3WS4A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-2a)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws4A00
1S6RA 1BT5A 3O86A 4UA9A 1NY0A 1MXOA 3IF6B 2ZD8A 3DWZA 1JTDA 4BJPA 4UA6A 4DXCA 4OQGA 1W79A 3FYZA 3BFDA 1XKZA 1XPBA 1ESIA 1RCJA 1S0WA 2OLVA 3LEZA 4K0WA 4H8RA 1ALQA 1IYPA 4HBUA 5AQBA 1O7EA 3OCLA 4JF5A 1W5DA 5KZHA 2ZQCA 4OPRA 2H0TA 2FFYA 4EWFA 1KVLA 5CGWA 4S2NC 1KDSA 1NYMA 1K57C 4WZ5C 1K6SA 1TDLA 3OZHA 2WKIA 2ZM2A 2ZQ9A 1N9BA 1YM1A 3MXRA 4UAAA 3ZG0A 5HX9A 3VP2A 1Y54A 4E6WA 4OOLA 5JYOA 3ZFZA 1K4FA 4FD8A 4OPZA 1YMXA 4JF6A 4KZ8A 1WYBA 3W4PA 5EVIC 4BQMA 1PYYA 3C4PA 1XX2A 4CPKA 1K56A 1E3UA 4QB8A 3OC2A 4HBTA 4BD1A 4PM5A 2XDMA 1K38A 5EPHA 1MWUA 4C75A 3PTEA 3RXWA 2HDRA 2Y2IA 3GMWA 3PBSA 1ZG4A 1VM1A 2OSUA 4FH4A 5EE8A 2VGKA 2EX6A 3HLCA 5DTKA 2ZQ7A 3D4FA 1HTZA 1BULA 3EQVA 5TR7A 1CEFA 3LO7A 5F82A 1KGFA 3BM6A 3IWOA 4N1HA 4PM8A 4CJNA 5CGXA 5HAQA 5A93A 5A91A 4OH0A 1GA9A 4DE0A 2P9VB 3MXSA 4EBLA 1LHYA 4DF6A 3ZVTA 1L0FA 3IHBA 2X02A 4PMAA 1NXYA 4KG5A 5FAOA 2J8YA 5FQIA 3V5MA 2WUQA 2Y2MA 1WE4A 1N4OA 2Y59A 1EROA 1SDEA 1ZKJA 5FI2A 4DRTA 2HP6A 1CI8A 1MWTA 5HARA 4RX2A 1E4DA 3UPPA 4O7DA 5E2FA 1ONHA 1MWRA 3JYIA 4MLLA 1K54C 2E8IA 3UE1A 4WMCD 4KQRA 3OPRA 4X55A 3ZDJA 5A90A 3QNBA 5BOHA 3UNWA 4E3IA 3HVFA 4U3TA 3VP4A 5HW3A 3ZG9B 4HESA 4MNRA 3HBRA 1ZG6A 3HUOA 1EI5A 1GA0A 2OV5A 1L0EA 3NDEA 2Y2LA 4IEDA 4GKUA 4OQIA 4GDNA 2HP9A 2I72A 4S2PA 1JWVA 4GN2A 4P87A 3CG5A 4RX3A 3WS2A 4IVIA 5EUAA 3ISGA 1TEMA 3O87A 2CC1A 1LI0A 3OPPA 2GDNA 3MZFA 3SS5A 3ZHHA 3ZCZA 1GHIA 1RGYA 4DDSA 4OQHA 1IKIA 3N7WA 4P0MA 2C5WB 3ZG8B 3LCEA 3Q1FA 3AGDA 2WGVA 3HLFA 4FCFA 2WAFA 3IF6C 2ZQ8A 1YLJA 2BLSA 1HVBA 2JBFA 2ZJ9A 3BRMA 3ZG5A 1ES2A 1K25A 3NBLA 2RL3A 4OVDA 2EFXA 1IYQA 3IXGA 4XUZA 1CEGA 4LENA 2Y2KA 2QZ6A 4GDBA 2JCHA 2WGIA 4GOGA 4LCMA 1NZOA 4RYEA 2QMIA 2EX9A 2EXAA 2ZC5B 4IBRA 3G2ZA 3BFFA 5EECA 5KMWA 5D3OA 4MBHA 4QY6A 3C7VA 4C3QA 5DTTA 5FQQA 5IHVA 4OP8A 3N8RA 1K55A 1YLPA 3BLSA 3IXHA 1BUEA 4PM7A 3P09A 4XXRA 1NZUA 5E2GA 5CHJA 3WWXA 4WEKA 2V1ZA 2Z2LB 3MFDA 3N8SA 2Y2OA 2EX8A 5GHXA 3VSKA 3PBRA 1FOFA 1XA7A 2HDSA 3QHYA 2XK1A 3NCKA 2ZC6B 5FASA 1GHPA 4KQQA 2R9WA 3OPLA 3ZGAB 1ES3A 4KENB 4KZBA 1ES5A 3W8KA 5CEDA 2XFSA 4BL2A 3DTMA 1M6KA 3V39A 3SH9A 4ZJ2A 1LL5A 5CEBA 1O07A 3WS1A 3WS4A 1OMEA 5TFQA 4GD8A 3A3EA 3OCNA 3Q7VB 5GLBA 2DRWA 2QPNA 4WMCA 3BLMA 5CGSA 4E3MA 3WS0A 1PI4A 4R4SA 3GSGA 1Q2PA 3IQAA 4S2NA 1C3BA 1K57A 2IWDA 2R9XA 4WZ5A 5G18A 2V2FF 3S4XA 2XGNA 3VP0A 4S2IA 1ES4A 2HP5A 4E6XA 2C6WB 4JXWA 2Y2HA 3A3FA 3G2YA 3IWQA 3BEBA 1NRFA 3W4OA 5FQJA 4R1GA 3ZVWA 4GB7A 3V50A 4JKTA 4WM9A 4X56A 5EVIA 2EFUA 1IELA 4FH2A 1PIOA 5FDHA 1IKGA 1FCNA 2EXBA 4GD6A 4KZAA 5FQKA 4N9LA 3M6HA 2WGWA 3HREA 5AQAA 3TOIA 2P74A 3MKFA 2ZC3B 5CECA 1DJCA 1IYOA 1I5QA 4JXSA 3MZEA 5CHMA 5HAPA 2XD5A 4P6BA 5GL9A 3GQZA 1JTGA 4JBFA 4OP5A 1KE4A 2WKHA 4KQOA 1YLYA 2A3UA 4P85A 3HLWA 4IVKA 3HL9A 1BZAA 1FCOA 3VSLA 3P98A 5HAIA 1CI9A 5DTSA 1DY6A 1PZPA 4ZBEA 4QD4A 1MKIA 5FAPA 3VFHA 1G68A 2XF3A 3GR2A 5M19A 3DWKA 1MWSA 2XLNA 3HUMA 3NY4A 4R23A 1ESUA 3BYDA 4ID4A 4N9KA 2Q9MA 2HPBA 3NDGA 4M3KA 2XH9A 1EWZA 4PPRA 3I7JA 2J9PA 2XFTA 5I94A 1K54A 2Y2GA 5F83A 1YLWA 3PAEA 4OOMA 5FSRA 4LV0A 3IH9A 3LY4A 4BL3A 4RA7A 4HEFA 5A92A 1XXMA 2XR0A 1GCEA 4OLDA 5FAQA 4X68A 1NYYA 4JPMA 1Z6FA 1PW8A 3M6BA 4WBGA 3IF5A 3PAGA 1K6RA 2B5RA 2WKEA 1MBLA 3HUNA 3UO9A 5J8XA 1MPLA 3QNCA 4XUXA 1W8YA 5AQ7A 2XEPA 4OONA 3IXBA 1PWDA 2FFFB 2G2WA 1TVFA 3VP3A 2ZM0A 4MBFA 2Y55A 2BG1A 1BLPA 1K56D 2WADA 1E3UD 1JVJA 1TDGA 2VGJA 1KE0A 2XD1A 3GV9A 3G34A 1H8ZA 4GZBA 4LV1A 3AGEA 2V20A 3C5AA 3VOYA 1YT4A 5AQ9A 3IF6A 3GTCA 2HDQA 4GNUA 5F1FA 5E2HA 3UE3A 3IXDA 1PI5A 1FSYA 3G35A 5FA7A 3SS4A 3UE0A 1QMEA 1AXBA 4WELA 5FI7A 3WS5A 3MZDA 1FR6A 3PBTA 1J9MA 2X71A 4U0XA 1LL9A 3FV7A 2UWXA 1VQQA 3NI9A 2JC7A 3UPOA 5GHYA 2IWBA 3S22A 4S2LA 1E25A 5KSCA 3BFGA 2IWCA 1FCMA 1DJAA 3HLDA 3AGFA 3DW0A 3HLEA 5EVLA 3EQUA 3HLGA 3BECA 4KG2A 4EBPA 4R3BA 3N8LA 4DDYA 5FATA 4K91A 4KZ7A 1W7FA 1JWPA 1LI9A 4S2OA 3Q7VA 4BD0A 4QU3A 2OLUA 4BLMA 4Z9QA 2G2UA 1ERMA 2PU2A 1G6AA 3ITAA 3NC8A 1XA1A 3A3JA 4IBXA 1PWCA 4ZAMA 4ZJ1A 1KVMA 3UPNA 5L2FA 3ITBA 4PM6A 1YLTA 4LV2A 1BLCA 3A3DA 3CJMA 1PW1A 5EOOA 4Q8IA 1KDWA 5GHZA 2ZQDA 3GRJA 5CTMA 3UDIA 3ZNTA 2XQZA 1YLZA 5FI6A 1SDNA 4WEJA 4R4RA 4X69A 2H0YA 4QHCA 3V3RA 2ZLYA 4YINA 2WAEA 4F94A 1YQSA 3RJUA 3W4QA 4D2OA 4MEZA 5DF9A 5EOEA 1U60A 2ZC7A 4C6YA 2ZQAA 3IH8A 4B88A 4DE2A 3M2KA 3SH7A 2WK0A 1BLSA 4E3LA 3N4IA 3RXXA 4DKIA 4NK3A 5JYPA 4EBNA 3E2LA 2P9VA 3CMZA 2RCXA 2WZXA 3M2JA 3O88A 4KG6A 3S1YA 3TG9A 5CERA 1ZC2A 2EX2A 2Y91A 1FR1A 3G4PA 3Q82A 1I2WA 5DF7A 4KZ5A 4KZ9A 1HD8A 4OOYA 1KGEA 4WYYA 1DJBA 4L0LA 2ZMAA 5FQ9A 5M18A 1XP4A 3BFEA 1PZOA 3N6IA 4X6TA 5M1AA 4PM9A 4ZJ3A 1SHVA 2JE5A 3MBZA 2A49A 3UDXA 2Y2NA 5E43A 4EQIA 1LLBA 3C4OA 4MBKA 4JXVA 4JF4A 1BLHA 3CZDA 3LY3A 1H5XA 3O3VA 4NETA 1BSGA 5CHUA 2J9OA 4ZDXA 5CTNA 4Y0UA 1SKFA 5GLCA 3UDFA 3V3SA 1JWZA 3HLBA 3E2KA 1ONGA 2J7VA 3PBOA 3C7UA 2Z2MB 4OPYA 4Y0OA 3FWLA 1IEMA 4LV3A 4Y0TA 4E3KA 4KZ6A 1IYSA 3NIAA 5EVIB 2Y2JA 3IT9A 1BTLA 3GVBA 5HL1A 2ZM8A 3FZCA 2X01A 3SH8A 4R0QA 1ERQA 2WGWB 2Y2PA 3FKWA 1L0GA 4N1XA 4UHUA 5CRFA 3MKEA 2PBYA 4DXBA 3PBNA 3Q07A 4K0XA 4QY5A 1HZOA 4JLFA 3UN7A 4BENA 4S2MA 3A3IA 5GLDA 1M40A 2Q9NA 3B3XA 4DE3A 3G32A 3ZNYA 4KZ3A 1W8QA 4E3OA 1KE3A 4OQ0A 4E3NA 2HDUA 4A5RA 1RP5A 3VMAA 3G31A 3VOZA 3PBQA 4X53A 5EVID 4JXGA 3SOIA 1NJ4A 4OLGA 4RVAA 1PWGA 4WZ4A 1XGIA 3TSGA 4Y7PA 5KSHA 5HFOA 1I2SA 1Q2QA 4E3JA 5FQMA 4ZTKA 3WRTA 3VFFA 4R3JA 2H5SA 4QJGA 4B4ZA 2DCFA 5TGFA 4OPQA 3G30A 3SS3A 1QMFA 1GHMA 4EV4A 4YFMA 3VP1A 2WYXA 1SCWA 2H10A 5DF8A 1FQGA 3BFCA 2PU4A 2Y4AA 1H8YA 5F1GA 1FSWA 1KGGA 5E2EA 2DNSA 1WYCA 3OPHA 3WRZA 4S2KA 3FKVA 4UA7A 1RGZA 5GLAA 3ZG7B 4N92A 5CXWA 3UY6A 4EUZA 3IHAA 4S2JA 5U47A 1L0DA 3Q81A 2Y2QA 4FSFA 1K4EA 1L2SA 3Q7ZA 1MY8A 4LCLA 1K55C 3IWIA 5DVAA 4U0TA 4KZ4A 4OKPA 4B4XA 1XGJA 4DE1A 2WZZA 1YMSA 2ZC4B 1CK3A
chains in the Genus database with same CATH superfamily
4R6LA 4EQ1A 4UA9A 1JTDA 2HJ9C 4UA6A 3KYQA 4D60A 4DXCA 4R70A 1X0OA 1DP9A 3LEZA 1P97A 4H8RA 1IYPA 5AQBA 4Y15A 4JF5A 5I5LA 5KZHA 1D06A 4OPRA 2FFYA 1SZVA 1K57C 5AJGA 2WKIA 5G4YA 5HX9A 3VP2A 5JYOA 1XX2A 4FOFA 3EOIA 3T4JA 3CHWP 1MWUA 3PTEA 2W1TA 4UEYA 2PR5A 3BJNA 2EX6A 3HLCA 5DKKA 3LO7A 3T4LA 3IWOA 4Y2FA 3H9WA 3MXSA 4MN5A 2W0NA 3F1NB 1NXYA 4G3VA 4HIAA 1L3LA 2WUQA 4DRTA 1SDEA 4RX2A 4O7DA 4Q0HA 3KSFA 1ONHA 2JKTM 1XFQA 3OPRA 3ZDJA 1AWIA 3H7WA 5BOHA 2A2LA 3HBRA 1ZG6A 2W3GA 3HUOA 2OV5A 4L9FA 4QWOA 4S2PA 1JWVA 4RX3A 3ISGA 2P7JA 3O87A 4MDZA 3OPPA 3ZCZA 2GDNA 1TS7A 1UGUA 3SW1A 1GHIA 1NRJA 1IKIA 4P0MA 4NXGA 2C5WB 3ZG8B 3K3DA 3Q1FA 3AGDA 3HLFA 2WAFA 3HJKA 2JBFA 3NBLA 2V1BA 4XUZA 2VV6A 4LENA 4CQHA 1MC0A 2QKPA 4LCMA 1NZOA 3BFFA 5D3OA 3C7VA 4C3QA 1VETB 4OP8A 1S4RA 3LIEA 2MJ6A 4XXRA 1NZUA 4WEKA 4BBUA 2Z2LB 3N8SA 1FOFA 3A0SA 1XA7A 3QHYA 2XK1A 3NCKA 4Y3IA 4KZBA 1ES5A 3W8KA 5CEDA 3DTMA 3SH9A 2K7SA 1O07A 1Z09A 3E4OA 3A3EA 3Q7VB 5GLBA 4WMCA 5CGSA 3WS0A 3IQAA 2ZMFA 1K57A 3VE3A 2IWDA 1ES4A 1PFLA 3TJZC 2PD7A 1OJ5A 3UB7A 5L09A 2WKPA 3G2YA 5HD5A 4X56A 3F1NA 2PDRA 4FH2A 2XROA 4KZAA 5AQAA 3M6HA 2WGWA 3HREA 4GHIA 1IYOA 1H3QA 4CLCC 3PR6A 1KOUA 5CHMA 5HAPA 4P6BA 5GL9A 2JN7A 4X1LA 3BWLA 2G7UA 2B18A 3VFHA 2XF3A 4X25A 4E04A 3UB9A 2ZBBA 4M3KA 2HPBA 2XH9A 4CLCB 4PPRA 3I7JA 5I94A 4P6ZS 5F83A 4II7A 4OOMA 4AFIA 5DFXA 5A92A 1XXMA 3M6BA 4ESPA 3FC7A 4EERA 4Y13A 2B5RA 4Z1WA 4EEPA 2PYRA 4I38A 5AQ7A 4EUVA 2FFFB 4JGQA 4LLOB 5F69A 3E98A 3LR4A 1KE0A 3PXPA 3U2AA 3G34A 4I5SA 3VOYA 2DMWA 4LV1A 1VETA 3GTCA 1AXBA 3WS5A 1FR6A 3PBTA 1LL9A 2UWXA 1DP6A 4S2LA 3IS2B 5KSCA 1FCMA 3AGFA 3HLEA 4R3BA 5FATA 1W7FA 3Q7VA 3GDIA 2G2UA 1ERMA 3IX3A 1PWCA 5L2FA 3ITBA 3MFXA 4GJ4A 4WLAA 1FILA 4X69A 4P6ZM 1YQSA 4D2OA 4MEZA 3ZYTA 4EXOA 1U60A 2P04A 5G4ZA 4L9GA 4EESA 2ZQAA 1TS0A 4DE2A 2O9AA 5DJUA 4E3LA 2GZAA 4DKIA 4NK3A 1HLUP 3B33A 2WZXA 5F6AA 2EX2A 2Y91A 1LSWA 3G4PA 3Q82A 2ACGA 4WYYA 4L0LA 3N6IA 1PZOA 2CMNA 4G3WA 3MBZA 4CLCA 3LR5A 1NLYA 1BLHA 2VGLM 1BSGA 3H82A 2J9OA 4O01A 1SKFA 4Y0OA 1IEMA 3BY8A 4LV3A 4E3KA 4KZ6A 1IYSA 1BTLA 2K31A 3GVBA 2ZM8A 4O0PA 2X01A 4R0QA 4ETXA 1L0GA 3MKEA 5L10A 3T1QB 4JLFA 3UN7A 4S2MA 3KO6A 4DE3A 3G32A 4KZ3A 2YKFA 4E3OA 1XJ3A 2HDUA 1OTEA 3C38A 3OBFA 3IS2A 2PR6A 3F1OB 1D1JA 1IFQA 3EEAA 4OLGA 2AVXA 1S4SA 1DRMA 4E3JA 5HZHA 4R3JA 2H5SA 2V8CA 5TGFA 3VP1A 2WYXA 1SCWA 4HQAA 4HNBA 1H8YA 5F1GA 3WRZA 1RGZA 3MF0A 4N92A 4EUZA 4XT2B 3Q7ZA 1YSQA 4LCLA 1K55C 4KZ4A 4PMAA 1CK3A 1S6RA 1BT5A 3VOLA 4BJPA 2J3TD 4FTXA 4I39A 4OQGA 1W79A 1ESIA 1OPXA 3LR0A 1O7EA 4WZ5C 3OZHA 3NECA 1GSWA 3HCYA 1WYBA 3UE6A 4CPKA 1P9WA 4BBTA 3RXWA 4ARZB 2OSUA 3GECA 1VB6A 4KQDA 3EQVA 1BULA 1IOUA 1CEFA 1KGFA 1LSXA 4OH0A 1LHYA 4DF6A 2INWA 3IHBA 1WE4A 2Y59A 1EROA 5FI2A 1MWTA 4EU0A 4MLLA 3S7QA 4WMCD 5A90A 3CLOA 4X55A 3QNBA 4BBVA 3UNWA 4E3IA 2J3TC 3BW6A 4U3TA 3T1RA 3VP4A 3ZG9B 1LL8A 3D9YA 4MNRA 1EI5A 1GA0A 3NDEA 2Y2LA 2HP9A 2LB9A 1TS8A 3CG5A 3MQ0A 5DKLA 3WS2A 4LRZE 3ZHHA 3MZFA 1RGYA 2W3EA 2P08A 2LB5A 2WGVA 4XT2A 4FCFA 4B9OA 1YLJA 3ZG5A 3F1PA 2XSSA 2B95A 5KIZA 2QYBA 3T4KA 2EFXA 3IXGA 1N9OA 3VV4A 2JCHA 2QMIA 1G5UA 4YOFA 2Y79A 5HWWA 4MBHA 1K55A 1YLPA 5E2GA 5CHJA 3WWXA 2V1ZA 2EX8A 3C2WA 3PBRA 4PAUA 2HDSA 3W2ZA 5FASA 4JGPA 4R38A 2R9WA 3OPLA 1CF0A 3V39A 3DBAA 3R4KA 3WS1A 5TFQA 5IU1A 3NHQA 3CPTB 2JKRM 1PI4A 3GSGA 2R9XA 4WZ5A 3S4XA 2HP5A 4JXWA 3IWQA 3W4OA 3V50A 4JKTA 2EFUA 3D72A 2PD8A 4H6JB 5CECA 2VEAA 3T4QA 5J4EA 3A0VA 1T1BA 4X1MA 2XD5A 2W1RA 4I3JA 3GQZA 1JTGA 4LRXC 4OP5A 2WKHA 1YLYA 1XJ4A 2D02A 5MC7A 3TW8A 3VSLA 1FCOA 3P98A 1CI9A 4MCWA 1MKIA 5FAPA 1MWSA 2XLNA 3NY4A 4R23A 3BYDA 2Q9MA 4FUWA 4EEUA 2XFTA 2XRNA 1ZHHB 1OTBA 5HPIA 2L4RA 4LV0A 3LY4A 4BL3A 2XR0A 1UWNX 1NYYA 3IBRA 4JPMA 2FZ0A 1Z6FA 4WBGA 3IF5A 3PAGA 2WKEA 3HUNA 3UO9A 1YPRA 5J8XA 2HZ5A 3QNCA 3UMDA 3LGOA 2XEPA 4OONA 1PWDA 2ZM0A 2BG1A 1BLPA 1K56D 4CLCD 1TDGA 3AGEA 5AQ9A 5E2HA 3SS4A 4WUJA 1VQQA 4BWIA 3UPOA 5GHYA 1SKOB 3BFGA 4JGOA 3HLGA 2ZOIA 3HJIA 3N8LA 4DDYA 4S2OA 4NKPA 4QU3A 2PAVP 4BLMA 2PU2A 3A3JA 4IBXA 3FG8A 4PM6A 1JNUA 4LV2A 1TD5A 3CJMA 4Q8IA 2ZQDA 3GRJA 3MQOA 3ZNTA 1YLZA 4WEJA 3ZQ5A 3V3RA 2WAEA 3MQQA 3S7PA 4F3LB 3T50A 4H6JA 2ZC7A 3G6OA 1TS6A 5K5BA 1BLSA 2EWVA 4EBNA 2RCXA 4KG6A 2E8JA 1J3WA 1ZC2A 1FR1A 1I2WA 3OOVA 4KZ9A 1DJBA 4X6TA 5M1AA 3P01A 4PM9A 4ZJ3A 2JE5A 2A49A 2GJ3A 2Y2NA 4EQIA 3L7HA 2QJ7A 4MBKA 4JXVA 4JF4A 3LY3A 2GX5A 2BTFP 1H5XA 3O3VA 4NETA 4ZDXA 3UDFA 3V3SA 3HLBA 4OPYA 3FWLA 5HDDA 3NIAA 5EVIB 1PNEA 1D7EA 2PBDP 5CRFA 3PBNA 2VKSA 4QY5A 4BENA 3KYEA 5GLDA 1OTDA 4Y17A 1KE3A 4OQ0A 2OOLA 3TE8A 4O8GA 2XA7S 4DJ2A 4A5RA 1RP5A 3VMAA 3PBQA 4JXGA 2QJ5A 1NJ4A 5J3WA 4WZ4A 5KSHA 4Y7PA 3NOPC 1I2SA 3RTYA 5FQMA 3WRTA 4QJGA 3CUEC 4B4ZA 2DCFA 4OPQA 3SS3A 1QMFA 3L9KA 3NOUC 3BQ8A 3BFCA 2PU4A 1N9LA 2Y4AA 5EV0A 1GSXA 5HL6A 5E2EA 1WYCA 5CXWA 5U47A 1L0DA 1MY8A 5DVAA 2QWSA 4B4XA 2PHYA 5LBRA 4DE1A 2VX8A 3T1SA 3O86A 1NY0A 1MXOA 3IF6B 2ZD8A 3UB8A 3KSIA 3KSHA 3IX8A 4R3AA 3EWKA 3FYZA 1XKZA 1RCJA 4K0WA 1ALQA 4HBUA 2IA2A 3OCLA 1W5DA 2H0TA 2VZWA 5CGWA 4S2NC 1KDSA 1TDLA 4Q0IA 2ZM2A 3MXRA 3ZG0A 4E6WA 4DMZA 1K4FA 4K08A 4FD8A 4OPZA 1YMXA 4JF6A 4KZ8A 3W4PA 4BQMA 3C4PA 1K56A 3OC2A 4HBTA 4BD1A 4PM5A 1CJFA 1K38A 5EPHA 2HDRA 1ACFA 3GMWA 3PBSA 1ZG4A 1VM1A 5EE8A 2VGKA 2ZQ7A 3D4FA 3LI8A 1HTZA 2NUPC 1K0KA 4PHTA 5TR7A 3BM6A 4PM8A 3PYPA 1GA9A 2P9VB 2Y8HA 2O9CA 3ZVTA 5TJJA 4HOIA 2J8YA 1ZKJA 2KOIA 3QP6A 1CI8A 1LSVA 1E4DA 3UPPA 3JYIA 1MWRA 1K54C 2E8IA 4HI4A 2FH5A 3HVFA 3DAVA 5A8BA 2OWHA 2O9BA 4HJ4A 1L0EA 3DTIA 4GKUA 1T1AA 4GN2A 4P87A 1TEMA 3SS5A 4DDSA 3N7WA 1DP8A 2ZL1B 3LFVA 3LIAA 2VA0A 4ETZA 3BRMA 2W27A 3CUEA 1K25A 2RL3A 3MMHA 4OVDA 3QP1A 1IYQA 5DJTA 2QZ6A 4GDBA 4HJ6A 3KX0X 4GOGA 2EX9A 2ZC5B 4IBRA 4IUKA 3G2ZA 5EECA 5L8MA 4QY6A 5DTTA 5IHVA 3N8RA 3IXHA 4PM7A 2L1MA 4ME4A 3CAXA 1LT0A 3MFDA 2Y2OA 5GHXA 3VSKA 1W63M 2ZC6B 1GHPA 5TBMB 3ZGAB 1ES3A 2XFSA 5HPFA 2V8FA 4BL2A 1M6KA 4WF0A 4ZJ2A 1YSPA 1LL5A 5CEBA 3WS4A 3KSGA 3MXQA 4GD8A 2DRWA 2QPNA 4E3MA 3S7OA 3QP8A 4YNRA 4S2NA 1C3BA 1UWPX 3LI9A 3A0RA 5EVEA 5HWTA 2C6WB 3A3FA 3BEBA 1NRFA 5FQJA 3ZVWA 1XFNA 1PIOA 3T4OA 5FDHA 1IKGA 1FCNA 2EXBA 2QHKA 4GD6A 3TOIA 4MN6A 4N9LA 3P7NA 2P74A 3MKFA 2ZC3B 1DJCA 1I5QA 3EGXC 2HV1A 3BQAA 3ICYA 2JKRI 4ZRRA 4JBFA 5J7EA 1KE4A 4KQOA 4P85A 3D3OA 4IVKA 3HL9A 1BZAA 5HAIA 3U4LP 5DTSA 4ZBEA 1W63Q 1YKDA 3F1OA 2K2NA 4RQ9A 5M19A 3DWKA 4DJ3A 1ESUA 3MSHA 3NDGA 3RH8B 1K54A 2PT7A 2ZL1A 1YLWA 5L07A 3PAEA 2W1TB 4RA7A 4HEFA 1GCEA 4OLDA 5FAQA 1K6RA 2A24B 3E0YA 4XUXA 4GW9A 5F5YA 4MBFA 2OWJA 1E3UD 2XD1A 2VGJA 3GV9A 4GZBA 2V20A 3C5AA 1YT4A 5AVEA 5F1FA 3UE3A 5FA7A 1PI5A 1F5MA 3G35A 4WELA 5FI7A 1J9MA 2X71A 4U0XA 2HJEA 3NI9A 2IWBA 1E25A 2W3DA 1DJAA 3HLDA 3DW0A 5FL3A 4KG2A 4EBPA 1LI9A 3SZTA 4ZAMA 3UPNA 4Q0JA 1GSVA 2JHEA 1YLTA 2OAQ1 5CTMA 3UDIA 1SDNA 4R4RA 1OTAA 4QHCA 2ZLYA 4F94A 4ARZA 5DF9A 2GNXA 5FEGA 3IH8A 4B88A 3M2KA 2WK0A 3RXXA 5JYPA 3LUQA 2BASA 3S1YA 3TG9A 5CERA 3UMEA 5IS1A 4B93A 2J3WA 1HD8A 4JGRA 2J80A 1KGEA 1XP4A 3K3CA 5E43A 3C4OA 1WA9A 3CZDA 5HD3A 1T18A 5CHUA 2J7VA 3PBOA 3C7UA 2Z2MB 3T1XA 4YWZA 4Y0TA 2A24A 1V9YA 2Y2JA 4DN0A 5HL1A 2EA9A 3FZCA 2WGWB 3FKWA 4GHIB 2PBYA 3Q07A 3JPUA 1HZOA 2I9VA 1S66L 3UB6A 1OTIA 5IT5A 4I3IA 1M40A 2Q9NA 1MZUA 3ZNYA 3LIDA 1W8QA 5HDCA 4PKYA 2HF6A 1S1YA 3UB5P 4L9EA 5EVID 1VHMA 1XGIA 3TSGA 5HFOA 1P0ZA 1Q2QA 4ZTKA 1XJ6A 4WN5A 3G30A 4EV4A 1GHMA 4YFMA 2VLGA 1T1CA 5DF8A 4NEED 1FSWA 1KGGA 2DNSA 3CPTA 4S2KA 3FKVA 4UA7A 5GLAA 3ZG7B 3FPWA 3EEHA 4S2JA 3R7WB 3Q81A 2Y2QA 1K4EA 3IWIA 2B02A 3LIBA 1ODVA 4OKPA 1XGJA 2WZZA 3S7NA 5CX7A 2ZC4B 2M7VA 1S1ZA 4NXFA 3DWZA 4CLCE 3CWFA 3BFDA 1XPBA 1S0WA 2M1CA 2OLVA 4HP4A 2ZQCA 4HJ3A 4UQIS 3K2NA 4EWFA 1KVLA 1NYMA 1K6SA 3V67A 2ZQ9A 4UAAA 1N9BA 1YM1A 1Y54A 5FEFA 4OOLA 2WKRA 3ZFZA 2JKGA 3QP5A 5EVIC 4I3AA 1PYYA 3C30A 4HH2A 1E3UA 4KUOA 4QB8A 2XDMA 2W3HA 5FDSA 4C75A 2Y2IA 1V9ZA 3E4QA 1TF1A 4FH4A 2WKQA 5DTKA 2YKHA 3TRCA 2V0UA 1OJGA 4CJNA 5F82A 4N1HA 5CGXA 5HAQA 5A93A 5A91A 4DE0A 4EBLA 5AVFA 1L0FA 3QP4A 2X02A 4KG5A 4NXEA 4M4XA 5FAOA 5FQIA 3V5MA 1F2KA 2Y2MA 1N4OA 5EM1A 2HP6A 2JKFA 5HARA 5E2FA 3NULA 3UE1A 1H8MA 3LIFA 4KQRA 3T4SA 3CI6A 5HW3A 4HESA 2Z6CA 4IEDA 4OQIA 4GDNA 1SKOA 4GCZA 2I72A 3H82B 1S67L 2EWWA 4IVIA 5EUAA 4UQIM 2O0YA 2CC1A 1LI0A 4OQHA 3BY9A 3OLOA 3LCEA 1VEUB 1NWZA 3R7WA 4NXBA 3IF6C 2ZQ8A 2BLSA 1HVBA 4LFUA 2ZJ9A 1ES2A 4F3LA 1CEGA 3KYZA 2Y2KA 2WGIA 4NG2A 4RYEA 2EXAA 2VGLS 1N9NA 5KMWA 2VV7A 2HGVA 5FQQA 4GS9B 1A0KA 3BLSA 1BUEA 3P09A 3RFBA 4KQQA 4KENB 3QP2A 1H0MA 2V1AA 1OMEA 2XA7M 3OCNA 3BLMA 2V9AA 2ZMVA 3MJQA 5F68A 4R4SA 1Q2PA 1T19A 3EGDC 5G18A 2O99A 2V2FF 2XGNA 4GLQA 3VP0A 4S2IA 4E6XA 5EM0A 2Y2HA 4R1GA 4MMNA 4GB7A 4WM9A 5EVIA 1IELA 1ZTUA 5FQKA 5EFWA 4LRYC 2PRFA 4KUKA 2VJWA 4JXSA 3MZEA 5HSQA 2A3UA 3HLWA 3MS6A 1DY6A 1YAXA 3B47A 1PZPA 4QD4A 4IHQA 3PHYA 1G68A 3GR2A 2VV8A 2Z6DA 3HUMA 3E4PA 4ID4A 4N9KA 1EWZA 2J9PA 4PKYG 3NOTC 5HDSA 1VEUA 2Y2GA 5FSRA 3IH9A 4X68A 1PW8A 2V0WA 1PRQA 1MBLA 1MPLA 1G6OA 2M7UA 1W8YA 3IXBA 1OT6A 2G2WA 1TVFA 3DTKA 3VP3A 2Y55A 2WADA 1JVJA 2KDKA 2R78A 1H8ZA 4GS9A 4IUHA 1F98A 3IF6A 2HDQA 4GNUA 3UE0A 3IXDA 1FSYA 1Y4OA 1QMEA 3JVVA 3MZDA 1F9IA 3LEQA 3T4TA 3FV7A 2JC7A 3S22A 4LPZA 2IWCA 4IJGA 4G3KA 5EVLA 3EQUA 3BECA 4K91A 1P9RA 4KZ7A 1MKMA 1JWPA 4BD0A 2OLUA 4Z9QA 3ITAA 1G6AA 3NC8A 1XA1A 4ZJ1A 4Y5FA 1KVMA 3IBJA 4QPRA 1BLCA 3A3DA 5EOOA 1PW1A 4HP9A 1KDWA 5GHZA 3DTEA 1EW0A 2UV0E 2VK3A 2XQZA 5FI6A 3JVUA 3F1PB 2H0YA 2L0WA 4YINA 3RJUA 3W4QA 2D01A 3CITA 5EOEA 4C6YA 3SH7A 4BMWA 3ULFA 2NUTC 3N4IA 3LICA 3E2LA 2P9VA 3CMZA 3M2JA 3O88A 1XJ2A 4EETB 4HY8A 2W3FA 1FIKA 3MR0A 5DF7A 4KZ5A 4OOYA 2ZMAA 5FQ9A 5M18A 3BFEA 3LYXA 1SHVA 2PYPA 3UDXA 1LLBA 4EW7A 3B42A 5CTNA 4Y0UA 5GLCA 1JWZA 3E2KA 1ONGA 5C5KA 1OT9A 2H28A 3IT9A 3SH8A 2KLIA 1ERQA 2Y2PA 3FPVA 3NJAA 2ZOHA 4N1XA 4UHUA 3LR3A 4DXBA 4K0XA 1Y28A 1NLZA 1G28A 3A3IA 3B3XA 4LGWA 2Q0OA 4WL9A 4E3NA 1CQAA 3G31A 3VOZA 4X53A 3SOIA 3T12B 2KX6A 4RVAA 1PWGA 3H7WB 5HWVA 4MN7A 3VFFA 5TBMA 2JKTI 1BYWA 1STZA 3C8CA 2H10A 2OAP1 1FQGA 4HH3A 3OPHA 4HHDA 3VE4A 3UY6A 3O5YA 3IHAA 4FSFA 1L2SA 4U0TA 3IX4A 5DFYA 1YMSA
chains in the Genus database with same CATH topology
1S6RA 1BT5A 3O86A 4UA9A 1NY0A 1MXOA 3IF6B 2ZD8A 3DWZA 1JTDA 4BJPA 4UA6A 4DXCA 4OQGA 1W79A 3FYZA 3BFDA 1XKZA 1XPBA 1ESIA 1RCJA 1S0WA 2OLVA 3LEZA 4K0WA 4H8RA 1ALQA 1IYPA 4HBUA 5AQBA 1O7EA 3OCLA 4JF5A 1W5DA 5KZHA 2ZQCA 4OPRA 2H0TA 2FFYA 4EWFA 1KVLA 5CGWA 4S2NC 1KDSA 1NYMA 1K57C 4WZ5C 1K6SA 1TDLA 3OZHA 2WKIA 2ZM2A 2ZQ9A 1N9BA 1YM1A 3MXRA 4UAAA 3ZG0A 5HX9A 3VP2A 1Y54A 4E6WA 4OOLA 5JYOA 3ZFZA 1K4FA 4FD8A 4OPZA 1YMXA 4JF6A 4KZ8A 1WYBA 3W4PA 5EVIC 4BQMA 1PYYA 3C4PA 1XX2A 4CPKA 1K56A 1E3UA 4QB8A 3OC2A 4HBTA 4BD1A 4PM5A 2XDMA 1K38A 5EPHA 1MWUA 4C75A 3PTEA 3RXWA 2HDRA 2Y2IA 3GMWA 3PBSA 1ZG4A 1VM1A 2OSUA 4FH4A 5EE8A 2VGKA 2EX6A 3HLCA 5DTKA 2ZQ7A 3D4FA 1HTZA 1BULA 3EQVA 5TR7A 1CEFA 3LO7A 5F82A 1KGFA 3BM6A 3IWOA 4N1HA 4PM8A 4CJNA 5CGXA 5HAQA 5A93A 5A91A 4OH0A 1GA9A 4DE0A 2P9VB 3MXSA 4EBLA 1LHYA 4DF6A 3ZVTA 1L0FA 3IHBA 2X02A 4PMAA 1NXYA 4KG5A 5FAOA 2J8YA 5FQIA 3V5MA 2WUQA 2Y2MA 1WE4A 1N4OA 2Y59A 1EROA 1SDEA 1ZKJA 5FI2A 4DRTA 2HP6A 1CI8A 1MWTA 5HARA 4RX2A 1E4DA 3UPPA 4O7DA 5E2FA 1ONHA 1MWRA 3JYIA 4MLLA 1K54C 2E8IA 3UE1A 4WMCD 4KQRA 3OPRA 4X55A 3ZDJA 5A90A 3QNBA 5BOHA 3UNWA 4E3IA 3HVFA 4U3TA 3VP4A 5HW3A 3ZG9B 4HESA 4MNRA 3HBRA 1ZG6A 3HUOA 1EI5A 1GA0A 2OV5A 1L0EA 3NDEA 2Y2LA 4IEDA 4GKUA 4OQIA 4GDNA 2HP9A 2I72A 4S2PA 1JWVA 4GN2A 4P87A 3CG5A 4RX3A 3WS2A 4IVIA 5EUAA 3ISGA 1TEMA 3O87A 2CC1A 1LI0A 3OPPA 2GDNA 3MZFA 3SS5A 3ZHHA 3ZCZA 1GHIA 1RGYA 4DDSA 4OQHA 1IKIA 3N7WA 4P0MA 2C5WB 3ZG8B 3LCEA 3Q1FA 3AGDA 2WGVA 3HLFA 4FCFA 2WAFA 3IF6C 2ZQ8A 1YLJA 2BLSA 1HVBA 2JBFA 2ZJ9A 3BRMA 3ZG5A 1ES2A 1K25A 3NBLA 2RL3A 4OVDA 2EFXA 1IYQA 3IXGA 4XUZA 1CEGA 4LENA 2Y2KA 2QZ6A 4GDBA 2JCHA 2WGIA 4GOGA 4LCMA 1NZOA 4RYEA 2QMIA 2EX9A 2EXAA 2ZC5B 4IBRA 3G2ZA 3BFFA 5EECA 5KMWA 5D3OA 4MBHA 4QY6A 3C7VA 4C3QA 5DTTA 5FQQA 5IHVA 4OP8A 3N8RA 1K55A 1YLPA 3BLSA 3IXHA 1BUEA 4PM7A 3P09A 4XXRA 1NZUA 5E2GA 5CHJA 3WWXA 4WEKA 2V1ZA 2Z2LB 3MFDA 3N8SA 2Y2OA 2EX8A 5GHXA 3VSKA 3PBRA 1FOFA 1XA7A 2HDSA 3QHYA 2XK1A 3NCKA 2ZC6B 5FASA 1GHPA 4KQQA 2R9WA 3OPLA 3ZGAB 1ES3A 4KENB 4KZBA 1ES5A 3W8KA 5CEDA 2XFSA 4BL2A 3DTMA 1M6KA 3V39A 3SH9A 4ZJ2A 1LL5A 5CEBA 1O07A 3WS1A 3WS4A 1OMEA 5TFQA 4GD8A 3A3EA 3OCNA 3Q7VB 5GLBA 2DRWA 2QPNA 4WMCA 3BLMA 5CGSA 4E3MA 3WS0A 1PI4A 4R4SA 3GSGA 1Q2PA 3IQAA 4S2NA 1C3BA 1K57A 2IWDA 2R9XA 4WZ5A 5G18A 2V2FF 3S4XA 2XGNA 3VP0A 4S2IA 1ES4A 2HP5A 4E6XA 2C6WB 4JXWA 2Y2HA 3A3FA 3G2YA 3IWQA 3BEBA 1NRFA 3W4OA 5FQJA 4R1GA 3ZVWA 4GB7A 3V50A 4JKTA 4WM9A 4X56A 5EVIA 2EFUA 1IELA 4FH2A 1PIOA 5FDHA 1IKGA 1FCNA 2EXBA 4GD6A 4KZAA 5FQKA 4N9LA 3M6HA 2WGWA 3HREA 5AQAA 3TOIA 2P74A 3MKFA 2ZC3B 5CECA 1DJCA 1IYOA 1I5QA 4JXSA 3MZEA 5CHMA 5HAPA 2XD5A 4P6BA 5GL9A 3GQZA 1JTGA 4JBFA 4OP5A 1KE4A 2WKHA 4KQOA 1YLYA 2A3UA 4P85A 3HLWA 4IVKA 3HL9A 1BZAA 1FCOA 3VSLA 3P98A 5HAIA 1CI9A 5DTSA 1DY6A 1PZPA 4ZBEA 4QD4A 1MKIA 5FAPA 3VFHA 1G68A 2XF3A 3GR2A 5M19A 3DWKA 1MWSA 2XLNA 3HUMA 3NY4A 4R23A 1ESUA 3BYDA 4ID4A 4N9KA 2Q9MA 2HPBA 3NDGA 4M3KA 2XH9A 1EWZA 4PPRA 3I7JA 2J9PA 2XFTA 5I94A 1K54A 2Y2GA 5F83A 1YLWA 3PAEA 4OOMA 5FSRA 4LV0A 3IH9A 3LY4A 4BL3A 4RA7A 4HEFA 5A92A 1XXMA 2XR0A 1GCEA 4OLDA 5FAQA 4X68A 1NYYA 4JPMA 1Z6FA 1PW8A 3M6BA 4WBGA 3IF5A 3PAGA 1K6RA 2B5RA 2WKEA 1MBLA 3HUNA 3UO9A 5J8XA 1MPLA 3QNCA 4XUXA 1W8YA 5AQ7A 2XEPA 4OONA 3IXBA 1PWDA 2FFFB 2G2WA 1TVFA 3VP3A 2ZM0A 4MBFA 2Y55A 2BG1A 1BLPA 1K56D 2WADA 1E3UD 1JVJA 1TDGA 2VGJA 1KE0A 2XD1A 3GV9A 3G34A 1H8ZA 4GZBA 4LV1A 3AGEA 2V20A 3C5AA 3VOYA 1YT4A 5AQ9A 3IF6A 3GTCA 2HDQA 4GNUA 5F1FA 5E2HA 3UE3A 3IXDA 1PI5A 1FSYA 3G35A 5FA7A 3SS4A 3UE0A 1QMEA 1AXBA 4WELA 5FI7A 3WS5A 3MZDA 1FR6A 3PBTA 1J9MA 2X71A 4U0XA 1LL9A 3FV7A 2UWXA 1VQQA 3NI9A 2JC7A 3UPOA 5GHYA 2IWBA 3S22A 4S2LA 1E25A 5KSCA 3BFGA 2IWCA 1FCMA 1DJAA 3HLDA 3AGFA 3DW0A 3HLEA 5EVLA 3EQUA 3HLGA 3BECA 4KG2A 4EBPA 4R3BA 3N8LA 4DDYA 5FATA 4K91A 4KZ7A 1W7FA 1JWPA 1LI9A 4S2OA 3Q7VA 4BD0A 4QU3A 2OLUA 4BLMA 4Z9QA 2G2UA 1ERMA 2PU2A 1G6AA 3ITAA 3NC8A 1XA1A 3A3JA 4IBXA 1PWCA 4ZAMA 4ZJ1A 1KVMA 3UPNA 5L2FA 3ITBA 4PM6A 1YLTA 4LV2A 1BLCA 3A3DA 3CJMA 1PW1A 5EOOA 4Q8IA 1KDWA 5GHZA 2ZQDA 3GRJA 5CTMA 3UDIA 3ZNTA 2XQZA 1YLZA 5FI6A 1SDNA 4WEJA 4R4RA 4X69A 2H0YA 4QHCA 3V3RA 2ZLYA 4YINA 2WAEA 4F94A 1YQSA 3RJUA 3W4QA 4D2OA 4MEZA 5DF9A 5EOEA 1U60A 2ZC7A 4C6YA 2ZQAA 3IH8A 4B88A 4DE2A 3M2KA 3SH7A 2WK0A 1BLSA 4E3LA 3N4IA 3RXXA 4DKIA 4NK3A 5JYPA 4EBNA 3E2LA 2P9VA 3CMZA 2RCXA 2WZXA 3M2JA 3O88A 4KG6A 3S1YA 3TG9A 5CERA 1ZC2A 2EX2A 2Y91A 1FR1A 3G4PA 3Q82A 1I2WA 5DF7A 4KZ5A 4KZ9A 1HD8A 4OOYA 1KGEA 4WYYA 1DJBA 4L0LA 2ZMAA 5FQ9A 5M18A 1XP4A 3BFEA 1PZOA 3N6IA 4X6TA 5M1AA 4PM9A 4ZJ3A 1SHVA 2JE5A 3MBZA 2A49A 3UDXA 2Y2NA 5E43A 4EQIA 1LLBA 3C4OA 4MBKA 4JXVA 4JF4A 1BLHA 3CZDA 3LY3A 1H5XA 3O3VA 4NETA 1BSGA 5CHUA 2J9OA 4ZDXA 5CTNA 4Y0UA 1SKFA 5GLCA 3UDFA 3V3SA 1JWZA 3HLBA 3E2KA 1ONGA 2J7VA 3PBOA 3C7UA 2Z2MB 4OPYA 4Y0OA 3FWLA 1IEMA 4LV3A 4Y0TA 4E3KA 4KZ6A 1IYSA 3NIAA 5EVIB 2Y2JA 3IT9A 1BTLA 3GVBA 5HL1A 2ZM8A 3FZCA 2X01A 3SH8A 4R0QA 1ERQA 2WGWB 2Y2PA 3FKWA 1L0GA 4N1XA 4UHUA 5CRFA 3MKEA 2PBYA 4DXBA 3PBNA 3Q07A 4K0XA 4QY5A 1HZOA 4JLFA 3UN7A 4BENA 4S2MA 3A3IA 5GLDA 1M40A 2Q9NA 3B3XA 4DE3A 3G32A 3ZNYA 4KZ3A 1W8QA 4E3OA 1KE3A 4OQ0A 4E3NA 2HDUA 4A5RA 1RP5A 3VMAA 3G31A 3VOZA 3PBQA 4X53A 5EVID 4JXGA 3SOIA 1NJ4A 4OLGA 4RVAA 1PWGA 4WZ4A 1XGIA 3TSGA 4Y7PA 5KSHA 5HFOA 1I2SA 1Q2QA 4E3JA 5FQMA 4ZTKA 3WRTA 3VFFA 4R3JA 2H5SA 4QJGA 4B4ZA 2DCFA 5TGFA 4OPQA 3G30A 3SS3A 1QMFA 1GHMA 4EV4A 4YFMA 3VP1A 2WYXA 1SCWA 2H10A 5DF8A 1FQGA 3BFCA 2PU4A 2Y4AA 1H8YA 5F1GA 1FSWA 1KGGA 5E2EA 2DNSA 1WYCA 3OPHA 3WRZA 4S2KA 3FKVA 4UA7A 1RGZA 5GLAA 3ZG7B 4N92A 5CXWA 3UY6A 4EUZA 3IHAA 4S2JA 5U47A 1L0DA 3Q81A 2Y2QA 4FSFA 1K4EA 1L2SA 3Q7ZA 1MY8A 4LCLA 1K55C 3IWIA 5DVAA 4U0TA 4KZ4A 4OKPA 4B4XA 1XGJA 4DE1A 2WZZA 1YMSA 2ZC4B 1CK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S6R A;  1BT5 A;  3O86 A;  4UA9 A;  1NY0 A;  1MXO A;  3IF6 B;  2ZD8 A;  3DWZ A;  1JTD A;  4BJP A;  4UA6 A;  4DXC A;  4OQG A;  1W79 A;  3FYZ A;  3BFD A;  1XKZ A;  1XPB A;  1ESI A;  1RCJ A;  1S0W A;  2OLV A;  3LEZ A;  4K0W A;  4H8R A;  1ALQ A;  1IYP A;  4HBU A;  5AQB A;  1O7E A;  3OCL A;  4JF5 A;  1W5D A;  5KZH A;  2ZQC A;  4OPR A;  2H0T A;  2FFY A;  4EWF A;  1KVL A;  5CGW A;  4S2N C;  1KDS A;  1NYM A;  1K57 C;  4WZ5 C;  1K6S A;  1TDL A;  3OZH A;  2WKI A;  2ZM2 A;  2ZQ9 A;  1N9B A;  1YM1 A;  3MXR A;  4UAA A;  3ZG0 A;  5HX9 A;  3VP2 A;  1Y54 A;  4E6W A;  4OOL A;  5JYO A;  3ZFZ A;  1K4F A;  4FD8 A;  4OPZ A;  1YMX A;  4JF6 A;  4KZ8 A;  1WYB A;  3W4P A;  5EVI C;  4BQM A;  1PYY A;  3C4P A;  1XX2 A;  4CPK A;  1K56 A;  1E3U A;  4QB8 A;  3OC2 A;  4HBT A;  4BD1 A;  4PM5 A;  2XDM A;  1K38 A;  5EPH A;  1MWU A;  4C75 A;  3PTE A;  3RXW A;  2HDR A;  2Y2I A;  3GMW A;  3PBS A;  1ZG4 A;  1VM1 A;  2OSU A;  4FH4 A;  5EE8 A;  2VGK A;  2EX6 A;  3HLC A;  5DTK A;  2ZQ7 A;  3D4F A;  1HTZ A;  1BUL A;  3EQV A;  5TR7 A;  1CEF A;  3LO7 A;  5F82 A;  1KGF A;  3BM6 A;  3IWO A;  4N1H A;  4PM8 A;  4CJN A;  5CGX A;  5HAQ A;  5A93 A;  5A91 A;  4OH0 A;  1GA9 A;  4DE0 A;  2P9V B;  3MXS A;  4EBL A;  1LHY A;  4DF6 A;  3ZVT A;  1L0F A;  3IHB A;  2X02 A;  4PMA A;  1NXY A;  4KG5 A;  5FAO A;  2J8Y A;  5FQI A;  3V5M A;  2WUQ A;  2Y2M A;  1WE4 A;  1N4O A;  2Y59 A;  1ERO A;  1SDE A;  1ZKJ A;  5FI2 A;  4DRT A;  2HP6 A;  1CI8 A;  1MWT A;  5HAR A;  4RX2 A;  1E4D A;  3UPP A;  4O7D A;  5E2F A;  1ONH A;  1MWR A;  3JYI A;  4MLL A;  1K54 C;  2E8I A;  3UE1 A;  4WMC D;  4KQR A;  3OPR A;  4X55 A;  3ZDJ A;  5A90 A;  3QNB A;  5BOH A;  3UNW A;  4E3I A;  3HVF A;  4U3T A;  3VP4 A;  5HW3 A;  3ZG9 B;  4HES A;  4MNR A;  3HBR A;  1ZG6 A;  3HUO A;  1EI5 A;  1GA0 A;  2OV5 A;  1L0E A;  3NDE A;  2Y2L A;  4IED A;  4GKU A;  4OQI A;  4GDN A;  2HP9 A;  2I72 A;  4S2P A;  1JWV A;  4GN2 A;  4P87 A;  3CG5 A;  4RX3 A;  3WS2 A;  4IVI A;  5EUA A;  3ISG A;  1TEM A;  3O87 A;  2CC1 A;  1LI0 A;  3OPP A;  2GDN A;  3MZF A;  3SS5 A;  3ZHH A;  3ZCZ A;  1GHI A;  1RGY A;  4DDS A;  4OQH A;  1IKI A;  3N7W A;  4P0M A;  2C5W B;  3ZG8 B;  3LCE A;  3Q1F A;  3AGD A;  2WGV A;  3HLF A;  4FCF A;  2WAF A;  3IF6 C;  2ZQ8 A;  1YLJ A;  2BLS A;  1HVB A;  2JBF A;  2ZJ9 A;  3BRM A;  3ZG5 A;  1ES2 A;  1K25 A;  3NBL A;  2RL3 A;  4OVD A;  2EFX A;  1IYQ A;  3IXG A;  4XUZ A;  1CEG A;  4LEN A;  2Y2K A;  2QZ6 A;  4GDB A;  2JCH A;  2WGI A;  4GOG A;  4LCM A;  1NZO A;  4RYE A;  2QMI A;  2EX9 A;  2EXA A;  2ZC5 B;  4IBR A;  3G2Z A;  3BFF A;  5EEC A;  5KMW A;  5D3O A;  4MBH A;  4QY6 A;  3C7V A;  4C3Q A;  5DTT A;  5FQQ A;  5IHV A;  4OP8 A;  3N8R A;  1K55 A;  1YLP A;  3BLS A;  3IXH A;  1BUE A;  4PM7 A;  3P09 A;  4XXR A;  1NZU A;  5E2G A;  5CHJ A;  3WWX A;  4WEK A;  2V1Z A;  2Z2L B;  3MFD A;  3N8S A;  2Y2O A;  2EX8 A;  5GHX A;  3VSK A;  3PBR A;  1FOF A;  1XA7 A;  2HDS A;  3QHY A;  2XK1 A;  3NCK A;  2ZC6 B;  5FAS A;  1GHP A;  4KQQ A;  2R9W A;  3OPL A;  3ZGA B;  1ES3 A;  4KEN B;  4KZB A;  1ES5 A;  3W8K A;  5CED A;  2XFS A;  4BL2 A;  3DTM A;  1M6K A;  3V39 A;  3SH9 A;  4ZJ2 A;  1LL5 A;  5CEB A;  1O07 A;  3WS1 A;  3WS4 A;  1OME A;  5TFQ A;  4GD8 A;  3A3E A;  3OCN A;  3Q7V B;  5GLB A;  2DRW A;  2QPN A;  4WMC A;  3BLM A;  5CGS A;  4E3M A;  3WS0 A;  1PI4 A;  4R4S A;  3GSG A;  1Q2P A;  3IQA A;  4S2N A;  1C3B A;  1K57 A;  2IWD A;  2R9X A;  4WZ5 A;  5G18 A;  2V2F F;  3S4X A;  2XGN A;  3VP0 A;  4S2I A;  1ES4 A;  2HP5 A;  4E6X A;  2C6W B;  4JXW A;  2Y2H A;  3A3F A;  3G2Y A;  3IWQ A;  3BEB A;  1NRF A;  3W4O A;  5FQJ A;  4R1G A;  3ZVW A;  4GB7 A;  3V50 A;  4JKT A;  4WM9 A;  4X56 A;  5EVI A;  2EFU A;  1IEL A;  4FH2 A;  1PIO A;  5FDH A;  1IKG A;  1FCN A;  2EXB A;  4GD6 A;  4KZA A;  5FQK A;  4N9L A;  3M6H A;  2WGW A;  3HRE A;  5AQA A;  3TOI A;  2P74 A;  3MKF A;  2ZC3 B;  5CEC A;  1DJC A;  1IYO A;  1I5Q A;  4JXS A;  3MZE A;  5CHM A;  5HAP A;  2XD5 A;  4P6B A;  5GL9 A;  3GQZ A;  1JTG A;  4JBF A;  4OP5 A;  1KE4 A;  2WKH A;  4KQO A;  1YLY A;  2A3U A;  4P85 A;  3HLW A;  4IVK A;  3HL9 A;  1BZA A;  1FCO A;  3VSL A;  3P98 A;  5HAI A;  1CI9 A;  5DTS A;  1DY6 A;  1PZP A;  4ZBE A;  4QD4 A;  1MKI A;  5FAP A;  3VFH A;  1G68 A;  2XF3 A;  3GR2 A;  5M19 A;  3DWK A;  1MWS A;  2XLN A;  3HUM A;  3NY4 A;  4R23 A;  1ESU A;  3BYD A;  4ID4 A;  4N9K A;  2Q9M A;  2HPB A;  3NDG A;  4M3K A;  2XH9 A;  1EWZ A;  4PPR A;  3I7J A;  2J9P A;  2XFT A;  5I94 A;  1K54 A;  2Y2G A;  5F83 A;  1YLW A;  3PAE A;  4OOM A;  5FSR A;  4LV0 A;  3IH9 A;  3LY4 A;  4BL3 A;  4RA7 A;  4HEF A;  5A92 A;  1XXM A;  2XR0 A;  1GCE A;  4OLD A;  5FAQ A;  4X68 A;  1NYY A;  4JPM A;  1Z6F A;  1PW8 A;  3M6B A;  4WBG A;  3IF5 A;  3PAG A;  1K6R A;  2B5R A;  2WKE A;  1MBL A;  3HUN A;  3UO9 A;  5J8X A;  1MPL A;  3QNC A;  4XUX A;  1W8Y A;  5AQ7 A;  2XEP A;  4OON A;  3IXB A;  1PWD A;  2FFF B;  2G2W A;  1TVF A;  3VP3 A;  2ZM0 A;  4MBF A;  2Y55 A;  2BG1 A;  1BLP A;  1K56 D;  2WAD A;  1E3U D;  1JVJ A;  1TDG A;  2VGJ A;  1KE0 A;  2XD1 A;  3GV9 A;  3G34 A;  1H8Z A;  4GZB A;  4LV1 A;  3AGE A;  2V20 A;  3C5A A;  3VOY A;  1YT4 A;  5AQ9 A;  3IF6 A;  3GTC A;  2HDQ A;  4GNU A;  5F1F A;  5E2H A;  3UE3 A;  3IXD A;  1PI5 A;  1FSY A;  3G35 A;  5FA7 A;  3SS4 A;  3UE0 A;  1QME A;  1AXB A;  4WEL A;  5FI7 A;  3WS5 A;  3MZD A;  1FR6 A;  3PBT A;  1J9M A;  2X71 A;  4U0X A;  1LL9 A;  3FV7 A;  2UWX A;  1VQQ A;  3NI9 A;  2JC7 A;  3UPO A;  5GHY A;  2IWB A;  3S22 A;  4S2L A;  1E25 A;  5KSC A;  3BFG A;  2IWC A;  1FCM A;  1DJA A;  3HLD A;  3AGF A;  3DW0 A;  3HLE A;  5EVL A;  3EQU A;  3HLG A;  3BEC A;  4KG2 A;  4EBP A;  4R3B A;  3N8L A;  4DDY A;  5FAT A;  4K91 A;  4KZ7 A;  1W7F A;  1JWP A;  1LI9 A;  4S2O A;  3Q7V A;  4BD0 A;  4QU3 A;  2OLU A;  4BLM A;  4Z9Q A;  2G2U A;  1ERM A;  2PU2 A;  1G6A A;  3ITA A;  3NC8 A;  1XA1 A;  3A3J A;  4IBX A;  1PWC A;  4ZAM A;  4ZJ1 A;  1KVM A;  3UPN A;  5L2F A;  3ITB A;  4PM6 A;  1YLT A;  4LV2 A;  1BLC A;  3A3D A;  3CJM A;  1PW1 A;  5EOO A;  4Q8I A;  1KDW A;  5GHZ A;  2ZQD A;  3GRJ A;  5CTM A;  3UDI A;  3ZNT A;  2XQZ A;  1YLZ A;  5FI6 A;  1SDN A;  4WEJ A;  4R4R A;  4X69 A;  2H0Y A;  4QHC A;  3V3R A;  2ZLY A;  4YIN A;  2WAE A;  4F94 A;  1YQS A;  3RJU A;  3W4Q A;  4D2O A;  4MEZ A;  5DF9 A;  5EOE A;  1U60 A;  2ZC7 A;  4C6Y A;  2ZQA A;  3IH8 A;  4B88 A;  4DE2 A;  3M2K A;  3SH7 A;  2WK0 A;  1BLS A;  4E3L A;  3N4I A;  3RXX A;  4DKI A;  4NK3 A;  5JYP A;  4EBN A;  3E2L A;  2P9V A;  3CMZ A;  2RCX A;  2WZX A;  3M2J A;  3O88 A;  4KG6 A;  3S1Y A;  3TG9 A;  5CER A;  1ZC2 A;  2EX2 A;  2Y91 A;  1FR1 A;  3G4P A;  3Q82 A;  1I2W A;  5DF7 A;  4KZ5 A;  4KZ9 A;  1HD8 A;  4OOY A;  1KGE A;  4WYY A;  1DJB A;  4L0L A;  2ZMA A;  5FQ9 A;  5M18 A;  1XP4 A;  3BFE A;  1PZO A;  3N6I A;  4X6T A;  5M1A A;  4PM9 A;  4ZJ3 A;  1SHV A;  2JE5 A;  3MBZ A;  2A49 A;  3UDX A;  2Y2N A;  5E43 A;  4EQI A;  1LLB A;  3C4O A;  4MBK A;  4JXV A;  4JF4 A;  1BLH A;  3CZD A;  3LY3 A;  1H5X A;  3O3V A;  4NET A;  1BSG A;  5CHU A;  2J9O A;  4ZDX A;  5CTN A;  4Y0U A;  1SKF A;  5GLC A;  3UDF A;  3V3S A;  1JWZ A;  3HLB A;  3E2K A;  1ONG A;  2J7V A;  3PBO A;  3C7U A;  2Z2M B;  4OPY A;  4Y0O A;  3FWL A;  1IEM A;  4LV3 A;  4Y0T A;  4E3K A;  4KZ6 A;  1IYS A;  3NIA A;  5EVI B;  2Y2J A;  3IT9 A;  1BTL A;  3GVB A;  5HL1 A;  2ZM8 A;  3FZC A;  2X01 A;  3SH8 A;  4R0Q A;  1ERQ A;  2WGW B;  2Y2P A;  3FKW A;  1L0G A;  4N1X A;  4UHU A;  5CRF A;  3MKE A;  2PBY A;  4DXB A;  3PBN A;  3Q07 A;  4K0X A;  4QY5 A;  1HZO A;  4JLF A;  3UN7 A;  4BEN A;  4S2M A;  3A3I A;  5GLD A;  1M40 A;  2Q9N A;  3B3X A;  4DE3 A;  3G32 A;  3ZNY A;  4KZ3 A;  1W8Q A;  4E3O A;  1KE3 A;  4OQ0 A;  4E3N A;  2HDU A;  4A5R A;  1RP5 A;  3VMA A;  3G31 A;  3VOZ A;  3PBQ A;  4X53 A;  5EVI D;  4JXG A;  3SOI A;  1NJ4 A;  4OLG A;  4RVA A;  1PWG A;  4WZ4 A;  1XGI A;  3TSG A;  4Y7P A;  5KSH A;  5HFO A;  1I2S A;  1Q2Q A;  4E3J A;  5FQM A;  4ZTK A;  3WRT A;  3VFF A;  4R3J A;  2H5S A;  4QJG A;  4B4Z A;  2DCF A;  5TGF A;  4OPQ A;  3G30 A;  3SS3 A;  1QMF A;  1GHM A;  4EV4 A;  4YFM A;  3VP1 A;  2WYX A;  1SCW A;  2H10 A;  5DF8 A;  1FQG A;  3BFC A;  2PU4 A;  2Y4A A;  1H8Y A;  5F1G A;  1FSW A;  1KGG A;  5E2E A;  2DNS A;  1WYC A;  3OPH A;  3WRZ A;  4S2K A;  3FKV A;  4UA7 A;  1RGZ A;  5GLA A;  3ZG7 B;  4N92 A;  5CXW A;  3UY6 A;  4EUZ A;  3IHA A;  4S2J A;  5U47 A;  1L0D A;  3Q81 A;  2Y2Q A;  4FSF A;  1K4E A;  1L2S A;  3Q7Z A;  1MY8 A;  4LCL A;  1K55 C;  3IWI A;  5DVA A;  4U0T A;  4KZ4 A;  4OKP A;  4B4X A;  1XGJ A;  4DE1 A;  2WZZ A;  1YMS A;  2ZC4 B;  1CK3 A; 
#chains in the Genus database with same CATH topology
 4R6L A;  4EQ1 A;  4UA9 A;  1JTD A;  2HJ9 C;  4UA6 A;  3KYQ A;  4D60 A;  4DXC A;  4R70 A;  1X0O A;  1DP9 A;  3LEZ A;  1P97 A;  4H8R A;  1IYP A;  5AQB A;  4Y15 A;  4JF5 A;  5I5L A;  5KZH A;  1D06 A;  4OPR A;  2FFY A;  1SZV A;  1K57 C;  5AJG A;  2WKI A;  5G4Y A;  5HX9 A;  3VP2 A;  5JYO A;  1XX2 A;  4FOF A;  3EOI A;  3T4J A;  3CHW P;  1MWU A;  3PTE A;  2W1T A;  4UEY A;  2PR5 A;  3BJN A;  2EX6 A;  3HLC A;  5DKK A;  3LO7 A;  3T4L A;  3IWO A;  4Y2F A;  3H9W A;  3MXS A;  4MN5 A;  2W0N A;  3F1N B;  1NXY A;  4G3V A;  4HIA A;  1L3L A;  2WUQ A;  4DRT A;  1SDE A;  4RX2 A;  4O7D A;  4Q0H A;  3KSF A;  1ONH A;  2JKT M;  1XFQ A;  3OPR A;  3ZDJ A;  1AWI A;  3H7W A;  5BOH A;  2A2L A;  3HBR A;  1ZG6 A;  2W3G A;  3HUO A;  2OV5 A;  4L9F A;  4QWO A;  4S2P A;  1JWV A;  4RX3 A;  3ISG A;  2P7J A;  3O87 A;  4MDZ A;  3OPP A;  3ZCZ A;  2GDN A;  1TS7 A;  1UGU A;  3SW1 A;  1GHI A;  1NRJ A;  1IKI A;  4P0M A;  4NXG A;  2C5W B;  3ZG8 B;  3K3D A;  3Q1F A;  3AGD A;  3HLF A;  2WAF A;  3HJK A;  2JBF A;  3NBL A;  2V1B A;  4XUZ A;  2VV6 A;  4LEN A;  4CQH A;  1MC0 A;  2QKP A;  4LCM A;  1NZO A;  3BFF A;  5D3O A;  3C7V A;  4C3Q A;  1VET B;  4OP8 A;  1S4R A;  3LIE A;  2MJ6 A;  4XXR A;  1NZU A;  4WEK A;  4BBU A;  2Z2L B;  3N8S A;  1FOF A;  3A0S A;  1XA7 A;  3QHY A;  2XK1 A;  3NCK A;  4Y3I A;  4KZB A;  1ES5 A;  3W8K A;  5CED A;  3DTM A;  3SH9 A;  2K7S A;  1O07 A;  1Z09 A;  3E4O A;  3A3E A;  3Q7V B;  5GLB A;  4WMC A;  5CGS A;  3WS0 A;  3IQA A;  2ZMF A;  1K57 A;  3VE3 A;  2IWD A;  1ES4 A;  1PFL A;  3TJZ C;  2PD7 A;  1OJ5 A;  3UB7 A;  5L09 A;  2WKP A;  3G2Y A;  5HD5 A;  4X56 A;  3F1N A;  2PDR A;  4FH2 A;  2XRO A;  4KZA A;  5AQA A;  3M6H A;  2WGW A;  3HRE A;  4GHI A;  1IYO A;  1H3Q A;  4CLC C;  3PR6 A;  1KOU A;  5CHM A;  5HAP A;  4P6B A;  5GL9 A;  2JN7 A;  4X1L A;  3BWL A;  2G7U A;  2B18 A;  3VFH A;  2XF3 A;  4X25 A;  4E04 A;  3UB9 A;  2ZBB A;  4M3K A;  2HPB A;  2XH9 A;  4CLC B;  4PPR A;  3I7J A;  5I94 A;  4P6Z S;  5F83 A;  4II7 A;  4OOM A;  4AFI A;  5DFX A;  5A92 A;  1XXM A;  3M6B A;  4ESP A;  3FC7 A;  4EER A;  4Y13 A;  2B5R A;  4Z1W A;  4EEP A;  2PYR A;  4I38 A;  5AQ7 A;  4EUV A;  2FFF B;  4JGQ A;  4LLO B;  5F69 A;  3E98 A;  3LR4 A;  1KE0 A;  3PXP A;  3U2A A;  3G34 A;  4I5S A;  3VOY A;  2DMW A;  4LV1 A;  1VET A;  3GTC A;  1AXB A;  3WS5 A;  1FR6 A;  3PBT A;  1LL9 A;  2UWX A;  1DP6 A;  4S2L A;  3IS2 B;  5KSC A;  1FCM A;  3AGF A;  3HLE A;  4R3B A;  5FAT A;  1W7F A;  3Q7V A;  3GDI A;  2G2U A;  1ERM A;  3IX3 A;  1PWC A;  5L2F A;  3ITB A;  3MFX A;  4GJ4 A;  4WLA A;  1FIL A;  4X69 A;  4P6Z M;  1YQS A;  4D2O A;  4MEZ A;  3ZYT A;  4EXO A;  1U60 A;  2P04 A;  5G4Z A;  4L9G A;  4EES A;  2ZQA A;  1TS0 A;  4DE2 A;  2O9A A;  5DJU A;  4E3L A;  2GZA A;  4DKI A;  4NK3 A;  1HLU P;  3B33 A;  2WZX A;  5F6A A;  2EX2 A;  2Y91 A;  1LSW A;  3G4P A;  3Q82 A;  2ACG A;  4WYY A;  4L0L A;  3N6I A;  1PZO A;  2CMN A;  4G3W A;  3MBZ A;  4CLC A;  3LR5 A;  1NLY A;  1BLH A;  2VGL M;  1BSG A;  3H82 A;  2J9O A;  4O01 A;  1SKF A;  4Y0O A;  1IEM A;  3BY8 A;  4LV3 A;  4E3K A;  4KZ6 A;  1IYS A;  1BTL A;  2K31 A;  3GVB A;  2ZM8 A;  4O0P A;  2X01 A;  4R0Q A;  4ETX A;  1L0G A;  3MKE A;  5L10 A;  3T1Q B;  4JLF A;  3UN7 A;  4S2M A;  3KO6 A;  4DE3 A;  3G32 A;  4KZ3 A;  2YKF A;  4E3O A;  1XJ3 A;  2HDU A;  1OTE A;  3C38 A;  3OBF A;  3IS2 A;  2PR6 A;  3F1O B;  1D1J A;  1IFQ A;  3EEA A;  4OLG A;  2AVX A;  1S4S A;  1DRM A;  4E3J A;  5HZH A;  4R3J A;  2H5S A;  2V8C A;  5TGF A;  3VP1 A;  2WYX A;  1SCW A;  4HQA A;  4HNB A;  1H8Y A;  5F1G A;  3WRZ A;  1RGZ A;  3MF0 A;  4N92 A;  4EUZ A;  4XT2 B;  3Q7Z A;  1YSQ A;  4LCL A;  1K55 C;  4KZ4 A;  4PMA A;  1CK3 A;  1S6R A;  1BT5 A;  3VOL A;  4BJP A;  2J3T D;  4FTX A;  4I39 A;  4OQG A;  1W79 A;  1ESI A;  1OPX A;  3LR0 A;  1O7E A;  4WZ5 C;  3OZH A;  3NEC A;  1GSW A;  3HCY A;  1WYB A;  3UE6 A;  4CPK A;  1P9W A;  4BBT A;  3RXW A;  4ARZ B;  2OSU A;  3GEC A;  1VB6 A;  4KQD A;  3EQV A;  1BUL A;  1IOU A;  1CEF A;  1KGF A;  1LSX A;  4OH0 A;  1LHY A;  4DF6 A;  2INW A;  3IHB A;  1WE4 A;  2Y59 A;  1ERO A;  5FI2 A;  1MWT A;  4EU0 A;  4MLL A;  3S7Q A;  4WMC D;  5A90 A;  3CLO A;  4X55 A;  3QNB A;  4BBV A;  3UNW A;  4E3I A;  2J3T C;  3BW6 A;  4U3T A;  3T1R A;  3VP4 A;  3ZG9 B;  1LL8 A;  3D9Y A;  4MNR A;  1EI5 A;  1GA0 A;  3NDE A;  2Y2L A;  2HP9 A;  2LB9 A;  1TS8 A;  3CG5 A;  3MQ0 A;  5DKL A;  3WS2 A;  4LRZ E;  3ZHH A;  3MZF A;  1RGY A;  2W3E A;  2P08 A;  2LB5 A;  2WGV A;  4XT2 A;  4FCF A;  4B9O A;  1YLJ A;  3ZG5 A;  3F1P A;  2XSS A;  2B95 A;  5KIZ A;  2QYB A;  3T4K A;  2EFX A;  3IXG A;  1N9O A;  3VV4 A;  2JCH A;  2QMI A;  1G5U A;  4YOF A;  2Y79 A;  5HWW A;  4MBH A;  1K55 A;  1YLP A;  5E2G A;  5CHJ A;  3WWX A;  2V1Z A;  2EX8 A;  3C2W A;  3PBR A;  4PAU A;  2HDS A;  3W2Z A;  5FAS A;  4JGP A;  4R38 A;  2R9W A;  3OPL A;  1CF0 A;  3V39 A;  3DBA A;  3R4K A;  3WS1 A;  5TFQ A;  5IU1 A;  3NHQ A;  3CPT B;  2JKR M;  1PI4 A;  3GSG A;  2R9X A;  4WZ5 A;  3S4X A;  2HP5 A;  4JXW A;  3IWQ A;  3W4O A;  3V50 A;  4JKT A;  2EFU A;  3D72 A;  2PD8 A;  4H6J B;  5CEC A;  2VEA A;  3T4Q A;  5J4E A;  3A0V A;  1T1B A;  4X1M A;  2XD5 A;  2W1R A;  4I3J A;  3GQZ A;  1JTG A;  4LRX C;  4OP5 A;  2WKH A;  1YLY A;  1XJ4 A;  2D02 A;  5MC7 A;  3TW8 A;  3VSL A;  1FCO A;  3P98 A;  1CI9 A;  4MCW A;  1MKI A;  5FAP A;  1MWS A;  2XLN A;  3NY4 A;  4R23 A;  3BYD A;  2Q9M A;  4FUW A;  4EEU A;  2XFT A;  2XRN A;  1ZHH B;  1OTB A;  5HPI A;  2L4R A;  4LV0 A;  3LY4 A;  4BL3 A;  2XR0 A;  1UWN X;  1NYY A;  3IBR A;  4JPM A;  2FZ0 A;  1Z6F A;  4WBG A;  3IF5 A;  3PAG A;  2WKE A;  3HUN A;  3UO9 A;  1YPR A;  5J8X A;  2HZ5 A;  3QNC A;  3UMD A;  3LGO A;  2XEP A;  4OON A;  1PWD A;  2ZM0 A;  2BG1 A;  1BLP A;  1K56 D;  4CLC D;  1TDG A;  3AGE A;  5AQ9 A;  5E2H A;  3SS4 A;  4WUJ A;  1VQQ A;  4BWI A;  3UPO A;  5GHY A;  1SKO B;  3BFG A;  4JGO A;  3HLG A;  2ZOI A;  3HJI A;  3N8L A;  4DDY A;  4S2O A;  4NKP A;  4QU3 A;  2PAV P;  4BLM A;  2PU2 A;  3A3J A;  4IBX A;  3FG8 A;  4PM6 A;  1JNU A;  4LV2 A;  1TD5 A;  3CJM A;  4Q8I A;  2ZQD A;  3GRJ A;  3MQO A;  3ZNT A;  1YLZ A;  4WEJ A;  3ZQ5 A;  3V3R A;  2WAE A;  3MQQ A;  3S7P A;  4F3L B;  3T50 A;  4H6J A;  2ZC7 A;  3G6O A;  1TS6 A;  5K5B A;  1BLS A;  2EWV A;  4EBN A;  2RCX A;  4KG6 A;  2E8J A;  1J3W A;  1ZC2 A;  1FR1 A;  1I2W A;  3OOV A;  4KZ9 A;  1DJB A;  4X6T A;  5M1A A;  3P01 A;  4PM9 A;  4ZJ3 A;  2JE5 A;  2A49 A;  2GJ3 A;  2Y2N A;  4EQI A;  3L7H A;  2QJ7 A;  4MBK A;  4JXV A;  4JF4 A;  3LY3 A;  2GX5 A;  2BTF P;  1H5X A;  3O3V A;  4NET A;  4ZDX A;  3UDF A;  3V3S A;  3HLB A;  4OPY A;  3FWL A;  5HDD A;  3NIA A;  5EVI B;  1PNE A;  1D7E A;  2PBD P;  5CRF A;  3PBN A;  2VKS A;  4QY5 A;  4BEN A;  3KYE A;  5GLD A;  1OTD A;  4Y17 A;  1KE3 A;  4OQ0 A;  2OOL A;  3TE8 A;  4O8G A;  2XA7 S;  4DJ2 A;  4A5R A;  1RP5 A;  3VMA A;  3PBQ A;  4JXG A;  2QJ5 A;  1NJ4 A;  5J3W A;  4WZ4 A;  5KSH A;  4Y7P A;  3NOP C;  1I2S A;  3RTY A;  5FQM A;  3WRT A;  4QJG A;  3CUE C;  4B4Z A;  2DCF A;  4OPQ A;  3SS3 A;  1QMF A;  3L9K A;  3NOU C;  3BQ8 A;  3BFC A;  2PU4 A;  1N9L A;  2Y4A A;  5EV0 A;  1GSX A;  5HL6 A;  5E2E A;  1WYC A;  5CXW A;  5U47 A;  1L0D A;  1MY8 A;  5DVA A;  2QWS A;  4B4X A;  2PHY A;  5LBR A;  4DE1 A;  2VX8 A;  3T1S A;  3O86 A;  1NY0 A;  1MXO A;  3IF6 B;  2ZD8 A;  3UB8 A;  3KSI A;  3KSH A;  3IX8 A;  4R3A A;  3EWK A;  3FYZ A;  1XKZ A;  1RCJ A;  4K0W A;  1ALQ A;  4HBU A;  2IA2 A;  3OCL A;  1W5D A;  2H0T A;  2VZW A;  5CGW A;  4S2N C;  1KDS A;  1TDL A;  4Q0I A;  2ZM2 A;  3MXR A;  3ZG0 A;  4E6W A;  4DMZ A;  1K4F A;  4K08 A;  4FD8 A;  4OPZ A;  1YMX A;  4JF6 A;  4KZ8 A;  3W4P A;  4BQM A;  3C4P A;  1K56 A;  3OC2 A;  4HBT A;  4BD1 A;  4PM5 A;  1CJF A;  1K38 A;  5EPH A;  2HDR A;  1ACF A;  3GMW A;  3PBS A;  1ZG4 A;  1VM1 A;  5EE8 A;  2VGK A;  2ZQ7 A;  3D4F A;  3LI8 A;  1HTZ A;  2NUP C;  1K0K A;  4PHT A;  5TR7 A;  3BM6 A;  4PM8 A;  3PYP A;  1GA9 A;  2P9V B;  2Y8H A;  2O9C A;  3ZVT A;  5TJJ A;  4HOI A;  2J8Y A;  1ZKJ A;  2KOI A;  3QP6 A;  1CI8 A;  1LSV A;  1E4D A;  3UPP A;  3JYI A;  1MWR A;  1K54 C;  2E8I A;  4HI4 A;  2FH5 A;  3HVF A;  3DAV A;  5A8B A;  2OWH A;  2O9B A;  4HJ4 A;  1L0E A;  3DTI A;  4GKU A;  1T1A A;  4GN2 A;  4P87 A;  1TEM A;  3SS5 A;  4DDS A;  3N7W A;  1DP8 A;  2ZL1 B;  3LFV A;  3LIA A;  2VA0 A;  4ETZ A;  3BRM A;  2W27 A;  3CUE A;  1K25 A;  2RL3 A;  3MMH A;  4OVD A;  3QP1 A;  1IYQ A;  5DJT A;  2QZ6 A;  4GDB A;  4HJ6 A;  3KX0 X;  4GOG A;  2EX9 A;  2ZC5 B;  4IBR A;  4IUK A;  3G2Z A;  5EEC A;  5L8M A;  4QY6 A;  5DTT A;  5IHV A;  3N8R A;  3IXH A;  4PM7 A;  2L1M A;  4ME4 A;  3CAX A;  1LT0 A;  3MFD A;  2Y2O A;  5GHX A;  3VSK A;  1W63 M;  2ZC6 B;  1GHP A;  5TBM B;  3ZGA B;  1ES3 A;  2XFS A;  5HPF A;  2V8F A;  4BL2 A;  1M6K A;  4WF0 A;  4ZJ2 A;  1YSP A;  1LL5 A;  5CEB A;  3WS4 A;  3KSG A;  3MXQ A;  4GD8 A;  2DRW A;  2QPN A;  4E3M A;  3S7O A;  3QP8 A;  4YNR A;  4S2N A;  1C3B A;  1UWP X;  3LI9 A;  3A0R A;  5EVE A;  5HWT A;  2C6W B;  3A3F A;  3BEB A;  1NRF A;  5FQJ A;  3ZVW A;  1XFN A;  1PIO A;  3T4O A;  5FDH A;  1IKG A;  1FCN A;  2EXB A;  2QHK A;  4GD6 A;  3TOI A;  4MN6 A;  4N9L A;  3P7N A;  2P74 A;  3MKF A;  2ZC3 B;  1DJC A;  1I5Q A;  3EGX C;  2HV1 A;  3BQA A;  3ICY A;  2JKR I;  4ZRR A;  4JBF A;  5J7E A;  1KE4 A;  4KQO A;  4P85 A;  3D3O A;  4IVK A;  3HL9 A;  1BZA A;  5HAI A;  3U4L P;  5DTS A;  4ZBE A;  1W63 Q;  1YKD A;  3F1O A;  2K2N A;  4RQ9 A;  5M19 A;  3DWK A;  4DJ3 A;  1ESU A;  3MSH A;  3NDG A;  3RH8 B;  1K54 A;  2PT7 A;  2ZL1 A;  1YLW A;  5L07 A;  3PAE A;  2W1T B;  4RA7 A;  4HEF A;  1GCE A;  4OLD A;  5FAQ A;  1K6R A;  2A24 B;  3E0Y A;  4XUX A;  4GW9 A;  5F5Y A;  4MBF A;  2OWJ A;  1E3U D;  2XD1 A;  2VGJ A;  3GV9 A;  4GZB A;  2V20 A;  3C5A A;  1YT4 A;  5AVE A;  5F1F A;  3UE3 A;  5FA7 A;  1PI5 A;  1F5M A;  3G35 A;  4WEL A;  5FI7 A;  1J9M A;  2X71 A;  4U0X A;  2HJE A;  3NI9 A;  2IWB A;  1E25 A;  2W3D A;  1DJA A;  3HLD A;  3DW0 A;  5FL3 A;  4KG2 A;  4EBP A;  1LI9 A;  3SZT A;  4ZAM A;  3UPN A;  4Q0J A;  1GSV A;  2JHE A;  1YLT A;  2OAQ 1;  5CTM A;  3UDI A;  1SDN A;  4R4R A;  1OTA A;  4QHC A;  2ZLY A;  4F94 A;  4ARZ A;  5DF9 A;  2GNX A;  5FEG A;  3IH8 A;  4B88 A;  3M2K A;  2WK0 A;  3RXX A;  5JYP A;  3LUQ A;  2BAS A;  3S1Y A;  3TG9 A;  5CER A;  3UME A;  5IS1 A;  4B93 A;  2J3W A;  1HD8 A;  4JGR A;  2J80 A;  1KGE A;  1XP4 A;  3K3C A;  5E43 A;  3C4O A;  1WA9 A;  3CZD A;  5HD3 A;  1T18 A;  5CHU A;  2J7V A;  3PBO A;  3C7U A;  2Z2M B;  3T1X A;  4YWZ A;  4Y0T A;  2A24 A;  1V9Y A;  2Y2J A;  4DN0 A;  5HL1 A;  2EA9 A;  3FZC A;  2WGW B;  3FKW A;  4GHI B;  2PBY A;  3Q07 A;  3JPU A;  1HZO A;  2I9V A;  1S66 L;  3UB6 A;  1OTI A;  5IT5 A;  4I3I A;  1M40 A;  2Q9N A;  1MZU A;  3ZNY A;  3LID A;  1W8Q A;  5HDC A;  4PKY A;  2HF6 A;  1S1Y A;  3UB5 P;  4L9E A;  5EVI D;  1VHM A;  1XGI A;  3TSG A;  5HFO A;  1P0Z A;  1Q2Q A;  4ZTK A;  1XJ6 A;  4WN5 A;  3G30 A;  4EV4 A;  1GHM A;  4YFM A;  2VLG A;  1T1C A;  5DF8 A;  4NEE D;  1FSW A;  1KGG A;  2DNS A;  3CPT A;  4S2K A;  3FKV A;  4UA7 A;  5GLA A;  3ZG7 B;  3FPW A;  3EEH A;  4S2J A;  3R7W B;  3Q81 A;  2Y2Q A;  1K4E A;  3IWI A;  2B02 A;  3LIB A;  1ODV A;  4OKP A;  1XGJ A;  2WZZ A;  3S7N A;  5CX7 A;  2ZC4 B;  2M7V A;  1S1Z A;  4NXF A;  3DWZ A;  4CLC E;  3CWF A;  3BFD A;  1XPB A;  1S0W A;  2M1C A;  2OLV A;  4HP4 A;  2ZQC A;  4HJ3 A;  4UQI S;  3K2N A;  4EWF A;  1KVL A;  1NYM A;  1K6S A;  3V67 A;  2ZQ9 A;  4UAA A;  1N9B A;  1YM1 A;  1Y54 A;  5FEF A;  4OOL A;  2WKR A;  3ZFZ A;  2JKG A;  3QP5 A;  5EVI C;  4I3A A;  1PYY A;  3C30 A;  4HH2 A;  1E3U A;  4KUO A;  4QB8 A;  2XDM A;  2W3H A;  5FDS A;  4C75 A;  2Y2I A;  1V9Z A;  3E4Q A;  1TF1 A;  4FH4 A;  2WKQ A;  5DTK A;  2YKH A;  3TRC A;  2V0U A;  1OJG A;  4CJN A;  5F82 A;  4N1H A;  5CGX A;  5HAQ A;  5A93 A;  5A91 A;  4DE0 A;  4EBL A;  5AVF A;  1L0F A;  3QP4 A;  2X02 A;  4KG5 A;  4NXE A;  4M4X A;  5FAO A;  5FQI A;  3V5M A;  1F2K A;  2Y2M A;  1N4O A;  5EM1 A;  2HP6 A;  2JKF A;  5HAR A;  5E2F A;  3NUL A;  3UE1 A;  1H8M A;  3LIF A;  4KQR A;  3T4S A;  3CI6 A;  5HW3 A;  4HES A;  2Z6C A;  4IED A;  4OQI A;  4GDN A;  1SKO A;  4GCZ A;  2I72 A;  3H82 B;  1S67 L;  2EWW A;  4IVI A;  5EUA A;  4UQI M;  2O0Y A;  2CC1 A;  1LI0 A;  4OQH A;  3BY9 A;  3OLO A;  3LCE A;  1VEU B;  1NWZ A;  3R7W A;  4NXB A;  3IF6 C;  2ZQ8 A;  2BLS A;  1HVB A;  4LFU A;  2ZJ9 A;  1ES2 A;  4F3L A;  1CEG A;  3KYZ A;  2Y2K A;  2WGI A;  4NG2 A;  4RYE A;  2EXA A;  2VGL S;  1N9N A;  5KMW A;  2VV7 A;  2HGV A;  5FQQ A;  4GS9 B;  1A0K A;  3BLS A;  1BUE A;  3P09 A;  3RFB A;  4KQQ A;  4KEN B;  3QP2 A;  1H0M A;  2V1A A;  1OME A;  2XA7 M;  3OCN A;  3BLM A;  2V9A A;  2ZMV A;  3MJQ A;  5F68 A;  4R4S A;  1Q2P A;  1T19 A;  3EGD C;  5G18 A;  2O99 A;  2V2F F;  2XGN A;  4GLQ A;  3VP0 A;  4S2I A;  4E6X A;  5EM0 A;  2Y2H A;  4R1G A;  4MMN A;  4GB7 A;  4WM9 A;  5EVI A;  1IEL A;  1ZTU A;  5FQK A;  5EFW A;  4LRY C;  2PRF A;  4KUK A;  2VJW A;  4JXS A;  3MZE A;  5HSQ A;  2A3U A;  3HLW A;  3MS6 A;  1DY6 A;  1YAX A;  3B47 A;  1PZP A;  4QD4 A;  4IHQ A;  3PHY A;  1G68 A;  3GR2 A;  2VV8 A;  2Z6D A;  3HUM A;  3E4P A;  4ID4 A;  4N9K A;  1EWZ A;  2J9P A;  4PKY G;  3NOT C;  5HDS A;  1VEU A;  2Y2G A;  5FSR A;  3IH9 A;  4X68 A;  1PW8 A;  2V0W A;  1PRQ A;  1MBL A;  1MPL A;  1G6O A;  2M7U A;  1W8Y A;  3IXB A;  1OT6 A;  2G2W A;  1TVF A;  3DTK A;  3VP3 A;  2Y55 A;  2WAD A;  1JVJ A;  2KDK A;  2R78 A;  1H8Z A;  4GS9 A;  4IUH A;  1F98 A;  3IF6 A;  2HDQ A;  4GNU A;  3UE0 A;  3IXD A;  1FSY A;  1Y4O A;  1QME A;  3JVV A;  3MZD A;  1F9I A;  3LEQ A;  3T4T A;  3FV7 A;  2JC7 A;  3S22 A;  4LPZ A;  2IWC A;  4IJG A;  4G3K A;  5EVL A;  3EQU A;  3BEC A;  4K91 A;  1P9R A;  4KZ7 A;  1MKM A;  1JWP A;  4BD0 A;  2OLU A;  4Z9Q A;  3ITA A;  1G6A A;  3NC8 A;  1XA1 A;  4ZJ1 A;  4Y5F A;  1KVM A;  3IBJ A;  4QPR A;  1BLC A;  3A3D A;  5EOO A;  1PW1 A;  4HP9 A;  1KDW A;  5GHZ A;  3DTE A;  1EW0 A;  2UV0 E;  2VK3 A;  2XQZ A;  5FI6 A;  3JVU A;  3F1P B;  2H0Y A;  2L0W A;  4YIN A;  3RJU A;  3W4Q A;  2D01 A;  3CIT A;  5EOE A;  4C6Y A;  3SH7 A;  4BMW A;  3ULF A;  2NUT C;  3N4I A;  3LIC A;  3E2L A;  2P9V A;  3CMZ A;  3M2J A;  3O88 A;  1XJ2 A;  4EET B;  4HY8 A;  2W3F A;  1FIK A;  3MR0 A;  5DF7 A;  4KZ5 A;  4OOY A;  2ZMA A;  5FQ9 A;  5M18 A;  3BFE A;  3LYX A;  1SHV A;  2PYP A;  3UDX A;  1LLB A;  4EW7 A;  3B42 A;  5CTN A;  4Y0U A;  5GLC A;  1JWZ A;  3E2K A;  1ONG A;  5C5K A;  1OT9 A;  2H28 A;  3IT9 A;  3SH8 A;  2KLI A;  1ERQ A;  2Y2P A;  3FPV A;  3NJA A;  2ZOH A;  4N1X A;  4UHU A;  3LR3 A;  4DXB A;  4K0X A;  1Y28 A;  1NLZ A;  1G28 A;  3A3I A;  3B3X A;  4LGW A;  2Q0O A;  4WL9 A;  4E3N A;  1CQA A;  3G31 A;  3VOZ A;  4X53 A;  3SOI A;  3T12 B;  2KX6 A;  4RVA A;  1PWG A;  3H7W B;  5HWV A;  4MN7 A;  3VFF A;  5TBM A;  2JKT I;  1BYW A;  1STZ A;  3C8C A;  2H10 A;  2OAP 1;  1FQG A;  4HH3 A;  3OPH A;  4HHD A;  3VE4 A;  3UY6 A;  3O5Y A;  3IHA A;  4FSF A;  1L2S A;  4U0T A;  3IX4 A;  5DFY A;  1YMS A; 
#chains in the Genus database with same CATH homology
 1S6R A;  1BT5 A;  3O86 A;  4UA9 A;  1NY0 A;  1MXO A;  3IF6 B;  2ZD8 A;  3DWZ A;  1JTD A;  4BJP A;  4UA6 A;  4DXC A;  4OQG A;  1W79 A;  3FYZ A;  3BFD A;  1XKZ A;  1XPB A;  1ESI A;  1RCJ A;  1S0W A;  2OLV A;  3LEZ A;  4K0W A;  4H8R A;  1ALQ A;  1IYP A;  4HBU A;  5AQB A;  1O7E A;  3OCL A;  4JF5 A;  1W5D A;  5KZH A;  2ZQC A;  4OPR A;  2H0T A;  2FFY A;  4EWF A;  1KVL A;  5CGW A;  4S2N C;  1KDS A;  1NYM A;  1K57 C;  4WZ5 C;  1K6S A;  1TDL A;  3OZH A;  2WKI A;  2ZM2 A;  2ZQ9 A;  1N9B A;  1YM1 A;  3MXR A;  4UAA A;  3ZG0 A;  5HX9 A;  3VP2 A;  1Y54 A;  4E6W A;  4OOL A;  5JYO A;  3ZFZ A;  1K4F A;  4FD8 A;  4OPZ A;  1YMX A;  4JF6 A;  4KZ8 A;  1WYB A;  3W4P A;  5EVI C;  4BQM A;  1PYY A;  3C4P A;  1XX2 A;  4CPK A;  1K56 A;  1E3U A;  4QB8 A;  3OC2 A;  4HBT A;  4BD1 A;  4PM5 A;  2XDM A;  1K38 A;  5EPH A;  1MWU A;  4C75 A;  3PTE A;  3RXW A;  2HDR A;  2Y2I A;  3GMW A;  3PBS A;  1ZG4 A;  1VM1 A;  2OSU A;  4FH4 A;  5EE8 A;  2VGK A;  2EX6 A;  3HLC A;  5DTK A;  2ZQ7 A;  3D4F A;  1HTZ A;  1BUL A;  3EQV A;  5TR7 A;  1CEF A;  3LO7 A;  5F82 A;  1KGF A;  3BM6 A;  3IWO A;  4N1H A;  4PM8 A;  4CJN A;  5CGX A;  5HAQ A;  5A93 A;  5A91 A;  4OH0 A;  1GA9 A;  4DE0 A;  2P9V B;  3MXS A;  4EBL A;  1LHY A;  4DF6 A;  3ZVT A;  1L0F A;  3IHB A;  2X02 A;  4PMA A;  1NXY A;  4KG5 A;  5FAO A;  2J8Y A;  5FQI A;  3V5M A;  2WUQ A;  2Y2M A;  1WE4 A;  1N4O A;  2Y59 A;  1ERO A;  1SDE A;  1ZKJ A;  5FI2 A;  4DRT A;  2HP6 A;  1CI8 A;  1MWT A;  5HAR A;  4RX2 A;  1E4D A;  3UPP A;  4O7D A;  5E2F A;  1ONH A;  1MWR A;  3JYI A;  4MLL A;  1K54 C;  2E8I A;  3UE1 A;  4WMC D;  4KQR A;  3OPR A;  4X55 A;  3ZDJ A;  5A90 A;  3QNB A;  5BOH A;  3UNW A;  4E3I A;  3HVF A;  4U3T A;  3VP4 A;  5HW3 A;  3ZG9 B;  4HES A;  4MNR A;  3HBR A;  1ZG6 A;  3HUO A;  1EI5 A;  1GA0 A;  2OV5 A;  1L0E A;  3NDE A;  2Y2L A;  4IED A;  4GKU A;  4OQI A;  4GDN A;  2HP9 A;  2I72 A;  4S2P A;  1JWV A;  4GN2 A;  4P87 A;  3CG5 A;  4RX3 A;  3WS2 A;  4IVI A;  5EUA A;  3ISG A;  1TEM A;  3O87 A;  2CC1 A;  1LI0 A;  3OPP A;  2GDN A;  3MZF A;  3SS5 A;  3ZHH A;  3ZCZ A;  1GHI A;  1RGY A;  4DDS A;  4OQH A;  1IKI A;  3N7W A;  4P0M A;  2C5W B;  3ZG8 B;  3LCE A;  3Q1F A;  3AGD A;  2WGV A;  3HLF A;  4FCF A;  2WAF A;  3IF6 C;  2ZQ8 A;  1YLJ A;  2BLS A;  1HVB A;  2JBF A;  2ZJ9 A;  3BRM A;  3ZG5 A;  1ES2 A;  1K25 A;  3NBL A;  2RL3 A;  4OVD A;  2EFX A;  1IYQ A;  3IXG A;  4XUZ A;  1CEG A;  4LEN A;  2Y2K A;  2QZ6 A;  4GDB A;  2JCH A;  2WGI A;  4GOG A;  4LCM A;  1NZO A;  4RYE A;  2QMI A;  2EX9 A;  2EXA A;  2ZC5 B;  4IBR A;  3G2Z A;  3BFF A;  5EEC A;  5KMW A;  5D3O A;  4MBH A;  4QY6 A;  3C7V A;  4C3Q A;  5DTT A;  5FQQ A;  5IHV A;  4OP8 A;  3N8R A;  1K55 A;  1YLP A;  3BLS A;  3IXH A;  1BUE A;  4PM7 A;  3P09 A;  4XXR A;  1NZU A;  5E2G A;  5CHJ A;  3WWX A;  4WEK A;  2V1Z A;  2Z2L B;  3MFD A;  3N8S A;  2Y2O A;  2EX8 A;  5GHX A;  3VSK A;  3PBR A;  1FOF A;  1XA7 A;  2HDS A;  3QHY A;  2XK1 A;  3NCK A;  2ZC6 B;  5FAS A;  1GHP A;  4KQQ A;  2R9W A;  3OPL A;  3ZGA B;  1ES3 A;  4KEN B;  4KZB A;  1ES5 A;  3W8K A;  5CED A;  2XFS A;  4BL2 A;  3DTM A;  1M6K A;  3V39 A;  3SH9 A;  4ZJ2 A;  1LL5 A;  5CEB A;  1O07 A;  3WS1 A;  3WS4 A;  1OME A;  5TFQ A;  4GD8 A;  3A3E A;  3OCN A;  3Q7V B;  5GLB A;  2DRW A;  2QPN A;  4WMC A;  3BLM A;  5CGS A;  4E3M A;  3WS0 A;  1PI4 A;  4R4S A;  3GSG A;  1Q2P A;  3IQA A;  4S2N A;  1C3B A;  1K57 A;  2IWD A;  2R9X A;  4WZ5 A;  5G18 A;  2V2F F;  3S4X A;  2XGN A;  3VP0 A;  4S2I A;  1ES4 A;  2HP5 A;  4E6X A;  2C6W B;  4JXW A;  2Y2H A;  3A3F A;  3G2Y A;  3IWQ A;  3BEB A;  1NRF A;  3W4O A;  5FQJ A;  4R1G A;  3ZVW A;  4GB7 A;  3V50 A;  4JKT A;  4WM9 A;  4X56 A;  5EVI A;  2EFU A;  1IEL A;  4FH2 A;  1PIO A;  5FDH A;  1IKG A;  1FCN A;  2EXB A;  4GD6 A;  4KZA A;  5FQK A;  4N9L A;  3M6H A;  2WGW A;  3HRE A;  5AQA A;  3TOI A;  2P74 A;  3MKF A;  2ZC3 B;  5CEC A;  1DJC A;  1IYO A;  1I5Q A;  4JXS A;  3MZE A;  5CHM A;  5HAP A;  2XD5 A;  4P6B A;  5GL9 A;  3GQZ A;  1JTG A;  4JBF A;  4OP5 A;  1KE4 A;  2WKH A;  4KQO A;  1YLY A;  2A3U A;  4P85 A;  3HLW A;  4IVK A;  3HL9 A;  1BZA A;  1FCO A;  3VSL A;  3P98 A;  5HAI A;  1CI9 A;  5DTS A;  1DY6 A;  1PZP A;  4ZBE A;  4QD4 A;  1MKI A;  5FAP A;  3VFH A;  1G68 A;  2XF3 A;  3GR2 A;  5M19 A;  3DWK A;  1MWS A;  2XLN A;  3HUM A;  3NY4 A;  4R23 A;  1ESU A;  3BYD A;  4ID4 A;  4N9K A;  2Q9M A;  2HPB A;  3NDG A;  4M3K A;  2XH9 A;  1EWZ A;  4PPR A;  3I7J A;  2J9P A;  2XFT A;  5I94 A;  1K54 A;  2Y2G A;  5F83 A;  1YLW A;  3PAE A;  4OOM A;  5FSR A;  4LV0 A;  3IH9 A;  3LY4 A;  4BL3 A;  4RA7 A;  4HEF A;  5A92 A;  1XXM A;  2XR0 A;  1GCE A;  4OLD A;  5FAQ A;  4X68 A;  1NYY A;  4JPM A;  1Z6F A;  1PW8 A;  3M6B A;  4WBG A;  3IF5 A;  3PAG A;  1K6R A;  2B5R A;  2WKE A;  1MBL A;  3HUN A;  3UO9 A;  5J8X A;  1MPL A;  3QNC A;  4XUX A;  1W8Y A;  5AQ7 A;  2XEP A;  4OON A;  3IXB A;  1PWD A;  2FFF B;  2G2W A;  1TVF A;  3VP3 A;  2ZM0 A;  4MBF A;  2Y55 A;  2BG1 A;  1BLP A;  1K56 D;  2WAD A;  1E3U D;  1JVJ A;  1TDG A;  2VGJ A;  1KE0 A;  2XD1 A;  3GV9 A;  3G34 A;  1H8Z A;  4GZB A;  4LV1 A;  3AGE A;  2V20 A;  3C5A A;  3VOY A;  1YT4 A;  5AQ9 A;  3IF6 A;  3GTC A;  2HDQ A;  4GNU A;  5F1F A;  5E2H A;  3UE3 A;  3IXD A;  1PI5 A;  1FSY A;  3G35 A;  5FA7 A;  3SS4 A;  3UE0 A;  1QME A;  1AXB A;  4WEL A;  5FI7 A;  3WS5 A;  3MZD A;  1FR6 A;  3PBT A;  1J9M A;  2X71 A;  4U0X A;  1LL9 A;  3FV7 A;  2UWX A;  1VQQ A;  3NI9 A;  2JC7 A;  3UPO A;  5GHY A;  2IWB A;  3S22 A;  4S2L A;  1E25 A;  5KSC A;  3BFG A;  2IWC A;  1FCM A;  1DJA A;  3HLD A;  3AGF A;  3DW0 A;  3HLE A;  5EVL A;  3EQU A;  3HLG A;  3BEC A;  4KG2 A;  4EBP A;  4R3B A;  3N8L A;  4DDY A;  5FAT A;  4K91 A;  4KZ7 A;  1W7F A;  1JWP A;  1LI9 A;  4S2O A;  3Q7V A;  4BD0 A;  4QU3 A;  2OLU A;  4BLM A;  4Z9Q A;  2G2U A;  1ERM A;  2PU2 A;  1G6A A;  3ITA A;  3NC8 A;  1XA1 A;  3A3J A;  4IBX A;  1PWC A;  4ZAM A;  4ZJ1 A;  1KVM A;  3UPN A;  5L2F A;  3ITB A;  4PM6 A;  1YLT A;  4LV2 A;  1BLC A;  3A3D A;  3CJM A;  1PW1 A;  5EOO A;  4Q8I A;  1KDW A;  5GHZ A;  2ZQD A;  3GRJ A;  5CTM A;  3UDI A;  3ZNT A;  2XQZ A;  1YLZ A;  5FI6 A;  1SDN A;  4WEJ A;  4R4R A;  4X69 A;  2H0Y A;  4QHC A;  3V3R A;  2ZLY A;  4YIN A;  2WAE A;  4F94 A;  1YQS A;  3RJU A;  3W4Q A;  4D2O A;  4MEZ A;  5DF9 A;  5EOE A;  1U60 A;  2ZC7 A;  4C6Y A;  2ZQA A;  3IH8 A;  4B88 A;  4DE2 A;  3M2K A;  3SH7 A;  2WK0 A;  1BLS A;  4E3L A;  3N4I A;  3RXX A;  4DKI A;  4NK3 A;  5JYP A;  4EBN A;  3E2L A;  2P9V A;  3CMZ A;  2RCX A;  2WZX A;  3M2J A;  3O88 A;  4KG6 A;  3S1Y A;  3TG9 A;  5CER A;  1ZC2 A;  2EX2 A;  2Y91 A;  1FR1 A;  3G4P A;  3Q82 A;  1I2W A;  5DF7 A;  4KZ5 A;  4KZ9 A;  1HD8 A;  4OOY A;  1KGE A;  4WYY A;  1DJB A;  4L0L A;  2ZMA A;  5FQ9 A;  5M18 A;  1XP4 A;  3BFE A;  1PZO A;  3N6I A;  4X6T A;  5M1A A;  4PM9 A;  4ZJ3 A;  1SHV A;  2JE5 A;  3MBZ A;  2A49 A;  3UDX A;  2Y2N A;  5E43 A;  4EQI A;  1LLB A;  3C4O A;  4MBK A;  4JXV A;  4JF4 A;  1BLH A;  3CZD A;  3LY3 A;  1H5X A;  3O3V A;  4NET A;  1BSG A;  5CHU A;  2J9O A;  4ZDX A;  5CTN A;  4Y0U A;  1SKF A;  5GLC A;  3UDF A;  3V3S A;  1JWZ A;  3HLB A;  3E2K A;  1ONG A;  2J7V A;  3PBO A;  3C7U A;  2Z2M B;  4OPY A;  4Y0O A;  3FWL A;  1IEM A;  4LV3 A;  4Y0T A;  4E3K A;  4KZ6 A;  1IYS A;  3NIA A;  5EVI B;  2Y2J A;  3IT9 A;  1BTL A;  3GVB A;  5HL1 A;  2ZM8 A;  3FZC A;  2X01 A;  3SH8 A;  4R0Q A;  1ERQ A;  2WGW B;  2Y2P A;  3FKW A;  1L0G A;  4N1X A;  4UHU A;  5CRF A;  3MKE A;  2PBY A;  4DXB A;  3PBN A;  3Q07 A;  4K0X A;  4QY5 A;  1HZO A;  4JLF A;  3UN7 A;  4BEN A;  4S2M A;  3A3I A;  5GLD A;  1M40 A;  2Q9N A;  3B3X A;  4DE3 A;  3G32 A;  3ZNY A;  4KZ3 A;  1W8Q A;  4E3O A;  1KE3 A;  4OQ0 A;  4E3N A;  2HDU A;  4A5R A;  1RP5 A;  3VMA A;  3G31 A;  3VOZ A;  3PBQ A;  4X53 A;  5EVI D;  4JXG A;  3SOI A;  1NJ4 A;  4OLG A;  4RVA A;  1PWG A;  4WZ4 A;  1XGI A;  3TSG A;  4Y7P A;  5KSH A;  5HFO A;  1I2S A;  1Q2Q A;  4E3J A;  5FQM A;  4ZTK A;  3WRT A;  3VFF A;  4R3J A;  2H5S A;  4QJG A;  4B4Z A;  2DCF A;  5TGF A;  4OPQ A;  3G30 A;  3SS3 A;  1QMF A;  1GHM A;  4EV4 A;  4YFM A;  3VP1 A;  2WYX A;  1SCW A;  2H10 A;  5DF8 A;  1FQG A;  3BFC A;  2PU4 A;  2Y4A A;  1H8Y A;  5F1G A;  1FSW A;  1KGG A;  5E2E A;  2DNS A;  1WYC A;  3OPH A;  3WRZ A;  4S2K A;  3FKV A;  4UA7 A;  1RGZ A;  5GLA A;  3ZG7 B;  4N92 A;  5CXW A;  3UY6 A;  4EUZ A;  3IHA A;  4S2J A;  5U47 A;  1L0D A;  3Q81 A;  2Y2Q A;  4FSF A;  1K4E A;  1L2S A;  3Q7Z A;  1MY8 A;  4LCL A;  1K55 C;  3IWI A;  5DVA A;  4U0T A;  4KZ4 A;  4OKP A;  4B4X A;  1XGJ A;  4DE1 A;  2WZZ A;  1YMS A;  2ZC4 B;  1CK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...