3WS7A

The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with nadp+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
296
structure length
293
Chain Sequence
HHHSSGLVPRGSHMRVGFIGLGIMGGPMATHLLKAGFLAAVYNRTREKTKPFAEAGVYVAESPADLAKRVDVVIVMVSDAPDVEQVLFGPSGVVEGARPGLIVVDMSTNSPDWARKFAERLAQYGIEFLDAPVTGGQKGAIEGTLTIMVGGKEELFHRLLPIFKAMGRDIVYMGPVGYGQAMKLVNQVVVALNTVAMVEGLKLAKALGLDMDKVAEVLTARSGAIELYLPKLLKGDLSPGFKAEHLKKDLGYVLEEARKRGVKLPGAELAYELYRKMVEDGAGSLGIHALGFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NADP+and tartrate-bound complex of L-serine 3-dehydrogenase from the hyperthermophilic archaeon Pyrobaculum calidifontis.
pubmed doi rcsb
source organism Pyrobaculum calidifontis
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, NAD-binding protein
total genus 106
structure length 293
sequence length 296
ec nomenclature ec 1.1.1.276: Serine 3-dehydrogenase (NADP(+)).
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3ws7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ws7A01
1O5IA 4AJLA 4JJFA 4E6PA 3DAFA 1YJ8A 1TEHA 2AMFA 1E6EA 3P19A 5CDTA 1FDTA 1XCBA 2V7PA 4R16A 4BKOA 4U8GA 4BO5A 4QXMA 3MCVA 3S2GA 2Q1TA 2Q1WA 2Q4EA 2QZZA 4OIMA 2NU7A 1I36A 1U7HA 4F6CA 2ZYAA 5EQFA 5ES3A 3B1KA 2Z95A 3KSZO 4BNUA 1P9LA 2PGJA 3BYZA 1LDYA 2FPPA 3KETA 3PJGA 5CEEA 4PG7A 3QJ5A 3M1AA 4RVFA 3G17A 1C3VA 3ADPA 1UH5A 2NNLD 1HE2A 3UOGA 2POQX 4RVSA 1NPDA 1NFQA 3WX0A 5L40A 1VL6A 1BSVA 1QSGA 5L7WA 4II2A 3IL2A 1LDMA 5H83A 4Q3AA 2I76A 3VTZA 4ZN6A 1NFFA 2B4TO 4FJ2A 5EINA 4PG6A 7ADHA 5JCJA 1S6YA 4J1NA 3TJRA 4CQLB 3UF0A 4HFRA 3QSGA 2I3GA 3C24A 1NM5A 4ZA2A 3NDIA 3KYCA 3C7DB 4RL6A 5BNTA 3E18A 4XR9A 3PI7A 3WWZA 2FPGA 2FSVA 2BELA 1TA4A 1C1XA 4OHUA 4IDDA 4R1NA 2ZTMA 2DQ4A 4UVHA 1FDUA 2IYPA 4J4BA 1X13A 5LC1A 3UGKA 3L6DA 1P77A 4EUEA 2EGGA 1B14A 1LQUA 3ZZNA 1C0LA 2EIHA 1NHGA 2DM6A 4LCEA 5A5FA 2WTBA 3U4HA 4B7UA 3T7CA 4LRTB 3RC9A 2O3RA 1LSSA 1YDEA 5CPBA 4BNYA 3QVWA 1YB5A 5L51A 3JQ7A 5G0WA 5A9RA 3OMLA 5F3RA 4XIYA 1BRMA 3FD8A 4JK3A 4XKJA 4RVDA 5L7YA 5BSEA 2BI8A 2PKQP 3JYOA 4MVJA 4R3NA 5F1KA 2AA3A 1PGPA 1PL8A 3F9IA 4P4GA 1MFPA 3WMXA 4CM8B 2P91A 3OF2A 4XDZA 3TZQA 1HETA 4K28A 1KEUA 4CL8A 1PJLA 3H2ZA 2WMDA 2X0NA 2VZ8A 3IC5A 1PGJA 3JV7A 2NU8A 2IEBA 4ALKA 1NNUA 1ONPA 1IPFA 2PLAA 5TC4A 5FI5A 4NH4A 5IFLA 4J6FA 1KY5A 3D7LA 3OECA 2CMDA 1XYGA 3QW2A 3RUDA 3PQFA 1LBEA 4DBZA 1DIBA 3O03A 2F1KA 3KEQA 3B1FA 4NI5A 3PYLA 5TT1A 3DC2A 1P1HA 1W4ZA 1U8XX 1H6DA 4YBZA 3EW7A 1HDOA 4U0KA 1N9GA 3DO5A 4CJXA 3L77A 4PLTA 1T4BA 4XQCA 4Z9XA 1ISGA 1VSVA 2Q4BA 2WDZA 5DOVA 1JKIA 3U62A 4PVCA 2HRZA 4HNHA 1HLPA 4C7KA 2Q1UA 1YE3A 1SB8A 5CDUA 2OO5A 3DBRB 1H2HA 1V3VA 3BXXA 5CPFA 1R0KA 4PLYA 3S2IA 4XR4A 2X4GA 4WASA 3QVOA 4IDBA 3VH1A 3DZIA 4JX8A 1WZIA 1UDBA 1PU2A 3Q2KA 5L3ZA 1KS9A 1E5LA 4JJGA 1JAYA 1K6JA 2NU6A 2WYWA 2O3SA 4M86A 1Y5RA 1HSZA 1DFIA 4OKIA 3QQPA 1LEHA 1E3SA 2XAAA 4CL3A 2FMUA 4TZKA 4BNGA 1Y9EA 4N5NA 4IGFA 1YQXA 4IBOA 5L53A 3TRIA 1A27A 4CM8A 3MJ4A 5G0UA 1JKFA 8ADHA 4MDHA 3PRJA 2Y1EA 3UHAA 1ZK0A 4CV3A 2VRBA 2P2SA 2VRCA 2AQKA 4Z6KA 4EJ6A 1Y8QB 5B4VA 2IODA 4BMVA 1BW9A 2YW9A 1P1KA 3VKUA 5COBA 5C7LO 3WFIA 5IXSA 3DBHA 1JAXA 5AOVA 4FC6A 4PVDA 1I3KA 2W90A 3OQBA 3Q1LA 4CM9A 1LDEA 4XCVA 3STHA 1ARZA 1DB3A 5T8KC 1X7GA 1H0KA 1N5DA 4OO3A 2NVUB 3W8DA 3GNQA 3DWFA 2C07A 1XG5A 2B37A 1ADBA 1J4AA 1H6AA 3VH4A 1P0FA 3NDJA 3GF4A 1F0YA 3WQQA 2B5WA 4FGSA 2NWQA 4OXKA 3DR3A 4UULA 5G0VA 5B4UA 5ICMA 3ZNPA 4YA6A 3FWZA 3U0BA 3I1JA 1I2CA 1QR6A 1WMBA 3SLKA 3IIEA 1K6IA 1U1IA 4Y6PA 1Y8RA 1O0SA 4YT4A 4D3DA 1KEWA 1IPEA 1A7AA 1IB6A 2BHLA 3KBOA 4WK6A 4WLVA 4PLCA 3WR5A 3AI2A 2P4QA 2JKVA 4ND2A 1Q7GA 5BSGA 4DIFA 3RBVA 3HUDA 4R54A 1C0IA 1XDWA 3VPSA 1Z45A 5DBFA 1KEPA 1P45A 3GZNA 4OAQA 4CLRB 1R4NA 1SEVA 4YACA 4P38A 1PR9A 1ZSVA 2UUPA 3FPLA 1AUPA 1WP4A 3ETEA 4MVJP 4UUPA 3AM3A 3EGOA 3EAGA 2GN6A 4RF2A 1HKUA 3V1UA 5I9LA 1MA0A 3DHEA 1Y81A 5C7IO 3SLGA 5CG1A 3E6AA 2X22A 3BHMA 3LDHA 3CH6A 3UVEA 5TSDA 3QHAA 1EE9A 4HNGA 2C0CA 2J3IA 3K96A 1SOVA 1ZSYA 2I66A 2EV9A 5L9AA 3A1NA 4ND1A 1LC3A 4CLOB 3IP3A 4WUVA 1GZ3A 2P9CA 3PP8A 3K30A 4B4UA 5A02A 1CQIA 4BNZA 1CEQA 1T2DA 2VCYA 1F8FA 2VZ9A 1VL0A 3DHNA 3DHYA 1TT5A 3WBBA 2DC1A 2WWRA 1MG0A 2NLOA 2G5CA 1E1MA 1LLQA 3DBLA 4XJSA 1AE1A 4ZU3A 3WDSA 2W2KB 3VKVA 5U1PA 3CZRA 3L4SO 5L45A 4TVBA 1T2CA 5TQVA 1QLHA 2VHVA 3H5NA 3ASVA 5KJ1A 1K6XA 3H9JA 5JCXA 1M2WA 3AM5A 3DMYA 4NJMB 2H63A 4CM5A 3HWRA 3PJDA 1X1TA 4AJ4A 1NBOA 1UR5A 2OOSA 4C4OA 2GR9A 4CMIA 3NGXA 4S3MA 4Q9NA 2E4AA 1UZNA 4IS3A 4XQ9A 1E5QA 3JQ6A 4YT5A 5FFFA 1DRUA 3LC2O 3B20A 5JAZA 4DQUA 2P5YA 5A9SB 2QW8A 1B8VA 1GUZA 3C1OA 5JMPA 1X0XA 3E9MA 1C0PA 2X5KO 3ZGYA 4DXHA 3OA0A 3QWBA 2ZQZA 3HDHA 4XRGA 4IS2A 4HXYA 1YJQA 1DC6A 1MXHA 3BZUA 5DDIP 3WYEA 5IDXA 3BIOA 2OBYA 1RM0A 1Z75A 1KVUA 1BVUA 2XXJA 1EFLA 5THKA 3U4DA 4JGBA 1NAHA 4NBRA 3WNQA 4LRSB 5HS4A 1Z7BA 4EITA 3ZV6A 2AG5A 4HUJA 1Y8QA 4YAIA 4IDGA 8LDHA 1CJCA 1AXGA 1JWAB 1LLUA 3CUKA 3F47A 3ZHZA 2BFPA 3JQGA 4E31A 2ZQYA 3Q6IA 4OXYA 2J8ZA 4KUHA 2E82A 2G76A 2JCXA 5JDCC 5U4QA 5JW6A 2IZ0A 4Z0HO 1R4NB 2GERA 4BV8A 2GF2A 1P1RA 2JD1A 7MDHA 4CM9D 3Q2IA 1ZXLA 3GMSA 3GVXA 1PGOA 3KSUA 4OOFA 4R41A 3R3SA 5A9TA 1BDMA 1NQ5A 1CDOA 1JW9B 2F00A 3L6EA 5JCJD 4GLOA 1Y8RB 2FZEA 4NU5A 2O2SA 4LK3A 2Q46A 2ZTLA 4D79A 3LC7O 3TFOA 1A71A 3RFTA 3MTGA 4FOSA 4UEJA 2BFOA 1ZH8A 4E4YA 4EEXA 5FEUA 3MEQA 4R3WA 5AXCA 3AY7A 4XYEA 1LC0A 4ONEA 4UUOA 5EQDA 2HK7A 4C7JA 4UVGA 5J23A 1BXZA 1GYPA 3PLNA 3CKYA 2QIOA 3JD0A 5FYDA 1PJTA 3INGA 4WCFA 4J7UA 4GX5A 1ZVMA 5EMHA 3WTBA 1YWGO 4YRAA 2WSBA 4ROSA 3INTA 1H6BA 2HCTA 3H4VA 4FQ8A 3E8XA 1X1EA 4WGGA 3VZQA 3VVBA 3R0IA 4YAGA 3EZYA 1ENOA 4H3VA 2R2GA 4XYMA 2OMEA 2PH3A 3A06A 1RJWA 4WCFC 4E13A 3L07A 1DDOA 5F21A 4DL9A 1KVRA 2IYOA 3P7MA 4JLWA 9LDTA 3N7UA 1PJSA 4E12A 1DRVA 5TRTA 1YBAA 4Y6SA 4N7RA 1PZEA 2D2IA 1I33A 1VI2A 2I3AA 1GPDG 4BB6A 3K31A 3HHPA 4M49A 4I08A 1LUAA 3KOUA 1PZGA 4WOKA 3OIGA 3JD2A 3BMNB 1K2WA 3AWDA 3GEGA 3QVTA 3U9LA 2C54A 3I9JA 4DVJA 1KETA 4FW8A 3DZJA 2V65A 2Y1CA 3LT1A 1Y9AA 5HBRA 5AXDA 4Q3NA 3NTRA 3KXDA 1XU9A 1GQQA 3JTMA 3LLSA 5IG2A 3WS7A 4E5NA 2X9NA 2BD0A 3TDKA 1P33A 1GQYA 4BO6A 1IL0A 1GEGA 2EJWA 4XGNA 1KOLA 4P4LA 4R5MA 3ZH2A 3FRJA 2CY0A 3M2PA 3MWDB 1I24A 2A94A 3D3WB 5TS3A 1CERA 2ZIZA 4KDFA 5L7TA 1R4MB 2OGUA 5TLSA 1EFKA 2EWMA 1YO6A 1B3BA 2V6FA 4IQGA 4O63O 3GEMA 1H93A 1PR3A 5DCWA 3I4FA 2RCYA 1UZMA 2BMAA 1A9ZA 3AUTA 3R6DA 4OGWA 3TNLA 2GO1A 2UV8A 3DEYX 5IDQA 4INAA 3VVCA 1DIRA 3JD3A 1UXHA 1LLDA 4AJPA 3U49A 5JS6A 4K26A 5FWNA 1XEAA 3G1TA 3BTUA 4DGSA 1QV6A 1EVIA 2Q1SA 4JN6B 3RASA 5TIIA 3VPXA 3ZU4A 3GDFA 2PKQO 3FI9A 5I8ZA 1QXSA 2YQ4A 4ZQBA 1ZK3A 1F17A 3PHGA 1DFGA 1K0UA 1VM6A 3FNHA 1A4UA 5KVCA 2HKIA 1KEVA 3RFXA 1WPQA 2ZCUA 4RQTA 1U8FO 1YL7A 3TL2A 3B70A 3C85A 3H5AA 3OEYA 4E2ZA 5JY1A 2GCGA 1H9BA 2CZCA 3OM9A 5BT9A 4AJJA 1JKJA 1ZEJA 4XWYA 3P5SA 4YXFA 2HU2A 4JROA 1YL5A 3TN7A 4U7WA 2JCVA 3ZCXA 1ZKMA 3ZWBA 2QRJA 3F4LA 2GNAA 5EJ2A 3U4CA 1RWBA 4B3HA 1EUDA 5KKAA 1H9AA 2WE8A 3TZCA 4BB5A 5AVOA 2X5JO 4NQZA 3WSVA 4I5DA 2HK9A 5BSFA 3EZLA 3IOYA 1LDNA 3G49A 3A4VA 4WLUA 1B16A 4E2YA 3ANLA 3H7AA 3C7AA 2NSDA 3ETDA 3O26A 1NWCA 4CR6A 3GT0A 4J9VA 4F45A 4FFNA 4J4HA 2FPIA 4YJHA 1E3EA 3ZDFA 4BV9A 1PJ2A 4G5HA 4CLHA 4CMJA 2VWPA 4YJFB 1DXYA 1T1RA 3W8FA 1IE3A 4GX2A 1XSEA 4DUPA 4Q39A 4YAKA 3WGIA 4CLRA 4CR8A 3CTVA 3WBFA 5G4KA 2VWQA 2C59A 5AQ1A 4BO3A 4PZEA 4F3YA 2CUKA 4XB1A 3HB5X 4U6SA 1YH3A 2D5AA 3IUSA 4M1QA 1UP7A 4ALMA 3I5MA 3ZV4A 2W98A 3WJ7A 3WXBA 1ULUA 4RPKA 5HTOA 1Q0LA 1DHTA 4RCVA 4EDFA 3H2SA 4R9RA 1F8GA 1QV7A 1I2BA 4RGBA 1GZ4A 1H2BA 2DAPA 1ID1A 2GSDA 4A7PA 1I0ZA 3JYQA 3ZU5A 4LW8A 4EUHA 3VAZA 3FWNA 2VT2A 5KTKA 1E6UA 1HDZA 2BKAA 3PIDA 4GX0A 4R69A 2YQ5A 4URFA 4IINA 3KHUA 4PZDA 3F5QA 1UXJA 3BMNA 3GVPA 1QYDA 1N7HA 2IRWA 4AJ2A 1VKOA 3LVFO 2PNFA 3L0DA 2RHCA 3PK0A 2OZPA 3JQEA 1IHYA 4DLBA 3TL3A 4E5PA 1VL8A 2JHFA 2Y0EA 5G0SA 4Q3DA 3CTMA 4O1MA 1JU9A 4CR7A 1L7EA 2YDYA 1GZ6A 5L4LA 2G82A 1P1FA 3U09A 1HTBA 3G79A 3WLFA 3D4PA 1N7GA 4PGFA 3HDJA 1PL6A 2W2KA 4YQZA 5T8KA 1W6UA 3OFSA 4IIVA 4IMPA 4A10A 4NMHA 3RIHA 1Z73A 4BNHA 1E3WB 2JFGA 1PZHA 2DTEA 3WGGA 1TT5B 2NVWA 2R00A 1EQUA 2QYTA 1B3RA 3ZU2A 2WD8A 3E48A 4XB2A 3RVDA 1ZMOA 1ISHA 3WICA 3K9QO 1RKXA 3N58A 4CLEA 4MVJE 1GAEO 3IDSA 4LVUA 3VH2A 5KJ6A 1PS0A 4DPLA 4OQZA 1RYEA 3ZWXA 4DYVA 4I9HA 1UZLA 1YBVA 1QYXA 4TVOA 1GTMA 1MX3A 1R0LA 3ICPA 2Q45A 4ND3A 1GD1O 3WQSB 4PG4A 2CVZA 3GVHA 2CDBA 1DIAA 1Q2XA 2CD9A 1SAYA 4J2OA 4BNXA 4HY3A 1PZFA 1VC2A 1WDKA 4ESOA 1A7KA 4KUEA 3IMFA 3CINA 4FCCA 2X8LA 3I9LA 1ZCJA 3SXPA 3L9WA 3RBZA 4RVGA 3RC7A 5GMOA 4A5OA 2B0JA 3KB6A 5AXAA 2AEFA 1PEDA 4IY1A 2X86A 1OOEA 3SX2A 3NT5A 4QO8A 4PLWA 4QX6A 4E5KA 4KQWA 4GAEA 4BGVA 2YHIA 1DO8A 3LU1A 4MKZA 5IF3A 4TKMA 2VYNA 2YHUA 3TZHA 2AE1A 1DLJA 2D1YA 1I30A 3WGQA 4AJEA 4JP2A 1R15A 9LDBA 1YB1A 4NJOA 2C2YA 1BGVA 4EJ0A 2HMSA 4J0FA 4UVIA 3PYMA 4YT2A 3H6KA 4Z0PA 2PA3A 1C1XB 3GG2A 3TSCA 2OL4A 2BFMA 3AY3A 2JJYA 2CNBA 4R1TA 5JAQA 4MO2A 5MDHA 4N54A 1LRLA 3H9GA 1E1KA 5JBIA 3RROA 1ONOA 1PGNA 1HEUA 4MINA 4NFSA 4B4OA 1W0CA 3ABIA 3OSUA 3L6OO 5JY6A 4DRYA 3MJCA 1YOVA 3MJVA 3KM0A 3LT2A 1N2SA 1Y6JA 4NHEA 1DFHA 1WMAA 1ZXBA 5CP8A 4FC7A 4FIZA 1M66A 4DYDA 3EYWA 1X7DA 5C7OO 4II3A 5ICSA 4Z3KA 5EIOA 2UDPA 4BOYA 4IGEA 1XWFA 1Z7EA 4FGWA 2W4QA 3OETA 2WYVA 3JQFA 4U6QA 4CV2A 3QWHA 4OM8A 1HRDA 5KJCA 1BXKA 3GMDA 1DSSG 4TQGA 2W8ZA 3FTPA 4G65A 4ZRMA 4A03A 2YZ7A 3GH3A 1I01A 2X9GA 4A73A 4RDHA 3DMTA 5F5NA 2PV7A 3L4BA 1B2LA 1DLIA 4I9UA 1EDZA 4CQMB 5KOIA 1Q7BA 4OMUA 3ADOA 1VE9A 2Q99A 2G0TA 4GWKA 3GHHA 3K2BA 3JQ9A 3RU7A 3ASUA 1QYVA 2IZZA 5GY7A 4JXKA 3WSWA 1U3VA 1UP6A 4MVJF 5BSHA 3TWOA 3AI1A 3D4OA 1GPJA 4N5LA 1GUYA 4G2NA 3AOEC 3GNTA 4Q3BA 1UDCA 4AL4A 3LT0A 4B8WA 1E3LA 4TRJA 3RSHA 3Q9NA 1C0KA 4J4TA 4DLAA 3AU8A 2OXIA 5MGBA 5KWEA 1E92A 2IE0A 2ZKLA 3UCXA 2DUUA 4B3IA 4CUKA 5G2OA 3GY0A 1HSOA 4ZQEA 4WEQA 4CM4A 2HLPA 4YJGA 1EMDA 2YV2A 2PR2A 1GADO 2CVQA 2VHXA 1DPGA 3FNFA 4O5OA 3VZSA 2HMWA 2X6TA 4NR0A 3ICCA 3O8QB 1CF2O 3QLJA 3TF5A 4J7CA 3ZNOA 4ALJA 2EP7A 1O9BA 5KJEA 2QRKA 5TF4A 3VDQA 1ZEMA 1U3TA 3SVTA 4MKXA 5A4DA 4GPD1 3GDGA 3ITDA 1QP8A 1VLLA 2XPCA 3MOGA 1K3TA 3HSKA 2HJRA 5EL0A 4J43A 2JCYA 2D0IA 3IKVA 3R3JA 3OJ0A 1KY4A 1Z6ZA 2GLXA 4GQAA 2NUAA 3LLVA 1IZ9A 3WJAA 3GZ4A 2EJVA 2RH8A 1XKQA 3AU9A 2I5PO 1J5PA 1P1IA 5C5IA 1E7QA 1YDWA 3M2TA 3TZKA 4ND4A 4QECA 1ADCA 2VUUA 1R6DA 2AEMA 4KP7A 1ENYA 1NFRA 4F46A 5BR7A 4TWRA 2FN7A 3H9EO 3WQRA 1QYCA 1ZBQA 2I6TA 4RPGA 2J5KA 3A28A 4DC0A 5DBIA 4J91A 3U3XA 2X0IA 3PLRA 4K6CA 2J5RA 4DPKA 2J3KA 1EE2A 3VPGA 3ULKA 1HT0A 4CM6A 3L4BC 1BVRA 4X54A 5JNLA 3UKOA 3FBTA 4IXWA 1UAYA 3ONFA 1MB4A 1WAMA 4HP8A 3KZVA 3KYBA 3K6JA 3A14A 3PWSA 1LXCA 4W7HA 4BKRA 5DT9A 1SMKA 5U9CA 1E7MA 6LDHA 2YV1A 2Y67A 4PLPA 5DZSA 4NJMA 4KDEA 1PJBA 4RF3A 4TKLA 3F6YA 3GUYA 4Z0TA 4B3JA 4YJFA 5KKCA 3WGYA 4DIOA 3TZ6A 1KBZA 1FDSA 4OKNA 3ANNA 5T64A 2PTGA 3GUCA 2SCUA 1JVBA 2TMGA 2EGHA 4L4RA 3HB4X 1U2DA 3DOOA 3QIVA 3MZ0A 1A9YA 5ENVA 3CZMA 1ADFA 5DCUA 3K5PA 3BMCB 1D4FA 3D5QA 5KIAA 1O8CA 3Q9UA 2VHYA 1NVMB 3PHHA 3KLMX 1D1SA 3QA9A 5EERA 1DRWA 2Q49A 3M6IA 4BGEA 4TRMA 4NNJA 3RJ9A 2GPTA 3D3WA 3OQ6A 3D4NA 4RORA 2PD4A 4YPOA 1LU9A 2CDAA 3B1JA 3I9OA 3HE3A 3WMWA 3ZWPA 4BO7A 3PXXA 4AJNA 3I83A 1NASA 1TB4A 4WPGA 4XX0A 1HDRA 2DUWA 5CEFA 3F3SA 1N1GA 2NM0A 2O48X 1T2AA 4BNNA 4D41A 2B36A 1X15A 3DFUA 1LRKA 1G0OA 2GN4A 1IYZA 3INRA 1Y7TA 1NQTA 1U7TA 3EDMA 1QYWA 3JQGB 4NZ9A 4B7CA 1T4DA 3KO8A 4GX1A 4QEDA 2H5LA 5K6AC 1PQPA 4QFCA 1HYGA 2WD7A 1PSDA 3DBLB 2VOEA 3DZGA 3HDYA 4P4NA 4UEKA 4BQPA 4CM3A 1D8AA 5JDIC 4KMSA 4ILKA 1HXHA 2X58A 4EUFA 2NQ8A 1YL6A 3NV9A 4L4XA 4CUJA 2P5UA 4HX5A 3NEPX 3O38A 3RUFA 4LCJA 4CLDA 2OP0A 2ZATA 4G81A 1OMOA 3OEWA 4LVCA 4Q3EA 2Y66A 3G0OA 1IY8A 4CM4B 1E0DA 3E82A 2A9FA 4ZD6A 4E2XA 1DBVO 3JQ8B 2QQ5A 1OFGA 3I52A 3OQ1A 3PFWO 3VH3A 5A5EA 4MVJI 3KRTA 2JFHA 3GAZA 2EERA 2GZ3A 1X14A 4J1SA 4BNJA 4BMSA 3COSA 4FJ1A 1O94A 4HFMA 1K89A 1HZZA 1DAPA 4LMRA 4YVFA 5COAA 3C3XA 4QSMA 5DCYA 1FDVA 1BW9B 2IXAA 1R4MA 4NG5A 2CFCA 4QO7A 4J7XA 2HUNA 4GKVA 3GC6A 1ZO8A 1P74A 4K1LA 3OIDA 5H82A 1WW8A 4CQMD 2FRDA 2ZJ1A 4W9NA 3F5SA 4FDAA 2YFHA 2FR1A 3NRCA 2B83A 3DZBA 4XGKA 1CIVA 1VJ1A 2VN8A 2B5VA 4JCOA 4RV9A 4M8SA 1BXGA 1HDCA 1V8BA 2CDCA 4L76A 3NT2A 4ZQFA 4BKUA 4L4SA 4NBVA 2YFQA 4HKTA 2EF1A 1QLJA 4PN3A 1D3AA 2FOIA 3MTJA 1T26A 1GR0A 3ROPA 4GMGA 1KVQA 3CE6A 1YONA 2DLDA 3PGXA 1GDHA 5CDYA 1VRWA 4CV1A 2VUSA 1GV1A 4L8VA 4EYEA 3AJRA 4KWHA 2P9GA 4GSKA 3MJEA 1YRLA 4LSMA 2C5EA 3WIDA 3WLEA 1M75A 4MIYA 3GGPA 4AJIA 1AHHA 3RUIA 2A92A 3K8ZA 1M6HA 4EJMA 5B4TA 2ZB7A 4FFMA 3QWIA 3PQEA 2X23A 1T2EA 4YR9A 1H5QA 3PYXA 3FTNA 4RDIA 4YB8A 2D59A 2BI7A 2O4UX 4CODB 1R0SA 2H1SA 4GBJA 3D5TA 4BO4A 1NHWA 3RBXA 3RCBA 5JC8A 1LDBA 3VPHA 3HFGA 4PZCA 4W4TA 4D44A 1C1DB 4KZPA 3GN1A 3JQCA 3RD5A 4XEHA 4DBVO 3U5TA 4MIEA 4N5MA 2GASA 4FB5A 1LX6A 3DB2A 3WYCA 4QUKA 3BTSA 5KNLA 3HN7A 2YUTA 1ISFA 3BHIA 5F1PA 4YJHB 5A3VA 1I3NA 4WLEA 2R6JA 2G17A 1B26A 1PJ3A 5IZCC 3BMQB 1D1TA 1VKNA 3NDRA 1WDLA 2WEKA 2FP4A 4I1IA 4KOAA 3ZWCA 4Y98A 1OC4A 5LCXA 3GVIA 5JDCA 1ZW1A 4MP6A 2EW8A 3ZWOA 2O7SA 2O4CA 4TMFA 1KVTA 1U2GA 2FR8A 5L4NA 3NUGA 3ENKA 1NR1A 1IOLA 1B8PA 2C7VA 3NTOA 1OAAA 3F1KA 5HRUA 3HDQA 5CDSA 2O3UA 2UAGA 4BGUA 3BMQA 1HE5A 1U4OA 2VYVA 3BMCA 3FNEA 3KTDA 4I5FA 4J1QA 1ISJA 3JCZA 4FFOA 1EBUA 3W4JA 4B4WA 1HYEA 4R9SA 1ML3A 1HDYA 4WLOA 4XD2A 1UXKA 3E9NA 3PQDA 3RI3A 1E7WA 2NVBA 3VC7A 3MJTA 5EN4A 2Y1GA 1UXGA 3RKUA 4EZBA 4FJ0A 4HFJA 1T1SA 1BMDA 1ENPA 2OFPA 4O6VA 3RQSA 1HE4A 1F12A 1KERA 2D8AA 4Y67A 4DREA 5JAMA 1XLTA 4E32A 5F1OA 4IZIA 5H81A 2PZKA 1PX0A 4NFYA 1Y1PA 4BNKA 1ZK4A 1B15A 3ITKA 3DDNA 4N18A 3ZWNA 3V2HA 1T2FA 3KVOA 2ZB8A 2VYND 4E2WA 4IQ8A 3N74A 2GDZA 1S7CA 1YB4A 1BWSA 4XQGA 1DJNA 1LJ8A 1I2ZA 4KUGA 3Q3CA 1ZFNA 4ALIA 4PLFA 2QRLA 1I10A 1OC2A 3B6ZA 2BRUA 1N9GB 1WDMA 1GCUA 3AW9A 3HG7A 2PZMA 2DKNA 3GQVA 4PRKA 3GG9A 3SJ7A 4CMIB 5L95A 1XQ6A 2HAEA 3K92A 4BNFA 4WCDA 2EW2A 2X9VA 3LF1A 2PGDA 4L75A 3ZWYA 1V6AA 2YYYA 4RQUA 4NBUA 4GL4A 3QV1A 4MOWA 3I6IA 3OIFA 1YS4A 4RZHA 1DOHA 4D7AA 2QHXA 3I4CA 4R1SA 3JYPA 4E5MA 1DC3A 1I8TA 2I67A 3FCOA 3LSYA 4DMLA 2VTDA 3BMOA 4A27A 4M54A 2VRCD 4QTZA 5HA5A 3VOSA 3WFJA 3DL2A 2FZWA 4NPCA 4FD3A 3PFFA 3PDJA 3PWKA 3S2EA 2CF5A 1BTOA 4B4VA 2QG4A 3GK3A 1PJQA 4D3FA 4BNMA 2BGKA 4E30A 3RWBA 3HJAA 1ONNA 2Y93A 4GGPA 4NU6A 2RAFA 3JYLA 4HADA 4FPXA 5AXBA 1SCUA 4MKRA 2ZJ0A 4AVYA 1ZK1A 4RVUA 2VOJA 5HS6A 2C29D 3DXFA 2P9EA 2NADA 2Y1DA 3WB9A 4DC1A 4ALLA 5I7SA 3KLPX 1WVGA 1JN0A 2RHRA 3ANMA 1XQ1A 2Y68A 2DFDA 4AFNA 3GFBA 5DN9A 4XRRA 1BXGB 5I8WA 5ILGA 1TXGA 3IQDB 3D1LA 1E3IA 3NTQA 1ENZA 5IDWA 1DIGA 1NAIA 4A2CA 2O50A 2ILTA 3GN2A 4YJGB 1HWYA 3C1TA 4TSKA 1UP4A 1U28A 4K9DA 4I5EA 2GD1O 1N8KA 3CXRA 1JLLA 3GOHA 3ZU3A 4ZHSA 2WE7A 2BGMA 4UEOA 5DNAA 2C7GA 3VZPA 3WGZA 3S55A 2BH9A 3OBBA 4K6FA 3GRKA 1PJCA 4YDRA 2E49A 4KQXA 2VHWA 2FHSA 1UJMA 3K73O 5JSFA 1AN9A 1MV8A 1V35A 4Z9FA 3WWYA 3IJRA 3TOXA 4QT0A 3DOJA 4LMPA 3GLQA 1QG6A 1ZSNA 1JQBA 3SBOA 1MLDA 1ZJYA 1NP3A 5TJ9A 5A06A 5B12A 1CYDA 2Z1NA 4CM7A 1MXFA 3TFQA 4EGFA 1E7RA 4OSPA 1G0NA 4LSWA 2VTEA 4J16A 3I23A 1OI7A 4XDYA 4ZJUA 4NBTA 2C5AA 4QQRA 1MFZA 1WZEA 2BGLA 3BA1A 5B1YA 1LSJA 2PGLA 5CG2A 1I32A 4I9NA 4UUNA 5ER9A 5ADHA 4WJZA 1MP0A 4CLOA 1EQ2A 3JQAB 2AQ8A 4FSHA 3UAGA 2DT5A 4CM1A 1KC1A 5TNXA 2BF7A 2Q2WA 5DF1A 4RPJA 3ON5A 3GDOA 3RC1A 4Q3CA 4U5QA 4PFJA 1KC3A 3EMKA 3RJ5A 5TJHA 1XR3A 1X0VA 5IXYA 1E3WA 4BO0A 1N1EA 4ZQGA 2O3JA 2J5QA 5JYDA 1YXMA 3ENNA 1EBFA 5A1TA 5JPIA 5A05A 4R5HA 3WOHA 2GUGA 2Q2QA 3OH8A 1WWKA 2EXXA 3ZW8A 1G1AA 3AFMA 2UUOA 4BHTA 4NK5A 4R68A 4GGOA 5BQFA 1EUCA 1V3TA 1QORA 3EHEA 1FK8A 4GKBA 5K6AA 2NQTA 3OICA 1BG6A 3QE3A 1Q7CA 5C3MA 1LSUA 2EHDA 1PTJA 3RUEA 4A0SA 5K0ZA 1DEHA 4LGVA 3ZWMA 3PZRA 1KIFA 1OBFO 3GRPA 1SEPA 2YDXA 3I3OA 1E7YA 3VDRA 1W73A 3JQ9C 1SNYA 1DHRA 1B7GO 2NTNA 4WNIA 4BO2A 4BO8A 5G4LA 5TGDA 3IUPA 1TVEA 1XIVA 4FOOA 4JQCA 3DOCA 3DMTC 4GLLA 4PG5A 4XYLA 1C1DA 1SPXA 3ZV5A 3AUUA 1NQOA 4UREA 2O2YA 3PHIA 2JL1A 3JD1A 4WCFB 2C20A 3C1AA 5JE8A 2GN9A 2Y1OA 3HQ4O 2DBQA 1E6WA 5GZ6A 4ID9A 2DFVA 3QRWA 4IJKA 2QZ9A 2AQHA 2OUIA 2PD3A 2V6BA 1J49A 4CQMA 3DBHB 3E5RA 1PIWA 1U3WA 2BLLA 4NK4A 4OSOA 1U3UA 5A03A 1T24A 3W4KA 3ZWWA 3ZW9A 3GPDG 1ADGA 5T57A 1V3UA 4D3SA 3NJ8A 3HADA 1ZZEA 4OJNA 4OOEA 5ER6A 4YJDA 2W2LD 4ZGWA 3KEOA 1U5AA 4F6LA 4BO1A 2GZ2A 4M89A 3ORFA 1EK6A 3O4RA 3O9ZA 4AJ1A 1E1LA 3LYLA 4KTVE 3X2FA 2RH4A 2PWZA 3DONA 4Y8VA 3AK4A 4S1VA 1VJ0A 2XOXA 4RO0A 1Z82A 4YWJA 3ST7A 4DTIA 3PVZA 1ZMTA 1GY8A 4GVLA 4IJUA 4BNWA 2VQ3A 4CMEC 2GZ1A 4J90A 3FR7A 5JLAA 4U0JA 5BNFA 1TLTA 2DTXA 4D43A 1LTHR 2AG8A 1YKFA 4J3FA 3FNGA 1GU7A 2PK3A 3ZI0A 4CMCA 4J2HA 2D3TA 3RAJA 3EC7A 1O89A 3BMOB 4RPLA 3CPSA 3GZNB 1LA2A 4ITUA 3V1YA 2JFFA 3WGOA 3PGJA 4W6ZA 3PDUA 3LZ6A 1DIHA 1EZ4A 1V9LA 3ZHXA 1P31A 2GGSA 3Q0EA 1M76A 3BAZA 4OXNA 4AICA 4CUZA 1RPNA 3JQAD 3V2UA 1GL3A 4W9NC 4XYBA 3ZNNA 1P3DA 3UUWA 1LSOA 1JWBB 3C8MA 4E5YA 4J49A 2VUTA 4P22A 2Z5LA 1ISMA 1RYDA 2ZTVA 1ISIA 3G1UA 2OP1A 1UUFA 3MOIA 4Z3DA 2DTDA 1BDBA 3D64A 4YRDA 5I7EA 1N92A 1NPYA 1E3JA 1QKIA 2E6UX 3AI3A 4YAJA 4R1UA 1YGYA 2X0RA 4JBIA 3LK7A 4BNVA 4YEDA 3CSDA 3DBVO 2R00C 3S1LA 1XA0A 2EG9A 5ENDA 5CFZA 1U9JA 2B69A 4IDEA 4I5GA 5DBGA 5B37A 2OORA 4IJWA 5T5QA 1GQ2A 1HDXA 1JTVA 2TMDA 3GHYA 2B35A 1FJHA 3QP9A 4MVJG 4BMNA 2O3TA 1B8UA 1EDOA 2I65A 2IEDA 2Y1FA 3UXYA 3KUXA 5I7VA 2H6EA 2ET6A 4GVXA 4O0LA 2AHRA 5IN5A 4DQXA 3SC6A 5KVQA 3AOEA 1PQWA 1HDGO 5ITWA 3C7CB 2Z1MA 3LT4A 4DMMA 2C82A 2E37A 2X0JA 4JIGA 4D42A 4HV4A 5A04A 1HF3A 1HE3A 3WGHA 4H7PA 1QMGA 1X7HA 1ULSA 2ZK7A 4H15A 3AUAA 3KYCB 1F14A 4JNKA 2AEJA 2NVUA 4QFDA 4EI2A 4Y9DA 1IHXA 2QX7A 4P8RA 3OJLA 4HFNA 3DFZA 1EVZA 4J1TA 4L0QA 4WEOA 1YQGA 4L74A 3WYBA 4ALNA 4CMEA 3CEAA 4IMRA 3S8MA 2UVDA 2VWHA 3I9MA 1ZK2A 3MJSA 2LDXA 2YJZA 3VPFA 4FFPA 3PIIA 3GNSA 1PL7A 4PCVA 3PHJA 2OBNA 3VHRA 3ZWVA 5I7FA 3E5MA 1Q1NA 2FY8A 2Y05A 3EVTA 4Y6RA 3IP1A 3DAPA 3I6QA 3P2YA 1DC5A 3A9WA 3SJUA 2Y99A 4DWVA 3ZV3A 3EUWA 2VWGA 1OZAA 4D0SA 2P68A 5IN4A 5JC1A 1D7OA 4BNTA 2VNSA 3NGLA 5KJFA 4AJHA 5CAEA 2PZJA 4D45A 4BNIA 2ZB4A 2WM3A 5T6BA 4FS3A 3T7EA 4ZRNA 2Y0CA 1SB9A 4UUMA 3DTTA 1PS9A 2AE2A 2YV3A 4FR5A 2W2LA 5IDYA 1RM4A 3L9XA 3MWEB 5JO0A 5JXWA 1DAOA 4PLHA 3W1VA 1P44A 3QWFA 3H3FA 2BFAA 4TRNA 3M1LA 4AJKA 4FN4A 1PS8A 2V6MA 2A35A 2D4AA 4JBGA 5KVSA 3WTCA 4YRBA 4WECA 1LDGA 1P0CA 3V5NA 2O3QA 2HRBA 1Z74A 1VSUA 3BTOA 2Q50A 2VHZA 4IXTA 2X7HA 3IJPA 2NTJA 3LC1O 1AGNA 4YTEA 4E21A 4HWKA 1RM5A 4TZTA 1UXIA 1P1JA 2AQIA 2RIRA 4MJLA 3ROQA 5THQA 4AG3A 3RU9A 4JP3A 1E7SA 5JO9A 1MC5A 4IJVA 1ZUD1 2DBRA 4MP3A 4UVEA 2I9PA 3V2GA 3QVXA 3I9NA 1YQDA 4IUYA 5JYEA 1NVTA 1L1FA 4ZQHA 2UYYA 5HM8A 1MGOA 3AY6A 2LDBA 2AW5A 3U4IA 4CMGA 1CETA 3RUHA 2B4QA 3QVSA 3TPCA 3W6ZA 4XGIA 3PPIA 3PTZA 1TT7A 2HMTA 2VNAA 2PKRA 2FWMX 2NTVA 1SBYA 3WIEA 1HLDA 1I3MA 1NYTA 1ZIDA 4NDNE 1IULA 1EEHA 1SZJG 3OJFA 2HDHA 1YVEI 4NFHA 5LDHA 3JQAA 3EK2A 1JA9A 3R1IA 5JAIA 2HQ1A 3JQ7B 2DU8A 3E9QA 4WNCA 1EK5A 1NTOA 3O8QA 4RLHA 5DP2A 4EEZA 1E1NA 5DULA 5COQA 4GH5A 1EUZA 3ZWAA 4WLNA 2EKLA 2YY7A 1V0JA 3W4IA 2JD0A 3RUAA 3PHLA 1G6KA 3TQHA 4IIUA 3DZHA 3UFXA 2WYUA 1ORRA 2PZLA 4RF5A 2FR0A 1U5CA 2ZB3A 1W8DA 2DPHA 3G3EA 1M67A 5A9SA 1GFSA 4B8ZA 3WGTA 4BVAA 1H6CA 4LN1A 4M55A 4WLFA 3VZRA 2P4HX 1MC4A 4W7IA 3KV3O 4MVJH 1LQTA 4OH1A 1XGKA 2NV6A 1BHSA 3JD4A 3OJEA 1O95A 4B7XA 2IZ1A 4CPDA 2DBVO 4R51A 4CV0A 4RVHA 3V8BA 5I9NA 3LF2A 4CQLA 2YHIB 4PG8A 3ZNQA 3CMMA 2AXQA 2PH5A 2ZYDA 4O59O 1FDWA 2HMUA 1PWZA 2B4RO 3OJOA 5F5LA 1R37A 3GGOA 3F1LA 4XA8A 3W8EA 3ZN2A 4BIIA 1GV0A 4KWIA 4PLGA 1NR7A 3FF4A 5C37A 3GR6A 3RFVA 2IXBA 4BQRA 2Q3EA 3AOGA 4CMBA 4EW6A 2DPGA 2ZTUA 2HK8A 3T4EA 3OP4A 4WKGA 4BKQA 1RM3A 4I8XA 2J6IA 3H8VA 2FSSA 3LQFA 4JJIA 5JMWA 1JVSA 3JQDA 1QRRA 4DLLA 3NX4A 2HSDA 4H16A 1CQJA 4IPTA 1XELA 1R16A 1YOVB 2I99A 2V6GA 3ZHBA 3JQBC 1DC4A 4IDFA 2EKPA 5ITVA 1NVGA 2C2XA 4NIMA 3ROKA 1M6WA 3FSRA 4BNLA 3WNVA 1GYRA 3JQFC 1LI4A 4YYZA 4ND5A 2A4KA 3H9QA 3UN1A 5K9ZA 1PGQA 1KVSA 4FFLA 2NU9A 3FR8A 5IZ4A 3PJFA 2XF8A 3IKTA 4CMKA 4MP8A 5HWSA 4MIOA 5G0TA 2HJSA 3DAGA 3F4BA 2PD6A 3PJEA 4D0RA 1JDJA 5TX7A 4XQEA 4RJTA 3UH1A 2PFGA 3E03A 5ILOA 3GEDA 4E33A 2CVOA 4OQYA 2EP5A 3HN2A 1HZJA 4WE3A 3NJ4A 1CWUA 4BUCA 3EY4A 3HNPA 3QWAA 2VZ0A 2QYSA 3FN4A 4L9RA 1C14A 1R12A 5L4SA 1HYHA 1J0XO 4BS9A 4RF4A 1XU7A 4E3ZA 3GVCA 3GPIA 1SC6A 1L7DA 1MG5A 1R66A 2OHXA 4PLZA 3AUSA 1FXSA 3UW3A 1ZNQO 1LNQA 1GYQA 2WD7B 4GSLA 1SOWA 2JAHA 4GWGA 1H94A 1Y5MA 3FBGA 3NAQA 4W82A 3SEFA 4UAGA 4PIVA 2RBEA 1VJTA 5KCZA 2J3JA 2H9IA 3SC4A 1NX6A 1GEEA 2EKQA 3ROMA 3AFNA 3ONDA 4NBWA 4WOJA 5EESA 4DA9A 1XHLA 4A26A 3GAFA 2J3HA 3W6UA 2X1HA 5CDGA 4TRRA 4HBGA 5CHEA 5A3JA 1IUKA 3JSAA 5DP1A 3EVNA 1HL3A 2E48A 2GN8A 2WJPA 3X2EA 5AYVA 5GZ1A 4Z9YA 1LLCA 4XJTA 1GUFA 1J6UA 1EVYA 3UCFA 4FFRA 1PWXA 2HO5A 2Q2VA 4IDAA 3PWZA 2GYYA 3D3EA 3HFSA 5GZ3A 2Y0DA 3UCEA 2EEZA 3HZZA 3ONEA 1GCOA 1I3LA 2VT3A 4YAEA 5KVVA 4OYRA 1CRWG 4J0EA 3F46A 4D46A 4FBGA 4PRLA 3E1KA 4LISA 5DOZA 2CF6A 3K2EA 5JFOA 2GRAA 3H65A 5JDIA 4E0BA 2JAPA 6ADHA 4ZVVA 2DVMA 1LRJA 3KYDB 1DJQA 4CMAA 1WXDA 3H3JA 1SO8A 5CEJA 3H5RA 3UICA 4AJOA 1O6ZA 2PY6A 2ZCVA 3KYDA 5TT0A 5BNIA 4RPHA 2JHGA 4XYGA 3S2FA 3DZKA 3Q11A 1I5RA 3NKLA 1PQUA 2HMVA 4IQ0A 4R4JA 4DIBA 5IJZA 3PZBA 4GMFA 4MVJD 4XZ3A 3IS3A 2D5CA 3AM4A 3DBRA 3OHSX 5EPOA 4M87A 4BGIA 4TROA 3ETGA 5IAAA 1Q0HA 3TOZA 3RUCA 3DTYA 2O23A 4EBFA 3NT4A 1VPDA 4YT8A 4KTTE 4XIJA 3RC2A 1NQAO 3CIFA 1A72A 4IDCA 1PJ4A 4PLVA 1Q0QA 2NACA 2X5OA 1A5ZA 1TI7A 4MVJM 5IZCA 3FPCA 3P2OA 5FI3A 1YBMA 1MUUA 4UVDA 2JD2A 2XXBA 3BHJA 1A4IA 2VYVD 4RLSA 3DZFA 5I9MA 3DQPA 3FHLA 4L73A 4BO9A 1NPTO 4DPMA 4W99A 4IZHA 2G1UA 1NWHA 3VTFA 1FMCA 4OL9A 1B0AA 1NXQA 3GFGA 5G4KB 3I9KA 1IZ0A 3CMCO 1UAGA 1WNTA 4MPDA 3JQ8A 4DQVA 3KSDO 3JQBA 4J9UE 1KYQA 2IDZA 3ZHYA 2DBZA 4JBHA 4CLXA 4RZIA 2ZYGA 4BL5A 1AXEA 3PEFA 4ZICA 1K5HA 4GI2A 3D0OA 3WG9A 3GA0A 1U4SA 1ZJZA 3H9UA 2CSUA 1EVJA 3V1TC 2O7QA 3RKRA 4CMHA 5FF9A 1WLYA 1UDAA 3QY9A 1AHIA 3JYNA 4YQYA 1FF9A 4IM7A 3GGGA 1F06A 4R01A 5LDGA 4BKPA 3NYWA 3IAHA 4YCAA 1E77A 3T4XA 5T67A 3BTVA 3OA2A 1T25A 4B79A
chains in the Genus database with same CATH superfamily
1NF8A 1O5IA 4HLUC 4UD2A 3ZDYB 3PE6A 2X14A 4JJFA 1Z88A 1XZDA 2AMFA 1MO6A 3P19A 1PQYA 3I04M 4J75A 1QP7A 4IDOA 5J63A 5T3YA 1Q7TA 1XCBA 2AYXA 1B6GA 4R16A 5JFTA 4BKOA 3DCJA 4U8GA 1MEJA 3W5JA 2VDQB 1SCBA 1JG1A 3W2GA 3R7AA 3DW1X 4RGYA 1NW4A 3CX3A 2Q1TA 2JCGA 2FE1A 2VDMB 3A1FA 4DMHA 2CUZA 3NGMA 1F2TB 2NU7A 4QBGB 5I7OA 4XUEA 4HLCA 1F2UB 4ZOLA 4HNAA 5ES3A 4DCGA 3S1AA 3AQIA 2HN9A 1NVXQ 2PGJA 2CV0A 1LB1B 2WMNB 4JB0A 5BSVA 5CIYA 3O2NA 3KETA 3O4FA 2F59A 2V4ZA 2WJIA 3AHIA 4Y2SA 2HQBA 1ESNA 1U02A 4KREA 2XNDD 1A9SA 1UMBB 5HFAA 1EI9A 4BMCA 4RVSA 4PY2A 5I7WA 1NFQA 1RWXA 3R7FA 4F6RB 2CFOA 1Z4MA 2Z2JA 1T9HA 3O3MB 2ZRBA 1QF9A 2R7LA 2IUYA 5EJEA 1QB7A 1QSGA 3Q1KA 4URWR 4MB2A 5FWDA 1L5LA 3PDIA 4NE7A 3G2MA 3GQBB 3OUUA 3RABA 1LDMA 5L7WA 3EEOA 3TYXA 1TAUA 4AWAA 4DLSA 5FDFA 1HM5A 1X1RA 5DSZA 2I76A 4FMDB 4NCJA 1G8JA 4PPNA 3V7WA 1FSZA 2BMVA 2JG3A 1ULHA 2B4TO 4PG6A 3JWPA 1S6YA 2I1WA 4CQLB 5LZ4A 3FHJA 4QM6A 3DB1A 1EDDA 4LHXA 2ZRMA 2XLBA 3IBYA 1X94A 4O25A 4L6AA 1NM5A 4YP5A 5JANA 1V2GA 3M89A 2ODTX 4IIXA 4NSNA 3CPJB 2R68A 3PI7A 3WWZA 1HNNA 3IUEA 4WVFA 3CG0A 5AHOA 3DV0B 1N6PA 1LNSA 2QJFA 4R1NA 1QHXA 2BZ0A 2AN3A 1RXVA 2DR3A 3L40A 2IYPA 5LC1A 2HXYA 3UGKA 3ZEIA 4PGGA 1F5NA 2I2FA 2UVPA 3I76A 3EVDA 1JEDA 1VECA 1LQUA 1NP6A 4LCEA 3R9WA 1OHHD 4UBJA 5JPCA 1LSSA 1P73A 1XDDA 1YDEA 2YWFA 3ZH9B 1XZKA 2ZLBA 3CBGA 4BNYA 1WG8A 1HQKA 5L51A 3JQ7A 3HK2A 5G0WA 5A9RA 4Q21A 4NHOA 3FD8A 3W3ZB 3OLYA 5L7YA 3PFNA 5ADUS 4K6OA 1IVSA 1XZFA 2ZR0A 3PUHA 3V8MA 1XXHE 5DX8A 4GI5A 1E79A 3F9IA 3OG9A 4N76A 1ATIA 1MVOA 3FLAA 3NJRA 3UH0A 4ZCTA 3UMRA 4Q12A 2BEUA 4UM5A 5DYWA 5FR1A 4XDZA 8OHMA 2GTPA 3NOQA 3AEUB 1HETA 4DUGD 4E11A 5AVRA 3HZOA 1O03A 1QG4A 3NEAA 4FHFA 1TIBA 4K6MA 2QM8A 2HEIA 4FI3F 4LTDA 1KTVA 2VZ8A 4KYUA 2IEBA 3WLLA 5EHXA 4BZPA 2PLAA 5TC4A 4IFBA 3DGEC 2KSQA 3TIGA 3GW8A 2RG7A 4NH4A 2PMDA 2NW6A 2HOQA 3D4BA 1OFHA 4MYHA 1PV1A 1MJFA 2YNMC 5JD5A 3PEVA 3SX4A 1R5OA 2QL6A 3FOBA 3SMQA 4DM3A 3E22A 1MC8A 1G8MA 1LBEA 1T9ZA 4FLEA 3BF8A 1IH8A 4JVOA 3U44B 1CPYA 3O03A 1A8PA 3B1FA 3GJ5A 1HKHA 4GOXA 4OBXA 3MINB 5FPTA 4JFAA 3DKVA 4U0KA 3DO5A 2L17A 3U4MA 1RWNA 1RZ3A 2GS9A 3LWNA 1R27A 4O2AB 4IXDA 4Z9XA 2IZ5A 1VSVA 2ATCA 2ZAIA 4DJFC 5HZHA 4MYDA 1ZOOA 5BOVA 4MYRA 3CXUA 3ZC3A 3HJRA 4PU0A 5HPYB 2QD5A 4M0LA 2ZRPA 4OBEA 4FWTA 1PVOA 1HLPA 4MCIA 5K01A 3NLLA 5EYPA 1YE3A 4Q00A 3OZFA 2FETA 1R0KA 2J07A 4AMVA 4R1QA 4PLYA 1EK0A 3NU1A 5M3BA 2B1IA 1XL1A 2XUOA 3DZIA 5HQTA 1CUDA 1IZ8A 2RBGA 1WZIA 2RGWA 3V8EA 4HNQA 1YHZA 1IXSB 2VT6A 4H6VA 1G9SA 1NYLA 2NU6A 3G9QA 1CG6A 1KK0A 2O3SA 4M86A 3U31A 1Y5RA 1L7PA 4DUYB 1DFIA 4LHYA 1OLXB 2R84A 3AMVA 3IEUA 3OOSA 2H2GA 1CEEA 3N7AA 3QQPA 1LEHA 4OKIA 5DK4A 2IS6A 3KR0A 4K81B 2OZKA 2XBLA 4KYTA 4CL3A 4NCNA 4LRUA 5K0BA 3PR2B 2BEVB 2VP5A 2XGJA 4K88A 1UEXC 3KXIA 4CM8A 2M6SA 1AT1A 3MJ4A 2J0SA 2VBGA 4FCTA 1EWRA 1ZK0A 2AZ4A 3T5CA 1MW9X 2W6JA 4TTQA 2VHEA 2AQKA 1FQJA 2C04A 3HVUA 3JPWA 2HNKA 3WB1A 5JV5A 4OQLA 1BW9A 3EBOA 4KYVA 4ZO9A 3VKUA 2PUGA 1WPRA 4IWXA 4FC6A 3C4VA 1RABA 4PVDA 1I3KA 1QIDA 2QPLA 2W90A 1QH8A 2LD4A 3BD6A 3O21A 4XCVA 4NOLA 2VK2A 1WZ2A 1DB3A 2OXFA 3BXHA 4C30A 1X7GA 1H0KA 2NVUB 1FMTA 3J7TA 2C07A 2B37A 4GOND 1PNTA 2YVAA 3J80A 4FZVA 4EHFA 4EOGA 1RHQA 4Q7KA 1CJSA 3KSMA 5A3SA 4RY9A 1N5LA 1Z15A 2FP3A 3RWOA 2B5WA 1ZU4A 4P4TA 2NWQA 3JALA 2ERYA 5G0VA 5B4UA 3F8SA 1W0JA 3K70C 3LCJA 3I1JA 4DCJA 4Q9KA 1KZ6A 4WZ6A 4JODA 5C4GB 5KYGA 5FAXA 3ROGA 3I04A 1NLYA 1CVRA 2Y0PA 1MT0A 4WK4B 4YPVA 4C89A 1ST2A 2CHQA 5A4KA 4JUBA 4ZPXA 2XWSA 3TLAA 1E1QD 1YA4A 3EG9A 3VNSA 4YRJA 4YT4A 2XGMA 1M83A 4O8ZA 2BHLA 1P75A 3KBOA 2OTCA 4Y6GB 1OX4B 3IP6A 3AI2A 3SP1A 1EB9A 4XDHA 4DIFA 2R4TA 3ND8A 5IMSA 5KOJB 4DCCA 1C0IA 5DWQA 1G7RA 3WRWA 1K5GA 5AI4A 2DQSA 1W35A 1Z45A 3WLJA 1KSJA 4EI9A 2VAVA 5DBFA 4OAQA 2C84A 1K7XB 1KNQA 3BMXA 4EYQA 2I7VA 1SOMA 1CZOA 1A69A 1V8FA 3FPLA 3M70A 1J22A 4EDHA 4TT8A 4UUPA 4YRMA 3OT1B 3EGOA 1RZRD 1M34A 3N0XA 3VTAA 1WZCA 2JFUA 1O58A 4RF2A 3V1UA 4I8DA 1V37A 1THMA 3WKEA 2ZAOA 1Y81A 3SLGA 2JLVA 2XQIA 5CG1A 3E6AA 1OAOC 3L6CA 5L3SB 5JU6A 3BHMA 3A9CA 3MVEA 4REOA 3CH6A 1QHIA 2QAGC 3QBJA 4RTNA 3GLIA 5TSDA 2FE4A 2O5CA 5E1MA 3V97A 5BUCA 1CIPA 1SOVA 2GVNA 2GF0A 4DHWA 1S2DA 5FWAA 1AC5A 1M8FA 2EV9A 2ZBPA 1J23A 3A1NA 4ND1A 4Y2JA 5L9AA 1LC3A 5SYAA 3TM4A 3UA4A 3ZBTA 3PP8A 5ALWA 4LE0A 1EYZA 1CLUA 4PS1A 4GNRA 4BNZA 2VJDA 2VZ9A 4NYMQ 5I9TA 3DHYA 4CTJA 2PSSA 4C5CA 1P4RA 1DEOA 3PC4A 4XM1A 2QAGB 3DUFB 5ALVA 4N0EA 4ABTA 2G5CA 5IC4A 4IDNA 2J5XA 2EZUA 4FYPA 4G5QA 2IZ7A 4B35A 4JBYA 1AE1A 4XJSA 4ZU3A 1J5EB 2QW1A 1PYDA 1FVOA 1A0OA 1QYIA 2JGKA 1M5UA 3CZRA 3R3XA 4BZQA 4FP9A 3ZCSA 1QLHA 2ETVA 3PGVA 5IMBA 3NM5A 2QTNA 4GP7A 1FTQA 2J6CA 3CRRA 3EWNA 5AVVA 2R85A 2OCLA 5KJ1A 1K86A 1L4FA 4G1EB 1M2FA 2C96A 4K9KA 2CKDA 5KDLA 3B1ZA 1M2WA 2VPYA 1XZJA 4LECA 1AF7A 3HWRA 3UWKA 1Z6XA 3DZCA 3HJNA 1BU5A 4PAGA 4CCWA 3Q2OA 3EX7C 3ZJUA 5EXSA 3UXMA 4B6GA 2B99A 3VYVA 4CMIA 3BG5A 3N0RA 4L0CA 3BERA 4IFIA 4Q9NA 3ITEA 1H2RS 4MQFA 1HC7A 5FPYA 2J4DA 4YT5A 1X19A 5FFFA 3VYRB 1NU8A 1DRUA 1NRWA 2Y9YA 3UTDA 2BJVA 2QR5A 3IEIA 1ACJA 4LPSA 4DQUA 3SNHA 3FPBA 2P5YA 3C97A 4G1VA 1B8VA 3O9MA 2QYOA 3ELDA 3QXJA 3E9MA 5LDDC 2WB2A 2BGWA 3Q9LA 1P8AA 5EJGA 1U8YA 5F33A 1ZGHA 3UEOA 1CHNA 3ZGYA 1K66A 2H92A 4DXHA 4A1OA 3I5YA 2ZQZA 3DD1A 1B6TA 3SS8A 4E5SA 1GXSA 2AOTA 3U7EB 3MS2A 3BSSA 3HDVA 2IYZA 5DDIP 4EFNA 5IDXA 4KKVA 5LQNA 4DANA 2PUAA 1DO0A 3BIOA 3R09A 2BEWB 3WWOA 1XDUA 3V4PB 3CRZA 3L92A 4I14A 4RFSB 4GEGA 2I22A 1OWNA 4NBRA 2AN4A 3L41A 3WNQA 3QTLA 5DVZA 3I30X 3PB3A 1Z4QA 3CS3A 5PGMA 3F78A 4E03A 4EITA 3B7PA 3MUOA 1JXOA 1PI3A 5KYWB 5JD4A 3ZV6A 1KZYC 3P2MA 3S2ZA 4AIRA 9ATCA 1AQYA 2AI2A 2NYVA 1Q16A 4HUJA 4RL4A 5IJAA 1RXYA 4L28A 2H4YA 2PN1A 4QT4A 4D6XA 1ESMA 3D7KA 2W2MA 5E6UB 3K0KA 1U2GC 1T36A 2AIRA 2C9ZA 2W6JD 2ZQYA 3REFA 4AZ3B 1ECGA 1JQ3A 1QHYA 1ZGJA 4KUHA 2G76A 2J8ZA 1GGMA 2JCXA 3GLTA 1S2NA 3IHTA 4HEA6 4LJ5A 3HU2A 3WSTA 1MT3A 2IZ0A 4Z0HO 4Y6LA 3I8SA 1BHO1 4OLJA 4S1OA 5ETJA 1R4NB 3UHPA 1KZ1A 4F2HA 3PPYA 3KP1A 2JD1A 2CBZA 3VDMA 5EJ4A 3HCNA 3Q2IA 1ADJA 1ZXLA 3GVXA 3LL7A 1PGOA 2KHZA 1ESCA 2PSDA 2OWDA 4MTLA 1KEKA 1BDMA 4KPFC 4PV7A 5BN5A 4HQKA 1Z4OA 2A8YA 4WA8A 3L6EA 4WGFA 3U13A 2BBTA 2KQUA 4EMUA 2QY6A 4BLPA 1Y8RB 4TSFA 4DV0B 1YNSA 4F06A 2O2SA 3K4HA 4G3XA 4HLDA 2O52A 2ZTLA 2FN9A 2W71A 4D79A 4FOPA 4ODIA 4B3DA 4JL6A 4BZXA 5HKLA 2BCJQ 2GT1A 2ZWIA 5LWQA 5IWAB 3KQNA 5IWCA 1V7PC 2A0KA 2WC1A 2WKQA 4UEJA 1ZH8A 4RZ3A 1YNOA 3ZDEA 2NMVA 3HKEA 1NXSA 2QN7A 4V3BA 1G8GA 2BL4A 5FEUA 1BD3A 1RXCA 2IA5A 4YNBA 5KWVA 3AY7A 1LC0A 1EX6A 2H31A 4KAJA 4MS1B 1EHIA 2BM1A 3NR2A 3PQCA 4CG3A 2ZTSA 3FCXA 2ZRNA 1GYPA 4UVGA 3CKYA 5FYDA 2PZ8A 3LIPA 1XRLA 2W2OA 4KFUA 4QARA 3B13B 3AF3A 1C3EA 5EMHA 4JC4A 4BPBA 1KFJB 2HCTA 4F5EA 3CUTA 3E8XA 4A4DA 4S04A 2D5IA 2BM9A 4Z99A 1N0IA 1P3JA 2WNSA 5G53C 2C8KA 4RD6A 4UBOA 5CJPA 4H3VA 5PNTA 2QQFA 3V6MA 2J0QA 3T1HB 3H5TA 2WA1A 2GARA 2HL6A 5A0TA 2Y71A 1KI8A 3UT5B 2W22A 2H2FA 2QAJA 5F7ZA 5A2GA 2XRYA 4RYLA 1KSHA 2Q9UA 5DNYB 3JARA 4V02A 4DL9A 1FRNA 4C88A 1X87A 2IYOA 4LK2A 4ETMA 4JLWA 5LP6C 1YKGA 3A3OA 3FUTA 3BQNB 2OBXA 2C7QA 4DGQA 4M38A 4X64B 2II6A 4J3JA 3ELBA 4V1CB 3VBCA 4DILA 2AF4C 3EQ8A 5DNVA 3V1LA 2FPUA 2I62A 2D2IA 4F4FA 2P30A 2YN0A 2XVXA 1J8VA 3N59A 2XOEA 1T9GS 4Y0VA 2Y6UA 4CF4A 1GPDG 3IMCA 4M49A 4UNIA 3IILA 2X76A 1L5ZA 2GESA 2JCSA 3MLEA 5BW4A 4OHRA 4GM4A 4B7AA 5CFQA 4UATA 3OIGA 3GEGA 1P9RA 4XJXA 3U9LA 1G5HA 3EYAA 1Z2PX 1P3Y1 5K8VA 3DZJA 3PUWA 3RS3A 4EYOA 5FTJA 2Y1CA 2A78A 4GMXA 4PX9A 4ZJPA 4HO1X 5AXDA 2P7IA 4GZ3A 1JI3A 2M2IA 4JJ7A 5CLIA 3KXDA 1I80A 1GQQA 1E2FA 3LLSA 5DHTA 5EUMA 5IT0A 4Y9TA 5IG2A 4BO6A 2C94A 3RFCA 3GDHA 3W9SA 1GEGA 4QU8A 4XGNA 2WVHA 4R5MA 4IWYA 2A5YB 3OT4A 1BX1A 1KSGA 4A2PA 3M2PA 3NYRA 3C43A 2QLLA 1C9MA 1TADA 5GIPE 3CZ5A 1FIUA 4HT3B 2P5TB 5TS3A 4KDFA 5D00A 5L7TA 3MQ2A 2CJFA 5IRCD 2RI0A 2A0WA 1M2OA 1N57A 2XQFA 3GD5A 5KNBA 3BXGA 5KX5B 4AS2A 3E5NA 3OWOA 1B3BA 1ZUNA 2V6FA 2ID9A 1QGUA 2BC9A 5CD9A 3WHLA 1KXJA 1UBOS 5KYVA 1N78A 1NT2A 2YBDA 3HB1A 3AUTA 2B61A 5AI8A 2GO1A 3TNLA 2WIJA 3B85A 4KCGA 2A5FA 1NQVA 2HQOA 3IALA 1XCOA 3S2UA 1WOMA 4I3FA 3SY8A 1KMMA 1XHEA 3U49A 2MR5A 5BN3B 5FUQA 2GYUA 2FFHA 4HAOA 2JFNA 3G1TA 4RENA 1QNLA 1YCFA 3D8NA 5J5CA 3P27A 5IPFA 2Q1SA 4PX2A 3RSFA 4CCAA 4GYWA 4JYAB 4K6HA 1NYRA 2XE7A 3RIYA 1V5EA 2PKQO 5KSOA 5I8ZA 3EW9A 4HWPA 4CU2A 5DNUA 1C3JA 1SH7A 3I1FA 1JE0A 3X1ZA 4CEIB 5JJIA 5F2NA 1J90A 1R3UA 3MS4A 5LBTA 4ZGBA 1CZKA 5EJAA 1ZJ6A 2I6FA 3GEHA 4MCJA 2H17A 3A9VA 4JXJA 1PK7A 1KEVA 3R41A 1SA0B 1WCV1 3CZCA 3D6VA 4FYIA 1Q74A 1GRVA 1WPQA 4MULA 5A71A 3LFHA 2GWRA 2PH1A 1G5FA 2ZCUA 3EDCA 3KPWA 3PPVA 1LBTA 1CFZA 2AOVA 3O1IC 3OFND 1FQWA 2WRZA 2FW9A 4Q1CA 2GCGA 4X61A 5EHIA 1M74A 4LBVA 1QZXA 4AJJA 1JKJA 4DJJA 2V5UA 1T9KA 1Y5IA 1QZ3A 2XUDA 3EE6A 3EXG2 3OT1A 4GBED 4KR9A 2QTZA 3TN7A 4ARUA 4YV1A 3ZCXA 2YQZA 4V1CI 3IBTA 4C0AC 5LA6A 3W5CA 4C01A 3MCUA 5IUNC 4XXHA 3U4CA 4CNBA 1R6XA 5KKAA 5L3QB 1YC2A 3FXAA 1DCMA 3TZCA 1NGSA 4BB5A 1JJAA 2IYVA 1RQGA 4NQZA 3R6WA 2Q7XA 1DQYA 1G64A 2HK9A 3NWEA 3KV1A 5KINB 1CQJB 1MMFB 3G49A 3RO7A 2BHNA 5HIIA 4WLUA 1NIJA 1YQQA 7AT1A 2MHCA 2FN8A 1S3FA 5CD1A 2ZJAA 5F1YA 2PJRA 2CCJA 3EF0A 1DWOA 4FFNA 3GUVA 4J4HA 4QGAA 6YASA 3L79A 1E3EA 1RPZA 3SDSA 4G5HA 3RSGA 4CLHA 4CMJA 1EQAA 2V3WA 4FBMA 1BE8A 5GVSA 1AUXA 3AM1A 3OPYB 3N2GB 5EJ9A 1IE3A 1MB3A 4GX2A 4Q39A 3NBYC 2WWXA 3WGIA 2N46A 2WU3A 1YB2A 4TV9A 3FH0A 4CR8A 4XVUA 4TPKA 2LKDA 5CDFE 1E0JA 5AQ1A 3MUFA 2XYVA 4EF6A 1OI2A 2A1UA 2PS9A 5LXTF 3SXJA 3FZNA 5IFKA 2AC7A 2R66A 4PZEA 4F3YA 4KHPB 4K9NA 4RH1A 1P7VA 3ZHCA 1ETUA 1XVLA 3CVJA 3E0XA 3KJFA 2UYOA 3OJWA 4GRIA 4XB1A 3S2YA 5LA6F 3RJTA 2XTJA 3QVGA 3I5MA 5DSTA 3ZV4A 4BE7B 4EF4A 2JPDA 3HBJA 2HPHA 4RPKA 3ICQB 2R6FA 1Q0LA 3TINA 4G0WA 1DHTA 5FP0A 4E94A 1CFJA 1ICIA 1I2BA 3T35A 2ONZA 1G19A 1H2BA 4NZYA 5AW5A 5EJ6A 5MF6A 1ID1A 1W2WB 2Q28A 3ZE8A 1B6SA 3JYQA 3MS7A 4LW8A 4AUNA 2XECA 1R0RE 3L2OB 2WIKA 1MRZA 1QE5A 3T3GA 2VT2A 4I6EA 5KTKA 4QYXA 2X9QA 4R8RA 3PIDA 2OFWA 2YQ5A 2WPDD 3OM1A 2VP2A 3F5QA 3BMNA 3GCDA 2GN1A 3SBDA 3EN0A 4AF7A 1A98A 2IXDA 1QYDA 2PNFA 2O7VA 3LBHA 4TUYA 2REQA 3PK0A 3VQTA 2OZPA 4ZI7B 3WIOA 4DLBA 3KWMA 4DKJA 4ZKEA 1ZJJA 2V6IA 3CUUA 1VL8A 4M37A 2JHFA 2QI9F 2FG7C 2Y0EA 2GCOA 5GV8A 3V48A 4Q3DA 1SQ5A 4KMOA 3IKLA 1GZ6A 2FP4B 1Z13A 2ZJOA 2E9SA 3ZDAA 2H4JA 1P1FA 2FU5C 3U7GA 3CVVA 1NE7A 4IIJB 1TVKB 1N7GA 2Y2VA 4HUQB 1W6UA 2EFEB 4IMPA 5EEGA 2I7DA 3HI4A 4FYYA 3T3DA 1WMEA 1I7SB 2FW0A 1OYVA 3EFOB 3NHJA 4KPUA 2UYGA 2P5SA 4RMGA 3VSAA 2WZBA 4TSFD 2P4EA 3DMPA 3UUFA 1DQNA 1G2OA 1SKAA 1TT5B 4M9ZA 4UNRA 2QYTA 1GTVA 3C6XA 2WILA 2XUQA 2PMBA 2MSCB 3WICA 3N58A 1RKXA 4NKRA 3SFZA 5KMGB 2P8JA 4MVJE 4CT4B 3ZCRA 3O91A 1PS0A 4RIEA 4Q37A 3EXIA 3UC9A 1HUQA 3HBAA 2A0XA 4ZGGA 1VHLA 5FRDA 4POAA 1GTMA 1MX3A 3O2QB 1AKNA 1NBAA 1EGMB 5A6SA 1HNZB 3A37A 2R48A 2WVJA 3GVHA 2PAFA 3PUKA 3ZYZA 1JXAA 2C4WA 2C78A 1Q2XA 2Z08A 3TAUA 1KKUA 2J0EA 4J2OA 5FI0B 1BDJA 3DPSA 4BNXA 4EY3A 4ARBA 4IRUB 4DR4B 4P54A 3IMFA 3Q3GE 3URKA 1W34A 2A5DA 3MILA 4R83A 2E4XA 2O8NA 5ALHA 4MUJA 5TQ0A 3WK6A 1VPTA 4IDQA 3UWDA 3RBZA 2I7CA 2PSEA 2B0JA 4N3CA 3F90A 1PEDA 1K5DA 1HPLA 1QANA 4IY1A 3UAYA 3I2GA 1NBWB 1LD3A 2HGSA 4NYJR 3AT1A 3NT5A 3V7FA 3AEQB 2HA4A 4Y3UA 1ZM4A 2GFIA 4DNPA 4E5KA 1LBQA 1XAGA 3LU1A 2FFJA 2YJ4A 4MKZA 1TIPA 4DDHA 2F8SA 1H8EA 2AOXA 3OLWA 3ORRA 5JSZA 2AE1A 3GJ6A 3HYSA 1SC3A 1YZHA 2WB4A 2AKEA 1CDZA 4AJEA 3BBLA 1QX4A 5CFLA 3DDHA 1IK4A 1BGVA 2OCPA 5KNCA 3K71B 2JFXA 1RCTE 3PYMA 4Z0PA 3QIAA 2PA3A 3FF1A 1XZLA 5GONA 8ATCA 3VR6A 2B82A 2IEIA 1SELA 2BFMA 2FPIB 4L27A 4D6YA 2BUBA 4FR2A 3SXUA 4JASB 5MDHA 1Z38A 4N54A 2HFJA 2PQ2A 2R44A 3DLAA 4UDYX 1UKCA 2FX5A 2ZJ3A 5M04A 1HEUA 2CUNA 5DIFA 3IXQA 2IV2X 1W0CA 2BTQB 3A27A 1S2GA 4IXMA 4X6XA 4DRYA 4HNVA 1E5XA 1C0EA 3RRJA 1DADA 1YOVA 4K0KB 1SBHA 4QJ4A 4Q82A 4X84A 2UZ1A 2P9FA 3LT2A 4FE7A 3AHDA 1XV5A 1ZXBA 3A26A 5KX5F 1IK6A 4Z7JA 1FS4A 1SVNA 3EYWA 1X7DA 5C7OO 5DYGA 3HCCA 4GW3A 3PNVA 4KR0A 5EIOA 2ZM5A 1XWFA 1Z7EA 2RSLA 4R2MA 3IA2A 1VHTA 4ITRC 1ILEA 1EWQA 2PUWA 2PFSA 5KJCA 2J4CA 2G40A 1YZQA 3E7WA 3H2JA 4LCBA 1I5OA 2WV9A 1XCJA 2AOUA 1DSSG 2D3WA 2Q3DA 4DV2B 2IIPA 2Q3JA 3L06A 1WF3A 1GVNB 2RKBA 3AESB 2J6HA 1I01A 3JVUA 3X1KA 2XCSB 1DV2A 2PCLA 3NXSA 4JBNA 4DT1B 4Q19A 1E9CA 1R18A 1DG1G 1TJ5A 3M33A 4FFBB 5IT5A 1DE0A 1G2PA 1B2LA 4WACA 3HJBA 4Q24A 4N7MA 2EBUA 3C7KA 5JRDS 3GP5A 1Q7BA 2KE5A 3N53A 4DSNA 2Z6QA 1Y7IA 3IA7A 2GN2A 2Q99A 4ER3A 4GWKA 1R8JA 2VXCA 2B3TA 3D6FA 4L85A 4Y2TA 2IUUA 3WSWA 16PKA 1UP6A 4MVJF 1F51E 1QCCA 3AI1A 3AEZA 1GPJA 4N5LA 2JVKA 4G2NA 1PF7E 2ORYA 2FCRA 3GNTA 1UDCA 2LP4Y 1OLUB 1NA5A 1SHLA 3P9QA 4US1R 2BR5A 4WKBA 4A82A 5D7NA 2JLZA 4TRJA 1Q7RA 4G9BA 3FPHA 1V4VA 4KHZA 3VISA 3Q9NA 2ZUFA 1RAGA 5MGBA 1KF0A 2OXIA 3VNRA 1A5SB 1H0RA 1Y5NA 4X7MA 3FLBA 4TS1A 4C43A 3UK7A 2G5PA 2ZJZA 2IE0A 3RYFB 3QLUC 1DDIA 1SHZA 4B3IA 1EB8A 4NMWA 4FZ3A 4CUKA 2FZKA 2ZWAA 1XA4A 4PYMA 5IXJA 4ZVQA 1SHKA 3GY0A 2QQEA 2NZ2A 1P60A 1JSCA 4MWBA 1ZD9A 5F5XA 1E20A 1SC4A 4YJGA 3GRZA 3Q98A 4ZMBA 2DQKA 4AT1A 3ECSA 2VDLB 4RSMA 1DPGA 4PM4A 5CJJA 2Q7OE 3RUPA 4F3RA 3FNFA 3AJDA 4O5OA 4TTVA 4QE3A 1KH1A 4PYQA 4NR0A 3UC5A 5EP3A 2JIOA 5BVHA 4KN9S 3WLOA 3I09A 4K6GA 1H3FA 3OCCA 4H1HA 2H8GA 4J7CA 3ZNOA 2QTGA 2EP7A 1JJIA 3L6UA 2IW1A 4OQPA 2X0KA 4AY4A 2A4MA 1HG1A 4M0FA 4YJ3F 2ONYA 5DXJA 3ITDA 2X8AA 3MOGA 4ZEOA 1K3TA 3HSKA 4A0GA 1BKYA 1U7ZA 5MHTA 1S3IA 1YVDA 1MTZA 5JEDA 4BDTA 3M49A 3SIRA 2D0IA 2YV5A 4ZV9A 3DULA 3R3JA 2YH2A 3G7UA 3NAZA 2CL5A 3MGAA 2GLXA 1EINA 2WJ3A 3UK2A 1TVKA 1OVMA 2HZ7A 2RH8A 3M6UA 1UJ4A 3AU9A 1EUYA 3L4KA 4OFXA 2PJZA 2Q6LA 2QF7A 1YR6A 5U4XA 2R7MA 1GKYA 1L0BA 4KQKA 3OLZA 4ZC8A 2O0KA 1W4RA 2YIVX 4PYNA 5DMHA 2VUUA 3KT6A 5KTYA 4HQ0A 4FMDF 1ENYA 5EXPA 4C1BA 4B4DA 5BRAA 2WT4A 1D6NA 2JA2A 4JJZA 1E3TA 4WJLA 3LOPA 4TWRA 2NAPA 3BGOS 3L7IA 1AURA 3JX9A 5JI3E 3V4SA 2C61A 3WQRA 4AO8A 1ZBQA 1PR2A 3COYA 5LQMA 1FNBA 4IRMA 3M3DA 4F5WA 3U3XA 4A6DA 3ZVMA 4MWTA 4DR7B 2QRGA 2CJWB 2W6IA 4DPKA 2O2XA 2FSUA 4DQLA 1EE2A 5FLXA 3MAJA 1JQEA 4DJTA 1QVVA 4AY2A 3FYCA 5TEWA 2HJ9A 2HO4A 1BVRA 4X54A 2WJJA 4EF5A 3I32A 4IXWA 2CWWA 3ONFA 3J7AC 3VR5H 2QTRA 5HGXA 3IPCA 2JVJA 3BILA 4CQJA 2XNCA 3K6JA 4JLUA 2N42A 3PWSA 4H7FA 4PBTA 3AETB 1CY8A 5EQTA 1D2EA 3P20A 4KZKA 4Q7EA 2YV1A 4PLPA 4B9EA 1DT5A 1CR2A 2XTMA 3H5VA 4JD5A 3UGTA 1XN4A 4K6KA 4KDEA 4BAUA 5J59A 4CXMA 1K7FB 3GUYA 1H1TA 1HQDA 4B3JA 4EYKA 3WGYA 3T38A 1B6RA 4M9UA 1CJVC 1R8SA 3KD2A 1BYIA 1AKVA 1TZBA 2PTGA 2SCUA 1G2IA 2TMGA 3G5AA 3OCJA 3HB4X 4L4RA 3DOOA 4UHFA 1YV9A 5CXUA 1X7ZA 5KQMA 1ABBA 2XZTA 3EJWA 2ZRGA 1B41A 1C7JA 2X1VA 3FFWA 1XK7A 2OSVA 2VL7A 2XQGA 4PBSA 5DCUA 4AQ7A 3S7ZA 2V96A 1FFCA 3EA4A 4UMVA 4PC6A 2B78A 2J09A 2VYCA 3KLMX 4KVZA 4EM6A 2Q49A 3M6IA 2I4MA 4QBTA 4QQFA 4EX6A 3D4NA 2WF7A 1U94A 2VNIA 3W5VA 3HJUA 1PFVA 5JECA 3ER6A 3ECAA 3SJAA 3N8DA 3VOTA 4U7DA 1ZAYA 3I83A 1NASA 2GAOA 4Q4DA 3SHOA 2GK4A 4YMUA 1V8ZA 2CLEB 3HGTA 1RQ7A 2OK8A 3E3AA 2DX7A 3R5JA 4HAYA 1N4AA 3QXHA 3CQ9A 4KQHA 4CIXA 1YAHA 4R0NA 2PS1A 5B2FA 1Y7TA 2HI0A 2YIMA 1QYWA 2C8LA 2IOQA 2P4UA 3Q3VA 1OPXA 4B4KA 1LGYA 4GX1A 3VHLB 2O8EB 2F3SA 5DI9A 4H27A 1DG9A 2V9PA 4QFCA 3G0HA 2WD7A 4OSEA 1WUJS 4P4NA 4HOYA 4UEKA 1BO6A 4BQPA 4DA6A 1K27A 1N2GA 2YMQA 4YV0A 4LMBA 2ACVA 2XT9A 4AZ0B 3R7WA 3V9AA 1M1YE 3MD9A 3WNCA 3K32A 1G7SA 3RSLA 1PT6A 5AW6A 1HXHA 3LX6A 1PHRA 1GU0A 3AV3A 1JT2A 2NQ8A 1YL6A 1X2EA 2WPDA 5FPSA 3PGLA 1UC4B 4OIFA 3O38A 1FYFA 2R65A 1EFUA 2HZBA 4CEIA 1ULZA 2WNIA 1DC7A 4YXWA 3OEWA 1L7MA 2WKSA 1DAMA 3D43A 2X41A 3DYIA 3EZFA 4O8CA 4AMUA 3SIXA 1IY8A 3FZEA 4CM4B 1F0KA 2ID4A 1NT4A 1XRQA 2QL9A 2WOOA 4Z4IA 2QE7D 3E82A 4ZD6A 4MR7B 4W1SA 5KTPA 5KYTA 4MPTA 1OFGA 3PFWO 4H60A 3CLTD 2CE2X 3KTAA 3STWA 5A5EA 4HNTA 1T9DA 3KRTA 3PVCA 1AV7A 2AOUB 3CWQA 4PWZA 5H5JA 3V9PA 3X1JA 5C8VA 4YRTA 4RESA 3PWTA 3L7AA 2F48A 1ZL0A 2HPAA 1A9XA 3IVRA 3DJFA 4DLKA 5HKOA 2IUFA 4FJ1A 3KJEA 4DG5A 1IM8A 1CZHA 2J3MA 1K89A 1HZZA 2IL1A 2VDKB 5A6SB 3RS7A 4D99A 2OC4A 3G02A 3RVRA 4DDKA 3E9ZA 5CUQA 3C16C 4KLCA 1N5KA 3TW4A 1M5RA 1TCUA 1BW9B 1W47A 2CFCA 2DWPA 5I4KA 1VE1A 2HUNA 4LJYA 3OOEA 4Q03A 4MQ6A 3ZPXA 1F4LA 2FGJA 1EZ1A 2VYQA 4F96A 3OIDA 1QIEA 5T4HA 1LZLA 1U8CB 1PVDA 2CDRA 3EXG1 2FRDA 2ZJ1A 4R2WA 4JP1A 4I4TB 4CQMD 5KHOC 3PIRA 1XZCA 1FPQA 1Y80A 1TM2A 4RD1A 5C32A 2FR1A 4YDHB 4RKYA 1ISPA 2L2QA 4KJXA 3UENA 3FHCB 2PKXA 1XAJA 5BPFA 2XXAB 4CNQA 1GTL1 2EJTA 1GPMA 2X2EA 4JCOA 4DSAA 5TQ2B 2IVZA 1Y6GA 1V1RB 3UA3A 2XDYA 3TB4A 4KV9A 4L76A 4D6PA 5HMMA 5IASA 3BWYA 4ZQFA 3U7RA 5JROA 2EX1A 2GH1A 1T5HX 1QLJA 3MTJA 2FOIA 2O6HA 5BV8A 1Z63A 3M82A 1W96A 3DF7A 3QUSA 4U2GA 5C1DA 3INNA 1KVQA 1MABB 3IO3A 1MN6A 4N6OA 3IVAA 2G9ZA 4WHMA 1T2UA 1IY0A 2VUSA 1SD1A 2YJ5A 4QBKA 1GRRA 4LDAA 1UWVA 4LWOA 1D6SA 3G7SA 4GSKA 3LUDA 3MJEA 3RH0A 3GLSA 4OA5A 2ZAMA 4PFSA 1KE2A 3RUIA 4QHTA 3K8ZA 2HXGA 3KR2A 1FRQA 4EJMA 3UK0A 5JYCA 3KX2A 2ZB7A 1OXUA 3AZPA 2QOEA 2YFKA 1U1FA 1VKRA 4YX9A 3HJCA 4WVLA 4HTAA 2ODQA 2HWWA 1KOGA 4ENVA 1GITA 1AQJA 1GTG1 4RDIA 4YB8A 4XLTA 4A91A 3RVKA 3GFFA 4PINA 3VPDA 2H1SA 4BO4A 4V0ME 1KP9A 5JC8A 4KVAA 4N40A 4UCWA 3EXFB 3LUKA 1PFUA 4FDVA 4D44A 4CQNA 2P2YA 1ZWKA 2Z98A 2EKDA 1EK1A 1DJOA 2E87A 2B6NA 2NSYA 1O94D 3PR1A 4U6NA 2WF9A 5EGSA 4BBAA 3MWDA 3U5TA 3LPMA 3BXEA 4MIEA 1EFHA 1KTIA 1W5TA 3G2KA 4JEHA 4P2GA 5TDHA 4FB5A 3DB2A 3O92A 1CUCA 3MCAA 3HN7A 2Q4DA 3A1DA 3VNAA 2ZM6B 1CCWA 3L3BA 2R86A 1ISFA 2V1XA 2R5WA 3MWGA 5F1PA 1RYZA 5CW2A 5FHRA 3K0EA 3ZXYA 1MH1A 3QPAA 4QJ3A 3QLVC 4G09A 3KQMA 2G17A 2G5TA 4QOFA 1F7VA 2ORED 4HQOA 4EGJA 5HZMA 1MOQA 5BV2P 2K7ZA 2PTHA 3NDRA 1WDLA 4ZO4A 1BFKA 1LF5A 4F9GA 2C7RA 2FP4A 1CIJA 1XD2B 3P9XA 5A1TA 2VLBA 3TRKA 3ZCUA 4EYSA 1OFVA 4ZZ3A 2H3EA 1N5RA 2O7SA 2IE8A 2NSLA 2O4CA 1N2CE 4AX4A 3E1SA 4DSOA 2PE5A 4W5HA 4X6YA 1A95A 1U2GA 5A6VA 3VC3A 5L4NA 1VBKA 3FFTA 3UUGA 2IH4A 1CW2B 1I4EB 1TYBE 4YP1A 3ZVRA 5FWXB 3KKNA 3ZQKA 3NDBB 1FCJA 2O8BB 2O3UA 4BYGA 3C6MA 3GJ7A 3T5DA 1AY0A 2VAMA 4KGXA 3AKEA 4YS6A 1KOJA 4ZCSA 4HXEB 4B85A 3QY0A 4WOPA 5EG5A 4R8KA 1T3LA 1O6BA 1ADYA 3DR5A 2DFNA 3WNBA 1XAIA 4B4WA 1HYEA 4X71A 3ZY2A 5GIOE 1LQ2A 3PQ3A 4XD2A 3OPMA 1TMYA 1VIYA 3E9NA 4RQAA 2I29A 2OV6A 3ZJ5A 3ENQA 1E7WA 5EZ6B 3BORA 1PFGA 4NCIA 1U9ZA 4F72A 4F9FA 4Z4QA 3EEIA 1UJ6A 3TTUA 1R4ZA 1SQSA 3W78A 3TUZC 2XNJA 1GNLA 4NCHA 1BKDR 5LZ2A 4EZBA 4QHSA 5EZQA 3WLMA 2ES4A 1T1SA 1BMDA 5JAMA 4O6VA 1HE4A 1F12A 1BVHA 3EXFA 2MINA 1XLTA 1YRAA 3FCYA 3BJIC 1WW3A 5BV7A 2PZKA 2GUWA 3ZVLA 4V39A 4BNKA 1ZK4A 1XE3A 1VIMA 3DDNA 4N18A 3FRIA 2ZU0C 3L7JA 3S6JA 1N2BA 4S1PA 1T2FA 3ZWNA 3PENA 3CEHA 1TW2A 3CTPA 4QYWA 1P61B 3AB7A 3EIXA 1YB4A 1TM1E 4TT3A 4XQGA 1CUFA 1QGZA 5ALMA 4MVWA 4KUGA 1ZFNA 2EZ8A 3L04A 4OHMA 4R1MA 4ALIA 4PLFA 4MA5A 5JNUA 3E3MA 3EQ9A 4MRVA 1NJGA 4I55F 4KJZA 3ZDRA 4RPCA 4QDOA 4DN6A 5KQLA 4TWJA 4R8VA 1T1EA 2PZMA 5EA2A 3GG9A 3SJ7A 3GLGB 3CVUA 1L7AA 2HXSA 1BA3A 2PYIA 3UJNA 1TZ2A 4MUYA 2I6XA 5I4BA 3IQXA 4JJ6A 3QELA 2X2FA 1V6AA 4C76A 4KR6A 2LKCA 3USCS 1XOIA 3I6IA 1P4GA 2IZOA 4KLZA 3PCXA 3KOXA 5BR1A 1DKOA 4D7AA 4PSUA 3DBOB 3NDPA 4PR0A 3JQQA 4RIIA 5AI0A 2JBAB 4OHYA 3K0FA 4QVGA 1E5VA 3B9BA 4Y2HA 2VTDA 4ZT3A 4ZT6A 1YTUA 3P9PA 3MFQA 2X7JA 4QTZA 4BVBA 3SS7X 3VOSA 1DEXA 4ZT5A 4U00A 4FD3A 3EVFA 4EY5A 1T3ZA 3P71T 1SU4A 1USGA 1FFXB 4BFUA 3DCYA 4B4VA 1SULA 1U8ZA 1GDTA 3V1NA 1PJQA 2CYBA 4BNMA 3T1QA 4LYHA 5HUHA 4D02A 3RTBA 3HJAA 3UANA 4WBNB 1W5EA 3ADDA 5TXGA 2RAFA 1ZL2A 3COJA 5IAEA 1DUIA 4BQNA 4UCFA