3WSFA

Oxidized hcgd from methanocaldococcus jannaschii with citrate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
248
structure length
248
Chain Sequence
EVVNMKAKEIIEFIETFAPKDLAIEGDNIGLQVGDNLDKEIKKLGIALDPSLSVIKKAEKEGVDFLFTHHPLLKDPIRNFTGVIYKKLKILMENDIILYSAHTNLDICKNGLNDALAELYNLENPKPLYDNGLGRVGIFKGSFEEFLEITKKYIHKNPIVVKSKEVDDNFKLAVLSGYGLSQSSIKYVAEKADVYLSGDLTHHSKILAEELGLVVVDATHYSTEVFGLKKFKEFLSSNLDLEIISLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GTP cyclohydrolase 1 type 2
publication title A possible iron delivery function of the dinuclear iron center of HcgD in [Fe]-hydrogenase cofactor biosynthesis
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 89
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 3wsfA01
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 3wsfA02
4IWMA 1NMPA 2YYBA 4IWGA 3WSHA 1NMOA 2FYWA 3WSGA 3WSFA 3WSIA 3WSEA 3WSDA
chains in the Genus database with same CATH superfamily
1NMPA 2YYBA 3EEQA 4QF5A 4BUBA 1NMOA 1KNXA 3L31A 4C13A 4CVLA 2IOJA 4IHFA 3WSDA 3WSIA 3ZL8A 3WSHA 4E75A 2AM1A 3ZM6A 4C12A 2XJAA 3WSFA 2IU8A 4IWMA 4ZIYA 2IUAA 2FYWA 4IHGA 3WSEA 1GG4A 3EH0A 1KO7A 3L2BA 4IWGA 2AM2A 3PMOA 4CVMA 4E79A 1E8CA 4IHHA 4CVKA 3ZM5A 3WSGA 4QDIA 2IU9A 2WTZA
chains in the Genus database with same CATH topology
4IWMA 1NMPA 2YYBA 4IWGA 3WSHA 1NMOA 2FYWA 3WSGA 3WSFA 3WSIA 3WSEA 3WSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IWM A;  1NMP A;  2YYB A;  4IWG A;  3WSH A;  1NMO A;  2FYW A;  3WSG A;  3WSF A;  3WSI A;  3WSE A;  3WSD A; 
#chains in the Genus database with same CATH topology
 1NMP A;  2YYB A;  3EEQ A;  4QF5 A;  4BUB A;  1NMO A;  1KNX A;  3L31 A;  4C13 A;  4CVL A;  2IOJ A;  4IHF A;  3WSD A;  3WSI A;  3ZL8 A;  3WSH A;  4E75 A;  2AM1 A;  3ZM6 A;  4C12 A;  2XJA A;  3WSF A;  2IU8 A;  4IWM A;  4ZIY A;  2IUA A;  2FYW A;  4IHG A;  3WSE A;  1GG4 A;  3EH0 A;  1KO7 A;  3L2B A;  4IWG A;  2AM2 A;  3PMO A;  4CVM A;  4E79 A;  1E8C A;  4IHH A;  4CVK A;  3ZM5 A;  3WSG A;  4QDI A;  2IU9 A;  2WTZ A; 
#chains in the Genus database with same CATH homology
 4IWM A;  1NMP A;  2YYB A;  4IWG A;  3WSH A;  1NMO A;  2FYW A;  3WSG A;  3WSF A;  3WSI A;  3WSE A;  3WSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...