3WSEA

Reduced hcgd from methanocaldococcus jannaschii
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
EVVNMKAKEIIEFIETFAPKDLAIEGDNIGLQVGDNLDKEIKKLGIALDPSLSVIKKAEKEGVDFLFTHHPLLKDPIRNFTGVIYKKLKILMENDIILYSAHTNLDICKNGLNDALAELYNLENPKPLYDNGLGRVGIFKGSFEEFLEITKKYIHKNPIVVKSKEVDDNFKLAVLSGYGLSQSSIKYVAEKADVYLSGDLTHHSKILAEELGLVVVDATHYSTEVFGLKKFKEFLSSNLDLEIISLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GTP cyclohydrolase 1 type 2
publication title A possible iron delivery function of the dinuclear iron center of HcgD in [Fe]-hydrogenase cofactor biosynthesis
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 90
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 3wseA01
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 3wseA02
1NMOA 3WSIA 3WSHA 3WSEA 2FYWA 3WSDA 3WSGA 1NMPA 4IWMA 3WSFA 2YYBA 4IWGA
chains in the Genus database with same CATH superfamily
1NMOA 3ZM5A 3EH0A 2IU8A 2AM2A 4C13A 3L2BA 3PMOA 2IU9A 4IHHA 2YYBA 4E75A 1E8CA 3WSIA 4QF5A 2XJAA 3WSEA 3WSDA 4CVKA 1KO7A 1NMPA 4ZIYA 2WTZA 4C12A 2AM1A 4IWGA 3ZL8A 2FYWA 4CVLA 3WSGA 4IHFA 4QDIA 4IWMA 3WSFA 4BUBA 3EEQA 1GG4A 3WSHA 3L31A 3ZM6A 2IOJA 2IUAA 4CVMA 1KNXA 4IHGA 4E79A
chains in the Genus database with same CATH topology
1NMOA 3WSIA 3WSHA 3WSEA 2FYWA 3WSDA 3WSGA 1NMPA 4IWMA 3WSFA 2YYBA 4IWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMO A;  3WSI A;  3WSH A;  3WSE A;  2FYW A;  3WSD A;  3WSG A;  1NMP A;  4IWM A;  3WSF A;  2YYB A;  4IWG A; 
#chains in the Genus database with same CATH topology
 1NMO A;  3ZM5 A;  3EH0 A;  2IU8 A;  2AM2 A;  4C13 A;  3L2B A;  3PMO A;  2IU9 A;  4IHH A;  2YYB A;  4E75 A;  1E8C A;  3WSI A;  4QF5 A;  2XJA A;  3WSE A;  3WSD A;  4CVK A;  1KO7 A;  1NMP A;  4ZIY A;  2WTZ A;  4C12 A;  2AM1 A;  4IWG A;  3ZL8 A;  2FYW A;  4CVL A;  3WSG A;  4IHF A;  4QDI A;  4IWM A;  3WSF A;  4BUB A;  3EEQ A;  1GG4 A;  3WSH A;  3L31 A;  3ZM6 A;  2IOJ A;  2IUA A;  4CVM A;  1KNX A;  4IHG A;  4E79 A; 
#chains in the Genus database with same CATH homology
 1NMO A;  3WSI A;  3WSH A;  3WSE A;  2FYW A;  3WSD A;  3WSG A;  1NMP A;  4IWM A;  3WSF A;  2YYB A;  4IWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...