3WS4A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-2a)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
b'QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws4A00
4Y0TA 2XQZA 3QHYA 4LV0A 5FAQA 1NY0A 3OZHA 4OLDA 4P6BA 1YMXA 2J7VA 5DVAA 4E6XA 4PM5A 4IEDA 4KZ8A 1JWZA 1TEMA 1EWZA 4DXCA 5CEDA 3HVFA 1S6RA 2B5RA 1WYCA 4C6YA 4Y7PA 4XXRA 1CK3A 1NZOA 1E4DA 1NYMA 3WRZA 4MBFA 1KVMA 2JC7A 3OC2A 4ZTKA 2X02A 4R3BA 4E6WA 4RX2A 5U47A 4KG5A 4OP5A 1BLCA 2XFSA 1MXOA 1K25A 2ZQAA 4EBNA 2WUQA 4S2IA 4DDYA 2H10A 1RCJA 2ZQ7A 1IYSA 1LLBA 2EX6A 4U0XA 5EPHA 5GLBA 2G2UA 4P87A 5CGWA 4LV2A 1WE4A 5HW3A 2RCXA 4RA7A 3NI9A 3RJUA 5CTNA 3O86A 1NZUA 2JBFA 2EX9A 3SS4A 1ZC2A 3WS2A 3UPOA 4DKIA 1KGEA 1FSWA 4ZAMA 1KE0A 2ZJ9A 3VOYA 3VP1A 1JTGA 1K54C 3Q1FA 4OKPA 5AQAA 4S2OA 3GRJA 3Q07A 5KSCA 4JXGA 5FA7A 1BLPA 5G18A 5HAQA 2WZXA 2XD5A 3BRMA 3D4FA 3HLCA 1KE3A 1BTLA 4X55A 3GTCA 1MWRA 3N7WA 4N92A 4OQIA 2Y2IA 5TFQA 1GA9A 1K55A 3ISGA 1EROA 5EVIC 2HDSA 4WMCA 4WM9A 2DRWA 5JYPA 3CMZA 1G68A 1L0EA 4N9KA 4ZBEA 4OPZA 2Z2MB 1XKZA 3BM6A 1DY6A 3MZFA 3W8KA 4UA9A 1FR1A 5GLAA 3IWIA 2RL3A 3A3EA 2HP5A 5EVIB 4FCFA 1KVLA 1U60A 5E2EA 2XLNA 1E3UD 1BLHA 1KGGA 4A5RA 3BLMA 3GVBA 5CRFA 2EFXA 3VP4A 3LEZA 3MFDA 3RXWA 3UO9A 4BLMA 5F1FA 1I2SA 3NBLA 5J8XA 2WAEA 2PU2A 3AGEA 3C4PA 3M6HA 3GMWA 3PBRA 4JXSA 3UDFA 4CPKA 3IHBA 2WKIA 2ZQ9A 3M6BA 1MBLA 4X69A 5A92A 1YLWA 3N8RA 4U3TA 5GHXA 4OLGA 4DF6A 1JVJA 5HARA 3EQVA 3PAGA 1HVBA 3GR2A 1IYOA 5DTSA 1H8YA 1ZG6A 2V20A 3A3IA 3NDGA 5IHVA 5E43A 2R9XA 3G31A 5CTMA 3ZFZA 3C7UA 1K6SA 3W4OA 1MWSA 2EXBA 1XP4A 3N6IA 4WBGA 5E2HA 4WEKA 1FCNA 2V1ZA 4FH2A 3IWOA 4KG6A 3VFHA 2C6WB 1E25A 1ES5A 3AGFA 5DF7A 2FFYA 2XFTA 3BFGA 4R3JA 2HDUA 1XGIA 1SKFA 1N9BA 1ERMA 2HDRA 2ZQDA 5FAPA 3WS4A 3VSKA 3BECA 5KZHA 2XH9A 4PM9A 1TDLA 4Y0OA 1ES4A 2WAFA 3TG9A 4FSFA 1VM1A 3G4PA 5DTTA 1TVFA 1PIOA 2Y2NA 3LY3A 4NK3A 3MZEA 3DWKA 3PBSA 4LCLA 1H8ZA 3NCKA 3IF6A 3N8LA 3PBTA 4DDSA 1ERQA 4MEZA 3E2KA 1PW8A 5KMWA 4HEFA 4IVKA 5GLDA 3Q82A 4E3LA 1GHIA 2QZ6A 3G30A 1L0DA 3NC8A 4O7DA 4EV4A 3ZG9B 2ZC4B 4MBHA 4BENA 4R0QA 3PBQA 2Y2QA 5A93A 4OPRA 4R4RA 1ESIA 2Y2LA 3MXSA 3NDEA 3Q81A 2A3UA 2WK0A 5D3OA 1KE4A 1CI8A 5CERA 1C3BA 1LI0A 3VSLA 1SDEA 2BG1A 2OLUA 4C75A 1OMEA 1HTZA 1XX2A 2Y2MA 4WELA 1PWCA 4P85A 1MWTA 1PI4A 1WYBA 1MKIA 1RP5A 3G2YA 2PU4A 3CG5A 1K55C 3OPPA 4KQQA 4UA7A 2WGVA 2WGIA 4B4XA 4PPRA 4QY6A 1CI9A 4OQHA 5F1GA 3SOIA 4X6TA 2XEPA 4GOGA 5AQ7A 1VQQA 3O87A 2GDNA 4KZAA 3WRTA 4KZ9A 5CGXA 1LI9A 5HAIA 1PWDA 4KQRA 2QMIA 3FWLA 4PMAA 4NETA 3FYZA 4C3QA 1RGZA 4PM8A 3ZG5A 1NYYA 1W8YA 3OCLA 4GD8A 4E3IA 3G2ZA 3PBNA 1SHVA 4RVAA 2V2FF 4B4ZA 4EBLA 1EI5A 2EXAA 3BYDA 1SDNA 1YLYA 3S4XA 5FAOA 4WZ4A 1KDWA 2ZM2A 1YMSA 3IH9A 1YQSA 2R9WA 4R4SA 5FATA 5F83A 5EOEA 3LY4A 3UNWA 3G35A 4LV1A 2ZC3B 4Y0UA 3Q7VA 4K0XA 4GDNA 5AQ9A 1ONHA 3UDXA 2ZMAA 3ZG0A 4OH0A 4E3NA 4JF4A 4OVDA 3ZDJA 4DE0A 2A49A 1K57A 3B3XA 4N1HA 3LO7A 3E2LA 2ZM0A 3V3RA 3IH8A 3UY6A 3WS1A 4GNUA 4JF6A 4RX3A 2Y2GA 1XPBA 2IWBA 4RYEA 5CHJA 2ZC7A 3FKWA 3HLFA 1YLPA 3HUOA 1ALQA 1YLTA 1GHPA 3P98A 4ZJ3A 5TR7A 2P9VA 2Y2OA 3IF5A 3HUNA 4KZ7A 3VMAA 1I2WA 3C7VA 2ZLYA 5CHMA 3V50A 1Q2PA 4X68A 1E3UA 1Q2QA 3PBOA 4WZ5C 3ZNYA 4JPMA 4JLFA 4DE3A 3OPLA 3ZVTA 2ZC5B 4X56A 5GHZA 3M2JA 3MXRA 4MBKA 3PTEA 4IBXA 1ZG4A 1IKIA 3BFEA 3C4OA 4HBTA 2WKEA 3QNCA 4GN2A 2JE5A 3UE3A 1BUEA 1N4OA 3UE1A 2ZQCA 3ZVWA 3BFCA 4BL3A 3IXBA 4OP8A 1L2SA 3MBZA 3IF6B 4D2OA 1GA0A 2EX8A 3IHAA 5F82A 2DCFA 3G34A 3UDIA 1LL9A 1YLJA 2X71A 1M6KA 3JYIA 1PI5A 3V39A 1YT4A 1NXYA 2BLSA 4OQ0A 4UHUA 1S0WA 5GL9A 2J9PA 4DE2A 5HL1A 2WGWA 5FQ9A 4R23A 3Q7ZA 5EVID 1PZPA 1K56D 4BQMA 3W4QA 2HDQA 1FCOA 1JWPA 4JBFA 4WEJA 4ZJ1A 2XD1A 4ID4A 4N1XA 1ONGA 5CGSA 4BD0A 4EUZA 1FR6A 1ES3A 3N8SA 5A91A 1CEGA 1IEMA 4JXVA 2H0YA 5BOHA 3IQAA 1PWGA 3VP0A 4P0MA 1YM1A 1XA1A 2XGNA 5FDHA 4KZ5A 4WYYA 3LCEA 4PM6A 3A3JA 3ZGAB 3WWXA 4EBPA 3OCNA 2HP9A 5FI2A 4E3OA 3N4IA 1BLSA 1FOFA 2H0TA 3ZNTA 4R1GA 5GHYA 3GV9A 3C5AA 3ITAA 2QPNA 5M1AA 4S2NA 1K4FA 4F94A 1L0GA 3BLSA 1MY8A 3CZDA 1BT5A 1CEFA 1JWVA 3FV7A 4PM7A 2E8IA 3FZCA 5DTKA 1K57C 4KZ3A 1HD8A 1AXBA 3IT9A 4JF5A 3BFFA 1TDGA 4KZ4A 1DJBA 3HBRA 4OONA 5CXWA 1DJCA 3HLGA 3ZG7B 4S2JA 4E3JA 4K0WA 4UAAA 2EX2A 1MWUA 5DF9A 5EECA 5E2FA 4FH4A 4IBRA 2ZD8A 3V3SA 3Q7VB 1RGYA 3ZCZA 5HFOA 1H5XA 3V5MA 3TSGA 2ZQ8A 1IELA 3PAEA 2VGKA 3O3VA 1XGJA 2XK1A 1ZKJA 4Q8IA 4QHCA 1IKGA 4Z9QA 4JXWA 2CC1A 2OLVA 3SS5A 4YINA 5FQJA 2ZC6B 3HLBA 2Y2JA 3HREA 3WS0A 1FCMA 4XUXA 4HESA 4KG2A 2P9VB 3EQUA 3UE0A 1G6AA 3MZDA 4X53A 1QMEA 4B88A 5E2GA 5EOOA 1HZOA 2Z2LB 1MPLA 4OQGA 3BEBA 5CHUA 3UPPA 4YFMA 3HLDA 5EUAA 4BJPA 4KQOA 4FD8A 1JTDA 4OPYA 2J9OA 2XF3A 1BZAA 4L0LA 1LHYA 5A90A 2X01A 1GHMA 4ZJ2A 1O07A 5FQIA 2XDMA 4QB8A 1W5DA 2PBYA 2Y2KA 1SCWA 3IWQA 3MKEA 4LV3A 4DXBA 4S2KA 1NJ4A 1Y54A 1W8QA 3S22A 4ZDXA 2WZZA 4CJNA 1K6RA 1PZOA 3QNBA 3HL9A 4JKTA 2G2WA 3W4PA 5HAPA 1KDSA 4WMCD 3IXDA 2FFFB 3OPHA 4QJGA 4KZ6A 2UWXA 4QD4A 3VFFA 5CECA 2IWCA 2C5WB 2I72A 3IF6C 2Y55A 1J9MA 4QY5A 4KENB 5DF8A 5M19A 3O88A 3HUMA 2Y91A 1YLZA 4E3KA 3RXXA 4EWFA 3FKVA 1W79A 3MKFA 2Y2PA 4DRTA 4QU3A 4IVIA 2WGWB 4GDBA 3ZHHA 2VGJA 2EFUA 1I5QA 4M3KA 2Q9MA 3VP3A 3SH9A 1ESUA 4U0TA 4K91A 2OV5A 2Y4AA 3GQZA 5FI6A 5M18A 2P74A 3DTMA 1XXMA 2DNSA 3IXGA 4MNRA 3SH7A 4N9LA 3NIAA 1QMFA 5FSRA 4S2LA 1K54A 5AQBA 5I94A 4KZBA 3S1YA 4OPQA 4LENA 3SS3A 4DE1A 4E3MA 3A3DA 4LCMA 4OOMA 1O7EA 4OOLA 2WKHA 3BFDA 4S2NC 1Z6FA 4XUZA 1K4EA 5EVLA 2HPBA 3WS5A 4S2MA 1XA7A 4BL2A 1IYQA 3TOIA 3HLWA 3GSGA 1M40A 1L0FA 2XR0A 3UPNA 2ZM8A 1GCEA 2WYXA 4UA6A 3DWZA 2HP6A 5EVIA 1LL5A 2J8YA 4GKUA 3P09A 5TGFA 5FI7A 1KGFA 1K56A 1FQGA 1W7FA 3NY4A 3VP2A 5KSHA 4GD6A 5FASA 2OSUA 1NRFA 2WADA 3M2KA 5FQMA 5JYOA 3G32A 3SH8A 4GZBA 4GB7A 5CEBA 3A3FA 5GLCA 2IWDA 1K38A 3ITBA 1DJAA 5FQQA 1PYYA 5FQKA 2JCHA 3AGDA 1IYPA 3ZG8B 2Q9NA 3IXHA 4OOYA 1FSYA 3HLEA 4WZ5A 3OPRA 4HBUA 4MLLA 2Y2HA 3DW0A 1PW1A 3I7JA 1ES2A 5EE8A 3VOZA 5HX9A 2Y59A 1BULA 3UN7A 5L2FA 4H8RA 4EQIA 1BSGA 4S2PA 4BD1A 3CJMA 2H5SA
chains in the Genus database with same CATH superfamily
4NXEA 1NY0A 3OZHA 4DMZA 4OLDA 3MF0A 4E6XA 5DVAA 4IEDA 2J3TC 1JWZA 3QP4A 3K3CA 1EWZA 2B5RA 1NYMA 3WRZA 4OP5A 1BLCA 2BTFP 2WUQA 4S2IA 2H10A 5L09A 5EPHA 4P87A 4LV2A 4RA7A 3NI9A 3RJUA 3O86A 2EX9A 2OWHA 3UPOA 3VP1A 3LIBA 4OKPA 3F1PB 2JKTI 3T1XA 4S2OA 2WKPA 5KSCA 4HP4A 2WZXA 1KOUA 5DJUA 3GTCA 2JKTM 4N92A 4OQIA 2WKRA 2J3WA 3QP5A 3LI9A 1Z09A 4OPZA 4G3KA 2Z2MB 3W8KA 4HJ3A 3T4LA 3A3EA 1SKOB 3MJQA 5EVIB 1T1AA 4FCFA 1BLHA 4FTXA 2EFXA 2L0WA 4EUVA 4KUOA 3UB9A 2WAEA 3UDFA 4JXSA 4CPKA 3PBRA 3IHBA 1S1ZA 2ZQ9A 1YLWA 3N8RA 2V8CA 4DF6A 5HARA 1HVBA 1IYOA 5DTSA 5IHVA 1ZG6A 3NDGA 5L07A 4P6ZM 3W4OA 1XP4A 4WEKA 4HNBA 4FH2A 3IWOA 4KG6A 5KIZA 5DF7A 2B02A 3L7HA 5FAPA 2HDUA 2ZQDA 1ERMA 4R3AA 4NXBA 2BASA 1VM1A 1H0MA 4NK3A 3MZEA 2M1CA 1F9IA 5AVEA 3G30A 3TW8A 4L9GA 4CLCC 4X1LA 2UV0E 3GECA 2A3UA 2WK0A 3NECA 1KE4A 1G6OA 3LR5A 1TS0A 5CERA 1C3BA 4C75A 1OMEA 1T18A 1PWCA 1PI4A 5KMWA 1K55C 3UMEA 4RQ9A 4KZAA 1LI9A 4MDZA 4KQRA 3S7NA 2QMIA 4NETA 2O0YA 4ETXA 3NULA 3T1QB 3G2ZA 4MN7A 4B4ZA 3NOTC 1EI5A 5FAOA 2PHYA 1YQSA 2R9WA 4R4SA 3MQQA 4Y0UA 3Q7VA 3ZDJA 2A49A 3B3XA 2J3TD 3E2LA 3V3RA 3BQ8A 5AJGA 2Y79A 4K08A 1YLTA 5TR7A 2P9VA 3IF5A 2XA7M 3HUNA 2ZLYA 5CHMA 1Q2QA 3PBOA 4WZ5C 4IUKA 4DE3A 3OPLA 2HJ9C 4X56A 4IBXA 1ZG4A 3UE3A 2ZQCA 4BL3A 4L9FA 3MBZA 2L4RA 1GA0A 3IHAA 2DCFA 3UDIA 1YLJA 3HJIA 1M6KA 3JYIA 1NRJA 4HQAA 1YT4A 3BY9A 2VGLS 1PZPA 4CQHA 4G3WA 4BQMA 1FCOA 2H28A 3QP1A 4EUZA 3BW6A 1SZVA 5A91A 2HGVA 3DTIA 3IX8A 4P0MA 1YM1A 2VV8A 5FDHA 3T12B 4EBPA 2HP9A 5FI2A 1FOFA 1W63M 3ITAA 3T4KA 3BLSA 3CZDA 3FV7A 2K31A 5HDDA 2A2LA 1HD8A 3IT9A 3KSHA 3DTEA 4JF5A 4OONA 5CXWA 1DJCA 4FOFA 5EECA 2ZD8A 4MN6A 1HLUP 3ZCZA 5HFOA 4GS9B 2ZQ8A 2D02A 3IX4A 4Z9QA 4JXWA 3SS5A 1ZTUA 3HLBA 2Y2JA 3HREA 2EWWA 3A0SA 1HZOA 2Z2LB 4CLCD 1DRMA 3BEBA 3PHYA 3HLDA 1JTDA 2J9OA 2YKHA 2M7VA 5A90A 4ZJ2A 1MZUA 1SCWA 1NJ4A 1W8QA 1YAXA 1OTIA 2O9CA 4UQIS 3F1NB 5CECA 1VEUB 2IWCA 2I72A 5M19A 1VB6A 1DP9A 3RXXA 4IJGA 2KX6A 4IVIA 2WGWB 4GDBA 3ZHHA 1TS7A 2Q9MA 4QPRA 3LIFA 2OV5A 2W3GA 4HY8A 3GQZA 2PT7A 2M7UA 3IXGA 3B47A 4N9LA 2HF6A 5AQBA 3S7OA 4KZBA 4LENA 3A3DA 2WKHA 3BFDA 5EVLA 1LL8A 3B33A 1XA7A 1AWIA 1IYQA 3KX0X 3C30A 1L0FA 2XR0A 2WYXA 2JKGA 2J8YA 4GKUA 5TGFA 1FQGA 3VP2A 5KSHA 5HZHA 5FASA 4Q0HA 2ZOIA 4GZBA 3A3FA 2JHEA 2IWDA 1K38A 3U4LP 5FQKA 1CJFA 3BJNA 1IYPA 3ZG8B 2E8JA 2Q9NA 4WZ5A 1FSYA 3HLEA 3C2WA 4AFIA 2A24B 3UN7A 3JPUA 4S2PA 4BD1A 3CJMA 5EOOA 4XT2A 2XSSA 2PD7A 2D01A 3QHYA 4P6BA 1YMXA 2J7VA 4PM5A 4DXCA 1D06A 2W27A 4LRZE 1WYCA 4LRXC 4Y7PA 5HWVA 4XXRA 2X02A 2W3FA 4RX2A 2XFSA 1XJ3A 1N9NA 2ZQ7A 1LLBA 2EX6A 5GLBA 2V1BA 3QP2A 5F6AA 1WE4A 2V9AA 2JBFA 3WS2A 4ETZA 1KGEA 5HPFA 2ZJ9A 2KLIA 1K54C 5AQAA 4ARZA 3T4JA 5FA7A 5G18A 5HAQA 2XD5A 5K5BA 1MWRA 3JVUA 1UWPX 5EVIC 2HDSA 4L9EA 5JYPA 4ZBEA 3SW1A 1FR1A 3IWIA 2RL3A 3IBRA 2XLNA 1E3UD 2LB5A 3VP4A 3RXWA 4BLMA 5EM0A 5F1FA 4PKYG 3LR4A 2VV6A 3RH8B 2PU2A 3AGEA 3C4PA 3GMWA 3S7QA 4HI4A 4X69A 4U3TA 1JVJA 2VLGA 5J3WA 1H8YA 2KDKA 3A3IA 2R9XA 5CTMA 3C7UA 3CPTB 4IUHA 2V1ZA 2HZ5A 2FFYA 2XFTA 1XGIA 1SKFA 1N9BA 2HDRA 3SZTA 3BECA 4II7A 2XH9A 2XRNA 4Y0OA 4I3AA 2GX5A 4JGPA 5DTTA 3LY3A 3DWKA 3PBSA 4F3LB 3N8LA 4DDSA 1PNEA 3E2KA 1PW8A 4HEFA 4IVKA 4E3LA 3NC8A 1L0DA 4EERA 3H7WB 3PBQA 3T1RA 1P97A 4OPRA 1CF0A 4R4RA 2Y2LA 3Q81A 2VJWA 2VK3A 5TBMB 4EW7A 1CI8A 3P01A 3VSLA 5TJJA 2BG1A 4F3LA 1L3LA 2OLUA 2Y2MA 4P85A 1MKIA 3CG5A 2JN7A 4LFUA 4PPRA 5F1GA 3H7WA 5AQ7A 1VQQA 5FEFA 5DFXA 4KZ9A 5HAIA 4PMAA 5TBMA 3FYZA 3ULFA 1S4RA 3EOIA 4GD8A 4BWIA 5DKKA 3PBNA 5DFYA 2EXAA 3IX3A 1YLYA 3UB7A 4Y5FA 3IH9A 1YSPA 4LV1A 2ZC3B 3NOPC 3PYPA 2ZL1A 4K0XA 3UDXA 4JF4A 4LLOB 1P0ZA 4N1HA 3LO7A 3IH8A 4JF6A 4RX3A 4RYEA 2ZC7A 2V8FA 3FKWA 4Q0JA 3R4KA 3HUOA 4ZJ3A 3P98A 4EQ1A 2Y2OA 1T19A 2J80A 1I2WA 1UWNX 4EETB 4JPMA 3ZVTA 2ZC5B 3MXRA 4MBKA 1OTAA 3PTEA 1YSQA 2WKEA 2QWSA 4R70A 5IS1A 2ZBBA 3A0VA 4OP8A 3KYZA 4D2OA 2EWVA 1S1YA 2EX8A 2Y8HA 3G34A 2P08A 1PI5A 4DJ2A 3E4OA 3V39A 2L1MA 1S0WA 2J9PA 3EWKA 5FQ9A 5EVID 1K56D 3W4QA 5DKLA 1TD5A 1JWPA 3ZQ5A 1V9YA 4ZJ1A 2XD1A 4ID4A 4BD0A 2NUPC 1OT9A 1FR6A 1ES3A 5BOHA 3IQAA 3VP0A 2XGNA 3LIAA 4O8GA 3OLOA 5F68A 5A8BA 3WWXA 4E3OA 1BLSA 4YWZA 3GV9A 5M1AA 4S2NA 1K4FA 1L0GA 2O9BA 3VV4A 3QP6A 1BT5A 4PM7A 3L9KA 1LSWA 2ZMVA 4PHTA 1K57C 4KZ3A 3CWFA 2AVXA 3B42A 3BFFA 1TDGA 4HJ6A 3HLGA 3ZG7B 2PAVP 4E3JA 4K0WA 5DF9A 3D9YA 1N9LA 3V3SA 3Q7VB 4Y2FA 3TSGA 1IELA 2VGKA 3O3VA 1XGJA 1YKDA 4LRYC 3IS2A 3HJKA 4O0PA 3LR3A 3WS0A 1FCMA 3R7WA 1N9OA 2P9VB 1OT6A 3KSFA 3UE0A 1G6AA 4B88A 4OQGA 5CHUA 4BJPA 4FD8A 4OPYA 1GSXA 2GZAA 5FQIA 2XDMA 2EA9A 4S2KA 1Y54A 3QNBA 3CLOA 1MC0A 3CITA 4WMCD 3H9WA 4QJGA 3P7NA 4NXGA 2VKSA 3IF6C 4QY5A 1J9MA 5DF8A 3O88A 2QJ7A 2W1RA 2Y91A 2Y2PA 4DRTA 4M3KA 3SH9A 3D3OA 4K91A 2Y4AA 3DTMA 4MNRA 3NIAA 5FSRA 1K0KA 3S1YA 4OPQA 2K7SA 1OJ5A 3SS3A 1Z6FA 2GNXA 4XUZA 2HPBA 3WS5A 4S2MA 1Y4OA 4Y15A 3GSGA 1M40A 4I5SA 3KSGA 4UA6A 2HP6A 2ZOHA 3P09A 5FI7A 1KGFA 1W7FA 3NY4A 3KYEA 4QWOA 4EESA 3G32A 4GB7A 1G28A 3ITBA 3T4TA 5FQQA 1PYYA 4GLQA 3LIDA 2K2NA 4OOYA 3CUEC 3DBAA 3MMHA 5J4EA 2Y59A 1BULA 3T1SA 3O5YA 2H5SA 4X25A 2XQZA 4LV0A 1DP8A 1TEMA 1NZOA 1E4DA 2OAP1 4PAUA 4MBFA 3OC2A 4R3BA 4E6WA 5HWWA 2ZMFA 4U0XA 5CGWA 4YOFA 2RCXA 5LBRA 5CTNA 1NZUA 1ZC2A 2XROA 4NG2A 1GSWA 2VX8A 1FSWA 4CLCA 4DJ3A 3T4QA 3VOYA 1JTGA 4WF0A 4MCWA 3GRJA 4JXGA 3CI6A 1BLPA 3FPWA 3BRMA 4X55A 4BBVA 2Y2IA 5TFQA 1GA9A 1K55A 4WM9A 3MSHA 3CMZA 1G68A 1XJ6A 1L0EA 4UEYA 1XKZA 3BM6A 5EV0A 3PR6A 4UA9A 3VOLA 1P9RA 4GHIA 1KVLA 1U60A 5E2EA 1J3WA 1BYWA 4NKPA 3MFDA 3UO9A 2DMWA 3M6HA 4B9OA 3FC7A 3M6BA 5FDSA 5A92A 5GHXA 4OLGA 3EQVA 3PAGA 2V20A 1PRQA 5E43A 5HSQA 3G31A 1OPXA 1K6SA 5IU1A 1MWSA 2EXBA 3N6IA 1FCNA 1E25A 3H82A 4R3JA 4XT2B 3WS4A 1LSVA 3VSKA 4PM9A 1T1CA 2HV1A 4FSFA 3G4PA 1TVFA 1PIOA 2Y2NA 4JGRA 3NCKA 3IF6A 3PBTA 2GJ3A 4KUKA 3C38A 1GHIA 3UB6A 5EM1A 3ZG9B 3EEHA 4BENA 4R0QA 2Y2QA 1FIKA 5HD5A 1ESIA 3W2ZA 2VGLM 3NDEA 1F5MA 1LI0A 2IA2A 2LB9A 1XX2A 3TJZC 1RP5A 4KQQA 4UA7A 1S67L 2VZWA 4B4XA 3C8CA 4QY6A 4ARZB 4OQHA 2Z6CA 4FUWA 2PRFA 4GOGA 3O87A 4DN0A 5CGXA 1PWDA 3FWLA 4JGQA 4C3QA 3ZG5A 3K3DA 2QYBA 4RVAA 3BYDA 2OWJA 4EEUA 3S4XA 1KDWA 1YMSA 3CUEA 3TE8A 3MS6A 5F83A 5HL6A 5EOEA 3LY4A 4Y17A 5F69A 2PBDP 3UNWA 4MN5A 3MR0A 4OH0A 1S66L 4D60A 2QHKA 3NHQA 4X1MA 2ZM0A 3EEAA 1XPBA 2IWBA 3LGOA 1YLPA 4P6ZS 1NWZA 1ACFA 4HIAA 5FEGA 3F1OA 2W3EA 3C7VA 4X68A 1E3UA 4EEPA 1W63Q 3VE3A 3M2JA 3BFEA 1IKIA 3E4QA 3QNCA 4GN2A 1FILA 3UE1A 3BFCA 3LEQA 4BMWA 1H8MA 3D72A 4KQDA 4JGOA 2I9VA 3ZYTA 2BLSA 2INWA 3NJAA 4OQ0A 5HL1A 4DE2A 4R23A 3Q7ZA 5F5YA 3DTKA 1S4SA 4JBFA 4WEJA 5CGSA 4N1XA 1ONGA 1F98A 1UGUA 2VV7A 3N8SA 1IEMA 1XA1A 4LPZA 3LCEA 3A3JA 3OCNA 4H6JB 4R6LA 3C5AA 4F94A 2JKFA 5HWTA 1CEFA 5FL3A 1JWVA 3KO6A 3LFVA 5DTKA 2PYPA 3CHWP 3LIEA 4KZ4A 3HBRA 1F2KA 4S2JA 4UAAA 5E2FA 4IBRA 2ZL1B 4H6JA 4B93A 3PAEA 4GCZA 2ACGA 2OLVA 2ZC6B 1XFNA 5CX7A 4HESA 2XA7S 3CAXA 3EQUA 3E0YA 3MZDA 4X53A 1QMEA 3UPPA 1MPLA 2PD8A 4YFMA 5EUAA 4KQOA 1LSXA 2XF3A 1BZAA 4L0LA 1GHMA 1O07A 5G4ZA 1W5DA 3IWQA 2NUTC 5HD3A 4LV3A 3S22A 2WZZA 2PDRA 4CJNA 4JKTA 2FH5A 5HAPA 1KDSA 2FFFB 4KZ6A 2W0NA 1EW0A 2QKPA 5EVEA 4G3VA 1ODVA 3LYXA 4EXOA 4EWFA 3F1PA 2EFUA 2VGJA 1ESUA 3SH7A 1XXMA 5L10A 2OOLA 1K54A 1VETB 5I94A 3U2AA 5I5LA 4DE1A 2OAQ1 1O7EA 3ICYA 3TOIA 3HLWA 2QJ5A 4ME4A 3LICA 4GJ4A 1SKOA 3DWZA 5EVIA 4ESPA 1LL5A 5IT5A 1K56A 1VETA 2WADA 5FQMA 3M2KA 1D1JA 5JYOA 1OTDA 4IHQA 5GLCA 4BBUA 1DJAA 3IXHA 3OPRA 4HBUA 4R38A 3DW0A 3I7JA 1PW1A 5EE8A 1ES2A 3T50A 5HX9A 4H8RA 1BSGA 3IS2B 3BY8A 3MFXA 4Y0TA 5HPIA 5FAQA 2W3HA 3R7WB 4HHDA 4Q0IA 1TS6A 4I3IA 4M4XA 5CEDA 3HVFA 1S6RA 4C6YA 1CK3A 3VE4A 1KVMA 2JC7A 4ZTKA 4HH3A 5U47A 4KG5A 2ZQAA 1MXOA 1K25A 4EBNA 4DDYA 1RCJA 1IYSA 2G2UA 3IBJA 5HW3A 4HH2A 1P9WA 1XJ4A 3SS4A 1YPRA 4DKIA 1VHMA 1XFQA 2R78A 4NXFA 4ZAMA 1KE0A 3Q1FA 2P7JA 3G6OA 3Q07A 3D4FA 3HLCA 4LGWA 1KE3A 1BTLA 3N7WA 1V9ZA 4NEED 3ISGA 1EROA 4WMCA 3BQAA 2DRWA 4N9KA 1DY6A 3MZFA 4I3JA 5GLAA 2B95A 1GSVA 2HP5A 1KGGA 4A5RA 3BLMA 3GVBA 5CRFA 3LEZA 1I2SA 3NBLA 4BBTA 5J8XA 2WKIA 1MBLA 2W3DA 2V0UA 3LI8A 3GR2A 3ZFZA 3BWLA 4WBGA 5E2HA 1WA9A 3VFHA 2C6WB 1ES5A 3AGFA 3BFGA 2V1AA 2V0WA 4Y3IA 3PXPA 5KZHA 1TDLA 1ES4A 2WAFA 3TG9A 3TRCA 5DJTA 3UB5P 3E4PA 3K2NA 3KYQA 4LCLA 1H8ZA 5EFWA 1ERQA 4MEZA 5GLDA 3Q82A 1NLYA 2QZ6A 4O7DA 4EV4A 2ZC4B 4MBHA 5A93A 3MXSA 3EGDC 4HP9A 1NLZA 4WL9A 5D3OA 1SDEA 1HTZA 4WELA 4CLCB 1MWTA 4KZ8A 1WYBA 3G2YA 2PU4A 3KSIA 3OPPA 2FZ0A 2WGVA 2WGIA 3GDIA 1OTEA 1CI9A 3SOIA 1STZA 2XEPA 4X6TA 5AVFA 1X0OA 3RFBA 2GDNA 2JKRI 3WRTA 3UB8A 1JNUA 1RGZA 4PM8A 1NYYA 3QP8A 1G5UA 1W8YA 2JKRM 3OCLA 4E3IA 1ZHHB 1SHVA 2V2FF 4EBLA 1SDNA 1PFLA 4WZ4A 2ZM2A 1A0KA 5FATA 3HCYA 4GHIB 5HDCA 3G35A 4GDNA 5AQ9A 1ONHA 3ZG0A 2ZMAA 4GS9A 1OTBA 2YKFA 4E3NA 4OVDA 4DE0A 1K57A 1LT0A 3UY6A 3WS1A 4GNUA 2Y2GA 5CHJA 3HLFA 4ZRRA 2Q0OA 1ALQA 1GHPA 4I39A 3DAVA 4KZ7A 3VMAA 3V50A 3RTYA 1Q2PA 3H82B 3ZNYA 4JLFA 5GHZA 4HBTA 3UE6A 3C4OA 1CQAA 2JE5A 1BUEA 1N4OA 3ZVWA 3IXBA 1L2SA 1H3QA 3IF6B 5G4YA 5F82A 1LL9A 2X71A 2WKQA 3F1NA 1VEUA 3EGXC 4GW9A 1XJ2A 4HOIA 1NXYA 4UHUA 5GL9A 2HJEA 5J7EA 2B18A 2CMNA 2WGWA 3V67A 2HDQA 1Y28A 4I38A 2VEAA 4EU0A 1IOUA 2Z6DA 2PR5A 3OBFA 1CEGA 4JXVA 2H0YA 3FG8A 1PWGA 3NOUC 4MMNA 4KZ5A 4WYYA 4PM6A 3ZGAB 3N4IA 2H0TA 3ZNTA 4R1GA 5GHYA 4E04A 2QPNA 1MY8A 4O01A 3OOVA 1MKMA 2E8IA 3FZCA 3MXQA 2KOIA 2PYRA 1AXBA 1DJBA 2EX2A 1MWUA 2W1TB 1IFQA 3JVVA 4FH4A 3UMDA 1RGYA 4HJ4A 5MC7A 1H5XA 3V5MA 1D7EA 3E98A 2XK1A 1ZKJA 2A24A 4Q8IA 4QHCA 1IKGA 5C5KA 2CC1A 3MQOA 4YINA 4PKYA 5FQJA 4XUXA 4KG2A 2W1TA 3F1OB 5E2GA 1TS8A 1DP6A 4WN5A 5HDSA 1LHYA 2X01A 3T4SA 1TF1A 3T4OA 4QB8A 2Y2KA 2PBYA 3MKEA 4DXBA 4ZDXA 1K6RA 1PZOA 2MJ6A 3HL9A 4WUJA 2G2WA 3LUQA 3W4PA 3IXDA 4WLAA 3OPHA 4QD4A 2UWXA 3VFFA 2C5WB 2Y55A 4KENB 3HUMA 4E3KA 1YLZA 3A0RA 3FKVA 1W79A 3MKFA 4QU3A 2G7UA 1I5QA 3VP3A 4U0TA 3S7PA 5FI6A 5M18A 2P74A 2DNSA 1QMFA 4S2LA 4UQIM 3MQ0A 2O99A 4E3MA 4LCMA 4OOMA 4OOLA 4S2NC 1K4EA 3LR0A 4BL2A 2P04A 4Z1WA 3UPNA 2ZM8A 4Y13A 1GCEA 4YNRA 3FPVA 4GD6A 2OSUA 1NRFA 3SH8A 5CEBA 5L8MA 2VA0A 2JCHA 4CLCE 3AGDA 2PR6A 1OJGA 3CPTA 1T1BA 4MLLA 2Y2HA 3VOZA 5L2FA 4EQIA 2O9AA
chains in the Genus database with same CATH topology
4Y0TA 2XQZA 3QHYA 4LV0A 5FAQA 1NY0A 3OZHA 4OLDA 4P6BA 1YMXA 2J7VA 5DVAA 4E6XA 4PM5A 4IEDA 4KZ8A 1JWZA 1TEMA 1EWZA 4DXCA 5CEDA 3HVFA 1S6RA 2B5RA 1WYCA 4C6YA 4Y7PA 4XXRA 1CK3A 1NZOA 1E4DA 1NYMA 3WRZA 4MBFA 1KVMA 2JC7A 3OC2A 4ZTKA 2X02A 4R3BA 4E6WA 4RX2A 5U47A 4KG5A 4OP5A 1BLCA 2XFSA 1MXOA 1K25A 2ZQAA 4EBNA 2WUQA 4S2IA 4DDYA 2H10A 1RCJA 2ZQ7A 1IYSA 1LLBA 2EX6A 4U0XA 5EPHA 5GLBA 2G2UA 4P87A 5CGWA 4LV2A 1WE4A 5HW3A 2RCXA 4RA7A 3NI9A 3RJUA 5CTNA 3O86A 1NZUA 2JBFA 2EX9A 3SS4A 1ZC2A 3WS2A 3UPOA 4DKIA 1KGEA 1FSWA 4ZAMA 1KE0A 2ZJ9A 3VOYA 3VP1A 1JTGA 1K54C 3Q1FA 4OKPA 5AQAA 4S2OA 3GRJA 3Q07A 5KSCA 4JXGA 5FA7A 1BLPA 5G18A 5HAQA 2WZXA 2XD5A 3BRMA 3D4FA 3HLCA 1KE3A 1BTLA 4X55A 3GTCA 1MWRA 3N7WA 4N92A 4OQIA 2Y2IA 5TFQA 1GA9A 1K55A 3ISGA 1EROA 5EVIC 2HDSA 4WMCA 4WM9A 2DRWA 5JYPA 3CMZA 1G68A 1L0EA 4N9KA 4ZBEA 4OPZA 2Z2MB 1XKZA 3BM6A 1DY6A 3MZFA 3W8KA 4UA9A 1FR1A 5GLAA 3IWIA 2RL3A 3A3EA 2HP5A 5EVIB 4FCFA 1KVLA 1U60A 5E2EA 2XLNA 1E3UD 1BLHA 1KGGA 4A5RA 3BLMA 3GVBA 5CRFA 2EFXA 3VP4A 3LEZA 3MFDA 3RXWA 3UO9A 4BLMA 5F1FA 1I2SA 3NBLA 5J8XA 2WAEA 2PU2A 3AGEA 3C4PA 3M6HA 3GMWA 3PBRA 4JXSA 3UDFA 4CPKA 3IHBA 2WKIA 2ZQ9A 3M6BA 1MBLA 4X69A 5A92A 1YLWA 3N8RA 4U3TA 5GHXA 4OLGA 4DF6A 1JVJA 5HARA 3EQVA 3PAGA 1HVBA 3GR2A 1IYOA 5DTSA 1H8YA 1ZG6A 2V20A 3A3IA 3NDGA 5IHVA 5E43A 2R9XA 3G31A 5CTMA 3ZFZA 3C7UA 1K6SA 3W4OA 1MWSA 2EXBA 1XP4A 3N6IA 4WBGA 5E2HA 4WEKA 1FCNA 2V1ZA 4FH2A 3IWOA 4KG6A 3VFHA 2C6WB 1E25A 1ES5A 3AGFA 5DF7A 2FFYA 2XFTA 3BFGA 4R3JA 2HDUA 1XGIA 1SKFA 1N9BA 1ERMA 2HDRA 2ZQDA 5FAPA 3WS4A 3VSKA 3BECA 5KZHA 2XH9A 4PM9A 1TDLA 4Y0OA 1ES4A 2WAFA 3TG9A 4FSFA 1VM1A 3G4PA 5DTTA 1TVFA 1PIOA 2Y2NA 3LY3A 4NK3A 3MZEA 3DWKA 3PBSA 4LCLA 1H8ZA 3NCKA 3IF6A 3N8LA 3PBTA 4DDSA 1ERQA 4MEZA 3E2KA 1PW8A 5KMWA 4HEFA 4IVKA 5GLDA 3Q82A 4E3LA 1GHIA 2QZ6A 3G30A 1L0DA 3NC8A 4O7DA 4EV4A 3ZG9B 2ZC4B 4MBHA 4BENA 4R0QA 3PBQA 2Y2QA 5A93A 4OPRA 4R4RA 1ESIA 2Y2LA 3MXSA 3NDEA 3Q81A 2A3UA 2WK0A 5D3OA 1KE4A 1CI8A 5CERA 1C3BA 1LI0A 3VSLA 1SDEA 2BG1A 2OLUA 4C75A 1OMEA 1HTZA 1XX2A 2Y2MA 4WELA 1PWCA 4P85A 1MWTA 1PI4A 1WYBA 1MKIA 1RP5A 3G2YA 2PU4A 3CG5A 1K55C 3OPPA 4KQQA 4UA7A 2WGVA 2WGIA 4B4XA 4PPRA 4QY6A 1CI9A 4OQHA 5F1GA 3SOIA 4X6TA 2XEPA 4GOGA 5AQ7A 1VQQA 3O87A 2GDNA 4KZAA 3WRTA 4KZ9A 5CGXA 1LI9A 5HAIA 1PWDA 4KQRA 2QMIA 3FWLA 4PMAA 4NETA 3FYZA 4C3QA 1RGZA 4PM8A 3ZG5A 1NYYA 1W8YA 3OCLA 4GD8A 4E3IA 3G2ZA 3PBNA 1SHVA 4RVAA 2V2FF 4B4ZA 4EBLA 1EI5A 2EXAA 3BYDA 1SDNA 1YLYA 3S4XA 5FAOA 4WZ4A 1KDWA 2ZM2A 1YMSA 3IH9A 1YQSA 2R9WA 4R4SA 5FATA 5F83A 5EOEA 3LY4A 3UNWA 3G35A 4LV1A 2ZC3B 4Y0UA 3Q7VA 4K0XA 4GDNA 5AQ9A 1ONHA 3UDXA 2ZMAA 3ZG0A 4OH0A 4E3NA 4JF4A 4OVDA 3ZDJA 4DE0A 2A49A 1K57A 3B3XA 4N1HA 3LO7A 3E2LA 2ZM0A 3V3RA 3IH8A 3UY6A 3WS1A 4GNUA 4JF6A 4RX3A 2Y2GA 1XPBA 2IWBA 4RYEA 5CHJA 2ZC7A 3FKWA 3HLFA 1YLPA 3HUOA 1ALQA 1YLTA 1GHPA 3P98A 4ZJ3A 5TR7A 2P9VA 2Y2OA 3IF5A 3HUNA 4KZ7A 3VMAA 1I2WA 3C7VA 2ZLYA 5CHMA 3V50A 1Q2PA 4X68A 1E3UA 1Q2QA 3PBOA 4WZ5C 3ZNYA 4JPMA 4JLFA 4DE3A 3OPLA 3ZVTA 2ZC5B 4X56A 5GHZA 3M2JA 3MXRA 4MBKA 3PTEA 4IBXA 1ZG4A 1IKIA 3BFEA 3C4OA 4HBTA 2WKEA 3QNCA 4GN2A 2JE5A 3UE3A 1BUEA 1N4OA 3UE1A 2ZQCA 3ZVWA 3BFCA 4BL3A 3IXBA 4OP8A 1L2SA 3MBZA 3IF6B 4D2OA 1GA0A 2EX8A 3IHAA 5F82A 2DCFA 3G34A 3UDIA 1LL9A 1YLJA 2X71A 1M6KA 3JYIA 1PI5A 3V39A 1YT4A 1NXYA 2BLSA 4OQ0A 4UHUA 1S0WA 5GL9A 2J9PA 4DE2A 5HL1A 2WGWA 5FQ9A 4R23A 3Q7ZA 5EVID 1PZPA 1K56D 4BQMA 3W4QA 2HDQA 1FCOA 1JWPA 4JBFA 4WEJA 4ZJ1A 2XD1A 4ID4A 4N1XA 1ONGA 5CGSA 4BD0A 4EUZA 1FR6A 1ES3A 3N8SA 5A91A 1CEGA 1IEMA 4JXVA 2H0YA 5BOHA 3IQAA 1PWGA 3VP0A 4P0MA 1YM1A 1XA1A 2XGNA 5FDHA 4KZ5A 4WYYA 3LCEA 4PM6A 3A3JA 3ZGAB 3WWXA 4EBPA 3OCNA 2HP9A 5FI2A 4E3OA 3N4IA 1BLSA 1FOFA 2H0TA 3ZNTA 4R1GA 5GHYA 3GV9A 3C5AA 3ITAA 2QPNA 5M1AA 4S2NA 1K4FA 4F94A 1L0GA 3BLSA 1MY8A 3CZDA 1BT5A 1CEFA 1JWVA 3FV7A 4PM7A 2E8IA 3FZCA 5DTKA 1K57C 4KZ3A 1HD8A 1AXBA 3IT9A 4JF5A 3BFFA 1TDGA 4KZ4A 1DJBA 3HBRA 4OONA 5CXWA 1DJCA 3HLGA 3ZG7B 4S2JA 4E3JA 4K0WA 4UAAA 2EX2A 1MWUA 5DF9A 5EECA 5E2FA 4FH4A 4IBRA 2ZD8A 3V3SA 3Q7VB 1RGYA 3ZCZA 5HFOA 1H5XA 3V5MA 3TSGA 2ZQ8A 1IELA 3PAEA 2VGKA 3O3VA 1XGJA 2XK1A 1ZKJA 4Q8IA 4QHCA 1IKGA 4Z9QA 4JXWA 2CC1A 2OLVA 3SS5A 4YINA 5FQJA 2ZC6B 3HLBA 2Y2JA 3HREA 3WS0A 1FCMA 4XUXA 4HESA 4KG2A 2P9VB 3EQUA 3UE0A 1G6AA 3MZDA 4X53A 1QMEA 4B88A 5E2GA 5EOOA 1HZOA 2Z2LB 1MPLA 4OQGA 3BEBA 5CHUA 3UPPA 4YFMA 3HLDA 5EUAA 4BJPA 4KQOA 4FD8A 1JTDA 4OPYA 2J9OA 2XF3A 1BZAA 4L0LA 1LHYA 5A90A 2X01A 1GHMA 4ZJ2A 1O07A 5FQIA 2XDMA 4QB8A 1W5DA 2PBYA 2Y2KA 1SCWA 3IWQA 3MKEA 4LV3A 4DXBA 4S2KA 1NJ4A 1Y54A 1W8QA 3S22A 4ZDXA 2WZZA 4CJNA 1K6RA 1PZOA 3QNBA 3HL9A 4JKTA 2G2WA 3W4PA 5HAPA 1KDSA 4WMCD 3IXDA 2FFFB 3OPHA 4QJGA 4KZ6A 2UWXA 4QD4A 3VFFA 5CECA 2IWCA 2C5WB 2I72A 3IF6C 2Y55A 1J9MA 4QY5A 4KENB 5DF8A 5M19A 3O88A 3HUMA 2Y91A 1YLZA 4E3KA 3RXXA 4EWFA 3FKVA 1W79A 3MKFA 2Y2PA 4DRTA 4QU3A 4IVIA 2WGWB 4GDBA 3ZHHA 2VGJA 2EFUA 1I5QA 4M3KA 2Q9MA 3VP3A 3SH9A 1ESUA 4U0TA 4K91A 2OV5A 2Y4AA 3GQZA 5FI6A 5M18A 2P74A 3DTMA 1XXMA 2DNSA 3IXGA 4MNRA 3SH7A 4N9LA 3NIAA 1QMFA 5FSRA 4S2LA 1K54A 5AQBA 5I94A 4KZBA 3S1YA 4OPQA 4LENA 3SS3A 4DE1A 4E3MA 3A3DA 4LCMA 4OOMA 1O7EA 4OOLA 2WKHA 3BFDA 4S2NC 1Z6FA 4XUZA 1K4EA 5EVLA 2HPBA 3WS5A 4S2MA 1XA7A 4BL2A 1IYQA 3TOIA 3HLWA 3GSGA 1M40A 1L0FA 2XR0A 3UPNA 2ZM8A 1GCEA 2WYXA 4UA6A 3DWZA 2HP6A 5EVIA 1LL5A 2J8YA 4GKUA 3P09A 5TGFA 5FI7A 1KGFA 1K56A 1FQGA 1W7FA 3NY4A 3VP2A 5KSHA 4GD6A 5FASA 2OSUA 1NRFA 2WADA 3M2KA 5FQMA 5JYOA 3G32A 3SH8A 4GZBA 4GB7A 5CEBA 3A3FA 5GLCA 2IWDA 1K38A 3ITBA 1DJAA 5FQQA 1PYYA 5FQKA 2JCHA 3AGDA 1IYPA 3ZG8B 2Q9NA 3IXHA 4OOYA 1FSYA 3HLEA 4WZ5A 3OPRA 4HBUA 4MLLA 2Y2HA 3DW0A 1PW1A 3I7JA 1ES2A 5EE8A 3VOZA 5HX9A 2Y59A 1BULA 3UN7A 5L2FA 4H8RA 4EQIA 1BSGA 4S2PA 4BD1A 3CJMA 2H5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y0T A;  2XQZ A;  3QHY A;  4LV0 A;  5FAQ A;  1NY0 A;  3OZH A;  4OLD A;  4P6B A;  1YMX A;  2J7V A;  5DVA A;  4E6X A;  4PM5 A;  4IED A;  4KZ8 A;  1JWZ A;  1TEM A;  1EWZ A;  4DXC A;  5CED A;  3HVF A;  1S6R A;  2B5R A;  1WYC A;  4C6Y A;  4Y7P A;  4XXR A;  1CK3 A;  1NZO A;  1E4D A;  1NYM A;  3WRZ A;  4MBF A;  1KVM A;  2JC7 A;  3OC2 A;  4ZTK A;  2X02 A;  4R3B A;  4E6W A;  4RX2 A;  5U47 A;  4KG5 A;  4OP5 A;  1BLC A;  2XFS A;  1MXO A;  1K25 A;  2ZQA A;  4EBN A;  2WUQ A;  4S2I A;  4DDY A;  2H10 A;  1RCJ A;  2ZQ7 A;  1IYS A;  1LLB A;  2EX6 A;  4U0X A;  5EPH A;  5GLB A;  2G2U A;  4P87 A;  5CGW A;  4LV2 A;  1WE4 A;  5HW3 A;  2RCX A;  4RA7 A;  3NI9 A;  3RJU A;  5CTN A;  3O86 A;  1NZU A;  2JBF A;  2EX9 A;  3SS4 A;  1ZC2 A;  3WS2 A;  3UPO A;  4DKI A;  1KGE A;  1FSW A;  4ZAM A;  1KE0 A;  2ZJ9 A;  3VOY A;  3VP1 A;  1JTG A;  1K54 C;  3Q1F A;  4OKP A;  5AQA A;  4S2O A;  3GRJ A;  3Q07 A;  5KSC A;  4JXG A;  5FA7 A;  1BLP A;  5G18 A;  5HAQ A;  2WZX A;  2XD5 A;  3BRM A;  3D4F A;  3HLC A;  1KE3 A;  1BTL A;  4X55 A;  3GTC A;  1MWR A;  3N7W A;  4N92 A;  4OQI A;  2Y2I A;  5TFQ A;  1GA9 A;  1K55 A;  3ISG A;  1ERO A;  5EVI C;  2HDS A;  4WMC A;  4WM9 A;  2DRW A;  5JYP A;  3CMZ A;  1G68 A;  1L0E A;  4N9K A;  4ZBE A;  4OPZ A;  2Z2M B;  1XKZ A;  3BM6 A;  1DY6 A;  3MZF A;  3W8K A;  4UA9 A;  1FR1 A;  5GLA A;  3IWI A;  2RL3 A;  3A3E A;  2HP5 A;  5EVI B;  4FCF A;  1KVL A;  1U60 A;  5E2E A;  2XLN A;  1E3U D;  1BLH A;  1KGG A;  4A5R A;  3BLM A;  3GVB A;  5CRF A;  2EFX A;  3VP4 A;  3LEZ A;  3MFD A;  3RXW A;  3UO9 A;  4BLM A;  5F1F A;  1I2S A;  3NBL A;  5J8X A;  2WAE A;  2PU2 A;  3AGE A;  3C4P A;  3M6H A;  3GMW A;  3PBR A;  4JXS A;  3UDF A;  4CPK A;  3IHB A;  2WKI A;  2ZQ9 A;  3M6B A;  1MBL A;  4X69 A;  5A92 A;  1YLW A;  3N8R A;  4U3T A;  5GHX A;  4OLG A;  4DF6 A;  1JVJ A;  5HAR A;  3EQV A;  3PAG A;  1HVB A;  3GR2 A;  1IYO A;  5DTS A;  1H8Y A;  1ZG6 A;  2V20 A;  3A3I A;  3NDG A;  5IHV A;  5E43 A;  2R9X A;  3G31 A;  5CTM A;  3ZFZ A;  3C7U A;  1K6S A;  3W4O A;  1MWS A;  2EXB A;  1XP4 A;  3N6I A;  4WBG A;  5E2H A;  4WEK A;  1FCN A;  2V1Z A;  4FH2 A;  3IWO A;  4KG6 A;  3VFH A;  2C6W B;  1E25 A;  1ES5 A;  3AGF A;  5DF7 A;  2FFY A;  2XFT A;  3BFG A;  4R3J A;  2HDU A;  1XGI A;  1SKF A;  1N9B A;  1ERM A;  2HDR A;  2ZQD A;  5FAP A;  3WS4 A;  3VSK A;  3BEC A;  5KZH A;  2XH9 A;  4PM9 A;  1TDL A;  4Y0O A;  1ES4 A;  2WAF A;  3TG9 A;  4FSF A;  1VM1 A;  3G4P A;  5DTT A;  1TVF A;  1PIO A;  2Y2N A;  3LY3 A;  4NK3 A;  3MZE A;  3DWK A;  3PBS A;  4LCL A;  1H8Z A;  3NCK A;  3IF6 A;  3N8L A;  3PBT A;  4DDS A;  1ERQ A;  4MEZ A;  3E2K A;  1PW8 A;  5KMW A;  4HEF A;  4IVK A;  5GLD A;  3Q82 A;  4E3L A;  1GHI A;  2QZ6 A;  3G30 A;  1L0D A;  3NC8 A;  4O7D A;  4EV4 A;  3ZG9 B;  2ZC4 B;  4MBH A;  4BEN A;  4R0Q A;  3PBQ A;  2Y2Q A;  5A93 A;  4OPR A;  4R4R A;  1ESI A;  2Y2L A;  3MXS A;  3NDE A;  3Q81 A;  2A3U A;  2WK0 A;  5D3O A;  1KE4 A;  1CI8 A;  5CER A;  1C3B A;  1LI0 A;  3VSL A;  1SDE A;  2BG1 A;  2OLU A;  4C75 A;  1OME A;  1HTZ A;  1XX2 A;  2Y2M A;  4WEL A;  1PWC A;  4P85 A;  1MWT A;  1PI4 A;  1WYB A;  1MKI A;  1RP5 A;  3G2Y A;  2PU4 A;  3CG5 A;  1K55 C;  3OPP A;  4KQQ A;  4UA7 A;  2WGV A;  2WGI A;  4B4X A;  4PPR A;  4QY6 A;  1CI9 A;  4OQH A;  5F1G A;  3SOI A;  4X6T A;  2XEP A;  4GOG A;  5AQ7 A;  1VQQ A;  3O87 A;  2GDN A;  4KZA A;  3WRT A;  4KZ9 A;  5CGX A;  1LI9 A;  5HAI A;  1PWD A;  4KQR A;  2QMI A;  3FWL A;  4PMA A;  4NET A;  3FYZ A;  4C3Q A;  1RGZ A;  4PM8 A;  3ZG5 A;  1NYY A;  1W8Y A;  3OCL A;  4GD8 A;  4E3I A;  3G2Z A;  3PBN A;  1SHV A;  4RVA A;  2V2F F;  4B4Z A;  4EBL A;  1EI5 A;  2EXA A;  3BYD A;  1SDN A;  1YLY A;  3S4X A;  5FAO A;  4WZ4 A;  1KDW A;  2ZM2 A;  1YMS A;  3IH9 A;  1YQS A;  2R9W A;  4R4S A;  5FAT A;  5F83 A;  5EOE A;  3LY4 A;  3UNW A;  3G35 A;  4LV1 A;  2ZC3 B;  4Y0U A;  3Q7V A;  4K0X A;  4GDN A;  5AQ9 A;  1ONH A;  3UDX A;  2ZMA A;  3ZG0 A;  4OH0 A;  4E3N A;  4JF4 A;  4OVD A;  3ZDJ A;  4DE0 A;  2A49 A;  1K57 A;  3B3X A;  4N1H A;  3LO7 A;  3E2L A;  2ZM0 A;  3V3R A;  3IH8 A;  3UY6 A;  3WS1 A;  4GNU A;  4JF6 A;  4RX3 A;  2Y2G A;  1XPB A;  2IWB A;  4RYE A;  5CHJ A;  2ZC7 A;  3FKW A;  3HLF A;  1YLP A;  3HUO A;  1ALQ A;  1YLT A;  1GHP A;  3P98 A;  4ZJ3 A;  5TR7 A;  2P9V A;  2Y2O A;  3IF5 A;  3HUN A;  4KZ7 A;  3VMA A;  1I2W A;  3C7V A;  2ZLY A;  5CHM A;  3V50 A;  1Q2P A;  4X68 A;  1E3U A;  1Q2Q A;  3PBO A;  4WZ5 C;  3ZNY A;  4JPM A;  4JLF A;  4DE3 A;  3OPL A;  3ZVT A;  2ZC5 B;  4X56 A;  5GHZ A;  3M2J A;  3MXR A;  4MBK A;  3PTE A;  4IBX A;  1ZG4 A;  1IKI A;  3BFE A;  3C4O A;  4HBT A;  2WKE A;  3QNC A;  4GN2 A;  2JE5 A;  3UE3 A;  1BUE A;  1N4O A;  3UE1 A;  2ZQC A;  3ZVW A;  3BFC A;  4BL3 A;  3IXB A;  4OP8 A;  1L2S A;  3MBZ A;  3IF6 B;  4D2O A;  1GA0 A;  2EX8 A;  3IHA A;  5F82 A;  2DCF A;  3G34 A;  3UDI A;  1LL9 A;  1YLJ A;  2X71 A;  1M6K A;  3JYI A;  1PI5 A;  3V39 A;  1YT4 A;  1NXY A;  2BLS A;  4OQ0 A;  4UHU A;  1S0W A;  5GL9 A;  2J9P A;  4DE2 A;  5HL1 A;  2WGW A;  5FQ9 A;  4R23 A;  3Q7Z A;  5EVI D;  1PZP A;  1K56 D;  4BQM A;  3W4Q A;  2HDQ A;  1FCO A;  1JWP A;  4JBF A;  4WEJ A;  4ZJ1 A;  2XD1 A;  4ID4 A;  4N1X A;  1ONG A;  5CGS A;  4BD0 A;  4EUZ A;  1FR6 A;  1ES3 A;  3N8S A;  5A91 A;  1CEG A;  1IEM A;  4JXV A;  2H0Y A;  5BOH A;  3IQA A;  1PWG A;  3VP0 A;  4P0M A;  1YM1 A;  1XA1 A;  2XGN A;  5FDH A;  4KZ5 A;  4WYY A;  3LCE A;  4PM6 A;  3A3J A;  3ZGA B;  3WWX A;  4EBP A;  3OCN A;  2HP9 A;  5FI2 A;  4E3O A;  3N4I A;  1BLS A;  1FOF A;  2H0T A;  3ZNT A;  4R1G A;  5GHY A;  3GV9 A;  3C5A A;  3ITA A;  2QPN A;  5M1A A;  4S2N A;  1K4F A;  4F94 A;  1L0G A;  3BLS A;  1MY8 A;  3CZD A;  1BT5 A;  1CEF A;  1JWV A;  3FV7 A;  4PM7 A;  2E8I A;  3FZC A;  5DTK A;  1K57 C;  4KZ3 A;  1HD8 A;  1AXB A;  3IT9 A;  4JF5 A;  3BFF A;  1TDG A;  4KZ4 A;  1DJB A;  3HBR A;  4OON A;  5CXW A;  1DJC A;  3HLG A;  3ZG7 B;  4S2J A;  4E3J A;  4K0W A;  4UAA A;  2EX2 A;  1MWU A;  5DF9 A;  5EEC A;  5E2F A;  4FH4 A;  4IBR A;  2ZD8 A;  3V3S A;  3Q7V B;  1RGY A;  3ZCZ A;  5HFO A;  1H5X A;  3V5M A;  3TSG A;  2ZQ8 A;  1IEL A;  3PAE A;  2VGK A;  3O3V A;  1XGJ A;  2XK1 A;  1ZKJ A;  4Q8I A;  4QHC A;  1IKG A;  4Z9Q A;  4JXW A;  2CC1 A;  2OLV A;  3SS5 A;  4YIN A;  5FQJ A;  2ZC6 B;  3HLB A;  2Y2J A;  3HRE A;  3WS0 A;  1FCM A;  4XUX A;  4HES A;  4KG2 A;  2P9V B;  3EQU A;  3UE0 A;  1G6A A;  3MZD A;  4X53 A;  1QME A;  4B88 A;  5E2G A;  5EOO A;  1HZO A;  2Z2L B;  1MPL A;  4OQG A;  3BEB A;  5CHU A;  3UPP A;  4YFM A;  3HLD A;  5EUA A;  4BJP A;  4KQO A;  4FD8 A;  1JTD A;  4OPY A;  2J9O A;  2XF3 A;  1BZA A;  4L0L A;  1LHY A;  5A90 A;  2X01 A;  1GHM A;  4ZJ2 A;  1O07 A;  5FQI A;  2XDM A;  4QB8 A;  1W5D A;  2PBY A;  2Y2K A;  1SCW A;  3IWQ A;  3MKE A;  4LV3 A;  4DXB A;  4S2K A;  1NJ4 A;  1Y54 A;  1W8Q A;  3S22 A;  4ZDX A;  2WZZ A;  4CJN A;  1K6R A;  1PZO A;  3QNB A;  3HL9 A;  4JKT A;  2G2W A;  3W4P A;  5HAP A;  1KDS A;  4WMC D;  3IXD A;  2FFF B;  3OPH A;  4QJG A;  4KZ6 A;  2UWX A;  4QD4 A;  3VFF A;  5CEC A;  2IWC A;  2C5W B;  2I72 A;  3IF6 C;  2Y55 A;  1J9M A;  4QY5 A;  4KEN B;  5DF8 A;  5M19 A;  3O88 A;  3HUM A;  2Y91 A;  1YLZ A;  4E3K A;  3RXX A;  4EWF A;  3FKV A;  1W79 A;  3MKF A;  2Y2P A;  4DRT A;  4QU3 A;  4IVI A;  2WGW B;  4GDB A;  3ZHH A;  2VGJ A;  2EFU A;  1I5Q A;  4M3K A;  2Q9M A;  3VP3 A;  3SH9 A;  1ESU A;  4U0T A;  4K91 A;  2OV5 A;  2Y4A A;  3GQZ A;  5FI6 A;  5M18 A;  2P74 A;  3DTM A;  1XXM A;  2DNS A;  3IXG A;  4MNR A;  3SH7 A;  4N9L A;  3NIA A;  1QMF A;  5FSR A;  4S2L A;  1K54 A;  5AQB A;  5I94 A;  4KZB A;  3S1Y A;  4OPQ A;  4LEN A;  3SS3 A;  4DE1 A;  4E3M A;  3A3D A;  4LCM A;  4OOM A;  1O7E A;  4OOL A;  2WKH A;  3BFD A;  4S2N C;  1Z6F A;  4XUZ A;  1K4E A;  5EVL A;  2HPB A;  3WS5 A;  4S2M A;  1XA7 A;  4BL2 A;  1IYQ A;  3TOI A;  3HLW A;  3GSG A;  1M40 A;  1L0F A;  2XR0 A;  3UPN A;  2ZM8 A;  1GCE A;  2WYX A;  4UA6 A;  3DWZ A;  2HP6 A;  5EVI A;  1LL5 A;  2J8Y A;  4GKU A;  3P09 A;  5TGF A;  5FI7 A;  1KGF A;  1K56 A;  1FQG A;  1W7F A;  3NY4 A;  3VP2 A;  5KSH A;  4GD6 A;  5FAS A;  2OSU A;  1NRF A;  2WAD A;  3M2K A;  5FQM A;  5JYO A;  3G32 A;  3SH8 A;  4GZB A;  4GB7 A;  5CEB A;  3A3F A;  5GLC A;  2IWD A;  1K38 A;  3ITB A;  1DJA A;  5FQQ A;  1PYY A;  5FQK A;  2JCH A;  3AGD A;  1IYP A;  3ZG8 B;  2Q9N A;  3IXH A;  4OOY A;  1FSY A;  3HLE A;  4WZ5 A;  3OPR A;  4HBU A;  4MLL A;  2Y2H A;  3DW0 A;  1PW1 A;  3I7J A;  1ES2 A;  5EE8 A;  3VOZ A;  5HX9 A;  2Y59 A;  1BUL A;  3UN7 A;  5L2F A;  4H8R A;  4EQI A;  1BSG A;  4S2P A;  4BD1 A;  3CJM A;  2H5S A; 
#chains in the Genus database with same CATH topology
 4NXE A;  1NY0 A;  3OZH A;  4DMZ A;  4OLD A;  3MF0 A;  4E6X A;  5DVA A;  4IED A;  2J3T C;  1JWZ A;  3QP4 A;  3K3C A;  1EWZ A;  2B5R A;  1NYM A;  3WRZ A;  4OP5 A;  1BLC A;  2BTF P;  2WUQ A;  4S2I A;  2H10 A;  5L09 A;  5EPH A;  4P87 A;  4LV2 A;  4RA7 A;  3NI9 A;  3RJU A;  3O86 A;  2EX9 A;  2OWH A;  3UPO A;  3VP1 A;  3LIB A;  4OKP A;  3F1P B;  2JKT I;  3T1X A;  4S2O A;  2WKP A;  5KSC A;  4HP4 A;  2WZX A;  1KOU A;  5DJU A;  3GTC A;  2JKT M;  4N92 A;  4OQI A;  2WKR A;  2J3W A;  3QP5 A;  3LI9 A;  1Z09 A;  4OPZ A;  4G3K A;  2Z2M B;  3W8K A;  4HJ3 A;  3T4L A;  3A3E A;  1SKO B;  3MJQ A;  5EVI B;  1T1A A;  4FCF A;  1BLH A;  4FTX A;  2EFX A;  2L0W A;  4EUV A;  4KUO A;  3UB9 A;  2WAE A;  3UDF A;  4JXS A;  4CPK A;  3PBR A;  3IHB A;  1S1Z A;  2ZQ9 A;  1YLW A;  3N8R A;  2V8C A;  4DF6 A;  5HAR A;  1HVB A;  1IYO A;  5DTS A;  5IHV A;  1ZG6 A;  3NDG A;  5L07 A;  4P6Z M;  3W4O A;  1XP4 A;  4WEK A;  4HNB A;  4FH2 A;  3IWO A;  4KG6 A;  5KIZ A;  5DF7 A;  2B02 A;  3L7H A;  5FAP A;  2HDU A;  2ZQD A;  1ERM A;  4R3A A;  4NXB A;  2BAS A;  1VM1 A;  1H0M A;  4NK3 A;  3MZE A;  2M1C A;  1F9I A;  5AVE A;  3G30 A;  3TW8 A;  4L9G A;  4CLC C;  4X1L A;  2UV0 E;  3GEC A;  2A3U A;  2WK0 A;  3NEC A;  1KE4 A;  1G6O A;  3LR5 A;  1TS0 A;  5CER A;  1C3B A;  4C75 A;  1OME A;  1T18 A;  1PWC A;  1PI4 A;  5KMW A;  1K55 C;  3UME A;  4RQ9 A;  4KZA A;  1LI9 A;  4MDZ A;  4KQR A;  3S7N A;  2QMI A;  4NET A;  2O0Y A;  4ETX A;  3NUL A;  3T1Q B;  3G2Z A;  4MN7 A;  4B4Z A;  3NOT C;  1EI5 A;  5FAO A;  2PHY A;  1YQS A;  2R9W A;  4R4S A;  3MQQ A;  4Y0U A;  3Q7V A;  3ZDJ A;  2A49 A;  3B3X A;  2J3T D;  3E2L A;  3V3R A;  3BQ8 A;  5AJG A;  2Y79 A;  4K08 A;  1YLT A;  5TR7 A;  2P9V A;  3IF5 A;  2XA7 M;  3HUN A;  2ZLY A;  5CHM A;  1Q2Q A;  3PBO A;  4WZ5 C;  4IUK A;  4DE3 A;  3OPL A;  2HJ9 C;  4X56 A;  4IBX A;  1ZG4 A;  3UE3 A;  2ZQC A;  4BL3 A;  4L9F A;  3MBZ A;  2L4R A;  1GA0 A;  3IHA A;  2DCF A;  3UDI A;  1YLJ A;  3HJI A;  1M6K A;  3JYI A;  1NRJ A;  4HQA A;  1YT4 A;  3BY9 A;  2VGL S;  1PZP A;  4CQH A;  4G3W A;  4BQM A;  1FCO A;  2H28 A;  3QP1 A;  4EUZ A;  3BW6 A;  1SZV A;  5A91 A;  2HGV A;  3DTI A;  3IX8 A;  4P0M A;  1YM1 A;  2VV8 A;  5FDH A;  3T12 B;  4EBP A;  2HP9 A;  5FI2 A;  1FOF A;  1W63 M;  3ITA A;  3T4K A;  3BLS A;  3CZD A;  3FV7 A;  2K31 A;  5HDD A;  2A2L A;  1HD8 A;  3IT9 A;  3KSH A;  3DTE A;  4JF5 A;  4OON A;  5CXW A;  1DJC A;  4FOF A;  5EEC A;  2ZD8 A;  4MN6 A;  1HLU P;  3ZCZ A;  5HFO A;  4GS9 B;  2ZQ8 A;  2D02 A;  3IX4 A;  4Z9Q A;  4JXW A;  3SS5 A;  1ZTU A;  3HLB A;  2Y2J A;  3HRE A;  2EWW A;  3A0S A;  1HZO A;  2Z2L B;  4CLC D;  1DRM A;  3BEB A;  3PHY A;  3HLD A;  1JTD A;  2J9O A;  2YKH A;  2M7V A;  5A90 A;  4ZJ2 A;  1MZU A;  1SCW A;  1NJ4 A;  1W8Q A;  1YAX A;  1OTI A;  2O9C A;  4UQI S;  3F1N B;  5CEC A;  1VEU B;  2IWC A;  2I72 A;  5M19 A;  1VB6 A;  1DP9 A;  3RXX A;  4IJG A;  2KX6 A;  4IVI A;  2WGW B;  4GDB A;  3ZHH A;  1TS7 A;  2Q9M A;  4QPR A;  3LIF A;  2OV5 A;  2W3G A;  4HY8 A;  3GQZ A;  2PT7 A;  2M7U A;  3IXG A;  3B47 A;  4N9L A;  2HF6 A;  5AQB A;  3S7O A;  4KZB A;  4LEN A;  3A3D A;  2WKH A;  3BFD A;  5EVL A;  1LL8 A;  3B33 A;  1XA7 A;  1AWI A;  1IYQ A;  3KX0 X;  3C30 A;  1L0F A;  2XR0 A;  2WYX A;  2JKG A;  2J8Y A;  4GKU A;  5TGF A;  1FQG A;  3VP2 A;  5KSH A;  5HZH A;  5FAS A;  4Q0H A;  2ZOI A;  4GZB A;  3A3F A;  2JHE A;  2IWD A;  1K38 A;  3U4L P;  5FQK A;  1CJF A;  3BJN A;  1IYP A;  3ZG8 B;  2E8J A;  2Q9N A;  4WZ5 A;  1FSY A;  3HLE A;  3C2W A;  4AFI A;  2A24 B;  3UN7 A;  3JPU A;  4S2P A;  4BD1 A;  3CJM A;  5EOO A;  4XT2 A;  2XSS A;  2PD7 A;  2D01 A;  3QHY A;  4P6B A;  1YMX A;  2J7V A;  4PM5 A;  4DXC A;  1D06 A;  2W27 A;  4LRZ E;  1WYC A;  4LRX C;  4Y7P A;  5HWV A;  4XXR A;  2X02 A;  2W3F A;  4RX2 A;  2XFS A;  1XJ3 A;  1N9N A;  2ZQ7 A;  1LLB A;  2EX6 A;  5GLB A;  2V1B A;  3QP2 A;  5F6A A;  1WE4 A;  2V9A A;  2JBF A;  3WS2 A;  4ETZ A;  1KGE A;  5HPF A;  2ZJ9 A;  2KLI A;  1K54 C;  5AQA A;  4ARZ A;  3T4J A;  5FA7 A;  5G18 A;  5HAQ A;  2XD5 A;  5K5B A;  1MWR A;  3JVU A;  1UWP X;  5EVI C;  2HDS A;  4L9E A;  5JYP A;  4ZBE A;  3SW1 A;  1FR1 A;  3IWI A;  2RL3 A;  3IBR A;  2XLN A;  1E3U D;  2LB5 A;  3VP4 A;  3RXW A;  4BLM A;  5EM0 A;  5F1F A;  4PKY G;  3LR4 A;  2VV6 A;  3RH8 B;  2PU2 A;  3AGE A;  3C4P A;  3GMW A;  3S7Q A;  4HI4 A;  4X69 A;  4U3T A;  1JVJ A;  2VLG A;  5J3W A;  1H8Y A;  2KDK A;  3A3I A;  2R9X A;  5CTM A;  3C7U A;  3CPT B;  4IUH A;  2V1Z A;  2HZ5 A;  2FFY A;  2XFT A;  1XGI A;  1SKF A;  1N9B A;  2HDR A;  3SZT A;  3BEC A;  4II7 A;  2XH9 A;  2XRN A;  4Y0O A;  4I3A A;  2GX5 A;  4JGP A;  5DTT A;  3LY3 A;  3DWK A;  3PBS A;  4F3L B;  3N8L A;  4DDS A;  1PNE A;  3E2K A;  1PW8 A;  4HEF A;  4IVK A;  4E3L A;  3NC8 A;  1L0D A;  4EER A;  3H7W B;  3PBQ A;  3T1R A;  1P97 A;  4OPR A;  1CF0 A;  4R4R A;  2Y2L A;  3Q81 A;  2VJW A;  2VK3 A;  5TBM B;  4EW7 A;  1CI8 A;  3P01 A;  3VSL A;  5TJJ A;  2BG1 A;  4F3L A;  1L3L A;  2OLU A;  2Y2M A;  4P85 A;  1MKI A;  3CG5 A;  2JN7 A;  4LFU A;  4PPR A;  5F1G A;  3H7W A;  5AQ7 A;  1VQQ A;  5FEF A;  5DFX A;  4KZ9 A;  5HAI A;  4PMA A;  5TBM A;  3FYZ A;  3ULF A;  1S4R A;  3EOI A;  4GD8 A;  4BWI A;  5DKK A;  3PBN A;  5DFY A;  2EXA A;  3IX3 A;  1YLY A;  3UB7 A;  4Y5F A;  3IH9 A;  1YSP A;  4LV1 A;  2ZC3 B;  3NOP C;  3PYP A;  2ZL1 A;  4K0X A;  3UDX A;  4JF4 A;  4LLO B;  1P0Z A;  4N1H A;  3LO7 A;  3IH8 A;  4JF6 A;  4RX3 A;  4RYE A;  2ZC7 A;  2V8F A;  3FKW A;  4Q0J A;  3R4K A;  3HUO A;  4ZJ3 A;  3P98 A;  4EQ1 A;  2Y2O A;  1T19 A;  2J80 A;  1I2W A;  1UWN X;  4EET B;  4JPM A;  3ZVT A;  2ZC5 B;  3MXR A;  4MBK A;  1OTA A;  3PTE A;  1YSQ A;  2WKE A;  2QWS A;  4R70 A;  5IS1 A;  2ZBB A;  3A0V A;  4OP8 A;  3KYZ A;  4D2O A;  2EWV A;  1S1Y A;  2EX8 A;  2Y8H A;  3G34 A;  2P08 A;  1PI5 A;  4DJ2 A;  3E4O A;  3V39 A;  2L1M A;  1S0W A;  2J9P A;  3EWK A;  5FQ9 A;  5EVI D;  1K56 D;  3W4Q A;  5DKL A;  1TD5 A;  1JWP A;  3ZQ5 A;  1V9Y A;  4ZJ1 A;  2XD1 A;  4ID4 A;  4BD0 A;  2NUP C;  1OT9 A;  1FR6 A;  1ES3 A;  5BOH A;  3IQA A;  3VP0 A;  2XGN A;  3LIA A;  4O8G A;  3OLO A;  5F68 A;  5A8B A;  3WWX A;  4E3O A;  1BLS A;  4YWZ A;  3GV9 A;  5M1A A;  4S2N A;  1K4F A;  1L0G A;  2O9B A;  3VV4 A;  3QP6 A;  1BT5 A;  4PM7 A;  3L9K A;  1LSW A;  2ZMV A;  4PHT A;  1K57 C;  4KZ3 A;  3CWF A;  2AVX A;  3B42 A;  3BFF A;  1TDG A;  4HJ6 A;  3HLG A;  3ZG7 B;  2PAV P;  4E3J A;  4K0W A;  5DF9 A;  3D9Y A;  1N9L A;  3V3S A;  3Q7V B;  4Y2F A;  3TSG A;  1IEL A;  2VGK A;  3O3V A;  1XGJ A;  1YKD A;  4LRY C;  3IS2 A;  3HJK A;  4O0P A;  3LR3 A;  3WS0 A;  1FCM A;  3R7W A;  1N9O A;  2P9V B;  1OT6 A;  3KSF A;  3UE0 A;  1G6A A;  4B88 A;  4OQG A;  5CHU A;  4BJP A;  4FD8 A;  4OPY A;  1GSX A;  2GZA A;  5FQI A;  2XDM A;  2EA9 A;  4S2K A;  1Y54 A;  3QNB A;  3CLO A;  1MC0 A;  3CIT A;  4WMC D;  3H9W A;  4QJG A;  3P7N A;  4NXG A;  2VKS A;  3IF6 C;  4QY5 A;  1J9M A;  5DF8 A;  3O88 A;  2QJ7 A;  2W1R A;  2Y91 A;  2Y2P A;  4DRT A;  4M3K A;  3SH9 A;  3D3O A;  4K91 A;  2Y4A A;  3DTM A;  4MNR A;  3NIA A;  5FSR A;  1K0K A;  3S1Y A;  4OPQ A;  2K7S A;  1OJ5 A;  3SS3 A;  1Z6F A;  2GNX A;  4XUZ A;  2HPB A;  3WS5 A;  4S2M A;  1Y4O A;  4Y15 A;  3GSG A;  1M40 A;  4I5S A;  3KSG A;  4UA6 A;  2HP6 A;  2ZOH A;  3P09 A;  5FI7 A;  1KGF A;  1W7F A;  3NY4 A;  3KYE A;  4QWO A;  4EES A;  3G32 A;  4GB7 A;  1G28 A;  3ITB A;  3T4T A;  5FQQ A;  1PYY A;  4GLQ A;  3LID A;  2K2N A;  4OOY A;  3CUE C;  3DBA A;  3MMH A;  5J4E A;  2Y59 A;  1BUL A;  3T1S A;  3O5Y A;  2H5S A;  4X25 A;  2XQZ A;  4LV0 A;  1DP8 A;  1TEM A;  1NZO A;  1E4D A;  2OAP 1;  4PAU A;  4MBF A;  3OC2 A;  4R3B A;  4E6W A;  5HWW A;  2ZMF A;  4U0X A;  5CGW A;  4YOF A;  2RCX A;  5LBR A;  5CTN A;  1NZU A;  1ZC2 A;  2XRO A;  4NG2 A;  1GSW A;  2VX8 A;  1FSW A;  4CLC A;  4DJ3 A;  3T4Q A;  3VOY A;  1JTG A;  4WF0 A;  4MCW A;  3GRJ A;  4JXG A;  3CI6 A;  1BLP A;  3FPW A;  3BRM A;  4X55 A;  4BBV A;  2Y2I A;  5TFQ A;  1GA9 A;  1K55 A;  4WM9 A;  3MSH A;  3CMZ A;  1G68 A;  1XJ6 A;  1L0E A;  4UEY A;  1XKZ A;  3BM6 A;  5EV0 A;  3PR6 A;  4UA9 A;  3VOL A;  1P9R A;  4GHI A;  1KVL A;  1U60 A;  5E2E A;  1J3W A;  1BYW A;  4NKP A;  3MFD A;  3UO9 A;  2DMW A;  3M6H A;  4B9O A;  3FC7 A;  3M6B A;  5FDS A;  5A92 A;  5GHX A;  4OLG A;  3EQV A;  3PAG A;  2V20 A;  1PRQ A;  5E43 A;  5HSQ A;  3G31 A;  1OPX A;  1K6S A;  5IU1 A;  1MWS A;  2EXB A;  3N6I A;  1FCN A;  1E25 A;  3H82 A;  4R3J A;  4XT2 B;  3WS4 A;  1LSV A;  3VSK A;  4PM9 A;  1T1C A;  2HV1 A;  4FSF A;  3G4P A;  1TVF A;  1PIO A;  2Y2N A;  4JGR A;  3NCK A;  3IF6 A;  3PBT A;  2GJ3 A;  4KUK A;  3C38 A;  1GHI A;  3UB6 A;  5EM1 A;  3ZG9 B;  3EEH A;  4BEN A;  4R0Q A;  2Y2Q A;  1FIK A;  5HD5 A;  1ESI A;  3W2Z A;  2VGL M;  3NDE A;  1F5M A;  1LI0 A;  2IA2 A;  2LB9 A;  1XX2 A;  3TJZ C;  1RP5 A;  4KQQ A;  4UA7 A;  1S67 L;  2VZW A;  4B4X A;  3C8C A;  4QY6 A;  4ARZ B;  4OQH A;  2Z6C A;  4FUW A;  2PRF A;  4GOG A;  3O87 A;  4DN0 A;  5CGX A;  1PWD A;  3FWL A;  4JGQ A;  4C3Q A;  3ZG5 A;  3K3D A;  2QYB A;  4RVA A;  3BYD A;  2OWJ A;  4EEU A;  3S4X A;  1KDW A;  1YMS A;  3CUE A;  3TE8 A;  3MS6 A;  5F83 A;  5HL6 A;  5EOE A;  3LY4 A;  4Y17 A;  5F69 A;  2PBD P;  3UNW A;  4MN5 A;  3MR0 A;  4OH0 A;  1S66 L;  4D60 A;  2QHK A;  3NHQ A;  4X1M A;  2ZM0 A;  3EEA A;  1XPB A;  2IWB A;  3LGO A;  1YLP A;  4P6Z S;  1NWZ A;  1ACF A;  4HIA A;  5FEG A;  3F1O A;  2W3E A;  3C7V A;  4X68 A;  1E3U A;  4EEP A;  1W63 Q;  3VE3 A;  3M2J A;  3BFE A;  1IKI A;  3E4Q A;  3QNC A;  4GN2 A;  1FIL A;  3UE1 A;  3BFC A;  3LEQ A;  4BMW A;  1H8M A;  3D72 A;  4KQD A;  4JGO A;  2I9V A;  3ZYT A;  2BLS A;  2INW A;  3NJA A;  4OQ0 A;  5HL1 A;  4DE2 A;  4R23 A;  3Q7Z A;  5F5Y A;  3DTK A;  1S4S A;  4JBF A;  4WEJ A;  5CGS A;  4N1X A;  1ONG A;  1F98 A;  1UGU A;  2VV7 A;  3N8S A;  1IEM A;  1XA1 A;  4LPZ A;  3LCE A;  3A3J A;  3OCN A;  4H6J B;  4R6L A;  3C5A A;  4F94 A;  2JKF A;  5HWT A;  1CEF A;  5FL3 A;  1JWV A;  3KO6 A;  3LFV A;  5DTK A;  2PYP A;  3CHW P;  3LIE A;  4KZ4 A;  3HBR A;  1F2K A;  4S2J A;  4UAA A;  5E2F A;  4IBR A;  2ZL1 B;  4H6J A;  4B93 A;  3PAE A;  4GCZ A;  2ACG A;  2OLV A;  2ZC6 B;  1XFN A;  5CX7 A;  4HES A;  2XA7 S;  3CAX A;  3EQU A;  3E0Y A;  3MZD A;  4X53 A;  1QME A;  3UPP A;  1MPL A;  2PD8 A;  4YFM A;  5EUA A;  4KQO A;  1LSX A;  2XF3 A;  1BZA A;  4L0L A;  1GHM A;  1O07 A;  5G4Z A;  1W5D A;  3IWQ A;  2NUT C;  5HD3 A;  4LV3 A;  3S22 A;  2WZZ A;  2PDR A;  4CJN A;  4JKT A;  2FH5 A;  5HAP A;  1KDS A;  2FFF B;  4KZ6 A;  2W0N A;  1EW0 A;  2QKP A;  5EVE A;  4G3V A;  1ODV A;  3LYX A;  4EXO A;  4EWF A;  3F1P A;  2EFU A;  2VGJ A;  1ESU A;  3SH7 A;  1XXM A;  5L10 A;  2OOL A;  1K54 A;  1VET B;  5I94 A;  3U2A A;  5I5L A;  4DE1 A;  2OAQ 1;  1O7E A;  3ICY A;  3TOI A;  3HLW A;  2QJ5 A;  4ME4 A;  3LIC A;  4GJ4 A;  1SKO A;  3DWZ A;  5EVI A;  4ESP A;  1LL5 A;  5IT5 A;  1K56 A;  1VET A;  2WAD A;  5FQM A;  3M2K A;  1D1J A;  5JYO A;  1OTD A;  4IHQ A;  5GLC A;  4BBU A;  1DJA A;  3IXH A;  3OPR A;  4HBU A;  4R38 A;  3DW0 A;  3I7J A;  1PW1 A;  5EE8 A;  1ES2 A;  3T50 A;  5HX9 A;  4H8R A;  1BSG A;  3IS2 B;  3BY8 A;  3MFX A;  4Y0T A;  5HPI A;  5FAQ A;  2W3H A;  3R7W B;  4HHD A;  4Q0I A;  1TS6 A;  4I3I A;  4M4X A;  5CED A;  3HVF A;  1S6R A;  4C6Y A;  1CK3 A;  3VE4 A;  1KVM A;  2JC7 A;  4ZTK A;  4HH3 A;  5U47 A;  4KG5 A;  2ZQA A;  1MXO A;  1K25 A;  4EBN A;  4DDY A;  1RCJ A;  1IYS A;  2G2U A;  3IBJ A;  5HW3 A;  4HH2 A;  1P9W A;  1XJ4 A;  3SS4 A;  1YPR A;  4DKI A;  1VHM A;  1XFQ A;  2R78 A;  4NXF A;  4ZAM A;  1KE0 A;  3Q1F A;  2P7J A;  3G6O A;  3Q07 A;  3D4F A;  3HLC A;  4LGW A;  1KE3 A;  1BTL A;  3N7W A;  1V9Z A;  4NEE D;  3ISG A;  1ERO A;  4WMC A;  3BQA A;  2DRW A;  4N9K A;  1DY6 A;  3MZF A;  4I3J A;  5GLA A;  2B95 A;  1GSV A;  2HP5 A;  1KGG A;  4A5R A;  3BLM A;  3GVB A;  5CRF A;  3LEZ A;  1I2S A;  3NBL A;  4BBT A;  5J8X A;  2WKI A;  1MBL A;  2W3D A;  2V0U A;  3LI8 A;  3GR2 A;  3ZFZ A;  3BWL A;  4WBG A;  5E2H A;  1WA9 A;  3VFH A;  2C6W B;  1ES5 A;  3AGF A;  3BFG A;  2V1A A;  2V0W A;  4Y3I A;  3PXP A;  5KZH A;  1TDL A;  1ES4 A;  2WAF A;  3TG9 A;  3TRC A;  5DJT A;  3UB5 P;  3E4P A;  3K2N A;  3KYQ A;  4LCL A;  1H8Z A;  5EFW A;  1ERQ A;  4MEZ A;  5GLD A;  3Q82 A;  1NLY A;  2QZ6 A;  4O7D A;  4EV4 A;  2ZC4 B;  4MBH A;  5A93 A;  3MXS A;  3EGD C;  4HP9 A;  1NLZ A;  4WL9 A;  5D3O A;  1SDE A;  1HTZ A;  4WEL A;  4CLC B;  1MWT A;  4KZ8 A;  1WYB A;  3G2Y A;  2PU4 A;  3KSI A;  3OPP A;  2FZ0 A;  2WGV A;  2WGI A;  3GDI A;  1OTE A;  1CI9 A;  3SOI A;  1STZ A;  2XEP A;  4X6T A;  5AVF A;  1X0O A;  3RFB A;  2GDN A;  2JKR I;  3WRT A;  3UB8 A;  1JNU A;  1RGZ A;  4PM8 A;  1NYY A;  3QP8 A;  1G5U A;  1W8Y A;  2JKR M;  3OCL A;  4E3I A;  1ZHH B;  1SHV A;  2V2F F;  4EBL A;  1SDN A;  1PFL A;  4WZ4 A;  2ZM2 A;  1A0K A;  5FAT A;  3HCY A;  4GHI B;  5HDC A;  3G35 A;  4GDN A;  5AQ9 A;  1ONH A;  3ZG0 A;  2ZMA A;  4GS9 A;  1OTB A;  2YKF A;  4E3N A;  4OVD A;  4DE0 A;  1K57 A;  1LT0 A;  3UY6 A;  3WS1 A;  4GNU A;  2Y2G A;  5CHJ A;  3HLF A;  4ZRR A;  2Q0O A;  1ALQ A;  1GHP A;  4I39 A;  3DAV A;  4KZ7 A;  3VMA A;  3V50 A;  3RTY A;  1Q2P A;  3H82 B;  3ZNY A;  4JLF A;  5GHZ A;  4HBT A;  3UE6 A;  3C4O A;  1CQA A;  2JE5 A;  1BUE A;  1N4O A;  3ZVW A;  3IXB A;  1L2S A;  1H3Q A;  3IF6 B;  5G4Y A;  5F82 A;  1LL9 A;  2X71 A;  2WKQ A;  3F1N A;  1VEU A;  3EGX C;  4GW9 A;  1XJ2 A;  4HOI A;  1NXY A;  4UHU A;  5GL9 A;  2HJE A;  5J7E A;  2B18 A;  2CMN A;  2WGW A;  3V67 A;  2HDQ A;  1Y28 A;  4I38 A;  2VEA A;  4EU0 A;  1IOU A;  2Z6D A;  2PR5 A;  3OBF A;  1CEG A;  4JXV A;  2H0Y A;  3FG8 A;  1PWG A;  3NOU C;  4MMN A;  4KZ5 A;  4WYY A;  4PM6 A;  3ZGA B;  3N4I A;  2H0T A;  3ZNT A;  4R1G A;  5GHY A;  4E04 A;  2QPN A;  1MY8 A;  4O01 A;  3OOV A;  1MKM A;  2E8I A;  3FZC A;  3MXQ A;  2KOI A;  2PYR A;  1AXB A;  1DJB A;  2EX2 A;  1MWU A;  2W1T B;  1IFQ A;  3JVV A;  4FH4 A;  3UMD A;  1RGY A;  4HJ4 A;  5MC7 A;  1H5X A;  3V5M A;  1D7E A;  3E98 A;  2XK1 A;  1ZKJ A;  2A24 A;  4Q8I A;  4QHC A;  1IKG A;  5C5K A;  2CC1 A;  3MQO A;  4YIN A;  4PKY A;  5FQJ A;  4XUX A;  4KG2 A;  2W1T A;  3F1O B;  5E2G A;  1TS8 A;  1DP6 A;  4WN5 A;  5HDS A;  1LHY A;  2X01 A;  3T4S A;  1TF1 A;  3T4O A;  4QB8 A;  2Y2K A;  2PBY A;  3MKE A;  4DXB A;  4ZDX A;  1K6R A;  1PZO A;  2MJ6 A;  3HL9 A;  4WUJ A;  2G2W A;  3LUQ A;  3W4P A;  3IXD A;  4WLA A;  3OPH A;  4QD4 A;  2UWX A;  3VFF A;  2C5W B;  2Y55 A;  4KEN B;  3HUM A;  4E3K A;  1YLZ A;  3A0R A;  3FKV A;  1W79 A;  3MKF A;  4QU3 A;  2G7U A;  1I5Q A;  3VP3 A;  4U0T A;  3S7P A;  5FI6 A;  5M18 A;  2P74 A;  2DNS A;  1QMF A;  4S2L A;  4UQI M;  3MQ0 A;  2O99 A;  4E3M A;  4LCM A;  4OOM A;  4OOL A;  4S2N C;  1K4E A;  3LR0 A;  4BL2 A;  2P04 A;  4Z1W A;  3UPN A;  2ZM8 A;  4Y13 A;  1GCE A;  4YNR A;  3FPV A;  4GD6 A;  2OSU A;  1NRF A;  3SH8 A;  5CEB A;  5L8M A;  2VA0 A;  2JCH A;  4CLC E;  3AGD A;  2PR6 A;  1OJG A;  3CPT A;  1T1B A;  4MLL A;  2Y2H A;  3VOZ A;  5L2F A;  4EQI A;  2O9A A; 
#chains in the Genus database with same CATH homology
 4Y0T A;  2XQZ A;  3QHY A;  4LV0 A;  5FAQ A;  1NY0 A;  3OZH A;  4OLD A;  4P6B A;  1YMX A;  2J7V A;  5DVA A;  4E6X A;  4PM5 A;  4IED A;  4KZ8 A;  1JWZ A;  1TEM A;  1EWZ A;  4DXC A;  5CED A;  3HVF A;  1S6R A;  2B5R A;  1WYC A;  4C6Y A;  4Y7P A;  4XXR A;  1CK3 A;  1NZO A;  1E4D A;  1NYM A;  3WRZ A;  4MBF A;  1KVM A;  2JC7 A;  3OC2 A;  4ZTK A;  2X02 A;  4R3B A;  4E6W A;  4RX2 A;  5U47 A;  4KG5 A;  4OP5 A;  1BLC A;  2XFS A;  1MXO A;  1K25 A;  2ZQA A;  4EBN A;  2WUQ A;  4S2I A;  4DDY A;  2H10 A;  1RCJ A;  2ZQ7 A;  1IYS A;  1LLB A;  2EX6 A;  4U0X A;  5EPH A;  5GLB A;  2G2U A;  4P87 A;  5CGW A;  4LV2 A;  1WE4 A;  5HW3 A;  2RCX A;  4RA7 A;  3NI9 A;  3RJU A;  5CTN A;  3O86 A;  1NZU A;  2JBF A;  2EX9 A;  3SS4 A;  1ZC2 A;  3WS2 A;  3UPO A;  4DKI A;  1KGE A;  1FSW A;  4ZAM A;  1KE0 A;  2ZJ9 A;  3VOY A;  3VP1 A;  1JTG A;  1K54 C;  3Q1F A;  4OKP A;  5AQA A;  4S2O A;  3GRJ A;  3Q07 A;  5KSC A;  4JXG A;  5FA7 A;  1BLP A;  5G18 A;  5HAQ A;  2WZX A;  2XD5 A;  3BRM A;  3D4F A;  3HLC A;  1KE3 A;  1BTL A;  4X55 A;  3GTC A;  1MWR A;  3N7W A;  4N92 A;  4OQI A;  2Y2I A;  5TFQ A;  1GA9 A;  1K55 A;  3ISG A;  1ERO A;  5EVI C;  2HDS A;  4WMC A;  4WM9 A;  2DRW A;  5JYP A;  3CMZ A;  1G68 A;  1L0E A;  4N9K A;  4ZBE A;  4OPZ A;  2Z2M B;  1XKZ A;  3BM6 A;  1DY6 A;  3MZF A;  3W8K A;  4UA9 A;  1FR1 A;  5GLA A;  3IWI A;  2RL3 A;  3A3E A;  2HP5 A;  5EVI B;  4FCF A;  1KVL A;  1U60 A;  5E2E A;  2XLN A;  1E3U D;  1BLH A;  1KGG A;  4A5R A;  3BLM A;  3GVB A;  5CRF A;  2EFX A;  3VP4 A;  3LEZ A;  3MFD A;  3RXW A;  3UO9 A;  4BLM A;  5F1F A;  1I2S A;  3NBL A;  5J8X A;  2WAE A;  2PU2 A;  3AGE A;  3C4P A;  3M6H A;  3GMW A;  3PBR A;  4JXS A;  3UDF A;  4CPK A;  3IHB A;  2WKI A;  2ZQ9 A;  3M6B A;  1MBL A;  4X69 A;  5A92 A;  1YLW A;  3N8R A;  4U3T A;  5GHX A;  4OLG A;  4DF6 A;  1JVJ A;  5HAR A;  3EQV A;  3PAG A;  1HVB A;  3GR2 A;  1IYO A;  5DTS A;  1H8Y A;  1ZG6 A;  2V20 A;  3A3I A;  3NDG A;  5IHV A;  5E43 A;  2R9X A;  3G31 A;  5CTM A;  3ZFZ A;  3C7U A;  1K6S A;  3W4O A;  1MWS A;  2EXB A;  1XP4 A;  3N6I A;  4WBG A;  5E2H A;  4WEK A;  1FCN A;  2V1Z A;  4FH2 A;  3IWO A;  4KG6 A;  3VFH A;  2C6W B;  1E25 A;  1ES5 A;  3AGF A;  5DF7 A;  2FFY A;  2XFT A;  3BFG A;  4R3J A;  2HDU A;  1XGI A;  1SKF A;  1N9B A;  1ERM A;  2HDR A;  2ZQD A;  5FAP A;  3WS4 A;  3VSK A;  3BEC A;  5KZH A;  2XH9 A;  4PM9 A;  1TDL A;  4Y0O A;  1ES4 A;  2WAF A;  3TG9 A;  4FSF A;  1VM1 A;  3G4P A;  5DTT A;  1TVF A;  1PIO A;  2Y2N A;  3LY3 A;  4NK3 A;  3MZE A;  3DWK A;  3PBS A;  4LCL A;  1H8Z A;  3NCK A;  3IF6 A;  3N8L A;  3PBT A;  4DDS A;  1ERQ A;  4MEZ A;  3E2K A;  1PW8 A;  5KMW A;  4HEF A;  4IVK A;  5GLD A;  3Q82 A;  4E3L A;  1GHI A;  2QZ6 A;  3G30 A;  1L0D A;  3NC8 A;  4O7D A;  4EV4 A;  3ZG9 B;  2ZC4 B;  4MBH A;  4BEN A;  4R0Q A;  3PBQ A;  2Y2Q A;  5A93 A;  4OPR A;  4R4R A;  1ESI A;  2Y2L A;  3MXS A;  3NDE A;  3Q81 A;  2A3U A;  2WK0 A;  5D3O A;  1KE4 A;  1CI8 A;  5CER A;  1C3B A;  1LI0 A;  3VSL A;  1SDE A;  2BG1 A;  2OLU A;  4C75 A;  1OME A;  1HTZ A;  1XX2 A;  2Y2M A;  4WEL A;  1PWC A;  4P85 A;  1MWT A;  1PI4 A;  1WYB A;  1MKI A;  1RP5 A;  3G2Y A;  2PU4 A;  3CG5 A;  1K55 C;  3OPP A;  4KQQ A;  4UA7 A;  2WGV A;  2WGI A;  4B4X A;  4PPR A;  4QY6 A;  1CI9 A;  4OQH A;  5F1G A;  3SOI A;  4X6T A;  2XEP A;  4GOG A;  5AQ7 A;  1VQQ A;  3O87 A;  2GDN A;  4KZA A;  3WRT A;  4KZ9 A;  5CGX A;  1LI9 A;  5HAI A;  1PWD A;  4KQR A;  2QMI A;  3FWL A;  4PMA A;  4NET A;  3FYZ A;  4C3Q A;  1RGZ A;  4PM8 A;  3ZG5 A;  1NYY A;  1W8Y A;  3OCL A;  4GD8 A;  4E3I A;  3G2Z A;  3PBN A;  1SHV A;  4RVA A;  2V2F F;  4B4Z A;  4EBL A;  1EI5 A;  2EXA A;  3BYD A;  1SDN A;  1YLY A;  3S4X A;  5FAO A;  4WZ4 A;  1KDW A;  2ZM2 A;  1YMS A;  3IH9 A;  1YQS A;  2R9W A;  4R4S A;  5FAT A;  5F83 A;  5EOE A;  3LY4 A;  3UNW A;  3G35 A;  4LV1 A;  2ZC3 B;  4Y0U A;  3Q7V A;  4K0X A;  4GDN A;  5AQ9 A;  1ONH A;  3UDX A;  2ZMA A;  3ZG0 A;  4OH0 A;  4E3N A;  4JF4 A;  4OVD A;  3ZDJ A;  4DE0 A;  2A49 A;  1K57 A;  3B3X A;  4N1H A;  3LO7 A;  3E2L A;  2ZM0 A;  3V3R A;  3IH8 A;  3UY6 A;  3WS1 A;  4GNU A;  4JF6 A;  4RX3 A;  2Y2G A;  1XPB A;  2IWB A;  4RYE A;  5CHJ A;  2ZC7 A;  3FKW A;  3HLF A;  1YLP A;  3HUO A;  1ALQ A;  1YLT A;  1GHP A;  3P98 A;  4ZJ3 A;  5TR7 A;  2P9V A;  2Y2O A;  3IF5 A;  3HUN A;  4KZ7 A;  3VMA A;  1I2W A;  3C7V A;  2ZLY A;  5CHM A;  3V50 A;  1Q2P A;  4X68 A;  1E3U A;  1Q2Q A;  3PBO A;  4WZ5 C;  3ZNY A;  4JPM A;  4JLF A;  4DE3 A;  3OPL A;  3ZVT A;  2ZC5 B;  4X56 A;  5GHZ A;  3M2J A;  3MXR A;  4MBK A;  3PTE A;  4IBX A;  1ZG4 A;  1IKI A;  3BFE A;  3C4O A;  4HBT A;  2WKE A;  3QNC A;  4GN2 A;  2JE5 A;  3UE3 A;  1BUE A;  1N4O A;  3UE1 A;  2ZQC A;  3ZVW A;  3BFC A;  4BL3 A;  3IXB A;  4OP8 A;  1L2S A;  3MBZ A;  3IF6 B;  4D2O A;  1GA0 A;  2EX8 A;  3IHA A;  5F82 A;  2DCF A;  3G34 A;  3UDI A;  1LL9 A;  1YLJ A;  2X71 A;  1M6K A;  3JYI A;  1PI5 A;  3V39 A;  1YT4 A;  1NXY A;  2BLS A;  4OQ0 A;  4UHU A;  1S0W A;  5GL9 A;  2J9P A;  4DE2 A;  5HL1 A;  2WGW A;  5FQ9 A;  4R23 A;  3Q7Z A;  5EVI D;  1PZP A;  1K56 D;  4BQM A;  3W4Q A;  2HDQ A;  1FCO A;  1JWP A;  4JBF A;  4WEJ A;  4ZJ1 A;  2XD1 A;  4ID4 A;  4N1X A;  1ONG A;  5CGS A;  4BD0 A;  4EUZ A;  1FR6 A;  1ES3 A;  3N8S A;  5A91 A;  1CEG A;  1IEM A;  4JXV A;  2H0Y A;  5BOH A;  3IQA A;  1PWG A;  3VP0 A;  4P0M A;  1YM1 A;  1XA1 A;  2XGN A;  5FDH A;  4KZ5 A;  4WYY A;  3LCE A;  4PM6 A;  3A3J A;  3ZGA B;  3WWX A;  4EBP A;  3OCN A;  2HP9 A;  5FI2 A;  4E3O A;  3N4I A;  1BLS A;  1FOF A;  2H0T A;  3ZNT A;  4R1G A;  5GHY A;  3GV9 A;  3C5A A;  3ITA A;  2QPN A;  5M1A A;  4S2N A;  1K4F A;  4F94 A;  1L0G A;  3BLS A;  1MY8 A;  3CZD A;  1BT5 A;  1CEF A;  1JWV A;  3FV7 A;  4PM7 A;  2E8I A;  3FZC A;  5DTK A;  1K57 C;  4KZ3 A;  1HD8 A;  1AXB A;  3IT9 A;  4JF5 A;  3BFF A;  1TDG A;  4KZ4 A;  1DJB A;  3HBR A;  4OON A;  5CXW A;  1DJC A;  3HLG A;  3ZG7 B;  4S2J A;  4E3J A;  4K0W A;  4UAA A;  2EX2 A;  1MWU A;  5DF9 A;  5EEC A;  5E2F A;  4FH4 A;  4IBR A;  2ZD8 A;  3V3S A;  3Q7V B;  1RGY A;  3ZCZ A;  5HFO A;  1H5X A;  3V5M A;  3TSG A;  2ZQ8 A;  1IEL A;  3PAE A;  2VGK A;  3O3V A;  1XGJ A;  2XK1 A;  1ZKJ A;  4Q8I A;  4QHC A;  1IKG A;  4Z9Q A;  4JXW A;  2CC1 A;  2OLV A;  3SS5 A;  4YIN A;  5FQJ A;  2ZC6 B;  3HLB A;  2Y2J A;  3HRE A;  3WS0 A;  1FCM A;  4XUX A;  4HES A;  4KG2 A;  2P9V B;  3EQU A;  3UE0 A;  1G6A A;  3MZD A;  4X53 A;  1QME A;  4B88 A;  5E2G A;  5EOO A;  1HZO A;  2Z2L B;  1MPL A;  4OQG A;  3BEB A;  5CHU A;  3UPP A;  4YFM A;  3HLD A;  5EUA A;  4BJP A;  4KQO A;  4FD8 A;  1JTD A;  4OPY A;  2J9O A;  2XF3 A;  1BZA A;  4L0L A;  1LHY A;  5A90 A;  2X01 A;  1GHM A;  4ZJ2 A;  1O07 A;  5FQI A;  2XDM A;  4QB8 A;  1W5D A;  2PBY A;  2Y2K A;  1SCW A;  3IWQ A;  3MKE A;  4LV3 A;  4DXB A;  4S2K A;  1NJ4 A;  1Y54 A;  1W8Q A;  3S22 A;  4ZDX A;  2WZZ A;  4CJN A;  1K6R A;  1PZO A;  3QNB A;  3HL9 A;  4JKT A;  2G2W A;  3W4P A;  5HAP A;  1KDS A;  4WMC D;  3IXD A;  2FFF B;  3OPH A;  4QJG A;  4KZ6 A;  2UWX A;  4QD4 A;  3VFF A;  5CEC A;  2IWC A;  2C5W B;  2I72 A;  3IF6 C;  2Y55 A;  1J9M A;  4QY5 A;  4KEN B;  5DF8 A;  5M19 A;  3O88 A;  3HUM A;  2Y91 A;  1YLZ A;  4E3K A;  3RXX A;  4EWF A;  3FKV A;  1W79 A;  3MKF A;  2Y2P A;  4DRT A;  4QU3 A;  4IVI A;  2WGW B;  4GDB A;  3ZHH A;  2VGJ A;  2EFU A;  1I5Q A;  4M3K A;  2Q9M A;  3VP3 A;  3SH9 A;  1ESU A;  4U0T A;  4K91 A;  2OV5 A;  2Y4A A;  3GQZ A;  5FI6 A;  5M18 A;  2P74 A;  3DTM A;  1XXM A;  2DNS A;  3IXG A;  4MNR A;  3SH7 A;  4N9L A;  3NIA A;  1QMF A;  5FSR A;  4S2L A;  1K54 A;  5AQB A;  5I94 A;  4KZB A;  3S1Y A;  4OPQ A;  4LEN A;  3SS3 A;  4DE1 A;  4E3M A;  3A3D A;  4LCM A;  4OOM A;  1O7E A;  4OOL A;  2WKH A;  3BFD A;  4S2N C;  1Z6F A;  4XUZ A;  1K4E A;  5EVL A;  2HPB A;  3WS5 A;  4S2M A;  1XA7 A;  4BL2 A;  1IYQ A;  3TOI A;  3HLW A;  3GSG A;  1M40 A;  1L0F A;  2XR0 A;  3UPN A;  2ZM8 A;  1GCE A;  2WYX A;  4UA6 A;  3DWZ A;  2HP6 A;  5EVI A;  1LL5 A;  2J8Y A;  4GKU A;  3P09 A;  5TGF A;  5FI7 A;  1KGF A;  1K56 A;  1FQG A;  1W7F A;  3NY4 A;  3VP2 A;  5KSH A;  4GD6 A;  5FAS A;  2OSU A;  1NRF A;  2WAD A;  3M2K A;  5FQM A;  5JYO A;  3G32 A;  3SH8 A;  4GZB A;  4GB7 A;  5CEB A;  3A3F A;  5GLC A;  2IWD A;  1K38 A;  3ITB A;  1DJA A;  5FQQ A;  1PYY A;  5FQK A;  2JCH A;  3AGD A;  1IYP A;  3ZG8 B;  2Q9N A;  3IXH A;  4OOY A;  1FSY A;  3HLE A;  4WZ5 A;  3OPR A;  4HBU A;  4MLL A;  2Y2H A;  3DW0 A;  1PW1 A;  3I7J A;  1ES2 A;  5EE8 A;  3VOZ A;  5HX9 A;  2Y59 A;  1BUL A;  3UN7 A;  5L2F A;  4H8R A;  4EQI A;  1BSG A;  4S2P A;  4BD1 A;  3CJM A;  2H5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...