1EE2A 4QBFA 1A96A 4OYYA 1DAKA 4AO8A 4P4NA 1VMAA 1XZAA 3KAJA 3K9WA 5AI5A 5G0VA 4F46A 1K7FB 2FPGA 4X93A 3GOHA 3T54A 3W90A 1L1EA 4NDZA 1ZEJA 3I61A 2QSJA 2BAGA 5J9FA 2P9YA 3QV1A 5F51A 3S2UA 3L07A 1XOIA 4D82A 4CG3A 3KKLA 1WIWA 1T1GA 1ETHA 3C41J 3W2TA 3ENQA 5I8PA 3MJFA 1FS4A 4CFYA 4NU6A 5AW4A 4RVSA 4WFKA 1TFRA 1GA6A 2FQ1A 3WQBA 1DQRA 4BP1A 2WMOB 4ER7A 4BNTA 1EPUA 1E9SA 3K1ZA 3NUQA 4HLQB 1NVXQ 5CNIA 3ZK9A 2YICA 4EJSC 4Z3KA 4NRDA 1RMYA 3NYIA 3LQYA 4FUQA 3A1WA 4TLLB 1UR5A 3IBTA 1QRAA 2F8LA 4NBKA 4LDRA 4EB6B 2DERA 2PA3A 4LA4A 4E5YA 3OI7A 3OSUA 1BQEA 4FNAA 4IZ6A 4U5XA 4Y9UA 5A6SB 4R5MA 4WNAA 1RABA 3MUEA 1NP3A 4FEEA 3V46A 5AW3A 1EP2B 1KSHA 2I7TA 3GLGA 1O96A 2J31A 3N8KA 3LH5A 4YCLA 2MU1A 4G5RA 4ZCPA 3S6JA 3VAAA 3AM5A 4J90A 4YP9A 5BRAA 3NDJA 4ML3A 2BI4A 4RSGA 2P3OA 2PNJA 5FOQA 1CS0A 3EF3A 3ADDA 2GBPA 3GZ4A 1SKMA 2DG2A 2QN8A 1QO9A 3EIUA 2AEJA 5KDOA 2OFPA 3CJTA 3HG7A 1T36B 4O4IA 1E2HA 1HT1E 2OA0A 4BNHA 2BEUA 3WZLA 3E7PA 2CYBA 2H1OA 2BE7A 5KVAA 2ORYA 3OF2A 5LWHA 2I3AA 4N0PA 2OQRA 2WICA 1CUAA 1EGMB 1GADO 1J4AA 2H0AA 2XXJA 4L8LA 4FONA 4HDCA 4QQNA 3UOGA 3BAZA 3VPHA 1NBHA 1M2OA 4NATA 5B3LA 3EW9A 3H9GA 2ICAA 1VG9B 2W48A 4ALJA 1OXMA 1NHWA 3K70B 1JLRA 2GPBA 4GX1A 2BI7A 1PQUA 4NESA 2I4LA 4KMSA 1RBQA 3GGSA 3PRKE 4UBMA 4PM4A 1UEXC 3L7LA 1C9JA 4GX0A 4JP2A 4O59O 4TM7A 4AKIA 1NQUA 1EE9A 1T34A 2IODA 1M1ZA 3I2GA 1Z5UA 4ZVQA 4FNMA 5D6NA 1EK0A 1CQXA 3IB3A 5F7OA 4Y0NA 4BFYA 2ZSFA 3FR8A 4X92A 1PGJA 5F2NA 1OX6A 2Q29A 3Q6MA 3E9CA 4YWHA 4A8JB 1SVUA 2H1SA 1ENOA 2BTQA 3KBOA 4L27A 1GWNA 4WBSA 4HB4A 4M22A 4EHFA 2EAUA 2JFQA 1IZ0A 2VOEA 3CRNA 3MZ0A 4QDTA 3LDFA 3FNFA 1QIKA 1RMTA 1ECCA 3AZOA 3ROFA 4P0QB 1NPDA 1IY9A 2P3LA 4IH4A 3QYFA 1RXSA 4MAAA 2C4MA 5BSRA 2GA9A 4ZDWA 3R7FA 1PL7A 3AGQA 1XRNA 4L8FA 1MXFA 4YT2A 4DDMA 2JD0A 2GTHA 1YCHA 4YRJA 2XDYA 3KJFA 2B1RA 5KTPA 5IULC 1SVSA 4D96A 2OE2A 5CITA 1FNDA 2RK6A 3O8CA 1XZLA 1E3EA 3ONNA 3AP1A 1YJQA 2P9CA 3E48A 2ZQZA 4UVGA 2W7TA 3BORA 3HADA 3NT4A 1BXGA 1I0IA 2MHCA 3FDXA 3ONEA 4GI5A 1K5DA 3WMFA 1Q0UA 2JHFA 4J16C 3B6IA 3VI3B 1TPYA 3OZUA 4DJDC 4QOGA 1ZD3A 3MTQA 3V80A 7YASA 4K05A 3IIMA 2VP0A 4R68A 1TMKA 5DSZA 5TX7A 4E5KA 3QEAZ 4ND7A 3CF0A 4XM2A 1QGED 3EBPA 4JU9A 1NR7A 3BL5A 4Q3KA 5EXEA 2BHSA 2Z4TA 1H42A 1UKBA 3F9RA 3H97A 2EJTA 2WZCA 3MQFA 1E6MA 4JV5B 3QLVA 5MGBA 2OV2A 3PD1A 4O4HB 4RXMA 3UV6A 3WYEA 4H7DA 1R0YA 1YS4A 1NP6A 2WE8A 3ZC3A 1L5MA 2PD4A 1XRLA 1KDYA 2UU9B 2D1YA 3L01A 4A8JA 3SWWA 1XJQA 1IHDA 2EP5A 3WADA 1LTHR 2QG6A 1P31A 2QE7D 3AR8A 3PTAA 3OP4A 3P2EA 3GFBA 1Q7GA 4LXYA 2A14A 4G09A 2GF2A 1JAXA 1WXGA 4LYHA 4XIGS 1F2UA 5GY7A 1LB1B 3LC1O 4G3XA 2O3RA 1NXTA 2XMBA 2YBDA 1NC3A 2PGJA 5AJTA 4NFHA 3ACCA 3D4LA 3U37A 1ATIA 5EOVA 1GTSA 3HXPA 3KVVA 1NRIA 1T43A 4H77A 2PK3A 4QSMA 1K7CA 3WB1A 3U81A 3HCOA 2D2VA 1COZA 4OM7A 3HVUA 1XLUA 3G8AA 3P2KA 1NI5A 3TMYA 1YB1A 4NZMA 3HU2A 1VPLA 2P6PA 1HOTA 1TM7E 2JRLA 4PBRA 4Q48A 3SHFA 3E1GA 3PWTA 4WCDA 1QE3A 3GEMA 3VHXA 3WV4A 3TJRA 5F21A 1TCUA 2GOYA 2D4AA 3DWFA 2IOYA 2PT6A 4LYFA 3T38A 1BJKA 2D3WA 2JLSA 3DO8A 5HZKA 1HG0A 2LD4A 3UKJA 1O0SA 3SZRA 1BGWA 2JFOA 3UAOA 5L3SB 4O4IB 2NXWA 2WF6A 4EG6A 1Y9JA 4QGFA 1GCOA 1GQQA 4DM4A 3U56A 2P30A 1CLUA 3JVUA 5C7OO 3RJ5A 4WEOA 2Y0CA 2Y0PA 4DPMA 2JATA 4P34A 5BUCA 1NQTA 4TRNA 3AVXA 1YT5A 1TJ5A 2RJOA 3CKLA 1OFIA 4DLUA 5HS4A 1N3LA 4XGIA 3UPTA 1SQFA 3SEFA 5FUQA 4B8ZA 3GF4A 1O96B 4UEOA 2WWGA 4QVIA 1ORIA 3TS1A 2VNSA 3SPXA 1T4CA 5E2AA 4CF4A 5BSVA 1YBVA 3O0DA 1F6DA 4E3WA 3DR3A 4X6UA 4EUNA 5IT0A 2ECQA 2R85A 1O58A 2DLNA 5TARA 2G9UA 3MG9A 3OU7A 3KLBA 2HNKA 1SG0A 3A06A 2X13A 4Q66C 3KFVA 4P32A 2RHOA 3AHIA 4DZTA 5EHZA 2FUEA 3D2BA 3HU3A 3JATB 3V8NA 2HWKA 4N3BA 2O48X 1QVWA 1Q0ZA 4BNDB 2YV4A 2H1HA 5IXSA 2LVBA 3OU6A 4X84A 3LCVB 1P62B 1VMEA 3GT7A 2ZWVA 1R50A 3L06A 1T2EA 3RUAA 1ST3A 1QLJA 2TMYA 1PDVA 4H60A 3R7DA 1CU1A 1UDRA 2R62A 4KXNA 5TF0A 1JILA 3UJCA 5E6SB 5C8VA 2VCHA 4TWJA 3AIIA 1MW8X 2GK7A 4EPWA 1UXIA 1EINA 3R3WA 5CD1A 1V1MA 1PQWA 2VZ9A 1Z0KA 3GA0A 1RP1A 4FYPA 2NACA 4V0RA 5EZSA 3HP4A 3TZHA 1I6KA 3DF9A 1DQPA 1E2KA 3PWKA 5CX4A 3K7EA 1G21E 1CD5A 4ID9A 3I6IA 2BHRA 3OUUA 3CZCA 3OY7A 3QLUA 4OI4A 1P5HA 4PPFA 1LDGA 1COWA 1P2VA 4Q21A 1DXHA 1FUUA 1TEVA 3BWYA 3I72A 2YHUA 3MJEA 4RMIA 3PEVA 5JSKA 3ZY2A 1RRFA 2F55A 5K51A 3M0EA 2VRBA 1CR2A 3PZBA 2PO5A 3W8NA 5A4JA 1MAAA 2H7VA 3WLSA 1SD5A 2XQVA 3TLMA 5U1PA 4BZXA 1A9YA 1A04A 4OU4A 2ENUA 3GHHA 1KXZA 1CRLA 2ECKA 1XD2A 5AK0A 2IE8A 1B4DA 4HLNA 1LEHA 2J4DA 4DR5B 1NVFA 1QQ7A 2W9XA 3LQRA 2HRRA 1B8NA 4LUCA 4EHHA 1WWKA 5CVUA 4CMEC 1B8VA 1U8CB 3UJPA 2F90A 2B1GA 2JGIA 1KY2A 3PU6A 4IVQA 4DSAA 5LD2B 5B4TA 3FHCB 5FAKA 1RTTA 2B2NA 3KELA 1T26A 1JLSA 4DT1A 3IULA 4M8SA 3PUHA 4A73A 2GR9A 3OZTA 1NQAO 1GNVA 3IODA 1W46A 4K9OA 4NJMA 5EIXA 3ZX5A 1K6EA 2WJIA 2ZR9A 3GJQA 1GRVA 2ACKA 3NDPA 5REQB 4D4IA 1X7DA 4X1YB 2GHIA 3GPBA 1SEPA 2QAGA 1UPXA 2I6FA 4HX9A 1ZY2A 4RH1A 4Y6LA 1YR2A 2AL7A 1GTJ1 1UXHA 4HWPA 5MDHA 1DNPA 1ULUA 2QENA 4LJLA 3SZLA 5JC8A 2W2NA 3L5KA 1ZD2P 5JANA 5DULA 1W2HA 5EA2A 4LV5B 2I65A 2IZ0A 4M76B 1NL3A 1Y9DA 4QU5A 1VLLA 5KO2A 2OM6A 4H17A 4N0MA 4URZR 3QXXA 1ID1A 2H08A 1RLUA 1VJCA 1ZKMA 2JEYA 2PR7A 3EDOA 1ZC3A 3TQTA 2FFAA 4IHJF 3VV2A 4AIIA 4D9FA 1EFAA 2YHBA 1HZZC 3EGXB 2I29A 3D6UA 4KITB 1FL9A 5HF8A 2G8LA 4PCAA 4OB8A 1KOGA 2QTVA 3VU9B 1Y6ZA 3N6RA 5KJCA 2C8KA 5CYGA 2LTAA 3THXA 1L8QA 1PJQA 2BBTA 2GMWA 2JLBA 3A0RB 3AI3A 3OMWA 3WGHA 4B35A 1PNVA 2PKQP 3BE5A 1GRRA 1N2ZA 2GARA 2Q5FA 1ZICA 4BLOA 5LXTF 3A3NA 1YFZA 1ZOOA 4U7DA 4MCIA 5IJWA 1VHLA 2FPLA 4PIMA 1AURA 2DCUA 1L9KA 1SQ6A 3EWNA 4I14A 3TINA 4E14A 5K0EA 4IFTA 3RW9A 4N1AA 1FDTA 2QTTA 2ZANA 3QOWA 4QUEA 3EPHA 1GNTA 2IYSA 3PHHA 5JNLA 1QFSA 1U2ZA 1XAIA 5H1YA 4GMFA 1N5RA 2JHGA 1P1JA 2HSJA 2QD1A 2PLNA 3I2YX 3NTOA 4OHOA 4WLFA 2ZIFA 4B74A 1WXIA 3BQNB 1WZIA 1C4WA 5CVEA 3TW0A 1HT0A 3ELDA 2PR2A 3A37A 1LJLA 2YFQA 3GX1A 3KB8A 2H17A 3SZGA 4E4TA 3QUTA 3S81A 4JSTA 1DO2A 4B9AA 4JUAA 1PT7A 3GJ6A 3VO2A 3CLVA 4QULA 4R0VA 3VPXA 3CPHA 5KVSA 3INRA 2WSLA 1S89A 3HA7A 2FG5A 4MXDA 1JJ7A 1XDZA 2NUBA 3DDZX 4JA0A 4YWJA 1WQ3A 5REQA 1LX7A 1AO3A 3PUKA 2AN5A 2PSFA 2VF4X 3B1ZA 3CLRD 3WA7A 4NMWA 3Q6IA 4W5HA 2R6GA 4YHBA 4V2IA 1X7ZA 2OHIA 5EXDA 3ZOZA 4DR7B 4FGZA 3TTYA 1IHPA 4F5ZA 4IJ5A 1NQVA 1OT5A 2ZR8A 1Y3BE 3B5EA 1XHLA 2H7CA 4WBXC 2Q27A 1DCFA 1GPMA 2UZAA 1P74A 3OLZA 1C9NA 1RBMA 2DLCX 4U02A 1K6XA 1SC6A 4MJLA 3PLAE 2IXEA 1RXUA 4BO7A 2BEWA 1NI4B 2PTGA 4CMEA 3AGPA 5J2UB 1DHRA 4ZJZA 2JC3A 3L82B 1DQYA 1P5ZB 3FBWA 3AEUB 3G1UA 5EJ2A 4WZBE 2DBQA 2DP4E 3KD3A 2X9NA 3ECAA 4KDCA 3G1TA 1OGYA 3GZJA 3TUZC 2XUQA 1QO7A 5LNK1 1XTPA 1XDSA 2WZBA 3KPJA 4DG8A 2Z8XA 3B38A 2BJWA 3D0QA 4R6WA 3VC7A 1RXIA 2O3SA 4EI2A 3F8SA 3PKZA 5EHIA 5DNDA 4OATA 2FI1A 1YASA 1YJCA 1J8DA 5KPDA 5E8JA 1OWLA 5IT5A 1NW4A 4UM9B 3CH5A 4JBIA 4BVHA 2Q2WA 1OF1A 3FB4A 4HDOB 4BQIA 4TT3A 1T0JB 3PQ3A 5CLLA 5AUQA 3RWMB 4N39A 4B84A 1HMYA 1RJDA 1ZK2A 3TIVA 3MILA 3HL0A 5J2TF 2GHQA 1TZJA 2PH3A 3GFRA 4MR7A 4KOAA 3VDNB 1FU7A 1BHJA 1T6XA 3QENA 1OBOA 4G9GA 4UBJA 4A2CA 1QGAA 4LZJA 4ZQHA 2BGJA 3KCNA 5COAA 3TKYA 2E89A 2QX4A 1I1QB 3ZGNA 4POOA 5BP7A 3DA8A 1U81A 5GJCA 5IFKA 3IXLA 2JS7A 1TUGA 2UYCA 3KXIA 2V96A 3UNXA 2RD2A 2XUGA 4CMGA 3C45A 4P31A 2AOTB 2B61A 3K0BA 2JGDB 3D7LA 5B1EA 5BW8A 3I6MA 3MW8A 3LI2A 4HWSA 1DBVO 5KNBA 4LZWA 1KDOA 2X9GA 5CBPA 4DF3A 2AOUA 3OHMA 1F9AA 3VHLB 3AOEA 1I9GA 3IO3A 3TIFA 1QTQA 4Z54A 2RE8A 3A11A 1Q1NA 2C0CA 4O4LF 4UEJA 3GRPA 4F3CA 1IHXA 1QG2A 1ZA2A 2J46A 2OBLA 2OBMA 2ZREA 3I37X 4C0KA 3CSSA 4Q18A 5CM2Z 4ESHA 5K8JB 2JEZA 2Y8EA 2CHFA 3DFFA 1V39A 4GPIB 5AK4A 4O2LA 2VBIA 4AI6A 1JR3A 1QS0A 4BBJA 4U9HS 3RG2A 4I8DA 2BMEA 3VISA 5FBWB 2GFHA 1YGPA 2FEOA 2GXSA 3LSTA 1UJMA 5HCNA 2PZBA 4N8EA 1GGKA 3DPSA 5DYYA 1KBOA 1WBJB 3PYLA 1C3XA 2I03A 1HQDA 1IPHA 2BMWA 4MMYB 3NWJA 4UD2A 5KSYA 4RESA 1HDRA 1R0CA 1F8FA 1VRCA 1WM1A 2GCGA 5IF3A 2AX4A 4QATA 4MQEB 5ELMA 2VK2A 1UL1X 2YFHA 2HB6A 3JQ9A 3CFYA 3QIVA 1G59A 4ID3A 3NDIA 4I99A 5DNUA 3GFOA 4CF3A 5K6AA 3Q7PA 1E9BA 1N6NA 2DE0X 2QAJA 1K63A 3PKJA 1RTKA 1HDXA 5GZ3A 1OYVA 3W4JA 4IRUB 4EJSA 2CXQA 4OYRA 3NU1A 4GXTA 5BYBA 1BC5A 1QPBA 1Q21A 4GWGA 3S27A 2A0FA 3VYTB 4Z99A 4B4UA 4FMDB 1C0LA 2GEDA 1KQNA 3F5MA 2VS1A 2ZR0A 4DDWA 2UVQA 1N75A 2MMCA 4IRMA 1DC6A 2H92A 2IC5A 1XTIA 4N5DA 4WECA 1PRYA 2WKSA 3GFFA 3FWZA 1RPNA 5D87A 5JOQA 4R4JA 4U6NA 1N3IA 3MT7A 1X7GA 4I2VA 4P38A 5ERYA 4BMXA 2GUGA 3DE0X 3T3NA 2J7PA 3ZBPA 5AXCA 3NGXA 2O52A 1T1IA 4FDUA 4ZZ1A 1ZXLA 1AGPA 5JR3A 2JBHA 3CA8A 3PBKA 4LF5B 1TI7A 3FOCA 1LC3A 2ZSIA 4RCZA 4WESB 3E9DA 1NUAA 2NU7A 4LWZA 3DDHA 3TW8A 4RE6A 4N40A 3B9RA 1KC3A 3K92A 5AVWA 2H5JA 1GFZA 1XZQA 3HBJA 1DG3A 3K0CA 4LVUA 1PNOA 3NHJA 1W1IA 3MIIA 1GITA 2FN9A 2XWJI 3Q15C 3C5WP 3I04M 3RHFA 2RGDA 2RAUA 4YMLA 4JVMA 4L51A 3LBNA 4I55B 3TQQA 1NWCA 3BBPA 3DYIA 1KZ9A 5B1SA 2ZSEA 4J4HA 1JPUA 3A6PC 3D4BA 1KMIY 2R96A 3HB4X 2IYVA 4NU0A 2F7SA 2ENWA 4YRGA 4N41A 2EEPA 2P79A 1OLUB 2AG5A 4OHBA 3T9AA 1IHUA 3WSWA 1NTRA 3KB6A 4GQIA 4CMAA 3S8EA 4QOFA 5ESXA 3RRJA 1T1RA 4DMLA 4N3NA 3ENWA 3EEBA 1QP8A 4FPXA 1O08A 2QTCA 3OFVA 1PR2A 3IEKA 2W98A 3K35A 4HHEA 4KO3S 2HM7A 2CYAA 2NPIA 4GEKA 4I0WB 1N4AA 2VKTA 4CTJA 3LVQE 4E4RA 1T4MA 2YJ5A 1JFFB 1GQRA 1HE2A 5CX1B 1Q1BA 4M0DA 1RACA 3PNKA 1BU8A 1CY0A 4YP0A 3BTVA 3B7PA 3CLRC 2TMKA 3R3XA 4FCWA 2AB0A 4EPYA 1NKSA 4FM9A 4WV3A 1L4GA 3U4QB 4EENA 1U4OA 2ZJOA 2AFHA 2FW9A 1QYVA 1G3IA 4MVJG 3OJXA 3NPAA 5BORA 5GINE 3L1HA 1PWZA 2EF1A 1QDEA 3K15A 4FC7A 1WDMA 1LSUA 2VDKB 1W76A 1VL5A 4O2AA 1VHTA 2DMRA 4JJFA 3TXXA 1JDVA 2WWHA 3PC3A 2JLCA 2IYRA 3NRBA 4UMVA 3JVEA 5T67A 4EB3A 3HYLA 1CLEA 4Z7NB 5B6JA 1UJNA 3LUBA 5D51S 3KOYA 1HTBA 4NLLA 1RQ7A 4ZCLA 4A6XA 3E7XA 1E98A 4XWGA 4JGGA 3V1NA 1OC2A 2V3VA 2A57A 2OOSA 5JDCA 2XOEA 4P3PA 2PG3A 2X7XA 5FKJA 3TLBA 3WTBA 1BWQA 1DKNA 4K5QA 5GVRA 4X7RA 1TM2A 5CEEA 5JAIA 1PZHA 4D79A 3D0RA 4JYMA 2ZSAA 1GTRA 2AJBA 4TSRA 2ODQA 1Z7GA 3G7SA 1A1VA 3ZGOA 3OEYA 4RDCA 3B7WA 5HFJA 1KARA 3FPLA 1DX6A 3SC2A 3ZWMA 4EFLA 3L6RA 3ITNA 3GG2A 3LQ1A 2QXUA 3TRFA 3LOUA 4IXWA 1A2KC 1QRDA 5LNK6 4KBFA 2O5CA 3W2FA 4YDHB 4Y2SA 1GZSA 5INTA 1QS0B 3WYCA 3K5IA 1QR2A 1AKNA 1OAOC 4FDAA 4TM8A 2YIJA 5CYOA 2O54A 3GJ0A 1U1CA 4E15A 5CGZA 2BFDB 1SOMA 4A0FA 4D4MA 2Q1WA 3I83A 3T5AA 3HU5A 1P2DA 2PWPA 5B3KA 5B1YA 1SU8A 1U4NA 2JCGA 2YZNA 3U61B 4Z1MD 1S96A 5IZCC 5CBKA 5C46F 2IYTA 2YYSA 4GC5A 4R54A 5JAPA 1EU1A 2AMYA 2AV6A 1XE3A 1Z8FA 2E4VA 3EWAA 1ZM4A 5AJUA 5UKDA 3TPFA 1SOAA 1US8A 3DE4X 3VPBA 4D26A 2BFNA 3I53A 3VVBA 4FKZA 3HFGA 2G88A 3R8XA 1GUZA 1N2JA 2RC6A 5AQEA 1E7SA 3AJAA 1E32A 1WNTA